217LA

Structural basis of alpha-helix propensity at two sites in t4 lysozyme
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
162
structure length
162
Chain Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKEELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords T4 LYSOZYME
publication title Structural basis of amino acid alpha helix propensity.
pubmed rcsb
source organism Enterobacteria phage t4
total genus 58
structure length 162
sequence length 162
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 1993-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 217lA00
1P7SA 1L54A 1KW5A 1P46A 173LA 1L55A 1L11A 226LA 152LA 1L73A 237LA 1L42A 234LA 219LA 1SWYA 131LA 258LA 2A4TA 118LA 3HH4A 1P36A 220LA 175LA 201LA 112LA 1L14A 4GRVA 114LA 1QTHA 4I7KA 1D3NA 120LA 1L57A 225LA 1L00A 1L64A 1CV1A 247LA 3SB9A 1L47A 3CDVA 1KY1A 3SN6R 1L21A 238LA 4ARPA 165LA 2HULA 1QUHA 1L98A 1L15A 1L85A 161LA 172LA 162LA 1C66A 1L06A 3FADA 1CUQA 103LA 125LA 3EMLA 4ARLA 1G0MA 215LA 4OO9A 4ARMB 2LCBA 3SB6A 2B75A 4EKPA 1OVHA 4EXMA 4DJHA 1T97A 1QTDA 2B6TA 3FA0A 1C6AA 1DYAA 4K5YA 1L92A 213LA 3C83A 4W56A 1C6JA 4W52A 111LA 1L43A 1L02A 217LA 2B6ZA 1G1VA 1C67A 1L70A 1QTBA 155LA 1KW7A 2QARC 1L63A 3C7YA 4EPFA 1XJUA 3HH5A 1P5CA 1L89A 2RB1X 2O4WA 2RB2X 188LA 1OVKA 3HTDA 1L82A 251LA 2OU9A 3PDSA 170LA 3DN3A 1L95A 159LA 261LA 2OTYX 140LA 1ZWNA 3GUIA 3HUQA 1L10A 3C8RA 150LA 1G0LA 199LA 1OV7A 1D3MA 1QUGA 102LA 2ANVA 1L97A 1C60A 167LA 1L30A 1KY0A 3CDRA 1P3NA 1CX7A 239LA 1DYFA 3L64A 3DN6A 1L44A 1G0QA 3RUNA 1C69A 1CU5A 1L83A 1C6FA 3HUKA 240LA 252LA 3C8SA 1L38A 1L65A 214LA 1C64A 1CV4A 1L33A 1L19A 1L80A 250LA 1L56A 1L96A 2F47A 2IGCA 1LYIA 2NTGA 209LA 1L28A 3GUKA 1L12A 1PQDA 206LA 1QT5A 1L27A 130LA 184LA 1L31A 1CU0A 3UONA 1C6QA 126LA 1C6BA 2RBRA 1L86A 259LA 2LZMA 3DN8A 227LA 1L32A 1LYGA 1L88A 1L75A 164LA 2RBSA 210LA 1P56A 1L81A 222LA 1LPYA 1JQUA 168LA 2LC9A 216LA 3CDTA 2B6XA 1D3JA 1CU6A 3CDOA 1L93A 232LA 1KNIA 142LA 1OVJA 231LA 3HTGA 3L2XA 3V2YA 1C6HA 1L67A 3PBLA 113LA 1G1WA 1CV3A 2O7AA 1L52A 3V2WA 3C8QA 1L35A 211LA 3HT9A 141LA 3HDFA 1C6NA 4ARMA 2B74A 1KS3A 1L40A 7LZMA 108LA 3GUJA 3G3VA 1L99A 1LLHA 1L05A 3OE0A 4EPIA 2OU8A 3DN2A 4AQNA 248LA 144LA 3C82A 1G0PA 4I7TA 1CVKA 1L29A 1QS9A 1EPYA 3ODUA 1SX2A 5LZMA 151LA 3DMVA 3C7ZA 1CUPA 2Z6BA 196LA 3HH6A 262LA 1L77A 171LA 190LA 1CX6A 2F2QA 4I7LA 2RBNA 1JTMA 246LA 1DYEA 1WTHA 2RAZX 169LA 1L07A 1K28A 3DNAA 1ZYTA 1L87A 1QT4A 2RB0X 1LI3A 1LYHA 255LA 3HTFA 1L66A 1PQKA 2O79A 4LZMA 260LA 4W54A 147LA 1L34A 1L76A 1L74A 1LWGA 1L41A 1TLAA 3LZMA 4I7PA 1L46A 1C62A 3HT6A 177LA 1C6PA 2ANXA 1QTCA 149LA 1JTNA 3CDQA 3NY8A 2B6YA 2B70A 2OE9X 1C61A 3GULA 157LA 1L62A 1L04A 4EKQA 254LA 1P2RA 4I7SA 186LA 3FI5A 178LA 4W51A 4ARQB 1DYBA 2OU0X 1P64A 1LYDA 3QAKA 3DN0A 104LA 1L03A 1QT6A 1G0GA 123LA 224LA 3DN4A 2RBQA 1L36A 3C81A 4DKLA 3HUAA 257LA 1L01A 3HU9A 160LA 1L61A 1CU3A 3G3WA 3JR6A 3SB5A 1C6MA 110LA 1OWYA 241LA 119LA 1L58A 1L08A 2HUKA 3DMXA 3HT8A 6LZMA 1L24A 4I7NA 2OEAX 3NY9A 1C68A 1PQIA 1L48A 4W57A 1L22A 1L69A 1L94A 1LWKA 1L18A 1L72A 3OE9A 4E97A 4LDLA 3OE8A 3GUPA 1L79A 1L0JA 3HU8A 1CV5A 3GUMA 3HH3A 122LA 107LA 4W55A 4S0WA 1D2WA 205LA 189LA 129LA 3SBBC 4LDEA 1G0JA 1DYDA 1OWZA 2B72A 2CUUA 3C7WA 3VW7A 4EKSA 3SBAA 3OE6A 1L09A 256LA 1QUOA 1B6IA 1XJTA 1C6GA 1QT7A 2Q9EA 244LA 2OTZX 4ARJA 4I7JA 1SWZA 109LA 1QSBA 4GBRB 1QT3A 3G3XA 128LA 139LA 1DYCA 2OE7X 228LA 138LA 4YXCA 1LGWA 191LA 2B73A 3HT7A 4ZPUA 1C6EA 4W59A 1L84A 1OV5A 4DAJA 3DKEX 180LA 1L71A 1CU2A 1L90A 1PQOA 3HDEA 4EKRA 2HUMA 2RH1A 192LA 1C6IA 1LGUA 2L78A 4PJZA 4W53A 1QS5A 4PK0A 3NYAA 1PQMA 166LA 174LA 236LA 1LYFA 2F32A 3GUOA 245LA 3HTBA 3F8VA 4I7OA 1C63A 1C6CA 4W58A 1LYEA 229LA 1QTZA 3RZEA 1XEPA 4I7MA 242LA 1L25A 1L49A 1L60A 235LA 3D4SA 1SSYA 1L39A 1L23A 148LE 1SX7A 2Q9DA 3SB8A 3DN1A 1DYGA 253LA 1T8AA 1P2LA 4EJ4A 1D2YA 1D9WA 1L13A 1P37A 233LA 4ARQA 218LA 2QB0B 127LA 1L16A 2B6WA 2OE4X 1ZURA 223LA 1C6DA 1L53A 4YXAC 1L17A 3SB7A 2RBOA 143LA 4I7QA 1L37A 3C80A 1L50A 2RAYX 212LA 145LA 1LYJA 1G07A 198LA 1QUDA 1C65A 1L0KA 195LA 1L59A 3DMZA 3GUNA 182LA 1D3FA 200LA 1G06A 187LA 221LA 2B7XA 4IAPA 158LA 1LI6A 1CTWA 1P6YA 4I7RA 176LA 1QT8A 1L26A 3HWLA 1LI2A 1OYUA 185LA 163LA 1T8GA 1SSWA 4LDOA 181LA 1C6KA 230LA 1T6HA 1NHBA 1L51A 1LW9A 1L45A 156LA 1L68A 1PQJA 183LA 197LA 1LGXA 2NTHA 1T8FA 3F9LA 115LA 243LA 3K2RA 4YX7C 5I14A 249LA 2RBPA 1QSQA 1QTVA 1I6SA 1C6LA 1CV0A 146LA 1L20A 1G0KA 1C6TA 137LA 1L91A 1CV6A
chains in the Genus database with same CATH superfamily
1KW5A 1FLUA 1L73A 1OUFA 1GBOA 4DDAA 4NGLA 3WYHA 4LYTA 118LA 3HBHA 1IOTA 220LA 1LOZA 5I54A 153LA 5F16A 1B5ZA 114LA 1JISA 1QTHA 2LYZA 1W6ZA 1D3NA 3A67Y 4I7KA 120LA 1L00A 1GF7A 4ETAA 4NFVA 4GCEA 1LHJA 3SB9A 5LINA 2BPUA 3CDVA 1KY1A 1VDPA 2HULA 1QUHA 1B7SA 1IX0A 2DQHY 3AZ6A 3RT5X 162LA 1C66A 3FADA 1QQYA 1G0MA 2MEHA 1XSFA 4KT3A 2B75A 1T3PA 4EKPA 2YDGA 4EXMA 4DJHA 1BHZA 1IR9A 1LHMA 3WPKA 3TXDA 4K5YA 2MEIA 3C83A 4W56A 4N9RA 5KXPA 4W52A 3WULA 111LA 5LAGA 1L43A 1DQJC 3A91A 1G1VA 1QTBA 1GDWA 2Z19A 1IR7A 1KW7A 194LA 1L63A 3C7YA 2O4WA 3HTDA 5D5FA 1VDTA 1L82A 193LA 2BQDA 1I1ZA 1HC0A 159LA 261LA 3GUIA 1L10A 4HJYA 150LA 3TXHA 3AGHA 1D3MA 1ZMYL 3LZTA 102LA 1VEDA 1GFEA 1AZFA 4XENA 1J1XY 2CGIA 2XBSA 3RUNA 5B05A 4NHIA 3N9EA 1FLQA 1C6FA 252LA 214LA 4RW2A 250LA 1SQ2L 1GE0A 1L56A 1B7QA 2F47A 2DQGY 2IGCA 2YBMA 3AYQA 2EPEA 4II8A 206LA 130LA 184LA 4J1BA 2F4GA 1CU0A 4NHPA 1LZ1A 5DL9A 1C6BA 2RBRA 1L86A 259LA 3WPJA 2B5ZA 2LZMA 4RW1A 1GFUA 1L32A 4ML7A 4HSFA 1IORA 4CFPA 1L88A 164LA 1P56A 2F2NA 1YROA 3CDTA 3A93A 3CDOA 232LA 2O7AA 5T3FA 2GV0A 1L35A 211LA 2Q0MX 2H9JA 1EQEA 1D9UA 7LZMA 1WQMA 3J6KA 1IY3A 1VAUA 3DN2A 248LA 2DQEY 144LA 1JPOA 3LYMA 4DC4A 1B9OA 4DD3A 1BVXA 1L29A 1EPYA 3ODUA 3W6DA 4LYCA 1SX2A 4DD0A 1GB2A 3DMVA 1GE3A 2I25L 3TMVA 1IR8A 3HH6A 4DWXA 1L77A 1UACY 1GBZA 2F2QA 1BWIA 3QY4A 1JTMA 1AT6A 4OWBA 246LA 4XYYA 5I4XA 3DNAA 4N8ZA 1ZYTA 3WXTA 1A4VA 2O79A 2W1XA 4LZMA 260LA 2ZIJA 1TLAA 5APFA 3HT6A 3TMUA 4H9FA 5LA5A 1GBSA 2DBTA 1B7MA 1L04A 2HU1A 2F4AA 1HELA 1EL1A 4I7SA 3FI5A 1INUA 1P64A 3QAKA 1LAAA 2NWDX 1QT6A 1Z55A 224LA 1XGRC 5APCA 3C81A 4DKLA 257LA 3QE8A 160LA 3P65A 1JKAA 3JR6A 2D4IA 119LA 3DMXA 3HT8A 1KIRC 1YAQA 2OEAX 1CKFA 4WLXA 3OE9A 1GB3A 5FSTA 3GUPA 1LSNA 5HNCA 1B5UA 3GUMA 3RNXA 5HNLA 1QDRA 1JUGA 1HEWA 1G0JA 2CUUA 3C7WA 3CSZA 3OE6A 1G7LC 1QUOA 3ZVQB 5KXLA 2OTZX 1SWZA 4NHSA 3AZ5A 1QT3A 4NGKA 1GF0A 228LA 138LA 1KIPC 1LGWA 4H9HA 2ZWBA 4WM5A 180LA 1L71A 4EKRA 3HDEA 3N9AA 192LA 1C6IA 3T6UA 1QS5A 1HHLA 4PHIA 4H90A 1GPQC 1PQMA 3GUOA 1GF9A 4I8SA 5KXNA 2ZNXY 229LA 2BQHA 5KXRA 3WW6A 242LA 2G4QA 3D4SA 4IATA 1OUHA 3DN1A 1F0WA 233LA 127LA 2B6WA 4G4CA 4X3BA 1C6DA 1GF6A 3SB7A 143LA 6LYZA 4I7QA 5KXMA 1L50A 4HTNA 4OW1A 1G07A 4XJFA 4WO9A 1QUDA 207LA 3TXKA 4NGJA 182LA 1D3FA 1G06A 4WMGA 3A90A 2B7XA 1UC0A 1LI6A 1CTWA 4WG7A 4DT3A 185LA 1XGPC 1BB3A 3VWOA 1LJEA 1T8GA 4H9EA 2CJLA 4LDOA 5KXSA 1GFKA 1T6HA 5DLAA 5A3ZA 5KXTA 4YOPA 1LSAA 2BLXA 1JSEA 1PQJA 4HP0A 2W1LA 5KXXA 4WL7A 3K3TA 1REXA 243LA 4XN6A 4YX7C 4G49A 1N4FA 1QTVA 1G0KA 137LA 1CV6A 1GF3A 1L54A 1L11A 152LA 2H9KA 234LA 1SWYA 1LJGA 4AGAA 112LA 4ETBA 4GRVA 4WL6A 4IASA 1NKHA 1L64A 4HV1A 2YBLA 4GN4A 247LA 3LYZA 3P64A 4NGYA 2W1MA 4ARPA 4I0CA 2HTXA 4LFPA 161LA 172LA 1D0KA 1HFXA 1CUQA 1D6PA 125LA 215LA 4ARMB 2LCBA 3SB6A 3M3UA 2HU3A 1UBZA 1D0MA 1OVHA 4TTDA 1T97A 1TCYA 3FA0A 4NHTA 5HMVA 1DYAA 5LVGA 1YILA 213LA 1C6JA 4R6CA 2ZQ4A 5LXWA 217LA 2B6ZA 1C67A 2Z18A 2BQMA 2QARC 4H91A 4EPFA 3HH5A 2ZYPA 2RB1X 1WTMA 3W6FA 2OU9A 4WLYA 3PDSA 5FELA 3DN3A 2BQJA 1HFZA 4HJVA 3LZ2A 199LA 1OV7A 3CDRA 1P3NA 1DYFA 3W6AA 1C69A 2Z37A 4PPOA 4DYGA 3HUKA 1GFVA 1L19A 1HFYA 3BKVA 1DI3A 1WQOA 5ILCA 1ALCA 1C6QA 4GN3A 1GBWA 4OWHA 1YANA 1IOQA 5EBHA 3DN8A 1JWRA 4LGKA 4NSHA 1LYGA 4Z41A 1KXXA 1L75A 5F14A 2RBSA 210LA 1L81A 2EIZC 5M1YA 1LPYA 1UIFA 3A8ZA 7LYZA 1CU6A 5FEKA 142LA 1DZBX 1OVJA 3HTGA 4Z98A 1C6HA 1L67A 1LSEA 2CDSA 1CV3A 1LPIA 2DQIY 3C8QA 4B4IA 3HT9A 3A92A 2BLYA 3HDFA 4ARMA 1GAZA 3W6EA 1L40A 1IIZA 1JTTL 1L05A 4ANRA 2MEEA 5LYMA 1GB0A 1REZA 1ZV5L 1I20A 1C7PA 1IO5A 1CVKA 5LYTA 5L3IA 1D6QA 4NGWA 1W08A 1CUPA 4YF2A 1LSYA 1IWUA 171LA 3TXGA 1CX6A 2RBNA 1D0LA 1BWJA 1J1PY 5I5QA 1WTHA 2G4PA 1YKXX 2FBBA 1K28A 3BKHA 3AZ4A 1LYSA 1L87A 4LT1A 4W94A 5LVHA 1YIKA 4NGIA 1GFAA 1XEIA 1L34A 1OUEA 1L74A 1LWGA 4EMNA 5J7CA 2Z38A 4I7PA 3RW8A 1LYOA 2DQCY 1C62A 1LZAA 177LA 2ANXA 149LA 2ZQ3A 3CDQA 3NY8A 2B6YA 1C61A 4H1PA 1GD6A 3FE0A 1UIEA 1JIYA 3ULRA 1PS5A 254LA 6LYTA 186LA 2WARA 1LMNA 1DYBA 2OU0X 1IP2A 1LYDA 4DQJA 104LA 1G0GA 3TMXA 5LIOA 1OUAA 4QGZA 4NHQA 3HUAA 3A3QA 1LMQA 1GE1A 3G3WA 5APDA 1CJ6A 3SB5A 1DKJA 2DQAA 3CQLA 1E8LA 1L58A 1UIDA 1L08A 4UWVA 1LJIA 4I7NA 1PQIA 3E3DA 1GFGA 2YVBA 4CJ2A 1L94A 4E97A 3B0OA 1L18A 1L72A 3OE8A 5C6IA 2YSSC 4WM6A 1L0JA 3WU8A 1CV5A 2BQOA 3HH3A 122LA 4L41A 1NQIA 4LDEA 1OWZA 4B0DA 3GXRA 4WLTA 4YM8A 3VW7A 4H9BA 256LA 4NSIA 1IWWA 1IY4A 244LA 4ARJA 4I7JA 109LA 3CSQA 4GBRB 1HEOA 1LJ4A 128LA 5FCPA 2OE7X 4N1EI 4YXCA 2B73A 1IOSA 3HT7A 4DD2A 1JKCA 1C6EA 1L84A 3CB7A 1L90A 1PQOA 1LHLA 5KJ9A 4KL7A 4LT0A 4W53A 3NYAA 174LA 2F32A 245LA 4HPIA 3HTBA 2F30A 4DD1A 1NDGC 3WVXA 1G7JC 1LSBA 2BQFA 1YQVY 1L49A 235LA 2IHLA 148LE 1QUTA 1MELL 1D2YA 1IWTA 1L13A 5KXWA 1GXV2 218LA 1LMAA 4MSTA 223LA 4YXAC 1JSFA 4GCBA 145LA 1ZVHL 1C45A 1C46A 1FBIX 1OUCA 1UIBA 1C65A 3OJPA 2LYMA 4CHXA 1OUJA 1L0KA 2EQLA 3DMZA 1B7PA 1OUGA 1HNLA 4OWEA 4H8XA 4I7RA 1VFBC 3HWLA 1UCOA 1LMPA 3OK0A 181LA 1C6KA 230LA 5KXYA 2DQFC 1SLYA 5KXZA 1AM7A 1BGIA 1B7OA 4IJ4A 2X0AA 1DI4A 2NTHA 5HQ1A 249LA 2RBPA 1QSQA 1VDSA 1L20A 1C6TA 2AUBA 3G3AB 1L91A 4XJIA 5F9UA 1P7SA 1P46A 173LA 1L55A 3WVYA 1IP3A 237LA 1LJ3A 4GCCA 131LA 258LA 2A4TA 3HH4A 3TXFA 4ETDA 4B4EA 175LA 5JENB 1YKZX 1C43A 1AKIA 1L57A 9LYZA 3LHMA 1CV1A 4RDSA 1QTEA 2BQNA 1LTMA 5LA8A 1L47A 3SN6R 1LMCA 1L21A 4A7DA 2D4JA 238LA 1LYZA 1L98A 3W3EA 1L15A 3CT0A 1L85A 4LYBA 1GBXA 1I56A 1XGUC 1OUBA 1GHLA 103LA 3EMLA 1IC7Y 4ARLA 4KPMA 4NIJA 4OO9A 5F81A 2RSCA 5LYZA 1YL0X 1QTDA 1LZTA 4HTKA 1FDLY 1B0DA 1RE2A 4QY9A 1C6AA 3LYTA 1L92A 4LT2A 1IWVA 4LZTA 4NWEA 3A96A 1L70A 4ETEA 1OUIA 3A34A 1XJUA 1L89A 1GFRA 188LA 1OVKA 1QTKA 2XBRA 251LA 1F6RA 1FN5A 170LA 5KY1A 2HEDA 4WM3A 5KXKA 140LA 1ZWNA 3HUQA 3B0IA 1QUGA 2ANVA 1L97A 1C60A 167LA 1KY0A 3GXKA 1CX7A 1P2CC 1GB8A 239LA 3L64A 1FKQA 1L44A 1G0QA 1LZBA 4NSJA 240LA 2MEAA 1L38A 1L65A 1C64A 1L33A 3WW5A 3A95A 1LJNA 4M4OA 4CFOA 1FLYA 1TEWA 1KXYA 1KIQC 1L12A 3WXUA 2HUBA 1PQDA 3HFMY 2YBNA 1YKYX 1B7LA 4OOOA 227LA 4XJGA 3TMWA 4BADA 1A2YC 1HERA 1LMTA 2MECA 1CKCA 168LA 1WQPA 216LA 1D3JA 4WO6A 1KNIA 3L2XA 3V2YA 113LA 1G1WA 1L52A 1WQQA 1BB5A 1C6NA 3CT5A 1KS3A 4WLDA 1TAYA 3GUJA 1L99A 1LLHA 5IELA 3OE0A 5DM9A 4EPIA 1G7IC 4J1AA 4TUNA 1IOCA 3C82A 4DD9A 1G0PA 1JTOL 4I7TA 3IJUA 4HV2A 1QS9A 4UWUA 1QIOA 4BS7A 3D3DA 1LKRA 8LYZA 262LA 1LJKA 1JKBA 190LA 4I7LA 1JEFA 2BQGA 1DYEA 169LA 4Z3MA 5B06A 1F10A 2I26L 2MEGA 2RB0X 1LI3A 1LYHA 255LA 1PQKA 1REYA 4W54A 1L76A 1FLWA 4QEQA 3RU5A 1L41A 1V7SA 2C8OA 3LZMA 1L46A 3TXJA 3P66A 134LA 1CJ9A 4QDNA 4J7VA 2B70A 2BQBA 3P4ZA 3GULA 3HBEX 2BQAA 4EKQA 2Y8PA 1P2RA 178LA 1PZYA 3A6CY 4W51A 4Z46A 3DN0A 1L03A 1RI8B 2HEAA 3AW6A 4MR1A 4ETCA 1WQNA 2RBQA 1L36A 3T36A 4OWCA 3EO5A 4H9IA 1L61A 1CU3A 5B59A 1C6MA 3B72A 1CKHA 1JJ0A 1OWYA 3AJNA 2HUKA 4G4HA 6LZMA 1L24A 5B07A 3NY9A 1QSWA 1C68A 1IC5Y 4EOFA 4OWAA 1L48A 1TBYA 4W57A 1L22A 1L69A 1LWKA 4LDLA 3WUAA 1VDQA 3HU8A 1OUDA 1GF5A 4W55A 107LA 3ZEKA 1GB9A 4S0WA 205LA 189LA 1DPWA 1LSZA 3SBBC 5ILFA 3LN2A 1GXXA 1LZRA 4NWHA 4R0FA 1C10A 2G4NA 4OOTA 1B5WA 1NHEA 1AT5A 5IHGA 1XJTA 2BQIA 4DQ7A 4PRUA 4TSBA 3IJVA 2Q9EA 5A3EA 4KXIA 4RLNA 5LVIA 1T6VL 1QSAA 4C3WA 4XJHA 3ATOA 3D9AC 1GB6A 2LZTA 4W96A 2YBIA 4W59A 4DAJA 1OV5A 3DKEX 4N0JA 1CU2A 2BQCA 2HUMA 2RH1A 1IEEA 5DN5A 1LGUA 2L78A 4PJZA 1DKKA 4WG1A 1OQMA 5C6LA 1B5XA 1HENA 1YAMA 4C5FA 166LA 236LA 1LYFA 1IP1A 3F8VA 3AGIA 4I7OA 1C6CA 4W58A 4HPEA 5E4PA 5I53A 5B1GA 3RZEA 1XEPA 4I7MA 1VATA 1GB7A 1SX7A 2Q9DA 2EKSC 1CNSA 3SB8A 1C08C 1LSPA 1P2LA 4EJ4A 4G9SA 1P37A 1UIHA 1DXJA 1CKGA 3J4GA 4M6DA 3CSRA 4NSGA 1L16A 1ZURA 1L53A 1L17A 4G4BA 4ET8A 1L37A 3C80A 1XEKA 2RAYX 212LA 1LYJA 3AZ7A 2MEFA 1B5VA 198LA 1JJ1A 1GEVA 4U3XB 3WH1A 4DD7A 1G7MC 4H94A 2XQOA 1DI5A 1XGTC 2BQKA 1YL1X 1P6YA 1B2KA 1QT8A 1L26A 1DPXA 1LI2A 5LAFA 1LSGA 1B7NA 163LA 1BB6A 1NHBA 1L51A 1LW9A 1L45A 156LA 4UWNA 3QNGA 5FDJA 1GWDA 3EBAB 1LSDA 183LA 3RZ4A 1LGXA 4FJRA 1LJJA 1WTNA 1T8FA 3F9LA 5KKIA 115LA 1HMKA 2FBDA 3K2RA 5I14A 1LZSA 1I6SA 1IP7A 1KXWA 1CV0A 1UUZC 3P68A 4NG1A 1LJHA 3M18B 2Z6BA 2Z2FA 1WVUA 226LA 1YAPA 4DDBA 1L42A 4N5RA 1NWGA 219LA 1J1OY 2LZ2A 1XGQC 1XEJA 3A6BY 1P36A 2ZILA 5LVJA 201LA 135LA 4NGOA 1L14A 3MGWA 2A7DA 1LSMA 225LA 4DDCA 4HJZA 4GCDA 1GFHA 4ZEEA 2YBHA 4ZIXA 2C8PA 3AGGG 2DQDY 165LA 4NEBA 2HEBA 5L9JA 1GFJA 1L06A 1H6MA 2YBJA 4H93A 1H87A 1UA6Y 1NF5A 1HSWA 2XTHA 2B6TA 4TX7A 1CKDA 4LFXA 3WPLA 1GBYA 4GLVA 2I6ZA 3WUNA 4TWSA 1L02A 155LA 4FDYA 1P5CA 2RB2X 1GF8A 3SP3A 1L95A 2OTYX 3C8RA 1G0LA 1HSXA 4N1CC 1QDTA 2ZNWY 1L30A 1EQ4A 1GE4A 4RLMA 2A7FA 2MEDA 5LVKA 3DN6A 4O34A 154LA 1CU5A 1L83A 3AW7A 1JITA 2FYCA 1IP4A 3C8SA 3HBDA 2CWIA 1CV4A 1L80A 2LYOA 1BVKC 2HEEA 3EMSA 1IP5A 4WM4A 1L96A 1LYIA 2NTGA 209LA 1L28A 1LZDA 3GUKA 3KAMA 1QT5A 1L27A 1L31A 3UONA 1MLCE 126LA 1LJFA 5E9RA 1LCNA 3B0KA 4P2EA 2D4KA 1LYYA 1JJ3A 1RCMA 222LA 3WU9A 1JQUA 2ZIKA 2LC9A 4GLAA 4YEMA 3G3BB 3WUMA 4PRQA 2B6XA 1L93A 231LA 1IVMA 3LYOA 1BB4A 1BQLY 3PBLA 1OP9B 4D9ZA 3WL2A 4J0LA 3N9CA 3V2WA 2LHMA 4GN5C 1HEMA 141LA 1GAYA 1GF4A 1WVVA 2B74A 133LA 4GCFA 5I4WA 108LA 3G3VA 4CGEA 3A94A 5HLLA 2OU8A 1REMA 4AQNA 1CJ7A 5FHWA 3IWRA 2D91A 4B49A 4LYMA 5LZMA 3TXIA 151LA 3C7ZA 196LA 4PJ2C 1B5YA 4B4JA 4DQ5A 2RAZX 1L07A 1LZEA 1HMLA 1QT4A 3TXBA 2Z12A 1V7TA 1LHIA 3HTFA 1GDXA 1L66A 1UIAA 2FYDA 147LA 1WQRA 1UIGA 1ZVYB 4NGVA 1EQ5A 1YAOA 1RFPA 2DQJY 1FKVA 1C6PA 1QTCA 1JTNA 4LYZA 4NGZA 2OE9X 3WMKA 157LA 1L62A 5D5CA 4BAPA 4ET9A 1JTPL 4ARQB 1IWYA 123LA 2HEFA 2Z39A 3DN4A 1LKSA 208LA 1L01A 4LYOA 3HU9A 4MCKA 5I4YA 110LA 4E3UA 241LA 1O23A 4ZFPA 4HTQA 1LZNA 5B1FA 2H5ZA 4WOAA 3TXEA 1GEZA 1IP6A 1L79A 4H8YA 4XADA 1LHHA 1F6SA 1LZ8A 4H9AA 3ZVQA 1D2WA 129LA 1BB7A 1LZGA 5APEA 1DYDA 2B72A 3B6LA 3AB6A 4EKSA 3SBAA 1L09A 4YENA 1LHKA 4B1AA 1B6IA 3W6BA 1C6GA 1LZ6A 5AMYA 4XJDA 1QT7A 1G7HC 2IFFY 1QSBA 3G3XA 139LA 1B7RA 1DYCA 1HEQA 5K7OA 3CT1A 191LA 1IWZA 4ZPUA 1LMOA 1GE2A 4PGJB 1GB5A 1TDYA 5II3A 1LSFA 2PC2A 1RJCB 1NBYC 4PK0A 1JKDA 4WM2A 1NDMC 1UICA 1HF4A 1CJ8A 1C63A 1LYEA 1QTZA 1L25A 1L60A 1SSYA 1L39A 1L23A 1IWXA 3FI7A 3F6ZA 1LZ5A 2DKVA 2VB1A 1GFTA 5HMJA 1DYGA 253LA 2MEBA 4H8ZA 4WM1A 1T8AA 1D9WA 4AXTA 2BQEA 4ARQA 2QB0B 5F9XA 1JHLA 2OE4X 4NY5A 5L3HA 2RBOA 4YEOA 1LSCA 1IC4Y 2HECA 4BAFA 5IDDA 2BQLA 1NMMA 4LT3A 3EXDA 195LA 1L59A 5DN4A 3GUNA 200LA 4H9CA 3WU7A 187LA 1BWHA 4NG8A 221LA 4IAPA 158LA 2ZYCA 176LA 2D6BA 3W6CA 2Z2EA 1NBZC 1OYUA 1LZ9A 2N5ZA 1SSWA 4H92A 2W1YA 1LZYA 5KKJA 132LA 1L68A 197LA 1LZ4A 1XFPL 1LZCA 5C6JA 2XJWA 1C6LA 146LA 4TSCA 1QUSA 3ATNA 4XJBA 3A3RX 2BAAA 5KXOA 1HEPA
chains in the Genus database with same CATH topology
1KW5A 1FLUA 1L73A 1OUFA 1GBOA 4DDAA 4NGLA 3WYHA 4LYTA 118LA 3HBHA 1IOTA 220LA 1LOZA 5I54A 153LA 5F16A 1B5ZA 114LA 1JISA 1QTHA 2LYZA 1W6ZA 1D3NA 3A67Y 4I7KA 120LA 1L00A 1GF7A 4ETAA 4NFVA 4GCEA 1LHJA 3SB9A 5LINA 2BPUA 3CDVA 1KY1A 1VDPA 2HULA 1QUHA 1B7SA 1IX0A 2DQHY 3AZ6A 3RT5X 162LA 1C66A 3FADA 1QQYA 1G0MA 2MEHA 1XSFA 4KT3A 2B75A 1T3PA 4EKPA 2YDGA 4EXMA 4DJHA 1BHZA 1IR9A 1LHMA 3WPKA 3TXDA 4K5YA 2MEIA 3C83A 4W56A 4N9RA 5KXPA 4W52A 3WULA 111LA 5LAGA 1L43A 1DQJC 3A91A 1G1VA 1QTBA 1GDWA 2Z19A 1IR7A 1KW7A 194LA 1L63A 3C7YA 2O4WA 3HTDA 5D5FA 1VDTA 1L82A 193LA 2BQDA 1I1ZA 1HC0A 159LA 261LA 3GUIA 1L10A 4HJYA 150LA 3TXHA 3AGHA 1D3MA 1ZMYL 3LZTA 102LA 1VEDA 1GFEA 1AZFA 4XENA 1J1XY 2CGIA 2XBSA 3RUNA 5B05A 4NHIA 3N9EA 1FLQA 1C6FA 252LA 214LA 4RW2A 250LA 1SQ2L 1GE0A 1L56A 1B7QA 2F47A 2DQGY 2IGCA 2YBMA 3AYQA 2EPEA 4II8A 206LA 130LA 184LA 4J1BA 2F4GA 1CU0A 4NHPA 1LZ1A 5DL9A 1C6BA 2RBRA 1L86A 259LA 3WPJA 2B5ZA 2LZMA 4RW1A 1GFUA 1L32A 4ML7A 4HSFA 1IORA 4CFPA 1L88A 164LA 1P56A 2F2NA 1YROA 3CDTA 3A93A 3CDOA 232LA 2O7AA 5T3FA 2GV0A 1L35A 211LA 2Q0MX 2H9JA 1EQEA 1D9UA 7LZMA 1WQMA 3J6KA 1IY3A 1VAUA 3DN2A 248LA 2DQEY 144LA 1JPOA 3LYMA 4DC4A 1B9OA 4DD3A 1BVXA 1L29A 1EPYA 3ODUA 3W6DA 4LYCA 1SX2A 4DD0A 1GB2A 3DMVA 1GE3A 2I25L 3TMVA 1IR8A 3HH6A 4DWXA 1L77A 1UACY 1GBZA 2F2QA 1BWIA 3QY4A 1JTMA 1AT6A 4OWBA 246LA 4XYYA 5I4XA 3DNAA 4N8ZA 1ZYTA 3WXTA 1A4VA 2O79A 2W1XA 4LZMA 260LA 2ZIJA 1TLAA 5APFA 3HT6A 3TMUA 4H9FA 5LA5A 1GBSA 2DBTA 1B7MA 1L04A 2HU1A 2F4AA 1HELA 1EL1A 4I7SA 3FI5A 1INUA 1P64A 3QAKA 1LAAA 2NWDX 1QT6A 1Z55A 224LA 1XGRC 5APCA 3C81A 4DKLA 257LA 3QE8A 160LA 3P65A 1JKAA 3JR6A 2D4IA 119LA 3DMXA 3HT8A 1KIRC 1YAQA 2OEAX 1CKFA 4WLXA 3OE9A 1GB3A 5FSTA 3GUPA 1LSNA 5HNCA 1B5UA 3GUMA 3RNXA 5HNLA 1QDRA 1JUGA 1HEWA 1G0JA 2CUUA 3C7WA 3CSZA 3OE6A 1G7LC 1QUOA 3ZVQB 5KXLA 2OTZX 1SWZA 4NHSA 3AZ5A 1QT3A 4NGKA 1GF0A 228LA 138LA 1KIPC 1LGWA 4H9HA 2ZWBA 4WM5A 180LA 1L71A 4EKRA 3HDEA 3N9AA 192LA 1C6IA 3T6UA 1QS5A 1HHLA 4PHIA 4H90A 1GPQC 1PQMA 3GUOA 1GF9A 4I8SA 5KXNA 2ZNXY 229LA 2BQHA 5KXRA 3WW6A 242LA 2G4QA 3D4SA 4IATA 1OUHA 3DN1A 1F0WA 233LA 127LA 2B6WA 4G4CA 4X3BA 1C6DA 1GF6A 3SB7A 143LA 6LYZA 4I7QA 5KXMA 1L50A 4HTNA 4OW1A 1G07A 4XJFA 4WO9A 1QUDA 207LA 3TXKA 4NGJA 182LA 1D3FA 1G06A 4WMGA 3A90A 2B7XA 1UC0A 1LI6A 1CTWA 4WG7A 4DT3A 185LA 1XGPC 1BB3A 3VWOA 1LJEA 1T8GA 4H9EA 2CJLA 4LDOA 5KXSA 1GFKA 1T6HA 5DLAA 5A3ZA 5KXTA 4YOPA 1LSAA 2BLXA 1JSEA 1PQJA 4HP0A 2W1LA 5KXXA 4WL7A 3K3TA 1REXA 243LA 4XN6A 4YX7C 4G49A 1N4FA 1QTVA 1G0KA 137LA 1CV6A 1GF3A 1L54A 1L11A 152LA 2H9KA 234LA 1SWYA 1LJGA 4AGAA 112LA 4ETBA 4GRVA 4WL6A 4IASA 1NKHA 1L64A 4HV1A 2YBLA 4GN4A 247LA 3LYZA 3P64A 4NGYA 2W1MA 4ARPA 4I0CA 2HTXA 4LFPA 161LA 172LA 1D0KA 1HFXA 1CUQA 1D6PA 125LA 215LA 4ARMB 2LCBA 3SB6A 3M3UA 2HU3A 1UBZA 1D0MA 1OVHA 4TTDA 1T97A 1TCYA 3FA0A 4NHTA 5HMVA 1DYAA 5LVGA 1YILA 213LA 1C6JA 4R6CA 2ZQ4A 5LXWA 217LA 2B6ZA 1C67A 2Z18A 2BQMA 2QARC 4H91A 4EPFA 3HH5A 2ZYPA 2RB1X 1WTMA 3W6FA 2OU9A 4WLYA 3PDSA 5FELA 3DN3A 2BQJA 1HFZA 4HJVA 3LZ2A 199LA 1OV7A 3CDRA 1P3NA 1DYFA 3W6AA 1C69A 2Z37A 4PPOA 4DYGA 3HUKA 1GFVA 1L19A 1HFYA 3BKVA 1DI3A 1WQOA 5ILCA 1ALCA 1C6QA 4GN3A 1GBWA 4OWHA 1YANA 1IOQA 5EBHA 3DN8A 1JWRA 4LGKA 4NSHA 1LYGA 4Z41A 1KXXA 1L75A 5F14A 2RBSA 210LA 1L81A 2EIZC 5M1YA 1LPYA 1UIFA 3A8ZA 7LYZA 1CU6A 5FEKA 142LA 1DZBX 1OVJA 3HTGA 4Z98A 1C6HA 1L67A 1LSEA 2CDSA 1CV3A 1LPIA 2DQIY 3C8QA 4B4IA 3HT9A 3A92A 2BLYA 3HDFA 4ARMA 1GAZA 3W6EA 1L40A 1IIZA 1JTTL 1L05A 4ANRA 2MEEA 5LYMA 1GB0A 1REZA 1ZV5L 1I20A 1C7PA 1IO5A 1CVKA 5LYTA 5L3IA 1D6QA 4NGWA 1W08A 1CUPA 4YF2A 1LSYA 1IWUA 171LA 3TXGA 1CX6A 2RBNA 1D0LA 1BWJA 1J1PY 5I5QA 1WTHA 2G4PA 1YKXX 2FBBA 1K28A 3BKHA 3AZ4A 1LYSA 1L87A 4LT1A 4W94A 5LVHA 1YIKA 4NGIA 1GFAA 1XEIA 1L34A 1OUEA 1L74A 1LWGA 4EMNA 5J7CA 2Z38A 4I7PA 3RW8A 1LYOA 2DQCY 1C62A 1LZAA 177LA 2ANXA 149LA 2ZQ3A 3CDQA 3NY8A 2B6YA 1C61A 4H1PA 1GD6A 3FE0A 1UIEA 1JIYA 3ULRA 1PS5A 254LA 6LYTA 186LA 2WARA 1LMNA 1DYBA 2OU0X 1IP2A 1LYDA 4DQJA 104LA 1G0GA 3TMXA 5LIOA 1OUAA 4QGZA 4NHQA 3HUAA 3A3QA 1LMQA 1GE1A 3G3WA 5APDA 1CJ6A 3SB5A 1DKJA 2DQAA 3CQLA 1E8LA 1L58A 1UIDA 1L08A 4UWVA 1LJIA 4I7NA 1PQIA 3E3DA 1GFGA 2YVBA 4CJ2A 1L94A 4E97A 3B0OA 1L18A 1L72A 3OE8A 5C6IA 2YSSC 4WM6A 1L0JA 3WU8A 1CV5A 2BQOA 3HH3A 122LA 4L41A 1NQIA 4LDEA 1OWZA 4B0DA 3GXRA 4WLTA 4YM8A 3VW7A 4H9BA 256LA 4NSIA 1IWWA 1IY4A 244LA 4ARJA 4I7JA 109LA 3CSQA 4GBRB 1HEOA 1LJ4A 128LA 5FCPA 2OE7X 4N1EI 4YXCA 2B73A 1IOSA 3HT7A 4DD2A 1JKCA 1C6EA 1L84A 3CB7A 1L90A 1PQOA 1LHLA 5KJ9A 4KL7A 4LT0A 4W53A 3NYAA 174LA 2F32A 245LA 4HPIA 3HTBA 2F30A 4DD1A 1NDGC 3WVXA 1G7JC 1LSBA 2BQFA 1YQVY 1L49A 235LA 2IHLA 148LE 1QUTA 1MELL 1D2YA 1IWTA 1L13A 5KXWA 1GXV2 218LA 1LMAA 4MSTA 223LA 4YXAC 1JSFA 4GCBA 145LA 1ZVHL 1C45A 1C46A 1FBIX 1OUCA 1UIBA 1C65A 3OJPA 2LYMA 4CHXA 1OUJA 1L0KA 2EQLA 3DMZA 1B7PA 1OUGA 1HNLA 4OWEA 4H8XA 4I7RA 1VFBC 3HWLA 1UCOA 1LMPA 3OK0A 181LA 1C6KA 230LA 5KXYA 2DQFC 1SLYA 5KXZA 1AM7A 1BGIA 1B7OA 4IJ4A 2X0AA 1DI4A 2NTHA 5HQ1A 249LA 2RBPA 1QSQA 1VDSA 1L20A 1C6TA 2AUBA 3G3AB 1L91A 4XJIA 5F9UA 1P7SA 1P46A 173LA 1L55A 3WVYA 1IP3A 237LA 1LJ3A 4GCCA 131LA 258LA 2A4TA 3HH4A 3TXFA 4ETDA 4B4EA 175LA 5JENB 1YKZX 1C43A 1AKIA 1L57A 9LYZA 3LHMA 1CV1A 4RDSA 1QTEA 2BQNA 1LTMA 5LA8A 1L47A 3SN6R 1LMCA 1L21A 4A7DA 2D4JA 238LA 1LYZA 1L98A 3W3EA 1L15A 3CT0A 1L85A 4LYBA 1GBXA 1I56A 1XGUC 1OUBA 1GHLA 103LA 3EMLA 1IC7Y 4ARLA 4KPMA 4NIJA 4OO9A 5F81A 2RSCA 5LYZA 1YL0X 1QTDA 1LZTA 4HTKA 1FDLY 1B0DA 1RE2A 4QY9A 1C6AA 3LYTA 1L92A 4LT2A 1IWVA 4LZTA 4NWEA 3A96A 1L70A 4ETEA 1OUIA 3A34A 1XJUA 1L89A 1GFRA 188LA 1OVKA 1QTKA 2XBRA 251LA 1F6RA 1FN5A 170LA 5KY1A 2HEDA 4WM3A 5KXKA 140LA 1ZWNA 3HUQA 3B0IA 1QUGA 2ANVA 1L97A 1C60A 167LA 1KY0A 3GXKA 1CX7A 1P2CC 1GB8A 239LA 3L64A 1FKQA 1L44A 1G0QA 1LZBA 4NSJA 240LA 2MEAA 1L38A 1L65A 1C64A 1L33A 3WW5A 3A95A 1LJNA 4M4OA 4CFOA 1FLYA 1TEWA 1KXYA 1KIQC 1L12A 3WXUA 2HUBA 1PQDA 3HFMY 2YBNA 1YKYX 1B7LA 4OOOA 227LA 4XJGA 3TMWA 4BADA 1A2YC 1HERA 1LMTA 2MECA 1CKCA 168LA 1WQPA 216LA 1D3JA 4WO6A 1KNIA 3L2XA 3V2YA 113LA 1G1WA 1L52A 1WQQA 1BB5A 1C6NA 3CT5A 1KS3A 4WLDA 1TAYA 3GUJA 1L99A 1LLHA 5IELA 3OE0A 5DM9A 4EPIA 1G7IC 4J1AA 4TUNA 1IOCA 3C82A 4DD9A 1G0PA 1JTOL 4I7TA 3IJUA 4HV2A 1QS9A 4UWUA 1QIOA 4BS7A 3D3DA 1LKRA 8LYZA 262LA 1LJKA 1JKBA 190LA 4I7LA 1JEFA 2BQGA 1DYEA 169LA 4Z3MA 5B06A 1F10A 2I26L 2MEGA 2RB0X 1LI3A 1LYHA 255LA 1PQKA 1REYA 4W54A 1L76A 1FLWA 4QEQA 3RU5A 1L41A 1V7SA 2C8OA 3LZMA 1L46A 3TXJA 3P66A 134LA 1CJ9A 4QDNA 4J7VA 2B70A 2BQBA 3P4ZA 3GULA 3HBEX 2BQAA 4EKQA 2Y8PA 1P2RA 178LA 1PZYA 3A6CY 4W51A 4Z46A 3DN0A 1L03A 1RI8B 2HEAA 3AW6A 4MR1A 4ETCA 1WQNA 2RBQA 1L36A 3T36A 4OWCA 3EO5A 4H9IA 1L61A 1CU3A 5B59A 1C6MA 3B72A 1CKHA 1JJ0A 1OWYA 3AJNA 2HUKA 4G4HA 6LZMA 1L24A 5B07A 3NY9A 1QSWA 1C68A 1IC5Y 4EOFA 4OWAA 1L48A 1TBYA 4W57A 1L22A 1L69A 1LWKA 4LDLA 3WUAA 1VDQA 3HU8A 1OUDA 1GF5A 4W55A 107LA 3ZEKA 1GB9A 4S0WA 205LA 189LA 1DPWA 1LSZA 3SBBC 5ILFA 3LN2A 1GXXA 1LZRA 4NWHA 4R0FA 1C10A 2G4NA 4OOTA 1B5WA 1NHEA 1AT5A 5IHGA 1XJTA 2BQIA 4DQ7A 4PRUA 4TSBA 3IJVA 2Q9EA 5A3EA 4KXIA 4RLNA 5LVIA 1T6VL 1QSAA 4C3WA 4XJHA 3ATOA 3D9AC 1GB6A 2LZTA 4W96A 2YBIA 4W59A 4DAJA 1OV5A 3DKEX 4N0JA 1CU2A 2BQCA 2HUMA 2RH1A 1IEEA 5DN5A 1LGUA 2L78A 4PJZA 1DKKA 4WG1A 1OQMA 5C6LA 1B5XA 1HENA 1YAMA 4C5FA 166LA 236LA 1LYFA 1IP1A 3F8VA 3AGIA 4I7OA 1C6CA 4W58A 4HPEA 5E4PA 5I53A 5B1GA 3RZEA 1XEPA 4I7MA 1VATA 1GB7A 1SX7A 2Q9DA 2EKSC 1CNSA 3SB8A 1C08C 1LSPA 1P2LA 4EJ4A 4G9SA 1P37A 1UIHA 1DXJA 1CKGA 3J4GA 4M6DA 3CSRA 4NSGA 1L16A 1ZURA 1L53A 1L17A 4G4BA 4ET8A 1L37A 3C80A 1XEKA 2RAYX 212LA 1LYJA 3AZ7A 2MEFA 1B5VA 198LA 1JJ1A 1GEVA 4U3XB 3WH1A 4DD7A 1G7MC 4H94A 2XQOA 1DI5A 1XGTC 2BQKA 1YL1X 1P6YA 1B2KA 1QT8A 1L26A 1DPXA 1LI2A 5LAFA 1LSGA 1B7NA 163LA 1BB6A 1NHBA 1L51A 1LW9A 1L45A 156LA 4UWNA 3QNGA 5FDJA 1GWDA 3EBAB 1LSDA 183LA 3RZ4A 1LGXA 4FJRA 1LJJA 1WTNA 1T8FA 3F9LA 5KKIA 115LA 1HMKA 2FBDA 3K2RA 5I14A 1LZSA 1I6SA 1IP7A 1KXWA 1CV0A 1UUZC 3P68A 4NG1A 1LJHA 3M18B 2Z6BA 2Z2FA 1WVUA 226LA 1YAPA 4DDBA 1L42A 4N5RA 1NWGA 219LA 1J1OY 2LZ2A 1XGQC 1XEJA 3A6BY 1P36A 2ZILA 5LVJA 201LA 135LA 4NGOA 1L14A 3MGWA 2A7DA 1LSMA 225LA 4DDCA 4HJZA 4GCDA 1GFHA 4ZEEA 2YBHA 4ZIXA 2C8PA 3AGGG 2DQDY 165LA 4NEBA 2HEBA 5L9JA 1GFJA 1L06A 1H6MA 2YBJA 4H93A 1H87A 1UA6Y 1NF5A 1HSWA 2XTHA 2B6TA 4TX7A 1CKDA 4LFXA 3WPLA 1GBYA 4GLVA 2I6ZA 3WUNA 4TWSA 1L02A 155LA 4FDYA 1P5CA 2RB2X 1GF8A 3SP3A 1L95A 2OTYX 3C8RA 1G0LA 1HSXA 4N1CC 1QDTA 2ZNWY 1L30A 1EQ4A 1GE4A 4RLMA 2A7FA 2MEDA 5LVKA 3DN6A 4O34A 154LA 1CU5A 1L83A 3AW7A 1JITA 2FYCA 1IP4A 3C8SA 3HBDA 2CWIA 1CV4A 1L80A 2LYOA 1BVKC 2HEEA 3EMSA 1IP5A 4WM4A 1L96A 1LYIA 2NTGA 209LA 1L28A 1LZDA 3GUKA 3KAMA 1QT5A 1L27A 1L31A 3UONA 1MLCE 126LA 1LJFA 5E9RA 1LCNA 3B0KA 4P2EA 2D4KA 1LYYA 1JJ3A 1RCMA 222LA 3WU9A 1JQUA 2ZIKA 2LC9A 4GLAA 4YEMA 3G3BB 3WUMA 4PRQA 2B6XA 1L93A 231LA 1IVMA 3LYOA 1BB4A 1BQLY 3PBLA 1OP9B 4D9ZA 3WL2A 4J0LA 3N9CA 3V2WA 2LHMA 4GN5C 1HEMA 141LA 1GAYA 1GF4A 1WVVA 2B74A 133LA 4GCFA 5I4WA 108LA 3G3VA 4CGEA 3A94A 5HLLA 2OU8A 1REMA 4AQNA 1CJ7A 5FHWA 3IWRA 2D91A 4B49A 4LYMA 5LZMA 3TXIA 151LA 3C7ZA 196LA 4PJ2C 1B5YA 4B4JA 4DQ5A 2RAZX 1L07A 1LZEA 1HMLA 1QT4A 3TXBA 2Z12A 1V7TA 1LHIA 3HTFA 1GDXA 1L66A 1UIAA 2FYDA 147LA 1WQRA 1UIGA 1ZVYB 4NGVA 1EQ5A 1YAOA 1RFPA 2DQJY 1FKVA 1C6PA 1QTCA 1JTNA 4LYZA 4NGZA 2OE9X 3WMKA 157LA 1L62A 5D5CA 4BAPA 4ET9A 1JTPL 4ARQB 1IWYA 123LA 2HEFA 2Z39A 3DN4A 1LKSA 208LA 1L01A 4LYOA 3HU9A 4MCKA 5I4YA 110LA 4E3UA 241LA 1O23A 4ZFPA 4HTQA 1LZNA 5B1FA 2H5ZA 4WOAA 3TXEA 1GEZA 1IP6A 1L79A 4H8YA 4XADA 1LHHA 1F6SA 1LZ8A 4H9AA 3ZVQA 1D2WA 129LA 1BB7A 1LZGA 5APEA 1DYDA 2B72A 3B6LA 3AB6A 4EKSA 3SBAA 1L09A 4YENA 1LHKA 4B1AA 1B6IA 3W6BA 1C6GA 1LZ6A 5AMYA 4XJDA 1QT7A 1G7HC 2IFFY 1QSBA 3G3XA 139LA 1B7RA 1DYCA 1HEQA 5K7OA 3CT1A 191LA 1IWZA 4ZPUA 1LMOA 1GE2A 4PGJB 1GB5A 1TDYA 5II3A 1LSFA 2PC2A 1RJCB 1NBYC 4PK0A 1JKDA 4WM2A 1NDMC 1UICA 1HF4A 1CJ8A 1C63A 1LYEA 1QTZA 1L25A 1L60A 1SSYA 1L39A 1L23A 1IWXA 3FI7A 3F6ZA 1LZ5A 2DKVA 2VB1A 1GFTA 5HMJA 1DYGA 253LA 2MEBA 4H8ZA 4WM1A 1T8AA 1D9WA 4AXTA 2BQEA 4ARQA 2QB0B 5F9XA 1JHLA 2OE4X 4NY5A 5L3HA 2RBOA 4YEOA 1LSCA 1IC4Y 2HECA 4BAFA 5IDDA 2BQLA 1NMMA 4LT3A 3EXDA 195LA 1L59A 5DN4A 3GUNA 200LA 4H9CA 3WU7A 187LA 1BWHA 4NG8A 221LA 4IAPA 158LA 2ZYCA 176LA 2D6BA 3W6CA 2Z2EA 1NBZC 1OYUA 1LZ9A 2N5ZA 1SSWA 4H92A 2W1YA 1LZYA 5KKJA 132LA 1L68A 197LA 1LZ4A 1XFPL 1LZCA 5C6JA 2XJWA 1C6LA 146LA 4TSCA 1QUSA 3ATNA 4XJBA 3A3RX 2BAAA 5KXOA 1HEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P7S A;  1L54 A;  1KW5 A;  1P46 A;  173L A;  1L55 A;  1L11 A;  226L A;  152L A;  1L73 A;  237L A;  1L42 A;  234L A;  219L A;  1SWY A;  131L A;  258L A;  2A4T A;  118L A;  3HH4 A;  1P36 A;  220L A;  175L A;  201L A;  112L A;  1L14 A;  4GRV A;  114L A;  1QTH A;  4I7K A;  1D3N A;  120L A;  1L57 A;  225L A;  1L00 A;  1L64 A;  1CV1 A;  247L A;  3SB9 A;  1L47 A;  3CDV A;  1KY1 A;  3SN6 R;  1L21 A;  238L A;  4ARP A;  165L A;  2HUL A;  1QUH A;  1L98 A;  1L15 A;  1L85 A;  161L A;  172L A;  162L A;  1C66 A;  1L06 A;  3FAD A;  1CUQ A;  103L A;  125L A;  3EML A;  4ARL A;  1G0M A;  215L A;  4OO9 A;  4ARM B;  2LCB A;  3SB6 A;  2B75 A;  4EKP A;  1OVH A;  4EXM A;  4DJH A;  1T97 A;  1QTD A;  2B6T A;  3FA0 A;  1C6A A;  1DYA A;  4K5Y A;  1L92 A;  213L A;  3C83 A;  4W56 A;  1C6J A;  4W52 A;  111L A;  1L43 A;  1L02 A;  217L A;  2B6Z A;  1G1V A;  1C67 A;  1L70 A;  1QTB A;  155L A;  1KW7 A;  2QAR C;  1L63 A;  3C7Y A;  4EPF A;  1XJU A;  3HH5 A;  1P5C A;  1L89 A;  2RB1 X;  2O4W A;  2RB2 X;  188L A;  1OVK A;  3HTD A;  1L82 A;  251L A;  2OU9 A;  3PDS A;  170L A;  3DN3 A;  1L95 A;  159L A;  261L A;  2OTY X;  140L A;  1ZWN A;  3GUI A;  3HUQ A;  1L10 A;  3C8R A;  150L A;  1G0L A;  199L A;  1OV7 A;  1D3M A;  1QUG A;  102L A;  2ANV A;  1L97 A;  1C60 A;  167L A;  1L30 A;  1KY0 A;  3CDR A;  1P3N A;  1CX7 A;  239L A;  1DYF A;  3L64 A;  3DN6 A;  1L44 A;  1G0Q A;  3RUN A;  1C69 A;  1CU5 A;  1L83 A;  1C6F A;  3HUK A;  240L A;  252L A;  3C8S A;  1L38 A;  1L65 A;  214L A;  1C64 A;  1CV4 A;  1L33 A;  1L19 A;  1L80 A;  250L A;  1L56 A;  1L96 A;  2F47 A;  2IGC A;  1LYI A;  2NTG A;  209L A;  1L28 A;  3GUK A;  1L12 A;  1PQD A;  206L A;  1QT5 A;  1L27 A;  130L A;  184L A;  1L31 A;  1CU0 A;  3UON A;  1C6Q A;  126L A;  1C6B A;  2RBR A;  1L86 A;  259L A;  2LZM A;  3DN8 A;  227L A;  1L32 A;  1LYG A;  1L88 A;  1L75 A;  164L A;  2RBS A;  210L A;  1P56 A;  1L81 A;  222L A;  1LPY A;  1JQU A;  168L A;  2LC9 A;  216L A;  3CDT A;  2B6X A;  1D3J A;  1CU6 A;  3CDO A;  1L93 A;  232L A;  1KNI A;  142L A;  1OVJ A;  231L A;  3HTG A;  3L2X A;  3V2Y A;  1C6H A;  1L67 A;  3PBL A;  113L A;  1G1W A;  1CV3 A;  2O7A A;  1L52 A;  3V2W A;  3C8Q A;  1L35 A;  211L A;  3HT9 A;  141L A;  3HDF A;  1C6N A;  4ARM A;  2B74 A;  1KS3 A;  1L40 A;  7LZM A;  108L A;  3GUJ A;  3G3V A;  1L99 A;  1LLH A;  1L05 A;  3OE0 A;  4EPI A;  2OU8 A;  3DN2 A;  4AQN A;  248L A;  144L A;  3C82 A;  1G0P A;  4I7T A;  1CVK A;  1L29 A;  1QS9 A;  1EPY A;  3ODU A;  1SX2 A;  5LZM A;  151L A;  3DMV A;  3C7Z A;  1CUP A;  2Z6B A;  196L A;  3HH6 A;  262L A;  1L77 A;  171L A;  190L A;  1CX6 A;  2F2Q A;  4I7L A;  2RBN A;  1JTM A;  246L A;  1DYE A;  1WTH A;  2RAZ X;  169L A;  1L07 A;  1K28 A;  3DNA A;  1ZYT A;  1L87 A;  1QT4 A;  2RB0 X;  1LI3 A;  1LYH A;  255L A;  3HTF A;  1L66 A;  1PQK A;  2O79 A;  4LZM A;  260L A;  4W54 A;  147L A;  1L34 A;  1L76 A;  1L74 A;  1LWG A;  1L41 A;  1TLA A;  3LZM A;  4I7P A;  1L46 A;  1C62 A;  3HT6 A;  177L A;  1C6P A;  2ANX A;  1QTC A;  149L A;  1JTN A;  3CDQ A;  3NY8 A;  2B6Y A;  2B70 A;  2OE9 X;  1C61 A;  3GUL A;  157L A;  1L62 A;  1L04 A;  4EKQ A;  254L A;  1P2R A;  4I7S A;  186L A;  3FI5 A;  178L A;  4W51 A;  4ARQ B;  1DYB A;  2OU0 X;  1P64 A;  1LYD A;  3QAK A;  3DN0 A;  104L A;  1L03 A;  1QT6 A;  1G0G A;  123L A;  224L A;  3DN4 A;  2RBQ A;  1L36 A;  3C81 A;  4DKL A;  3HUA A;  257L A;  1L01 A;  3HU9 A;  160L A;  1L61 A;  1CU3 A;  3G3W A;  3JR6 A;  3SB5 A;  1C6M A;  110L A;  1OWY A;  241L A;  119L A;  1L58 A;  1L08 A;  2HUK A;  3DMX A;  3HT8 A;  6LZM A;  1L24 A;  4I7N A;  2OEA X;  3NY9 A;  1C68 A;  1PQI A;  1L48 A;  4W57 A;  1L22 A;  1L69 A;  1L94 A;  1LWK A;  1L18 A;  1L72 A;  3OE9 A;  4E97 A;  4LDL A;  3OE8 A;  3GUP A;  1L79 A;  1L0J A;  3HU8 A;  1CV5 A;  3GUM A;  3HH3 A;  122L A;  107L A;  4W55 A;  4S0W A;  1D2W A;  205L A;  189L A;  129L A;  3SBB C;  4LDE A;  1G0J A;  1DYD A;  1OWZ A;  2B72 A;  2CUU A;  3C7W A;  3VW7 A;  4EKS A;  3SBA A;  3OE6 A;  1L09 A;  256L A;  1QUO A;  1B6I A;  1XJT A;  1C6G A;  1QT7 A;  2Q9E A;  244L A;  2OTZ X;  4ARJ A;  4I7J A;  1SWZ A;  109L A;  1QSB A;  4GBR B;  1QT3 A;  3G3X A;  128L A;  139L A;  1DYC A;  2OE7 X;  228L A;  138L A;  4YXC A;  1LGW A;  191L A;  2B73 A;  3HT7 A;  4ZPU A;  1C6E A;  4W59 A;  1L84 A;  1OV5 A;  4DAJ A;  3DKE X;  180L A;  1L71 A;  1CU2 A;  1L90 A;  1PQO A;  3HDE A;  4EKR A;  2HUM A;  2RH1 A;  192L A;  1C6I A;  1LGU A;  2L78 A;  4PJZ A;  4W53 A;  1QS5 A;  4PK0 A;  3NYA A;  1PQM A;  166L A;  174L A;  236L A;  1LYF A;  2F32 A;  3GUO A;  245L A;  3HTB A;  3F8V A;  4I7O A;  1C63 A;  1C6C A;  4W58 A;  1LYE A;  229L A;  1QTZ A;  3RZE A;  1XEP A;  4I7M A;  242L A;  1L25 A;  1L49 A;  1L60 A;  235L A;  3D4S A;  1SSY A;  1L39 A;  1L23 A;  148L E;  1SX7 A;  2Q9D A;  3SB8 A;  3DN1 A;  1DYG A;  253L A;  1T8A A;  1P2L A;  4EJ4 A;  1D2Y A;  1D9W A;  1L13 A;  1P37 A;  233L A;  4ARQ A;  218L A;  2QB0 B;  127L A;  1L16 A;  2B6W A;  2OE4 X;  1ZUR A;  223L A;  1C6D A;  1L53 A;  4YXA C;  1L17 A;  3SB7 A;  2RBO A;  143L A;  4I7Q A;  1L37 A;  3C80 A;  1L50 A;  2RAY X;  212L A;  145L A;  1LYJ A;  1G07 A;  198L A;  1QUD A;  1C65 A;  1L0K A;  195L A;  1L59 A;  3DMZ A;  3GUN A;  182L A;  1D3F A;  200L A;  1G06 A;  187L A;  221L A;  2B7X A;  4IAP A;  158L A;  1LI6 A;  1CTW A;  1P6Y A;  4I7R A;  176L A;  1QT8 A;  1L26 A;  3HWL A;  1LI2 A;  1OYU A;  185L A;  163L A;  1T8G A;  1SSW A;  4LDO A;  181L A;  1C6K A;  230L A;  1T6H A;  1NHB A;  1L51 A;  1LW9 A;  1L45 A;  156L A;  1L68 A;  1PQJ A;  183L A;  197L A;  1LGX A;  2NTH A;  1T8F A;  3F9L A;  115L A;  243L A;  3K2R A;  4YX7 C;  5I14 A;  249L A;  2RBP A;  1QSQ A;  1QTV A;  1I6S A;  1C6L A;  1CV0 A;  146L A;  1L20 A;  1G0K A;  1C6T A;  137L A;  1L91 A;  1CV6 A; 
#chains in the Genus database with same CATH topology
 1KW5 A;  1FLU A;  1L73 A;  1OUF A;  1GBO A;  4DDA A;  4NGL A;  3WYH A;  4LYT A;  118L A;  3HBH A;  1IOT A;  220L A;  1LOZ A;  5I54 A;  153L A;  5F16 A;  1B5Z A;  114L A;  1JIS A;  1QTH A;  2LYZ A;  1W6Z A;  1D3N A;  3A67 Y;  4I7K A;  120L A;  1L00 A;  1GF7 A;  4ETA A;  4NFV A;  4GCE A;  1LHJ A;  3SB9 A;  5LIN A;  2BPU A;  3CDV A;  1KY1 A;  1VDP A;  2HUL A;  1QUH A;  1B7S A;  1IX0 A;  2DQH Y;  3AZ6 A;  3RT5 X;  162L A;  1C66 A;  3FAD A;  1QQY A;  1G0M A;  2MEH A;  1XSF A;  4KT3 A;  2B75 A;  1T3P A;  4EKP A;  2YDG A;  4EXM A;  4DJH A;  1BHZ A;  1IR9 A;  1LHM A;  3WPK A;  3TXD A;  4K5Y A;  2MEI A;  3C83 A;  4W56 A;  4N9R A;  5KXP A;  4W52 A;  3WUL A;  111L A;  5LAG A;  1L43 A;  1DQJ C;  3A91 A;  1G1V A;  1QTB A;  1GDW A;  2Z19 A;  1IR7 A;  1KW7 A;  194L A;  1L63 A;  3C7Y A;  2O4W A;  3HTD A;  5D5F A;  1VDT A;  1L82 A;  193L A;  2BQD A;  1I1Z A;  1HC0 A;  159L A;  261L A;  3GUI A;  1L10 A;  4HJY A;  150L A;  3TXH A;  3AGH A;  1D3M A;  1ZMY L;  3LZT A;  102L A;  1VED A;  1GFE A;  1AZF A;  4XEN A;  1J1X Y;  2CGI A;  2XBS A;  3RUN A;  5B05 A;  4NHI A;  3N9E A;  1FLQ A;  1C6F A;  252L A;  214L A;  4RW2 A;  250L A;  1SQ2 L;  1GE0 A;  1L56 A;  1B7Q A;  2F47 A;  2DQG Y;  2IGC A;  2YBM A;  3AYQ A;  2EPE A;  4II8 A;  206L A;  130L A;  184L A;  4J1B A;  2F4G A;  1CU0 A;  4NHP A;  1LZ1 A;  5DL9 A;  1C6B A;  2RBR A;  1L86 A;  259L A;  3WPJ A;  2B5Z A;  2LZM A;  4RW1 A;  1GFU A;  1L32 A;  4ML7 A;  4HSF A;  1IOR A;  4CFP A;  1L88 A;  164L A;  1P56 A;  2F2N A;  1YRO A;  3CDT A;  3A93 A;  3CDO A;  232L A;  2O7A A;  5T3F A;  2GV0 A;  1L35 A;  211L A;  2Q0M X;  2H9J A;  1EQE A;  1D9U A;  7LZM A;  1WQM A;  3J6K A;  1IY3 A;  1VAU A;  3DN2 A;  248L A;  2DQE Y;  144L A;  1JPO A;  3LYM A;  4DC4 A;  1B9O A;  4DD3 A;  1BVX A;  1L29 A;  1EPY A;  3ODU A;  3W6D A;  4LYC A;  1SX2 A;  4DD0 A;  1GB2 A;  3DMV A;  1GE3 A;  2I25 L;  3TMV A;  1IR8 A;  3HH6 A;  4DWX A;  1L77 A;  1UAC Y;  1GBZ A;  2F2Q A;  1BWI A;  3QY4 A;  1JTM A;  1AT6 A;  4OWB A;  246L A;  4XYY A;  5I4X A;  3DNA A;  4N8Z A;  1ZYT A;  3WXT A;  1A4V A;  2O79 A;  2W1X A;  4LZM A;  260L A;  2ZIJ A;  1TLA A;  5APF A;  3HT6 A;  3TMU A;  4H9F A;  5LA5 A;  1GBS A;  2DBT A;  1B7M A;  1L04 A;  2HU1 A;  2F4A A;  1HEL A;  1EL1 A;  4I7S A;  3FI5 A;  1INU A;  1P64 A;  3QAK A;  1LAA A;  2NWD X;  1QT6 A;  1Z55 A;  224L A;  1XGR C;  5APC A;  3C81 A;  4DKL A;  257L A;  3QE8 A;  160L A;  3P65 A;  1JKA A;  3JR6 A;  2D4I A;  119L A;  3DMX A;  3HT8 A;  1KIR C;  1YAQ A;  2OEA X;  1CKF A;  4WLX A;  3OE9 A;  1GB3 A;  5FST A;  3GUP A;  1LSN A;  5HNC A;  1B5U A;  3GUM A;  3RNX A;  5HNL A;  1QDR A;  1JUG A;  1HEW A;  1G0J A;  2CUU A;  3C7W A;  3CSZ A;  3OE6 A;  1G7L C;  1QUO A;  3ZVQ B;  5KXL A;  2OTZ X;  1SWZ A;  4NHS A;  3AZ5 A;  1QT3 A;  4NGK A;  1GF0 A;  228L A;  138L A;  1KIP C;  1LGW A;  4H9H A;  2ZWB A;  4WM5 A;  180L A;  1L71 A;  4EKR A;  3HDE A;  3N9A A;  192L A;  1C6I A;  3T6U A;  1QS5 A;  1HHL A;  4PHI A;  4H90 A;  1GPQ C;  1PQM A;  3GUO A;  1GF9 A;  4I8S A;  5KXN A;  2ZNX Y;  229L A;  2BQH A;  5KXR A;  3WW6 A;  242L A;  2G4Q A;  3D4S A;  4IAT A;  1OUH A;  3DN1 A;  1F0W A;  233L A;  127L A;  2B6W A;  4G4C A;  4X3B A;  1C6D A;  1GF6 A;  3SB7 A;  143L A;  6LYZ A;  4I7Q A;  5KXM A;  1L50 A;  4HTN A;  4OW1 A;  1G07 A;  4XJF A;  4WO9 A;  1QUD A;  207L A;  3TXK A;  4NGJ A;  182L A;  1D3F A;  1G06 A;  4WMG A;  3A90 A;  2B7X A;  1UC0 A;  1LI6 A;  1CTW A;  4WG7 A;  4DT3 A;  185L A;  1XGP C;  1BB3 A;  3VWO A;  1LJE A;  1T8G A;  4H9E A;  2CJL A;  4LDO A;  5KXS A;  1GFK A;  1T6H A;  5DLA A;  5A3Z A;  5KXT A;  4YOP A;  1LSA A;  2BLX A;  1JSE A;  1PQJ A;  4HP0 A;  2W1L A;  5KXX A;  4WL7 A;  3K3T A;  1REX A;  243L A;  4XN6 A;  4YX7 C;  4G49 A;  1N4F A;  1QTV A;  1G0K A;  137L A;  1CV6 A;  1GF3 A;  1L54 A;  1L11 A;  152L A;  2H9K A;  234L A;  1SWY A;  1LJG A;  4AGA A;  112L A;  4ETB A;  4GRV A;  4WL6 A;  4IAS A;  1NKH A;  1L64 A;  4HV1 A;  2YBL A;  4GN4 A;  247L A;  3LYZ A;  3P64 A;  4NGY A;  2W1M A;  4ARP A;  4I0C A;  2HTX A;  4LFP A;  161L A;  172L A;  1D0K A;  1HFX A;  1CUQ A;  1D6P A;  125L A;  215L A;  4ARM B;  2LCB A;  3SB6 A;  3M3U A;  2HU3 A;  1UBZ A;  1D0M A;  1OVH A;  4TTD A;  1T97 A;  1TCY A;  3FA0 A;  4NHT A;  5HMV A;  1DYA A;  5LVG A;  1YIL A;  213L A;  1C6J A;  4R6C A;  2ZQ4 A;  5LXW A;  217L A;  2B6Z A;  1C67 A;  2Z18 A;  2BQM A;  2QAR C;  4H91 A;  4EPF A;  3HH5 A;  2ZYP A;  2RB1 X;  1WTM A;  3W6F A;  2OU9 A;  4WLY A;  3PDS A;  5FEL A;  3DN3 A;  2BQJ A;  1HFZ A;  4HJV A;  3LZ2 A;  199L A;  1OV7 A;  3CDR A;  1P3N A;  1DYF A;  3W6A A;  1C69 A;  2Z37 A;  4PPO A;  4DYG A;  3HUK A;  1GFV A;  1L19 A;  1HFY A;  3BKV A;  1DI3 A;  1WQO A;  5ILC A;  1ALC A;  1C6Q A;  4GN3 A;  1GBW A;  4OWH A;  1YAN A;  1IOQ A;  5EBH A;  3DN8 A;  1JWR A;  4LGK A;  4NSH A;  1LYG A;  4Z41 A;  1KXX A;  1L75 A;  5F14 A;  2RBS A;  210L A;  1L81 A;  2EIZ C;  5M1Y A;  1LPY A;  1UIF A;  3A8Z A;  7LYZ A;  1CU6 A;  5FEK A;  142L A;  1DZB X;  1OVJ A;  3HTG A;  4Z98 A;  1C6H A;  1L67 A;  1LSE A;  2CDS A;  1CV3 A;  1LPI A;  2DQI Y;  3C8Q A;  4B4I A;  3HT9 A;  3A92 A;  2BLY A;  3HDF A;  4ARM A;  1GAZ A;  3W6E A;  1L40 A;  1IIZ A;  1JTT L;  1L05 A;  4ANR A;  2MEE A;  5LYM A;  1GB0 A;  1REZ A;  1ZV5 L;  1I20 A;  1C7P A;  1IO5 A;  1CVK A;  5LYT A;  5L3I A;  1D6Q A;  4NGW A;  1W08 A;  1CUP A;  4YF2 A;  1LSY A;  1IWU A;  171L A;  3TXG A;  1CX6 A;  2RBN A;  1D0L A;  1BWJ A;  1J1P Y;  5I5Q A;  1WTH A;  2G4P A;  1YKX X;  2FBB A;  1K28 A;  3BKH A;  3AZ4 A;  1LYS A;  1L87 A;  4LT1 A;  4W94 A;  5LVH A;  1YIK A;  4NGI A;  1GFA A;  1XEI A;  1L34 A;  1OUE A;  1L74 A;  1LWG A;  4EMN A;  5J7C A;  2Z38 A;  4I7P A;  3RW8 A;  1LYO A;  2DQC Y;  1C62 A;  1LZA A;  177L A;  2ANX A;  149L A;  2ZQ3 A;  3CDQ A;  3NY8 A;  2B6Y A;  1C61 A;  4H1P A;  1GD6 A;  3FE0 A;  1UIE A;  1JIY A;  3ULR A;  1PS5 A;  254L A;  6LYT A;  186L A;  2WAR A;  1LMN A;  1DYB A;  2OU0 X;  1IP2 A;  1LYD A;  4DQJ A;  104L A;  1G0G A;  3TMX A;  5LIO A;  1OUA A;  4QGZ A;  4NHQ A;  3HUA A;  3A3Q A;  1LMQ A;  1GE1 A;  3G3W A;  5APD A;  1CJ6 A;  3SB5 A;  1DKJ A;  2DQA A;  3CQL A;  1E8L A;  1L58 A;  1UID A;  1L08 A;  4UWV A;  1LJI A;  4I7N A;  1PQI A;  3E3D A;  1GFG A;  2YVB A;  4CJ2 A;  1L94 A;  4E97 A;  3B0O A;  1L18 A;  1L72 A;  3OE8 A;  5C6I A;  2YSS C;  4WM6 A;  1L0J A;  3WU8 A;  1CV5 A;  2BQO A;  3HH3 A;  122L A;  4L41 A;  1NQI A;  4LDE A;  1OWZ A;  4B0D A;  3GXR A;  4WLT A;  4YM8 A;  3VW7 A;  4H9B A;  256L A;  4NSI A;  1IWW A;  1IY4 A;  244L A;  4ARJ A;  4I7J A;  109L A;  3CSQ A;  4GBR B;  1HEO A;  1LJ4 A;  128L A;  5FCP A;  2OE7 X;  4N1E I;  4YXC A;  2B73 A;  1IOS A;  3HT7 A;  4DD2 A;  1JKC A;  1C6E A;  1L84 A;  3CB7 A;  1L90 A;  1PQO A;  1LHL A;  5KJ9 A;  4KL7 A;  4LT0 A;  4W53 A;  3NYA A;  174L A;  2F32 A;  245L A;  4HPI A;  3HTB A;  2F30 A;  4DD1 A;  1NDG C;  3WVX A;  1G7J C;  1LSB A;  2BQF A;  1YQV Y;  1L49 A;  235L A;  2IHL A;  148L E;  1QUT A;  1MEL L;  1D2Y A;  1IWT A;  1L13 A;  5KXW A;  1GXV 2;  218L A;  1LMA A;  4MST A;  223L A;  4YXA C;  1JSF A;  4GCB A;  145L A;  1ZVH L;  1C45 A;  1C46 A;  1FBI X;  1OUC A;  1UIB A;  1C65 A;  3OJP A;  2LYM A;  4CHX A;  1OUJ A;  1L0K A;  2EQL A;  3DMZ A;  1B7P A;  1OUG A;  1HNL A;  4OWE A;  4H8X A;  4I7R A;  1VFB C;  3HWL A;  1UCO A;  1LMP A;  3OK0 A;  181L A;  1C6K A;  230L A;  5KXY A;  2DQF C;  1SLY A;  5KXZ A;  1AM7 A;  1BGI A;  1B7O A;  4IJ4 A;  2X0A A;  1DI4 A;  2NTH A;  5HQ1 A;  249L A;  2RBP A;  1QSQ A;  1VDS A;  1L20 A;  1C6T A;  2AUB A;  3G3A B;  1L91 A;  4XJI A;  5F9U A;  1P7S A;  1P46 A;  173L A;  1L55 A;  3WVY A;  1IP3 A;  237L A;  1LJ3 A;  4GCC A;  131L A;  258L A;  2A4T A;  3HH4 A;  3TXF A;  4ETD A;  4B4E A;  175L A;  5JEN B;  1YKZ X;  1C43 A;  1AKI A;  1L57 A;  9LYZ A;  3LHM A;  1CV1 A;  4RDS A;  1QTE A;  2BQN A;  1LTM A;  5LA8 A;  1L47 A;  3SN6 R;  1LMC A;  1L21 A;  4A7D A;  2D4J A;  238L A;  1LYZ A;  1L98 A;  3W3E A;  1L15 A;  3CT0 A;  1L85 A;  4LYB A;  1GBX A;  1I56 A;  1XGU C;  1OUB A;  1GHL A;  103L A;  3EML A;  1IC7 Y;  4ARL A;  4KPM A;  4NIJ A;  4OO9 A;  5F81 A;  2RSC A;  5LYZ A;  1YL0 X;  1QTD A;  1LZT A;  4HTK A;  1FDL Y;  1B0D A;  1RE2 A;  4QY9 A;  1C6A A;  3LYT A;  1L92 A;  4LT2 A;  1IWV A;  4LZT A;  4NWE A;  3A96 A;  1L70 A;  4ETE A;  1OUI A;  3A34 A;  1XJU A;  1L89 A;  1GFR A;  188L A;  1OVK A;  1QTK A;  2XBR A;  251L A;  1F6R A;  1FN5 A;  170L A;  5KY1 A;  2HED A;  4WM3 A;  5KXK A;  140L A;  1ZWN A;  3HUQ A;  3B0I A;  1QUG A;  2ANV A;  1L97 A;  1C60 A;  167L A;  1KY0 A;  3GXK A;  1CX7 A;  1P2C C;  1GB8 A;  239L A;  3L64 A;  1FKQ A;  1L44 A;  1G0Q A;  1LZB A;  4NSJ A;  240L A;  2MEA A;  1L38 A;  1L65 A;  1C64 A;  1L33 A;  3WW5 A;  3A95 A;  1LJN A;  4M4O A;  4CFO A;  1FLY A;  1TEW A;  1KXY A;  1KIQ C;  1L12 A;  3WXU A;  2HUB A;  1PQD A;  3HFM Y;  2YBN A;  1YKY X;  1B7L A;  4OOO A;  227L A;  4XJG A;  3TMW A;  4BAD A;  1A2Y C;  1HER A;  1LMT A;  2MEC A;  1CKC A;  168L A;  1WQP A;  216L A;  1D3J A;  4WO6 A;  1KNI A;  3L2X A;  3V2Y A;  113L A;  1G1W A;  1L52 A;  1WQQ A;  1BB5 A;  1C6N A;  3CT5 A;  1KS3 A;  4WLD A;  1TAY A;  3GUJ A;  1L99 A;  1LLH A;  5IEL A;  3OE0 A;  5DM9 A;  4EPI A;  1G7I C;  4J1A A;  4TUN A;  1IOC A;  3C82 A;  4DD9 A;  1G0P A;  1JTO L;  4I7T A;  3IJU A;  4HV2 A;  1QS9 A;  4UWU A;  1QIO A;  4BS7 A;  3D3D A;  1LKR A;  8LYZ A;  262L A;  1LJK A;  1JKB A;  190L A;  4I7L A;  1JEF A;  2BQG A;  1DYE A;  169L A;  4Z3M A;  5B06 A;  1F10 A;  2I26 L;  2MEG A;  2RB0 X;  1LI3 A;  1LYH A;  255L A;  1PQK A;  1REY A;  4W54 A;  1L76 A;  1FLW A;  4QEQ A;  3RU5 A;  1L41 A;  1V7S A;  2C8O A;  3LZM A;  1L46 A;  3TXJ A;  3P66 A;  134L A;  1CJ9 A;  4QDN A;  4J7V A;  2B70 A;  2BQB A;  3P4Z A;  3GUL A;  3HBE X;  2BQA A;  4EKQ A;  2Y8P A;  1P2R A;  178L A;  1PZY A;  3A6C Y;  4W51 A;  4Z46 A;  3DN0 A;  1L03 A;  1RI8 B;  2HEA A;  3AW6 A;  4MR1 A;  4ETC A;  1WQN A;  2RBQ A;  1L36 A;  3T36 A;  4OWC A;  3EO5 A;  4H9I A;  1L61 A;  1CU3 A;  5B59 A;  1C6M A;  3B72 A;  1CKH A;  1JJ0 A;  1OWY A;  3AJN A;  2HUK A;  4G4H A;  6LZM A;  1L24 A;  5B07 A;  3NY9 A;  1QSW A;  1C68 A;  1IC5 Y;  4EOF A;  4OWA A;  1L48 A;  1TBY A;  4W57 A;  1L22 A;  1L69 A;  1LWK A;  4LDL A;  3WUA A;  1VDQ A;  3HU8 A;  1OUD A;  1GF5 A;  4W55 A;  107L A;  3ZEK A;  1GB9 A;  4S0W A;  205L A;  189L A;  1DPW A;  1LSZ A;  3SBB C;  5ILF A;  3LN2 A;  1GXX A;  1LZR A;  4NWH A;  4R0F A;  1C10 A;  2G4N A;  4OOT A;  1B5W A;  1NHE A;  1AT5 A;  5IHG A;  1XJT A;  2BQI A;  4DQ7 A;  4PRU A;  4TSB A;  3IJV A;  2Q9E A;  5A3E A;  4KXI A;  4RLN A;  5LVI A;  1T6V L;  1QSA A;  4C3W A;  4XJH A;  3ATO A;  3D9A C;  1GB6 A;  2LZT A;  4W96 A;  2YBI A;  4W59 A;  4DAJ A;  1OV5 A;  3DKE X;  4N0J A;  1CU2 A;  2BQC A;  2HUM A;  2RH1 A;  1IEE A;  5DN5 A;  1LGU A;  2L78 A;  4PJZ A;  1DKK A;  4WG1 A;  1OQM A;  5C6L A;  1B5X A;  1HEN A;  1YAM A;  4C5F A;  166L A;  236L A;  1LYF A;  1IP1 A;  3F8V A;  3AGI A;  4I7O A;  1C6C A;  4W58 A;  4HPE A;  5E4P A;  5I53 A;  5B1G A;  3RZE A;  1XEP A;  4I7M A;  1VAT A;  1GB7 A;  1SX7 A;  2Q9D A;  2EKS C;  1CNS A;  3SB8 A;  1C08 C;  1LSP A;  1P2L A;  4EJ4 A;  4G9S A;  1P37 A;  1UIH A;  1DXJ A;  1CKG A;  3J4G A;  4M6D A;  3CSR A;  4NSG A;  1L16 A;  1ZUR A;  1L53 A;  1L17 A;  4G4B A;  4ET8 A;  1L37 A;  3C80 A;  1XEK A;  2RAY X;  212L A;  1LYJ A;  3AZ7 A;  2MEF A;  1B5V A;  198L A;  1JJ1 A;  1GEV A;  4U3X B;  3WH1 A;  4DD7 A;  1G7M C;  4H94 A;  2XQO A;  1DI5 A;  1XGT C;  2BQK A;  1YL1 X;  1P6Y A;  1B2K A;  1QT8 A;  1L26 A;  1DPX A;  1LI2 A;  5LAF A;  1LSG A;  1B7N A;  163L A;  1BB6 A;  1NHB A;  1L51 A;  1LW9 A;  1L45 A;  156L A;  4UWN A;  3QNG A;  5FDJ A;  1GWD A;  3EBA B;  1LSD A;  183L A;  3RZ4 A;  1LGX A;  4FJR A;  1LJJ A;  1WTN A;  1T8F A;  3F9L A;  5KKI A;  115L A;  1HMK A;  2FBD A;  3K2R A;  5I14 A;  1LZS A;  1I6S A;  1IP7 A;  1KXW A;  1CV0 A;  1UUZ C;  3P68 A;  4NG1 A;  1LJH A;  3M18 B;  2Z6B A;  2Z2F A;  1WVU A;  226L A;  1YAP A;  4DDB A;  1L42 A;  4N5R A;  1NWG A;  219L A;  1J1O Y;  2LZ2 A;  1XGQ C;  1XEJ A;  3A6B Y;  1P36 A;  2ZIL A;  5LVJ A;  201L A;  135L A;  4NGO A;  1L14 A;  3MGW A;  2A7D A;  1LSM A;  225L A;  4DDC A;  4HJZ A;  4GCD A;  1GFH A;  4ZEE A;  2YBH A;  4ZIX A;  2C8P A;  3AGG G;  2DQD Y;  165L A;  4NEB A;  2HEB A;  5L9J A;  1GFJ A;  1L06 A;  1H6M A;  2YBJ A;  4H93 A;  1H87 A;  1UA6 Y;  1NF5 A;  1HSW A;  2XTH A;  2B6T A;  4TX7 A;  1CKD A;  4LFX A;  3WPL A;  1GBY A;  4GLV A;  2I6Z A;  3WUN A;  4TWS A;  1L02 A;  155L A;  4FDY A;  1P5C A;  2RB2 X;  1GF8 A;  3SP3 A;  1L95 A;  2OTY X;  3C8R A;  1G0L A;  1HSX A;  4N1C C;  1QDT A;  2ZNW Y;  1L30 A;  1EQ4 A;  1GE4 A;  4RLM A;  2A7F A;  2MED A;  5LVK A;  3DN6 A;  4O34 A;  154L A;  1CU5 A;  1L83 A;  3AW7 A;  1JIT A;  2FYC A;  1IP4 A;  3C8S A;  3HBD A;  2CWI A;  1CV4 A;  1L80 A;  2LYO A;  1BVK C;  2HEE A;  3EMS A;  1IP5 A;  4WM4 A;  1L96 A;  1LYI A;  2NTG A;  209L A;  1L28 A;  1LZD A;  3GUK A;  3KAM A;  1QT5 A;  1L27 A;  1L31 A;  3UON A;  1MLC E;  126L A;  1LJF A;  5E9R A;  1LCN A;  3B0K A;  4P2E A;  2D4K A;  1LYY A;  1JJ3 A;  1RCM A;  222L A;  3WU9 A;  1JQU A;  2ZIK A;  2LC9 A;  4GLA A;  4YEM A;  3G3B B;  3WUM A;  4PRQ A;  2B6X A;  1L93 A;  231L A;  1IVM A;  3LYO A;  1BB4 A;  1BQL Y;  3PBL A;  1OP9 B;  4D9Z A;  3WL2 A;  4J0L A;  3N9C A;  3V2W A;  2LHM A;  4GN5 C;  1HEM A;  141L A;  1GAY A;  1GF4 A;  1WVV A;  2B74 A;  133L A;  4GCF A;  5I4W A;  108L A;  3G3V A;  4CGE A;  3A94 A;  5HLL A;  2OU8 A;  1REM A;  4AQN A;  1CJ7 A;  5FHW A;  3IWR A;  2D91 A;  4B49 A;  4LYM A;  5LZM A;  3TXI A;  151L A;  3C7Z A;  196L A;  4PJ2 C;  1B5Y A;  4B4J A;  4DQ5 A;  2RAZ X;  1L07 A;  1LZE A;  1HML A;  1QT4 A;  3TXB A;  2Z12 A;  1V7T A;  1LHI A;  3HTF A;  1GDX A;  1L66 A;  1UIA A;  2FYD A;  147L A;  1WQR A;  1UIG A;  1ZVY B;  4NGV A;  1EQ5 A;  1YAO A;  1RFP A;  2DQJ Y;  1FKV A;  1C6P A;  1QTC A;  1JTN A;  4LYZ A;  4NGZ A;  2OE9 X;  3WMK A;  157L A;  1L62 A;  5D5C A;  4BAP A;  4ET9 A;  1JTP L;  4ARQ B;  1IWY A;  123L A;  2HEF A;  2Z39 A;  3DN4 A;  1LKS A;  208L A;  1L01 A;  4LYO A;  3HU9 A;  4MCK A;  5I4Y A;  110L A;  4E3U A;  241L A;  1O23 A;  4ZFP A;  4HTQ A;  1LZN A;  5B1F A;  2H5Z A;  4WOA A;  3TXE A;  1GEZ A;  1IP6 A;  1L79 A;  4H8Y A;  4XAD A;  1LHH A;  1F6S A;  1LZ8 A;  4H9A A;  3ZVQ A;  1D2W A;  129L A;  1BB7 A;  1LZG A;  5APE A;  1DYD A;  2B72 A;  3B6L A;  3AB6 A;  4EKS A;  3SBA A;  1L09 A;  4YEN A;  1LHK A;  4B1A A;  1B6I A;  3W6B A;  1C6G A;  1LZ6 A;  5AMY A;  4XJD A;  1QT7 A;  1G7H C;  2IFF Y;  1QSB A;  3G3X A;  139L A;  1B7R A;  1DYC A;  1HEQ A;  5K7O A;  3CT1 A;  191L A;  1IWZ A;  4ZPU A;  1LMO A;  1GE2 A;  4PGJ B;  1GB5 A;  1TDY A;  5II3 A;  1LSF A;  2PC2 A;  1RJC B;  1NBY C;  4PK0 A;  1JKD A;  4WM2 A;  1NDM C;  1UIC A;  1HF4 A;  1CJ8 A;  1C63 A;  1LYE A;  1QTZ A;  1L25 A;  1L60 A;  1SSY A;  1L39 A;  1L23 A;  1IWX A;  3FI7 A;  3F6Z A;  1LZ5 A;  2DKV A;  2VB1 A;  1GFT A;  5HMJ A;  1DYG A;  253L A;  2MEB A;  4H8Z A;  4WM1 A;  1T8A A;  1D9W A;  4AXT A;  2BQE A;  4ARQ A;  2QB0 B;  5F9X A;  1JHL A;  2OE4 X;  4NY5 A;  5L3H A;  2RBO A;  4YEO A;  1LSC A;  1IC4 Y;  2HEC A;  4BAF A;  5IDD A;  2BQL A;  1NMM A;  4LT3 A;  3EXD A;  195L A;  1L59 A;  5DN4 A;  3GUN A;  200L A;  4H9C A;  3WU7 A;  187L A;  1BWH A;  4NG8 A;  221L A;  4IAP A;  158L A;  2ZYC A;  176L A;  2D6B A;  3W6C A;  2Z2E A;  1NBZ C;  1OYU A;  1LZ9 A;  2N5Z A;  1SSW A;  4H92 A;  2W1Y A;  1LZY A;  5KKJ A;  132L A;  1L68 A;  197L A;  1LZ4 A;  1XFP L;  1LZC A;  5C6J A;  2XJW A;  1C6L A;  146L A;  4TSC A;  1QUS A;  3ATN A;  4XJB A;  3A3R X;  2BAA A;  5KXO A;  1HEP A; 
#chains in the Genus database with same CATH homology
 1KW5 A;  1FLU A;  1L73 A;  1OUF A;  1GBO A;  4DDA A;  4NGL A;  3WYH A;  4LYT A;  118L A;  3HBH A;  1IOT A;  220L A;  1LOZ A;  5I54 A;  153L A;  5F16 A;  1B5Z A;  114L A;  1JIS A;  1QTH A;  2LYZ A;  1W6Z A;  1D3N A;  3A67 Y;  4I7K A;  120L A;  1L00 A;  1GF7 A;  4ETA A;  4NFV A;  4GCE A;  1LHJ A;  3SB9 A;  5LIN A;  2BPU A;  3CDV A;  1KY1 A;  1VDP A;  2HUL A;  1QUH A;  1B7S A;  1IX0 A;  2DQH Y;  3AZ6 A;  3RT5 X;  162L A;  1C66 A;  3FAD A;  1QQY A;  1G0M A;  2MEH A;  1XSF A;  4KT3 A;  2B75 A;  1T3P A;  4EKP A;  2YDG A;  4EXM A;  4DJH A;  1BHZ A;  1IR9 A;  1LHM A;  3WPK A;  3TXD A;  4K5Y A;  2MEI A;  3C83 A;  4W56 A;  4N9R A;  5KXP A;  4W52 A;  3WUL A;  111L A;  5LAG A;  1L43 A;  1DQJ C;  3A91 A;  1G1V A;  1QTB A;  1GDW A;  2Z19 A;  1IR7 A;  1KW7 A;  194L A;  1L63 A;  3C7Y A;  2O4W A;  3HTD A;  5D5F A;  1VDT A;  1L82 A;  193L A;  2BQD A;  1I1Z A;  1HC0 A;  159L A;  261L A;  3GUI A;  1L10 A;  4HJY A;  150L A;  3TXH A;  3AGH A;  1D3M A;  1ZMY L;  3LZT A;  102L A;  1VED A;  1GFE A;  1AZF A;  4XEN A;  1J1X Y;  2CGI A;  2XBS A;  3RUN A;  5B05 A;  4NHI A;  3N9E A;  1FLQ A;  1C6F A;  252L A;  214L A;  4RW2 A;  250L A;  1SQ2 L;  1GE0 A;  1L56 A;  1B7Q A;  2F47 A;  2DQG Y;  2IGC A;  2YBM A;  3AYQ A;  2EPE A;  4II8 A;  206L A;  130L A;  184L A;  4J1B A;  2F4G A;  1CU0 A;  4NHP A;  1LZ1 A;  5DL9 A;  1C6B A;  2RBR A;  1L86 A;  259L A;  3WPJ A;  2B5Z A;  2LZM A;  4RW1 A;  1GFU A;  1L32 A;  4ML7 A;  4HSF A;  1IOR A;  4CFP A;  1L88 A;  164L A;  1P56 A;  2F2N A;  1YRO A;  3CDT A;  3A93 A;  3CDO A;  232L A;  2O7A A;  5T3F A;  2GV0 A;  1L35 A;  211L A;  2Q0M X;  2H9J A;  1EQE A;  1D9U A;  7LZM A;  1WQM A;  3J6K A;  1IY3 A;  1VAU A;  3DN2 A;  248L A;  2DQE Y;  144L A;  1JPO A;  3LYM A;  4DC4 A;  1B9O A;  4DD3 A;  1BVX A;  1L29 A;  1EPY A;  3ODU A;  3W6D A;  4LYC A;  1SX2 A;  4DD0 A;  1GB2 A;  3DMV A;  1GE3 A;  2I25 L;  3TMV A;  1IR8 A;  3HH6 A;  4DWX A;  1L77 A;  1UAC Y;  1GBZ A;  2F2Q A;  1BWI A;  3QY4 A;  1JTM A;  1AT6 A;  4OWB A;  246L A;  4XYY A;  5I4X A;  3DNA A;  4N8Z A;  1ZYT A;  3WXT A;  1A4V A;  2O79 A;  2W1X A;  4LZM A;  260L A;  2ZIJ A;  1TLA A;  5APF A;  3HT6 A;  3TMU A;  4H9F A;  5LA5 A;  1GBS A;  2DBT A;  1B7M A;  1L04 A;  2HU1 A;  2F4A A;  1HEL A;  1EL1 A;  4I7S A;  3FI5 A;  1INU A;  1P64 A;  3QAK A;  1LAA A;  2NWD X;  1QT6 A;  1Z55 A;  224L A;  1XGR C;  5APC A;  3C81 A;  4DKL A;  257L A;  3QE8 A;  160L A;  3P65 A;  1JKA A;  3JR6 A;  2D4I A;  119L A;  3DMX A;  3HT8 A;  1KIR C;  1YAQ A;  2OEA X;  1CKF A;  4WLX A;  3OE9 A;  1GB3 A;  5FST A;  3GUP A;  1LSN A;  5HNC A;  1B5U A;  3GUM A;  3RNX A;  5HNL A;  1QDR A;  1JUG A;  1HEW A;  1G0J A;  2CUU A;  3C7W A;  3CSZ A;  3OE6 A;  1G7L C;  1QUO A;  3ZVQ B;  5KXL A;  2OTZ X;  1SWZ A;  4NHS A;  3AZ5 A;  1QT3 A;  4NGK A;  1GF0 A;  228L A;  138L A;  1KIP C;  1LGW A;  4H9H A;  2ZWB A;  4WM5 A;  180L A;  1L71 A;  4EKR A;  3HDE A;  3N9A A;  192L A;  1C6I A;  3T6U A;  1QS5 A;  1HHL A;  4PHI A;  4H90 A;  1GPQ C;  1PQM A;  3GUO A;  1GF9 A;  4I8S A;  5KXN A;  2ZNX Y;  229L A;  2BQH A;  5KXR A;  3WW6 A;  242L A;  2G4Q A;  3D4S A;  4IAT A;  1OUH A;  3DN1 A;  1F0W A;  233L A;  127L A;  2B6W A;  4G4C A;  4X3B A;  1C6D A;  1GF6 A;  3SB7 A;  143L A;  6LYZ A;  4I7Q A;  5KXM A;  1L50 A;  4HTN A;  4OW1 A;  1G07 A;  4XJF A;  4WO9 A;  1QUD A;  207L A;  3TXK A;  4NGJ A;  182L A;  1D3F A;  1G06 A;  4WMG A;  3A90 A;  2B7X A;  1UC0 A;  1LI6 A;  1CTW A;  4WG7 A;  4DT3 A;  185L A;  1XGP C;  1BB3 A;  3VWO A;  1LJE A;  1T8G A;  4H9E A;  2CJL A;  4LDO A;  5KXS A;  1GFK A;  1T6H A;  5DLA A;  5A3Z A;  5KXT A;  4YOP A;  1LSA A;  2BLX A;  1JSE A;  1PQJ A;  4HP0 A;  2W1L A;  5KXX A;  4WL7 A;  3K3T A;  1REX A;  243L A;  4XN6 A;  4YX7 C;  4G49 A;  1N4F A;  1QTV A;  1G0K A;  137L A;  1CV6 A;  1GF3 A;  1L54 A;  1L11 A;  152L A;  2H9K A;  234L A;  1SWY A;  1LJG A;  4AGA A;  112L A;  4ETB A;  4GRV A;  4WL6 A;  4IAS A;  1NKH A;  1L64 A;  4HV1 A;  2YBL A;  4GN4 A;  247L A;  3LYZ A;  3P64 A;  4NGY A;  2W1M A;  4ARP A;  4I0C A;  2HTX A;  4LFP A;  161L A;  172L A;  1D0K A;  1HFX A;  1CUQ A;  1D6P A;  125L A;  215L A;  4ARM B;  2LCB A;  3SB6 A;  3M3U A;  2HU3 A;  1UBZ A;  1D0M A;  1OVH A;  4TTD A;  1T97 A;  1TCY A;  3FA0 A;  4NHT A;  5HMV A;  1DYA A;  5LVG A;  1YIL A;  213L A;  1C6J A;  4R6C A;  2ZQ4 A;  5LXW A;  217L A;  2B6Z A;  1C67 A;  2Z18 A;  2BQM A;  2QAR C;  4H91 A;  4EPF A;  3HH5 A;  2ZYP A;  2RB1 X;  1WTM A;  3W6F A;  2OU9 A;  4WLY A;  3PDS A;  5FEL A;  3DN3 A;  2BQJ A;  1HFZ A;  4HJV A;  3LZ2 A;  199L A;  1OV7 A;  3CDR A;  1P3N A;  1DYF A;  3W6A A;  1C69 A;  2Z37 A;  4PPO A;  4DYG A;  3HUK A;  1GFV A;  1L19 A;  1HFY A;  3BKV A;  1DI3 A;  1WQO A;  5ILC A;  1ALC A;  1C6Q A;  4GN3 A;  1GBW A;  4OWH A;  1YAN A;  1IOQ A;  5EBH A;  3DN8 A;  1JWR A;  4LGK A;  4NSH A;  1LYG A;  4Z41 A;  1KXX A;  1L75 A;  5F14 A;  2RBS A;  210L A;  1L81 A;  2EIZ C;  5M1Y A;  1LPY A;  1UIF A;  3A8Z A;  7LYZ A;  1CU6 A;  5FEK A;  142L A;  1DZB X;  1OVJ A;  3HTG A;  4Z98 A;  1C6H A;  1L67 A;  1LSE A;  2CDS A;  1CV3 A;  1LPI A;  2DQI Y;  3C8Q A;  4B4I A;  3HT9 A;  3A92 A;  2BLY A;  3HDF A;  4ARM A;  1GAZ A;  3W6E A;  1L40 A;  1IIZ A;  1JTT L;  1L05 A;  4ANR A;  2MEE A;  5LYM A;  1GB0 A;  1REZ A;  1ZV5 L;  1I20 A;  1C7P A;  1IO5 A;  1CVK A;  5LYT A;  5L3I A;  1D6Q A;  4NGW A;  1W08 A;  1CUP A;  4YF2 A;  1LSY A;  1IWU A;  171L A;  3TXG A;  1CX6 A;  2RBN A;  1D0L A;  1BWJ A;  1J1P Y;  5I5Q A;  1WTH A;  2G4P A;  1YKX X;  2FBB A;  1K28 A;  3BKH A;  3AZ4 A;  1LYS A;  1L87 A;  4LT1 A;  4W94 A;  5LVH A;  1YIK A;  4NGI A;  1GFA A;  1XEI A;  1L34 A;  1OUE A;  1L74 A;  1LWG A;  4EMN A;  5J7C A;  2Z38 A;  4I7P A;  3RW8 A;  1LYO A;  2DQC Y;  1C62 A;  1LZA A;  177L A;  2ANX A;  149L A;  2ZQ3 A;  3CDQ A;  3NY8 A;  2B6Y A;  1C61 A;  4H1P A;  1GD6 A;  3FE0 A;  1UIE A;  1JIY A;  3ULR A;  1PS5 A;  254L A;  6LYT A;  186L A;  2WAR A;  1LMN A;  1DYB A;  2OU0 X;  1IP2 A;  1LYD A;  4DQJ A;  104L A;  1G0G A;  3TMX A;  5LIO A;  1OUA A;  4QGZ A;  4NHQ A;  3HUA A;  3A3Q A;  1LMQ A;  1GE1 A;  3G3W A;  5APD A;  1CJ6 A;  3SB5 A;  1DKJ A;  2DQA A;  3CQL A;  1E8L A;  1L58 A;  1UID A;  1L08 A;  4UWV A;  1LJI A;  4I7N A;  1PQI A;  3E3D A;  1GFG A;  2YVB A;  4CJ2 A;  1L94 A;  4E97 A;  3B0O A;  1L18 A;  1L72 A;  3OE8 A;  5C6I A;  2YSS C;  4WM6 A;  1L0J A;  3WU8 A;  1CV5 A;  2BQO A;  3HH3 A;  122L A;  4L41 A;  1NQI A;  4LDE A;  1OWZ A;  4B0D A;  3GXR A;  4WLT A;  4YM8 A;  3VW7 A;  4H9B A;  256L A;  4NSI A;  1IWW A;  1IY4 A;  244L A;  4ARJ A;  4I7J A;  109L A;  3CSQ A;  4GBR B;  1HEO A;  1LJ4 A;  128L A;  5FCP A;  2OE7 X;  4N1E I;  4YXC A;  2B73 A;  1IOS A;  3HT7 A;  4DD2 A;  1JKC A;  1C6E A;  1L84 A;  3CB7 A;  1L90 A;  1PQO A;  1LHL A;  5KJ9 A;  4KL7 A;  4LT0 A;  4W53 A;  3NYA A;  174L A;  2F32 A;  245L A;  4HPI A;  3HTB A;  2F30 A;  4DD1 A;  1NDG C;  3WVX A;  1G7J C;  1LSB A;  2BQF A;  1YQV Y;  1L49 A;  235L A;  2IHL A;  148L E;  1QUT A;  1MEL L;  1D2Y A;  1IWT A;  1L13 A;  5KXW A;  1GXV 2;  218L A;  1LMA A;  4MST A;  223L A;  4YXA C;  1JSF A;  4GCB A;  145L A;  1ZVH L;  1C45 A;  1C46 A;  1FBI X;  1OUC A;  1UIB A;  1C65 A;  3OJP A;  2LYM A;  4CHX A;  1OUJ A;  1L0K A;  2EQL A;  3DMZ A;  1B7P A;  1OUG A;  1HNL A;  4OWE A;  4H8X A;  4I7R A;  1VFB C;  3HWL A;  1UCO A;  1LMP A;  3OK0 A;  181L A;  1C6K A;  230L A;  5KXY A;  2DQF C;  1SLY A;  5KXZ A;  1AM7 A;  1BGI A;  1B7O A;  4IJ4 A;  2X0A A;  1DI4 A;  2NTH A;  5HQ1 A;  249L A;  2RBP A;  1QSQ A;  1VDS A;  1L20 A;  1C6T A;  2AUB A;  3G3A B;  1L91 A;  4XJI A;  5F9U A;  1P7S A;  1P46 A;  173L A;  1L55 A;  3WVY A;  1IP3 A;  237L A;  1LJ3 A;  4GCC A;  131L A;  258L A;  2A4T A;  3HH4 A;  3TXF A;  4ETD A;  4B4E A;  175L A;  5JEN B;  1YKZ X;  1C43 A;  1AKI A;  1L57 A;  9LYZ A;  3LHM A;  1CV1 A;  4RDS A;  1QTE A;  2BQN A;  1LTM A;  5LA8 A;  1L47 A;  3SN6 R;  1LMC A;  1L21 A;  4A7D A;  2D4J A;  238L A;  1LYZ A;  1L98 A;  3W3E A;  1L15 A;  3CT0 A;  1L85 A;  4LYB A;  1GBX A;  1I56 A;  1XGU C;  1OUB A;  1GHL A;  103L A;  3EML A;  1IC7 Y;  4ARL A;  4KPM A;  4NIJ A;  4OO9 A;  5F81 A;  2RSC A;  5LYZ A;  1YL0 X;  1QTD A;  1LZT A;  4HTK A;  1FDL Y;  1B0D A;  1RE2 A;  4QY9 A;  1C6A A;  3LYT A;  1L92 A;  4LT2 A;  1IWV A;  4LZT A;  4NWE A;  3A96 A;  1L70 A;  4ETE A;  1OUI A;  3A34 A;  1XJU A;  1L89 A;  1GFR A;  188L A;  1OVK A;  1QTK A;  2XBR A;  251L A;  1F6R A;  1FN5 A;  170L A;  5KY1 A;  2HED A;  4WM3 A;  5KXK A;  140L A;  1ZWN A;  3HUQ A;  3B0I A;  1QUG A;  2ANV A;  1L97 A;  1C60 A;  167L A;  1KY0 A;  3GXK A;  1CX7 A;  1P2C C;  1GB8 A;  239L A;  3L64 A;  1FKQ A;  1L44 A;  1G0Q A;  1LZB A;  4NSJ A;  240L A;  2MEA A;  1L38 A;  1L65 A;  1C64 A;  1L33 A;  3WW5 A;  3A95 A;  1LJN A;  4M4O A;  4CFO A;  1FLY A;  1TEW A;  1KXY A;  1KIQ C;  1L12 A;  3WXU A;  2HUB A;  1PQD A;  3HFM Y;  2YBN A;  1YKY X;  1B7L A;  4OOO A;  227L A;  4XJG A;  3TMW A;  4BAD A;  1A2Y C;  1HER A;  1LMT A;  2MEC A;  1CKC A;  168L A;  1WQP A;  216L A;  1D3J A;  4WO6 A;  1KNI A;  3L2X A;  3V2Y A;  113L A;  1G1W A;  1L52 A;  1WQQ A;  1BB5 A;  1C6N A;  3CT5 A;  1KS3 A;  4WLD A;  1TAY A;  3GUJ A;  1L99 A;  1LLH A;  5IEL A;  3OE0 A;  5DM9 A;  4EPI A;  1G7I C;  4J1A A;  4TUN A;  1IOC A;  3C82 A;  4DD9 A;  1G0P A;  1JTO L;  4I7T A;  3IJU A;  4HV2 A;  1QS9 A;  4UWU A;  1QIO A;  4BS7 A;  3D3D A;  1LKR A;  8LYZ A;  262L A;  1LJK A;  1JKB A;  190L A;  4I7L A;  1JEF A;  2BQG A;  1DYE A;  169L A;  4Z3M A;  5B06 A;  1F10 A;  2I26 L;  2MEG A;  2RB0 X;  1LI3 A;  1LYH A;  255L A;  1PQK A;  1REY A;  4W54 A;  1L76 A;  1FLW A;  4QEQ A;  3RU5 A;  1L41 A;  1V7S A;  2C8O A;  3LZM A;  1L46 A;  3TXJ A;  3P66 A;  134L A;  1CJ9 A;  4QDN A;  4J7V A;  2B70 A;  2BQB A;  3P4Z A;  3GUL A;  3HBE X;  2BQA A;  4EKQ A;  2Y8P A;  1P2R A;  178L A;  1PZY A;  3A6C Y;  4W51 A;  4Z46 A;  3DN0 A;  1L03 A;  1RI8 B;  2HEA A;  3AW6 A;  4MR1 A;  4ETC A;  1WQN A;  2RBQ A;  1L36 A;  3T36 A;  4OWC A;  3EO5 A;  4H9I A;  1L61 A;  1CU3 A;  5B59 A;  1C6M A;  3B72 A;  1CKH A;  1JJ0 A;  1OWY A;  3AJN A;  2HUK A;  4G4H A;  6LZM A;  1L24 A;  5B07 A;  3NY9 A;  1QSW A;  1C68 A;  1IC5 Y;  4EOF A;  4OWA A;  1L48 A;  1TBY A;  4W57 A;  1L22 A;  1L69 A;  1LWK A;  4LDL A;  3WUA A;  1VDQ A;  3HU8 A;  1OUD A;  1GF5 A;  4W55 A;  107L A;  3ZEK A;  1GB9 A;  4S0W A;  205L A;  189L A;  1DPW A;  1LSZ A;  3SBB C;  5ILF A;  3LN2 A;  1GXX A;  1LZR A;  4NWH A;  4R0F A;  1C10 A;  2G4N A;  4OOT A;  1B5W A;  1NHE A;  1AT5 A;  5IHG A;  1XJT A;  2BQI A;  4DQ7 A;  4PRU A;  4TSB A;  3IJV A;  2Q9E A;  5A3E A;  4KXI A;  4RLN A;  5LVI A;  1T6V L;  1QSA A;  4C3W A;  4XJH A;  3ATO A;  3D9A C;  1GB6 A;  2LZT A;  4W96 A;  2YBI A;  4W59 A;  4DAJ A;  1OV5 A;  3DKE X;  4N0J A;  1CU2 A;  2BQC A;  2HUM A;  2RH1 A;  1IEE A;  5DN5 A;  1LGU A;  2L78 A;  4PJZ A;  1DKK A;  4WG1 A;  1OQM A;  5C6L A;  1B5X A;  1HEN A;  1YAM A;  4C5F A;  166L A;  236L A;  1LYF A;  1IP1 A;  3F8V A;  3AGI A;  4I7O A;  1C6C A;  4W58 A;  4HPE A;  5E4P A;  5I53 A;  5B1G A;  3RZE A;  1XEP A;  4I7M A;  1VAT A;  1GB7 A;  1SX7 A;  2Q9D A;  2EKS C;  1CNS A;  3SB8 A;  1C08 C;  1LSP A;  1P2L A;  4EJ4 A;  4G9S A;  1P37 A;  1UIH A;  1DXJ A;  1CKG A;  3J4G A;  4M6D A;  3CSR A;  4NSG A;  1L16 A;  1ZUR A;  1L53 A;  1L17 A;  4G4B A;  4ET8 A;  1L37 A;  3C80 A;  1XEK A;  2RAY X;  212L A;  1LYJ A;  3AZ7 A;  2MEF A;  1B5V A;  198L A;  1JJ1 A;  1GEV A;  4U3X B;  3WH1 A;  4DD7 A;  1G7M C;  4H94 A;  2XQO A;  1DI5 A;  1XGT C;  2BQK A;  1YL1 X;  1P6Y A;  1B2K A;  1QT8 A;  1L26 A;  1DPX A;  1LI2 A;  5LAF A;  1LSG A;  1B7N A;  163L A;  1BB6 A;  1NHB A;  1L51 A;  1LW9 A;  1L45 A;  156L A;  4UWN A;  3QNG A;  5FDJ A;  1GWD A;  3EBA B;  1LSD A;  183L A;  3RZ4 A;  1LGX A;  4FJR A;  1LJJ A;  1WTN A;  1T8F A;  3F9L A;  5KKI A;  115L A;  1HMK A;  2FBD A;  3K2R A;  5I14 A;  1LZS A;  1I6S A;  1IP7 A;  1KXW A;  1CV0 A;  1UUZ C;  3P68 A;  4NG1 A;  1LJH A;  3M18 B;  2Z6B A;  2Z2F A;  1WVU A;  226L A;  1YAP A;  4DDB A;  1L42 A;  4N5R A;  1NWG A;  219L A;  1J1O Y;  2LZ2 A;  1XGQ C;  1XEJ A;  3A6B Y;  1P36 A;  2ZIL A;  5LVJ A;  201L A;  135L A;  4NGO A;  1L14 A;  3MGW A;  2A7D A;  1LSM A;  225L A;  4DDC A;  4HJZ A;  4GCD A;  1GFH A;  4ZEE A;  2YBH A;  4ZIX A;  2C8P A;  3AGG G;  2DQD Y;  165L A;  4NEB A;  2HEB A;  5L9J A;  1GFJ A;  1L06 A;  1H6M A;  2YBJ A;  4H93 A;  1H87 A;  1UA6 Y;  1NF5 A;  1HSW A;  2XTH A;  2B6T A;  4TX7 A;  1CKD A;  4LFX A;  3WPL A;  1GBY A;  4GLV A;  2I6Z A;  3WUN A;  4TWS A;  1L02 A;  155L A;  4FDY A;  1P5C A;  2RB2 X;  1GF8 A;  3SP3 A;  1L95 A;  2OTY X;  3C8R A;  1G0L A;  1HSX A;  4N1C C;  1QDT A;  2ZNW Y;  1L30 A;  1EQ4 A;  1GE4 A;  4RLM A;  2A7F A;  2MED A;  5LVK A;  3DN6 A;  4O34 A;  154L A;  1CU5 A;  1L83 A;  3AW7 A;  1JIT A;  2FYC A;  1IP4 A;  3C8S A;  3HBD A;  2CWI A;  1CV4 A;  1L80 A;  2LYO A;  1BVK C;  2HEE A;  3EMS A;  1IP5 A;  4WM4 A;  1L96 A;  1LYI A;  2NTG A;  209L A;  1L28 A;  1LZD A;  3GUK A;  3KAM A;  1QT5 A;  1L27 A;  1L31 A;  3UON A;  1MLC E;  126L A;  1LJF A;  5E9R A;  1LCN A;  3B0K A;  4P2E A;  2D4K A;  1LYY A;  1JJ3 A;  1RCM A;  222L A;  3WU9 A;  1JQU A;  2ZIK A;  2LC9 A;  4GLA A;  4YEM A;  3G3B B;  3WUM A;  4PRQ A;  2B6X A;  1L93 A;  231L A;  1IVM A;  3LYO A;  1BB4 A;  1BQL Y;  3PBL A;  1OP9 B;  4D9Z A;  3WL2 A;  4J0L A;  3N9C A;  3V2W A;  2LHM A;  4GN5 C;  1HEM A;  141L A;  1GAY A;  1GF4 A;  1WVV A;  2B74 A;  133L A;  4GCF A;  5I4W A;  108L A;  3G3V A;  4CGE A;  3A94 A;  5HLL A;  2OU8 A;  1REM A;  4AQN A;  1CJ7 A;  5FHW A;  3IWR A;  2D91 A;  4B49 A;  4LYM A;  5LZM A;  3TXI A;  151L A;  3C7Z A;  196L A;  4PJ2 C;  1B5Y A;  4B4J A;  4DQ5 A;  2RAZ X;  1L07 A;  1LZE A;  1HML A;  1QT4 A;  3TXB A;  2Z12 A;  1V7T A;  1LHI A;  3HTF A;  1GDX A;  1L66 A;  1UIA A;  2FYD A;  147L A;  1WQR A;  1UIG A;  1ZVY B;  4NGV A;  1EQ5 A;  1YAO A;  1RFP A;  2DQJ Y;  1FKV A;  1C6P A;  1QTC A;  1JTN A;  4LYZ A;  4NGZ A;  2OE9 X;  3WMK A;  157L A;  1L62 A;  5D5C A;  4BAP A;  4ET9 A;  1JTP L;  4ARQ B;  1IWY A;  123L A;  2HEF A;  2Z39 A;  3DN4 A;  1LKS A;  208L A;  1L01 A;  4LYO A;  3HU9 A;  4MCK A;  5I4Y A;  110L A;  4E3U A;  241L A;  1O23 A;  4ZFP A;  4HTQ A;  1LZN A;  5B1F A;  2H5Z A;  4WOA A;  3TXE A;  1GEZ A;  1IP6 A;  1L79 A;  4H8Y A;  4XAD A;  1LHH A;  1F6S A;  1LZ8 A;  4H9A A;  3ZVQ A;  1D2W A;  129L A;  1BB7 A;  1LZG A;  5APE A;  1DYD A;  2B72 A;  3B6L A;  3AB6 A;  4EKS A;  3SBA A;  1L09 A;  4YEN A;  1LHK A;  4B1A A;  1B6I A;  3W6B A;  1C6G A;  1LZ6 A;  5AMY A;  4XJD A;  1QT7 A;  1G7H C;  2IFF Y;  1QSB A;  3G3X A;  139L A;  1B7R A;  1DYC A;  1HEQ A;  5K7O A;  3CT1 A;  191L A;  1IWZ A;  4ZPU A;  1LMO A;  1GE2 A;  4PGJ B;  1GB5 A;  1TDY A;  5II3 A;  1LSF A;  2PC2 A;  1RJC B;  1NBY C;  4PK0 A;  1JKD A;  4WM2 A;  1NDM C;  1UIC A;  1HF4 A;  1CJ8 A;  1C63 A;  1LYE A;  1QTZ A;  1L25 A;  1L60 A;  1SSY A;  1L39 A;  1L23 A;  1IWX A;  3FI7 A;  3F6Z A;  1LZ5 A;  2DKV A;  2VB1 A;  1GFT A;  5HMJ A;  1DYG A;  253L A;  2MEB A;  4H8Z A;  4WM1 A;  1T8A A;  1D9W A;  4AXT A;  2BQE A;  4ARQ A;  2QB0 B;  5F9X A;  1JHL A;  2OE4 X;  4NY5 A;  5L3H A;  2RBO A;  4YEO A;  1LSC A;  1IC4 Y;  2HEC A;  4BAF A;  5IDD A;  2BQL A;  1NMM A;  4LT3 A;  3EXD A;  195L A;  1L59 A;  5DN4 A;  3GUN A;  200L A;  4H9C A;  3WU7 A;  187L A;  1BWH A;  4NG8 A;  221L A;  4IAP A;  158L A;  2ZYC A;  176L A;  2D6B A;  3W6C A;  2Z2E A;  1NBZ C;  1OYU A;  1LZ9 A;  2N5Z A;  1SSW A;  4H92 A;  2W1Y A;  1LZY A;  5KKJ A;  132L A;  1L68 A;  197L A;  1LZ4 A;  1XFP L;  1LZC A;  5C6J A;  2XJW A;  1C6L A;  146L A;  4TSC A;  1QUS A;  3ATN A;  4XJB A;  3A3R X;  2BAA A;  5KXO A;  1HEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...