221LA

The energetic cost and the structural consequences of burying a hydroxyl group within the core of a protein determined from ala to ser and val to thr substitutions in t4 lysozyme
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
162
structure length
162
Chain Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKSIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords T4 LYSOZYME
publication title Energetic cost and structural consequences of burying a hydroxyl group within the core of a protein determined from Ala-->Ser and Val-->Thr substitutions in T4 lysozyme.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 59
structure length 162
sequence length 162
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 1993-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 221lA00
191LA 2B74A 1G1VA 247LA 1B6IA 1L90A 1D3NA 1L67A 2OE7X 1CU0A 215LA 187LA 1PQOA 1L50A 1DYCA 168LA 1PQKA 1QUOA 4DKLA 112LA 1L51A 3SB7A 1QTDA 2B6ZA 3RUNA 1SSYA 146LA 4PK0A 1QTZA 2B70A 1L73A 2RBOA 3HUQA 1EPYA 1L29A 3V2YA 2HULA 3C81A 1LGWA 143LA 1C6MA 1LI3A 2OTZX 217LA 261LA 2NTHA 1OWYA 3GUPA 1L17A 1L68A 1P7SA 212LA 1L24A 4S0WA 1SX7A 1L93A 3FI5A 174LA 1D3MA 222LA 245LA 1KS3A 3HT9A 1L49A 138LA 1P6YA 4ARJA 1L45A 4YXAC 1L19A 1L97A 3HTBA 1L18A 2A4TA 1QUDA 258LA 1L53A 1L66A 162LA 1LYDA 188LA 1LWGA 1P5CA 1C6EA 140LA 1L09A 226LA 2B6TA 1KW7A 2RBSA 151LA 110LA 4ARQA 1G06A 1XJUA 3CDOA 144LA 1G1WA 149LA 1LW9A 3DN0A 2B6YA 238LA 227LA 3DNAA 1C67A 3RZEA 3DKEX 236LA 2F2QA 254LA 1XEPA 1C6BA 1CUPA 1DYAA 1QT3A 2O79A 2ANXA 1L86A 4EKSA 175LA 3G3XA 3OE6A 3DMZA 225LA 1C6LA 1ZWNA 181LA 190LA 103LA 1C6IA 1L96A 1OV7A 102LA 2Q9EA 2RB1X 3CDRA 1LYIA 4I7JA 260LA 115LA 4ZPUA 1L60A 1L74A 262LA 1L55A 5LZMA 1QT7A 1QT5A 1P36A 1C6GA 232LA 210LA 2IGCA 3HDEA 1CU6A 2B7XA 147LA 1L92A 3GUMA 3C7ZA 1L28A 1I6SA 3C7WA 211LA 1L12A 1T8FA 3HTGA 1L71A 1T8AA 1NHBA 186LA 1L98A 2Z6BA 7LZMA 4EKQA 1OWZA 2OU8A 1CV4A 4I7LA 1C6KA 1CVKA 1G0KA 1L06A 233LA 109LA 1T97A 3SB6A 242LA 118LA 1L26A 256LA 1L38A 1SSWA 3CDQA 259LA 2B72A 1L64A 1C6DA 1DYEA 141LA 4W56A 111LA 1CV5A 3VW7A 1KY0A 3FA0A 1PQIA 2HUMA 1ZYTA 3HWLA 108LA 164LA 1L52A 1QT6A 1TLAA 4I7OA 1JTNA 1L72A 3GUIA 165LA 1QT4A 128LA 4DAJA 1L23A 2RAYX 1L02A 1QT8A 1C60A 1L89A 1G07A 1D2WA 1QTVA 4EPFA 1DYBA 1L13A 1L47A 1LLHA 4OO9A 166LA 2OTYX 4ARPA 2F47A 4ARQB 2L78A 1CUQA 1CU3A 3ODUA 1L00A 1C6JA 3LZMA 155LA 1QUGA 3HH3A 253LA 3C80A 1L20A 1P3NA 2QARC 1L16A 1L33A 1L46A 4W52A 4YX7C 3PDSA 3CDVA 123LA 3L2XA 1L0JA 4LDLA 159LA 1PQMA 1P2LA 241LA 142LA 1CU5A 1QTCA 216LA 1DYDA 219LA 2LC9A 3SB5A 1L08A 1C6QA 251LA 1L10A 1L30A 1WTHA 1L88A 173LA 4EPIA 130LA 198LA 1L36A 1L69A 160LA 3D4SA 2F32A 206LA 218LA 1L65A 113LA 1SWZA 3HT7A 2RBNA 2B75A 1OVKA 1L57A 248LA 1SX2A 2RB2X 1D3FA 3DMVA 1L31A 4W55A 1L70A 4IAPA 120LA 1C61A 1KNIA 1L22A 250LA 1L11A 3HH5A 3GUKA 1CX6A 3DN1A 1LGXA 257LA 3CDTA 150LA 5I14A 2HUKA 1D2YA 1L75A 184LA 127LA 1SWYA 1L99A 1C6AA 119LA 1C65A 2RBRA 3DN2A 3SBAA 2OE9X 1L21A 3HH4A 1C6TA 240LA 3DN6A 201LA 2LCBA 2Q9DA 4I7PA 157LA 1L83A 4E97A 252LA 3HTFA 1L54A 1CTWA 1G0JA 3C83A 1C68A 1L43A 2OE4X 1L62A 192LA 1L01A 1L79A 3GULA 3OE8A 129LA 104LA 1G0GA 1L94A 3EMLA 4I7TA 4I7QA 1L41A 185LA 1L04A 3UONA 3C82A 4W54A 228LA 1G0LA 3DMXA 145LA 1CV6A 1K28A 213LA 3K2RA 199LA 1QSBA 2ANVA 4I7MA 1G0PA 3DN8A 4LDEA 4ARLA 3HUKA 1G0QA 3NYAA 1CU2A 3GUOA 172LA 4LZMA 1LI2A 1PQJA 1L35A 2RBQA 4ARMA 1P46A 1DYGA 1L58A 3V2WA 243LA 1L91A 1OVHA 3OE9A 4DJHA 1C6NA 126LA 1L48A 2RBPA 3DN3A 3DN4A 170LA 1XJTA 1L61A 3HT8A 4PJZA 156LA 4EKRA 3QAKA 196LA 1QTBA 158LA 1KW5A 3G3VA 1L82A 1P64A 1QTHA 1LPYA 1QS5A 2OU9A 1L25A 1P2RA 4YXCA 1L40A 1T8GA 189LA 183LA 1L05A 1P56A 1JTMA 107LA 4EJ4A 1L14A 3C8RA 209LA 3C7YA 223LA 1L32A 1LYHA 1CV1A 1L84A 171LA 1C6HA 1C6CA 220LA 1C6FA 1LYJA 1L81A 1KY1A 1L0KA 3NY9A 122LA 2CUUA 229LA 4AQNA 1L34A 1L76A 4LDOA 3SBBC 1QS9A 4K5YA 152LA 237LA 1LI6A 167LA 1L44A 4W53A 1LYGA 200LA 1L77A 1P37A 230LA 3HTDA 4GBRB 3GUJA 177LA 1OVJA 1QUHA 4I7SA 1L42A 244LA 2QB0B 2OEAX 3HU9A 1C63A 214LA 1L27A 1L63A 1D3JA 2B6WA 1C69A 234LA 161LA 3PBLA 231LA 137LA 4EKPA 1G0MA 3OE0A 125LA 4I7NA 1L80A 1CX7A 1L03A 2RH1A 3GUNA 2RAZX 4GRVA 178LA 1OV5A 3C8SA 1L07A 4W51A 2RB0X 195LA 2NTGA 2LZMA 1L15A 2B73A 1L85A 1LWKA 3SB8A 197LA 4ARMB 1C62A 1DYFA 3JR6A 1L39A 224LA 148LE 1D9WA 131LA 176LA 1JQUA 249LA 246LA 205LA 169LA 4W59A 1L59A 180LA 163LA 3SN6R 3NY8A 3C8QA 1QSQA 3F9LA 3FADA 3HT6A 1C6PA 3L64A 1L95A 1C64A 114LA 1T6HA 4W57A 139LA 2O4WA 3HU8A 1C66A 3HUAA 1L56A 1L87A 1LYFA 221LA 239LA 1ZURA 1LYEA 4I7KA 2OU0X 235LA 2B6XA 3F8VA 4I7RA 1OYUA 1PQDA 4EXMA 3HH6A 2O7AA 1L37A 255LA 3HDFA 3SB9A 182LA 1CV3A 4W58A 1CV0A 6LZMA 3G3WA 1LGUA
chains in the Genus database with same CATH superfamily
1DPWA 2B74A 2MEGA 4WL7A 3LHMA 1B6IA 4RLNA 1D3NA 1L67A 1CU0A 4NHTA 1DYCA 4DKLA 1ZVYB 1B5XA 3SB7A 4UWUA 2B6ZA 3E3DA 1GE1A 1UICA 1QUTA 146LA 5IELA 1QTZA 2B70A 2LYMA 4LYTA 1HFZA 3C81A 1LGWA 2OTZX 2ZIKA 1B5YA 2BQGA 1L68A 1UIHA 1VDTA 1IO5A 1L24A 4XADA 2XBRA 4H8YA 1SX7A 1L93A 1QTKA 1HEOA 4TWSA 1KS3A 1LSZA 2FBBA 4MSTA 1L45A 1GFHA 1L97A 3HTBA 1QUDA 2NWDX 1Z55A 3A96A 1LYDA 1LWGA 1C45A 1C6EA 1B2KA 151LA 110LA 1G06A 5FDJA 5LIOA 3DN0A 3F6ZA 5HMJA 4J1AA 3RZEA 1LSPA 4GLVA 1QDTA 236LA 1CKDA 2F2QA 1HSXA 1WVUA 3RW8A 5LINA 4PPOA 1L96A 2Q9EA 4I7JA 1NBYC 5C6JA 260LA 115LA 4U3XB 3WL2A 1L60A 262LA 4RDSA 3K3TA 5APFA 5LZMA 1JKCA 4NSHA 4ANRA 4AXTA 2BQFA 3W6EA 1CU6A 147LA 3GUMA 1I6SA 2Z2FA 1LZBA 1JWRA 1GB8A 4YEMA 1FBIX 1YILA 1GB3A 4EKQA 1CVKA 1G0KA 4QGZA 5KXOA 1DI4A 118LA 1GB9A 1L38A 1SSWA 3CDQA 259LA 1DYEA 5LA5A 1LZSA 4H9BA 1GB2A 1V7SA 207LA 164LA 1L52A 4I7OA 4MCKA 1JTNA 165LA 1XEJA 1IOCA 1C60A 4GCDA 1G07A 1L13A 4W96A 1IP7A 4TUNA 1LLHA 166LA 2OTYX 4ARQB 3AW6A 4G4HA 2DQCY 4WLDA 5C6IA 1CU3A 5F14A 3AZ7A 155LA 2LYOA 3AZ5A 1LZ1A 1P3NA 2QARC 1L33A 1O23A 4WL6A 3PDSA 4YM8A 3L2XA 3MGWA 3T36A 4H90A 2BQIA 1LHMA 3AZ4A 1D9UA 2H9KA 1IP4A 1NWGA 1WTHA 173LA 4EPIA 1UC0A 5KXKA 3TMUA 2RSCA 3LYTA 3HT7A 2RBNA 248LA 2RB2X 3DMVA 1L31A 1D0KA 4PRQA 1KNIA 3LN2A 4E3UA 4H94A 3A67Y 2MEHA 3HH5A 1CX6A 257LA 3A3QA 2F4AA 4OOOA 4PGJB 1A2YC 4G4CA 3BKHA 2Q9DA 3WPLA 4TSBA 3HTFA 3RU5A 3WPKA 1G0JA 2OE4X 1L79A 3OE8A 1D6PA 1IP5A 1GDXA 2HEEA 1G0GA 1L94A 4DD3A 4I7TA 1ZV5L 2EPEA 1JSEA 4NY5A 4W54A 228LA 1G0LA 3DMXA 145LA 1CV6A 1K28A 1QSBA 2YBIA 2BQOA 4ARLA 3WYHA 3VWOA 4DQ5A 5APEA 1LI2A 4HPIA 1BWHA 2RBQA 134LA 1DYGA 3W6CA 3V2WA 243LA 2RBPA 1N4FA 3A92A 4GN4A 4HTKA 3QAKA 2CDSA 2Z39A 3WUAA 1GB7A 1LSGA 4HTNA 5LVIA 4LYMA 1P64A 4NG8A 4HJVA 1B7MA 3WXUA 1I20A 3WVXA 1LCNA 4WLYA 183LA 4WLXA 1V7TA 1L05A 4DD1A 3C7YA 1KIPC 1D0LA 2MEIA 2BQKA 2EIZC 1L84A 4UWNA 171LA 2BQAA 220LA 4WM5A 1IOQA 2DQDY 1BVKC 3ATOA 3W6DA 5FCPA 1INUA 1L34A 1LAAA 1T6VL 3OJPA 4LDOA 4ETAA 152LA 237LA 1LI6A 1L44A 3TMVA 1JUGA 1C46A 1LYGA 200LA 1GBXA 1JTTL 3WU9A 3GUJA 5F81A 2W1LA 1QUHA 1WQOA 244LA 1FDLY 1UIFA 1GBWA 3HU9A 4GN3A 214LA 1L27A 2ZIJA 1D3JA 2B6WA 2LZ2A 2MEAA 161LA 231LA 4CGEA 1IIZA 3AYQA 4EKPA 1L80A 1CX7A 1L03A 4ET8A 2EKSC 4NSIA 1L07A 195LA 2PC2A 1REYA 1L15A 2YSSC 4LYOA 4WM1A 4WM2A 1HENA 3SB8A 4ARMB 1DYFA 5ILFA 3EMSA 148LE 1D9WA 176LA 1JQUA 3TMWA 1JJ0A 163LA 2DQJY 4J1BA 4NGOA 1WQQA 4W57A 1WTNA 1LMOA 1ZVHL 4NGKA 1L56A 221LA 1G7JC 1GWDA 1LKSA 4KPMA 3HH6A 1JTOL 5F16A 1A4VA 3CSZA 194LA 2DBTA 2LZTA 1CV0A 1DPXA 5LVGA 1VAUA 4B4JA 5LAGA 1CJ9A 4BAFA 247LA 4B0DA 1GFGA 2OE7X 187LA 1PQOA 3AW7A 1IWUA 1PQKA 2ZYPA 1QUOA 1YIKA 112LA 3TXDA 1LJHA 4PJ2C 4B1AA 1OUIA 1JKBA 2HEAA 4PK0A 3HBHA 1L73A 2RBOA 4ET9A 1L29A 4GLAA 143LA 217LA 1LZ9A 3G3AB 4S0WA 4BS7A 1D3MA 1W6ZA 245LA 1IP2A 1GF0A 1L49A 138LA 1P6YA 4ARJA 4YXAC 3QY4A 1XEIA 1OUDA 4IJ4A 2A4TA 258LA 3EXDA 1L66A 5C6LA 2BQLA 188LA 1HMKA 1P5CA 140LA 1L09A 1GE0A 2B6TA 1KW7A 149LA 1LZTA 238LA 2DQIY 3WU7A 1YROA 2ZNXY 1XGPC 1LSAA 1GD6A 1XEPA 4XN6A 1CUPA 1DYAA 2CGIA 3CT0A 208LA 1QT3A 2ANXA 4GCFA 175LA 2Y8PA 1VDQA 3DMZA 225LA 4G9SA 1C6LA 1ZWNA 4H9EA 3P66A 3CDRA 1LYIA 2BLYA 4ZPUA 4C5FA 1XFPL 1LSEA 2D4KA 3LYOA 4LYZA 1L74A 1J1PY 4H9AA 1B7QA 2B5ZA 1QT5A 3CSQA 1P36A 153LA 232LA 1IVMA 1GB5A 1MLCE 4NGYA 1DXJA 1T3PA 3C7ZA 5T3FA 1L12A 4NGJA 1T8FA 4B49A 1J1OY 3AZ6A 2IHLA 1L98A 1CV4A 4ETCA 1WTMA 3SB6A 1T97A 2HEDA 4NSJA 3GXKA 1LZRA 1UIAA 1LJKA 1L26A 5F9XA 5M1YA 1UIGA 1YAPA 3VW7A 1YAOA 1ZYTA 4R6CA 4TSCA 4XJFA 3GUIA 4DAJA 2RAYX 1RFPA 1IWWA 1D2WA 1LZEA 4GN5C 5B1GA 4OO9A 5KXMA 4ARPA 4RW1A 1JSFA 1CUQA 1TEWA 3RT5X 1L00A 1C6JA 3HH3A 4N5RA 1L20A 1L16A 4W52A 4N0JA 4LDLA 3IJVA 1PQMA 241LA 1G7IC 4YENA 1QTCA 1DYDA 6LYTA 4P2EA 1GFKA 2AUBA 1L08A 4DD2A 1L10A 1L30A 4YEOA 2MEDA 1NF5A 1B0DA 3W6AA 1L36A 4NWEA 160LA 1LHIA 132LA 218LA 1L65A 113LA 3ZVQA 1YQVY 1IWXA 4W55A 1L70A 120LA 1IEEA 4Z41A 4H9IA 1AKIA 1HEQA 2ZYCA 4XYYA 1GB0A 1LHHA 1GE2A 127LA 1NDGC 3N9AA 2RBRA 2OE9X 5DL9A 5B59A 1C43A 5B05A 240LA 3WMKA 1UIBA 5I4YA 1LJGA 4WOAA 4I7PA 1RE2A 3TMXA 1C7PA 1B5ZA 1L83A 1CTWA 1MELL 3P68A 1C68A 1L62A 3GULA 1GDWA 1L01A 3EBAB 3SP3A 129LA 1LZNA 1JJ1A 104LA 1LZYA 1LSYA 2XBSA 2Z2EA 3EMLA 1DZBX 185LA 3UONA 1HC0A 5KXXA 1B7RA 3K2RA 1HNLA 2ANVA 4OWAA 4N8ZA 1CU2A 4WM3A 172LA 1PQJA 1L35A 1LJ4A 1P46A 3CT5A 1L58A 3A6CY 1CJ6A 1LTMA 4DJHA 126LA 1L48A 3DN4A 1WQPA 3HT8A 156LA 4DQ7A 4EKRA 1JJ3A 196LA 1VEDA 4NGVA 1QTBA 1KW5A 3G3VA 1L82A 4WG1A 4ZEEA 5LVKA 4XJHA 2OU9A 4YXCA 1B5WA 4I0CA 189LA 1DKJA 5DN4A 2CWIA 1HELA 1P56A 1PZYA 209LA 5LXWA 5I54A 5KXNA 1CKFA 3WULA 2D91A 1LZ6A 1C6CA 4BADA 1C6FA 1JISA 1HERA 1LHJA 1UBZA 2F2NA 1LSCA 1BWIA 2N5ZA 2D4IA 1JITA 122LA 2CUUA 2FYDA 229LA 4AQNA 4Z98A 1QS9A 2MECA 4N1EI 1CJ7A 4H92A 1LYYA 1P37A 2LYZA 3HTDA 1LZAA 1F10A 4I7SA 3N9EA 4M4OA 2ZNWY 4HTQA 2A7DA 1GFAA 5APDA 234LA 3PBLA 4XJBA 5KKJA 3T6UA 3OE0A 125LA 1YKXX 4I7NA 9LYZA 2RAZX 2F30A 5I4WA 1HFXA 3C8SA 2RB0X 4D9ZA 3WXTA 2LZMA 3LYMA 2HEBA 3LYZA 1GEVA 3JR6A 2MEBA 1OUHA 3J6KA 4EMNA 4W59A 1BB6A 1L59A 180LA 1B5VA 4LT1A 114LA 139LA 2O4WA 3HU8A 1C66A 3HUAA 4DT3A 5FEKA 239LA 4NHSA 2OU0X 133LA 1GFTA 3IWRA 4WG7A 2HUBA 4BAPA 1GFEA 2B6XA 3F8VA 4I7RA 1PQDA 1RI8B 2FYCA 1GXV2 1L37A 255LA 3SB9A 5E9RA 182LA 3G3WA 4NGZA 1UA6Y 2Z38A 1G1VA 1L90A 1DI3A 215LA 1QIOA 3FI7A 2YBJA 1L50A 1L51A 5APCA 3RUNA 4DD9A 1SSYA 4LT2A 4H9FA 5FSTA 1EPYA 1I1ZA 4DDCA 1OUCA 3V2YA 2WARA 1XGRC 1C6MA 1W08A 4NIJA 261LA 3IJUA 1OWYA 3GUPA 1DI5A 1L17A 1NDMC 3FI5A 1KXYA 3HBEX 3HT9A 3WW6A 4ZFPA 3OK0A 1L53A 1QTEA 4ARQA 1XJUA 1C08C 4HPEA 144LA 1G1WA 2B6YA 4CHXA 1LJJA 3DNAA 3DKEX 1FLUA 254LA 1LSNA 3EO5A 4NGLA 5LAFA 4M6DA 2O79A 1NQIA 1L86A 3QNGA 2ZQ3A 2BQJA 4EKSA 3AGHA 4PHIA 3OE6A 1UUZC 1GXXA 181LA 190LA 5KXSA 1C6IA 1OV7A 2BLXA 3TXFA 4OW1A 3WUMA 1LMNA 1QT7A 2Z37A 1LJIA 1C6GA 1LYZA 1GBOA 5DN5A 1ALCA 3B0KA 3HDEA 4B4IA 1IC4Y 2Z19A 1L28A 1LMCA 3C7WA 211LA 3HTGA 1DQJC 2BQMA 1XGTC 3B72A 186LA 2Z6BA 7LZMA 1AT6A 1OWZA 3M18B 4I7LA 1L06A 233LA 109LA 4X3BA 1AT5A 1VDPA 256LA 2Q0MX 1LSDA 5IHGA 141LA 1EQ5A 4DD7A 4W56A 1CV5A 3TXGA 3FA0A 1JPOA 1TLAA 1D6QA 1GPQC 3BKVA 1J1XY 128LA 2LHMA 1LYSA 2W1MA 4J0LA 3WH1A 1QT8A 1L89A 1QTVA 3A95A 4EPFA 3P65A 3G3BB 3N9CA 1EQEA 1OUAA 1OUBA 3ODUA 1GF9A 1GF8A 1QUGA 253LA 3C80A 1LMQA 3CDVA 123LA 6LYZA 1L0JA 4WO6A 1GHLA 219LA 1B7PA 4I8SA 1LSMA 4ML7A 1BB5A 3P64A 2F32A 206LA 1NHEA 3WUNA 1SWZA 4GCBA 2B75A 1OVKA 1BHZA 1QDRA 1D3FA 1RCMA 2BAAA 1C61A 250LA 1L11A 1LGXA 1OUFA 3CDTA 4G49A 4HP0A 5I14A 2HUKA 4WM6A 1IX0A 1L75A 5I53A 184LA 1SWYA 1L99A 1YAQA 119LA 1REMA 3DN2A 3SBAA 1LPIA 1C6TA 4YOPA 1IR9A 2W1XA 201LA 4Z3MA 157LA 4R0FA 2I6ZA 252LA 2BQCA 2HTXA 1HEMA 4YF2A 192LA 1XGQC 1C10A 3ATNA 4LFPA 1LYOA 1HEWA 1L41A 4GCCA 1GAYA 1L04A 3C82A 2DKVA 4FDYA 2BQHA 1GF4A 199LA 1OQMA 2ZWBA 7LYZA 1G0PA 5KKIA 3W3EA 1YANA 3RZ4A 1OUGA 1LZGA 5LVJA 1REXA 1JTPL 5KXTA 4ARMA 2BQEA 4DDBA 1L91A 4W94A 2I25L 1OVHA 3OE9A 2X0AA 3DN3A 4OOTA 1LSBA 1XJTA 1L61A 1GE4A 3HFMY 4XENA 1IR8A 158LA 1JKAA 1QTHA 3WPJA 1L25A 1P2RA 1L40A 1T8GA 4NG1A 5E4PA 1QQYA 1JTMA 1IY4A 3B6LA 1L32A 1GFJA 1WQRA 2C8OA 2VB1A 1UIEA 3CQLA 4OWCA 1C6HA 4TTDA 5D5FA 1LYJA 1KY1A 1YL1X 1B5UA 1LMAA 3TXIA 4Z46A 4H8ZA 1L76A 1LHLA 1LZDA 1IWZA 4NSGA 4K5YA 5LVHA 167LA 2YBHA 1HSWA 4W53A 1L77A 154LA 4GBRB 1IOSA 177LA 1IY3A 2BQBA 1CNSA 2MEEA 1L42A 2QB0B 1YL0X 2OEAX 4N9RA 1C63A 1L63A 1JKDA 1C69A 1I56A 1GF5A 2HU1A 137LA 1ZMYL 2RH1A 3GUNA 3AGGG 1OV5A 4LGKA 4W51A 3WVYA 1L85A 1LWKA 3LZTA 197LA 3RNXA 8LYZA 4DC4A 2YBNA 1L39A 3LZ2A 224LA 131LA 1TBYA 246LA 1IP6A 4N1CC 169LA 4LFXA 1GBSA 3NY8A 4A7DA 1LJNA 1QSQA 5I5QA 1FLWA 3F9LA 1C6PA 4LYBA 2DQGY 1SQ2L 1CKGA 4DQJA 2D4JA 1LYFA 4HJZA 3CB7A 1IC7Y 2ZILA 2O7AA 3HDFA 1B7SA 4W58A 3GXRA 1LGUA 2D6BA 4EOFA 191LA 2A7FA 4CFPA 1BB4A 1B7OA 4NHQA 1H6MA 4WM4A 1G7MC 168LA 5KXLA 1LOZA 4OWBA 3A93A 1QTDA 4O34A 2Z18A 1GF7A 4H93A 1FKVA 4DWXA 1KIQC 2H5ZA 2DQEY 4WO9A 3HUQA 1OUJA 1WQMA 4KT3A 4KXIA 3CT1A 2HULA 4AGAA 1LI3A 1OUEA 3FE0A 2NTHA 1P7SA 1IWVA 1UCOA 212LA 3B0OA 5HMVA 174LA 1IC5Y 4NWHA 4XJGA 1VATA 1CKCA 222LA 2XTHA 4XJIA 1TCYA 5JENB 5KXYA 1YKYX 1L19A 5HLLA 1L18A 4PRUA 1P2CC 1CKHA 1REZA 162LA 226LA 5KXRA 2RBSA 3CDOA 1LW9A 5D5CA 1JIYA 2CJLA 2H9JA 227LA 1C67A 1HF4A 3TXEA 1C6BA 4NEBA 5IDDA 3G3XA 2I26L 2XQOA 103LA 4HJYA 102LA 2RB1X 3P4ZA 4IASA 1VDSA 4NHPA 1L55A 193LA 4OWHA 1HMLA 210LA 2IGCA 1GB6A 2B7XA 1L92A 4B4EA 3D3DA 3B0IA 3WW5A 4QY9A 1L71A 1HEPA 1T8AA 1GF3A 1NHBA 2FBDA 5B1FA 1LZ4A 4WMGA 2G4PA 2OU8A 5DM9A 4DDAA 1C6KA 1IP3A 3CSRA 4KL7A 4RW2A 242LA 4LYCA 4HV1A 5EBHA 2B72A 1L64A 4LT3A 1KXWA 4ETEA 1IP1A 1C6DA 5HQ1A 5F9UA 111LA 2W1YA 5FHWA 1KY0A 1PQIA 2HUMA 1BB3A 3HWLA 108LA 1H87A 1XSFA 1QT6A 4FJRA 1RJCB 1L72A 1QT4A 1GFUA 5KXPA 1AM7A 5DLAA 1L23A 1L02A 2YBLA 4RLMA 2YBMA 4DYGA 1DYBA 1L47A 4ETBA 1KIRC 1NMMA 1G7LC 2F47A 3A90A 1YAMA 2L78A 5A3ZA 3LZMA 1L46A 4YX7C 2Z12A 159LA 1GFVA 1P2LA 142LA 1CU5A 216LA 4XJDA 2XJWA 3A6BY 2LC9A 3SB5A 1C6QA 2DQHY 1LJEA 251LA 4IATA 1L88A 4MR1A 130LA 1IORA 1BGIA 1L69A 5KY1A 5L3IA 198LA 3ZEKA 3D4SA 2G4NA 4ETDA 1LMTA 1LJFA 4NHIA 3TXKA 1L57A 1TDYA 1SX2A 2HECA 4IAPA 5LYMA 2DQFC 2EQLA 1PS5A 2BQDA 2IFFY 1GBZA 1UACY 2DQAA 1F0WA 3GUKA 3DN1A 5LYZA 150LA 1LMPA 1D2YA 135LA 4J7VA 1C6AA 1C65A 4ZIXA 1L21A 3HH4A 1GBYA 4H8XA 5ILCA 1B7NA 3DN6A 2LCBA 5KXZA 4E97A 4H9CA 1L54A 1F6SA 3C83A 2BQNA 1L43A 4TX7A 1LKRA 1EL1A 1TAYA 5FELA 4I7QA 1IWTA 5HNCA 5KJ9A 4H91A 1GAZA 1F6RA 3HBDA 213LA 1GFRA 4I7MA 3DN8A 4LDEA 3J4GA 3HUKA 1G0QA 3A3RX 3NYAA 1FLYA 3TXHA 1LZ8A 3GUOA 1D0MA 4LZMA 5K7OA 1WVVA 5J7CA 5L3HA 1FKQA 2BPUA 1C6NA 1GE3A 170LA 1E8LA 3A8ZA 4PJZA 1B9OA 3AJNA 1BB7A 3TXBA 2YDGA 3AGIA 1LPYA 3QE8A 5B07A 1QS5A 3KAMA 3ZVQB 1JHLA 1HFYA 2G4QA 107LA 4EJ4A 1HHLA 1L14A 3C8RA 1CJ8A 1AZFA 223LA 3W6FA 1IOTA 1LYHA 1CV1A 5B06A 1BVXA 4WLTA 3M3UA 4LT0A 5LYTA 1JEFA 3AB6A 1L81A 1L0KA 3NY9A 3WU8A 1LHKA 3SBBC 1IWYA 1LJ3A 1GEZA 5L9JA 1FN5A 4H9HA 5I4XA 1VFBC 230LA 4NGWA 2ZQ4A 1YKZX 1OVJA 3ULRA 1EQ4A 1NKHA 5A3EA 5LA8A 4QDNA 2HU3A 1G0MA 2HEFA 1BQLY 5AMYA 4GRVA 178LA 4II8A 1DKKA 4GCEA 4HV2A 4DD0A 2NTGA 1WQNA 5HNLA 1GF6A 1OP9B 2B73A 4LZTA 1FLQA 1C62A 1XGUC 1IR7A 4G4BA 4NGIA 1NBZC 249LA 4HSFA 4UWVA 205LA 4C3WA 1XEKA 2YVBA 5II3A 3SN6R 3C8QA 1G7HC 3FADA 3HT6A 3L64A 1L95A 1C64A 1QSAA 3A34A 1T6HA 3TXJA 1LZ5A 1UIDA 2MEFA 4CFOA 1L87A 3A91A 1BWJA 1QUSA 1LSFA 1ZURA 1B7LA 1LYEA 4CJ2A 4H1PA 4I7KA 4NFVA 4QEQA 1SLYA 3W6BA 235LA 5KXWA 1OYUA 2C8PA 2F4GA 4EXMA 1LZCA 4L41A 3A94A 4OWEA 2GV0A 3D9AC 1KXXA 1CV3A 6LZMA 1QSWA 1L22A
chains in the Genus database with same CATH topology
1DPWA 2B74A 2MEGA 4WL7A 3LHMA 1B6IA 4RLNA 1D3NA 1L67A 1CU0A 4NHTA 1DYCA 4DKLA 1ZVYB 1B5XA 3SB7A 4UWUA 2B6ZA 3E3DA 1GE1A 1UICA 1QUTA 146LA 5IELA 1QTZA 2B70A 2LYMA 4LYTA 1HFZA 3C81A 1LGWA 2OTZX 2ZIKA 1B5YA 2BQGA 1L68A 1UIHA 1VDTA 1IO5A 1L24A 4XADA 2XBRA 4H8YA 1SX7A 1L93A 1QTKA 1HEOA 4TWSA 1KS3A 1LSZA 2FBBA 4MSTA 1L45A 1GFHA 1L97A 3HTBA 1QUDA 2NWDX 1Z55A 3A96A 1LYDA 1LWGA 1C45A 1C6EA 1B2KA 151LA 110LA 1G06A 5FDJA 5LIOA 3DN0A 3F6ZA 5HMJA 4J1AA 3RZEA 1LSPA 4GLVA 1QDTA 236LA 1CKDA 2F2QA 1HSXA 1WVUA 3RW8A 5LINA 4PPOA 1L96A 2Q9EA 4I7JA 1NBYC 5C6JA 260LA 115LA 4U3XB 3WL2A 1L60A 262LA 4RDSA 3K3TA 5APFA 5LZMA 1JKCA 4NSHA 4ANRA 4AXTA 2BQFA 3W6EA 1CU6A 147LA 3GUMA 1I6SA 2Z2FA 1LZBA 1JWRA 1GB8A 4YEMA 1FBIX 1YILA 1GB3A 4EKQA 1CVKA 1G0KA 4QGZA 5KXOA 1DI4A 118LA 1GB9A 1L38A 1SSWA 3CDQA 259LA 1DYEA 5LA5A 1LZSA 4H9BA 1GB2A 1V7SA 207LA 164LA 1L52A 4I7OA 4MCKA 1JTNA 165LA 1XEJA 1IOCA 1C60A 4GCDA 1G07A 1L13A 4W96A 1IP7A 4TUNA 1LLHA 166LA 2OTYX 4ARQB 3AW6A 4G4HA 2DQCY 4WLDA 5C6IA 1CU3A 5F14A 3AZ7A 155LA 2LYOA 3AZ5A 1LZ1A 1P3NA 2QARC 1L33A 1O23A 4WL6A 3PDSA 4YM8A 3L2XA 3MGWA 3T36A 4H90A 2BQIA 1LHMA 3AZ4A 1D9UA 2H9KA 1IP4A 1NWGA 1WTHA 173LA 4EPIA 1UC0A 5KXKA 3TMUA 2RSCA 3LYTA 3HT7A 2RBNA 248LA 2RB2X 3DMVA 1L31A 1D0KA 4PRQA 1KNIA 3LN2A 4E3UA 4H94A 3A67Y 2MEHA 3HH5A 1CX6A 257LA 3A3QA 2F4AA 4OOOA 4PGJB 1A2YC 4G4CA 3BKHA 2Q9DA 3WPLA 4TSBA 3HTFA 3RU5A 3WPKA 1G0JA 2OE4X 1L79A 3OE8A 1D6PA 1IP5A 1GDXA 2HEEA 1G0GA 1L94A 4DD3A 4I7TA 1ZV5L 2EPEA 1JSEA 4NY5A 4W54A 228LA 1G0LA 3DMXA 145LA 1CV6A 1K28A 1QSBA 2YBIA 2BQOA 4ARLA 3WYHA 3VWOA 4DQ5A 5APEA 1LI2A 4HPIA 1BWHA 2RBQA 134LA 1DYGA 3W6CA 3V2WA 243LA 2RBPA 1N4FA 3A92A 4GN4A 4HTKA 3QAKA 2CDSA 2Z39A 3WUAA 1GB7A 1LSGA 4HTNA 5LVIA 4LYMA 1P64A 4NG8A 4HJVA 1B7MA 3WXUA 1I20A 3WVXA 1LCNA 4WLYA 183LA 4WLXA 1V7TA 1L05A 4DD1A 3C7YA 1KIPC 1D0LA 2MEIA 2BQKA 2EIZC 1L84A 4UWNA 171LA 2BQAA 220LA 4WM5A 1IOQA 2DQDY 1BVKC 3ATOA 3W6DA 5FCPA 1INUA 1L34A 1LAAA 1T6VL 3OJPA 4LDOA 4ETAA 152LA 237LA 1LI6A 1L44A 3TMVA 1JUGA 1C46A 1LYGA 200LA 1GBXA 1JTTL 3WU9A 3GUJA 5F81A 2W1LA 1QUHA 1WQOA 244LA 1FDLY 1UIFA 1GBWA 3HU9A 4GN3A 214LA 1L27A 2ZIJA 1D3JA 2B6WA 2LZ2A 2MEAA 161LA 231LA 4CGEA 1IIZA 3AYQA 4EKPA 1L80A 1CX7A 1L03A 4ET8A 2EKSC 4NSIA 1L07A 195LA 2PC2A 1REYA 1L15A 2YSSC 4LYOA 4WM1A 4WM2A 1HENA 3SB8A 4ARMB 1DYFA 5ILFA 3EMSA 148LE 1D9WA 176LA 1JQUA 3TMWA 1JJ0A 163LA 2DQJY 4J1BA 4NGOA 1WQQA 4W57A 1WTNA 1LMOA 1ZVHL 4NGKA 1L56A 221LA 1G7JC 1GWDA 1LKSA 4KPMA 3HH6A 1JTOL 5F16A 1A4VA 3CSZA 194LA 2DBTA 2LZTA 1CV0A 1DPXA 5LVGA 1VAUA 4B4JA 5LAGA 1CJ9A 4BAFA 247LA 4B0DA 1GFGA 2OE7X 187LA 1PQOA 3AW7A 1IWUA 1PQKA 2ZYPA 1QUOA 1YIKA 112LA 3TXDA 1LJHA 4PJ2C 4B1AA 1OUIA 1JKBA 2HEAA 4PK0A 3HBHA 1L73A 2RBOA 4ET9A 1L29A 4GLAA 143LA 217LA 1LZ9A 3G3AB 4S0WA 4BS7A 1D3MA 1W6ZA 245LA 1IP2A 1GF0A 1L49A 138LA 1P6YA 4ARJA 4YXAC 3QY4A 1XEIA 1OUDA 4IJ4A 2A4TA 258LA 3EXDA 1L66A 5C6LA 2BQLA 188LA 1HMKA 1P5CA 140LA 1L09A 1GE0A 2B6TA 1KW7A 149LA 1LZTA 238LA 2DQIY 3WU7A 1YROA 2ZNXY 1XGPC 1LSAA 1GD6A 1XEPA 4XN6A 1CUPA 1DYAA 2CGIA 3CT0A 208LA 1QT3A 2ANXA 4GCFA 175LA 2Y8PA 1VDQA 3DMZA 225LA 4G9SA 1C6LA 1ZWNA 4H9EA 3P66A 3CDRA 1LYIA 2BLYA 4ZPUA 4C5FA 1XFPL 1LSEA 2D4KA 3LYOA 4LYZA 1L74A 1J1PY 4H9AA 1B7QA 2B5ZA 1QT5A 3CSQA 1P36A 153LA 232LA 1IVMA 1GB5A 1MLCE 4NGYA 1DXJA 1T3PA 3C7ZA 5T3FA 1L12A 4NGJA 1T8FA 4B49A 1J1OY 3AZ6A 2IHLA 1L98A 1CV4A 4ETCA 1WTMA 3SB6A 1T97A 2HEDA 4NSJA 3GXKA 1LZRA 1UIAA 1LJKA 1L26A 5F9XA 5M1YA 1UIGA 1YAPA 3VW7A 1YAOA 1ZYTA 4R6CA 4TSCA 4XJFA 3GUIA 4DAJA 2RAYX 1RFPA 1IWWA 1D2WA 1LZEA 4GN5C 5B1GA 4OO9A 5KXMA 4ARPA 4RW1A 1JSFA 1CUQA 1TEWA 3RT5X 1L00A 1C6JA 3HH3A 4N5RA 1L20A 1L16A 4W52A 4N0JA 4LDLA 3IJVA 1PQMA 241LA 1G7IC 4YENA 1QTCA 1DYDA 6LYTA 4P2EA 1GFKA 2AUBA 1L08A 4DD2A 1L10A 1L30A 4YEOA 2MEDA 1NF5A 1B0DA 3W6AA 1L36A 4NWEA 160LA 1LHIA 132LA 218LA 1L65A 113LA 3ZVQA 1YQVY 1IWXA 4W55A 1L70A 120LA 1IEEA 4Z41A 4H9IA 1AKIA 1HEQA 2ZYCA 4XYYA 1GB0A 1LHHA 1GE2A 127LA 1NDGC 3N9AA 2RBRA 2OE9X 5DL9A 5B59A 1C43A 5B05A 240LA 3WMKA 1UIBA 5I4YA 1LJGA 4WOAA 4I7PA 1RE2A 3TMXA 1C7PA 1B5ZA 1L83A 1CTWA 1MELL 3P68A 1C68A 1L62A 3GULA 1GDWA 1L01A 3EBAB 3SP3A 129LA 1LZNA 1JJ1A 104LA 1LZYA 1LSYA 2XBSA 2Z2EA 3EMLA 1DZBX 185LA 3UONA 1HC0A 5KXXA 1B7RA 3K2RA 1HNLA 2ANVA 4OWAA 4N8ZA 1CU2A 4WM3A 172LA 1PQJA 1L35A 1LJ4A 1P46A 3CT5A 1L58A 3A6CY 1CJ6A 1LTMA 4DJHA 126LA 1L48A 3DN4A 1WQPA 3HT8A 156LA 4DQ7A 4EKRA 1JJ3A 196LA 1VEDA 4NGVA 1QTBA 1KW5A 3G3VA 1L82A 4WG1A 4ZEEA 5LVKA 4XJHA 2OU9A 4YXCA 1B5WA 4I0CA 189LA 1DKJA 5DN4A 2CWIA 1HELA 1P56A 1PZYA 209LA 5LXWA 5I54A 5KXNA 1CKFA 3WULA 2D91A 1LZ6A 1C6CA 4BADA 1C6FA 1JISA 1HERA 1LHJA 1UBZA 2F2NA 1LSCA 1BWIA 2N5ZA 2D4IA 1JITA 122LA 2CUUA 2FYDA 229LA 4AQNA 4Z98A 1QS9A 2MECA 4N1EI 1CJ7A 4H92A 1LYYA 1P37A 2LYZA 3HTDA 1LZAA 1F10A 4I7SA 3N9EA 4M4OA 2ZNWY 4HTQA 2A7DA 1GFAA 5APDA 234LA 3PBLA 4XJBA 5KKJA 3T6UA 3OE0A 125LA 1YKXX 4I7NA 9LYZA 2RAZX 2F30A 5I4WA 1HFXA 3C8SA 2RB0X 4D9ZA 3WXTA 2LZMA 3LYMA 2HEBA 3LYZA 1GEVA 3JR6A 2MEBA 1OUHA 3J6KA 4EMNA 4W59A 1BB6A 1L59A 180LA 1B5VA 4LT1A 114LA 139LA 2O4WA 3HU8A 1C66A 3HUAA 4DT3A 5FEKA 239LA 4NHSA 2OU0X 133LA 1GFTA 3IWRA 4WG7A 2HUBA 4BAPA 1GFEA 2B6XA 3F8VA 4I7RA 1PQDA 1RI8B 2FYCA 1GXV2 1L37A 255LA 3SB9A 5E9RA 182LA 3G3WA 4NGZA 1UA6Y 2Z38A 1G1VA 1L90A 1DI3A 215LA 1QIOA 3FI7A 2YBJA 1L50A 1L51A 5APCA 3RUNA 4DD9A 1SSYA 4LT2A 4H9FA 5FSTA 1EPYA 1I1ZA 4DDCA 1OUCA 3V2YA 2WARA 1XGRC 1C6MA 1W08A 4NIJA 261LA 3IJUA 1OWYA 3GUPA 1DI5A 1L17A 1NDMC 3FI5A 1KXYA 3HBEX 3HT9A 3WW6A 4ZFPA 3OK0A 1L53A 1QTEA 4ARQA 1XJUA 1C08C 4HPEA 144LA 1G1WA 2B6YA 4CHXA 1LJJA 3DNAA 3DKEX 1FLUA 254LA 1LSNA 3EO5A 4NGLA 5LAFA 4M6DA 2O79A 1NQIA 1L86A 3QNGA 2ZQ3A 2BQJA 4EKSA 3AGHA 4PHIA 3OE6A 1UUZC 1GXXA 181LA 190LA 5KXSA 1C6IA 1OV7A 2BLXA 3TXFA 4OW1A 3WUMA 1LMNA 1QT7A 2Z37A 1LJIA 1C6GA 1LYZA 1GBOA 5DN5A 1ALCA 3B0KA 3HDEA 4B4IA 1IC4Y 2Z19A 1L28A 1LMCA 3C7WA 211LA 3HTGA 1DQJC 2BQMA 1XGTC 3B72A 186LA 2Z6BA 7LZMA 1AT6A 1OWZA 3M18B 4I7LA 1L06A 233LA 109LA 4X3BA 1AT5A 1VDPA 256LA 2Q0MX 1LSDA 5IHGA 141LA 1EQ5A 4DD7A 4W56A 1CV5A 3TXGA 3FA0A 1JPOA 1TLAA 1D6QA 1GPQC 3BKVA 1J1XY 128LA 2LHMA 1LYSA 2W1MA 4J0LA 3WH1A 1QT8A 1L89A 1QTVA 3A95A 4EPFA 3P65A 3G3BB 3N9CA 1EQEA 1OUAA 1OUBA 3ODUA 1GF9A 1GF8A 1QUGA 253LA 3C80A 1LMQA 3CDVA 123LA 6LYZA 1L0JA 4WO6A 1GHLA 219LA 1B7PA 4I8SA 1LSMA 4ML7A 1BB5A 3P64A 2F32A 206LA 1NHEA 3WUNA 1SWZA 4GCBA 2B75A 1OVKA 1BHZA 1QDRA 1D3FA 1RCMA 2BAAA 1C61A 250LA 1L11A 1LGXA 1OUFA 3CDTA 4G49A 4HP0A 5I14A 2HUKA 4WM6A 1IX0A 1L75A 5I53A 184LA 1SWYA 1L99A 1YAQA 119LA 1REMA 3DN2A 3SBAA 1LPIA 1C6TA 4YOPA 1IR9A 2W1XA 201LA 4Z3MA 157LA 4R0FA 2I6ZA 252LA 2BQCA 2HTXA 1HEMA 4YF2A 192LA 1XGQC 1C10A 3ATNA 4LFPA 1LYOA 1HEWA 1L41A 4GCCA 1GAYA 1L04A 3C82A 2DKVA 4FDYA 2BQHA 1GF4A 199LA 1OQMA 2ZWBA 7LYZA 1G0PA 5KKIA 3W3EA 1YANA 3RZ4A 1OUGA 1LZGA 5LVJA 1REXA 1JTPL 5KXTA 4ARMA 2BQEA 4DDBA 1L91A 4W94A 2I25L 1OVHA 3OE9A 2X0AA 3DN3A 4OOTA 1LSBA 1XJTA 1L61A 1GE4A 3HFMY 4XENA 1IR8A 158LA 1JKAA 1QTHA 3WPJA 1L25A 1P2RA 1L40A 1T8GA 4NG1A 5E4PA 1QQYA 1JTMA 1IY4A 3B6LA 1L32A 1GFJA 1WQRA 2C8OA 2VB1A 1UIEA 3CQLA 4OWCA 1C6HA 4TTDA 5D5FA 1LYJA 1KY1A 1YL1X 1B5UA 1LMAA 3TXIA 4Z46A 4H8ZA 1L76A 1LHLA 1LZDA 1IWZA 4NSGA 4K5YA 5LVHA 167LA 2YBHA 1HSWA 4W53A 1L77A 154LA 4GBRB 1IOSA 177LA 1IY3A 2BQBA 1CNSA 2MEEA 1L42A 2QB0B 1YL0X 2OEAX 4N9RA 1C63A 1L63A 1JKDA 1C69A 1I56A 1GF5A 2HU1A 137LA 1ZMYL 2RH1A 3GUNA 3AGGG 1OV5A 4LGKA 4W51A 3WVYA 1L85A 1LWKA 3LZTA 197LA 3RNXA 8LYZA 4DC4A 2YBNA 1L39A 3LZ2A 224LA 131LA 1TBYA 246LA 1IP6A 4N1CC 169LA 4LFXA 1GBSA 3NY8A 4A7DA 1LJNA 1QSQA 5I5QA 1FLWA 3F9LA 1C6PA 4LYBA 2DQGY 1SQ2L 1CKGA 4DQJA 2D4JA 1LYFA 4HJZA 3CB7A 1IC7Y 2ZILA 2O7AA 3HDFA 1B7SA 4W58A 3GXRA 1LGUA 2D6BA 4EOFA 191LA 2A7FA 4CFPA 1BB4A 1B7OA 4NHQA 1H6MA 4WM4A 1G7MC 168LA 5KXLA 1LOZA 4OWBA 3A93A 1QTDA 4O34A 2Z18A 1GF7A 4H93A 1FKVA 4DWXA 1KIQC 2H5ZA 2DQEY 4WO9A 3HUQA 1OUJA 1WQMA 4KT3A 4KXIA 3CT1A 2HULA 4AGAA 1LI3A 1OUEA 3FE0A 2NTHA 1P7SA 1IWVA 1UCOA 212LA 3B0OA 5HMVA 174LA 1IC5Y 4NWHA 4XJGA 1VATA 1CKCA 222LA 2XTHA 4XJIA 1TCYA 5JENB 5KXYA 1YKYX 1L19A 5HLLA 1L18A 4PRUA 1P2CC 1CKHA 1REZA 162LA 226LA 5KXRA 2RBSA 3CDOA 1LW9A 5D5CA 1JIYA 2CJLA 2H9JA 227LA 1C67A 1HF4A 3TXEA 1C6BA 4NEBA 5IDDA 3G3XA 2I26L 2XQOA 103LA 4HJYA 102LA 2RB1X 3P4ZA 4IASA 1VDSA 4NHPA 1L55A 193LA 4OWHA 1HMLA 210LA 2IGCA 1GB6A 2B7XA 1L92A 4B4EA 3D3DA 3B0IA 3WW5A 4QY9A 1L71A 1HEPA 1T8AA 1GF3A 1NHBA 2FBDA 5B1FA 1LZ4A 4WMGA 2G4PA 2OU8A 5DM9A 4DDAA 1C6KA 1IP3A 3CSRA 4KL7A 4RW2A 242LA 4LYCA 4HV1A 5EBHA 2B72A 1L64A 4LT3A 1KXWA 4ETEA 1IP1A 1C6DA 5HQ1A 5F9UA 111LA 2W1YA 5FHWA 1KY0A 1PQIA 2HUMA 1BB3A 3HWLA 108LA 1H87A 1XSFA 1QT6A 4FJRA 1RJCB 1L72A 1QT4A 1GFUA 5KXPA 1AM7A 5DLAA 1L23A 1L02A 2YBLA 4RLMA 2YBMA 4DYGA 1DYBA 1L47A 4ETBA 1KIRC 1NMMA 1G7LC 2F47A 3A90A 1YAMA 2L78A 5A3ZA 3LZMA 1L46A 4YX7C 2Z12A 159LA 1GFVA 1P2LA 142LA 1CU5A 216LA 4XJDA 2XJWA 3A6BY 2LC9A 3SB5A 1C6QA 2DQHY 1LJEA 251LA 4IATA 1L88A 4MR1A 130LA 1IORA 1BGIA 1L69A 5KY1A 5L3IA 198LA 3ZEKA 3D4SA 2G4NA 4ETDA 1LMTA 1LJFA 4NHIA 3TXKA 1L57A 1TDYA 1SX2A 2HECA 4IAPA 5LYMA 2DQFC 2EQLA 1PS5A 2BQDA 2IFFY 1GBZA 1UACY 2DQAA 1F0WA 3GUKA 3DN1A 5LYZA 150LA 1LMPA 1D2YA 135LA 4J7VA 1C6AA 1C65A 4ZIXA 1L21A 3HH4A 1GBYA 4H8XA 5ILCA 1B7NA 3DN6A 2LCBA 5KXZA 4E97A 4H9CA 1L54A 1F6SA 3C83A 2BQNA 1L43A 4TX7A 1LKRA 1EL1A 1TAYA 5FELA 4I7QA 1IWTA 5HNCA 5KJ9A 4H91A 1GAZA 1F6RA 3HBDA 213LA 1GFRA 4I7MA 3DN8A 4LDEA 3J4GA 3HUKA 1G0QA 3A3RX 3NYAA 1FLYA 3TXHA 1LZ8A 3GUOA 1D0MA 4LZMA 5K7OA 1WVVA 5J7CA 5L3HA 1FKQA 2BPUA 1C6NA 1GE3A 170LA 1E8LA 3A8ZA 4PJZA 1B9OA 3AJNA 1BB7A 3TXBA 2YDGA 3AGIA 1LPYA 3QE8A 5B07A 1QS5A 3KAMA 3ZVQB 1JHLA 1HFYA 2G4QA 107LA 4EJ4A 1HHLA 1L14A 3C8RA 1CJ8A 1AZFA 223LA 3W6FA 1IOTA 1LYHA 1CV1A 5B06A 1BVXA 4WLTA 3M3UA 4LT0A 5LYTA 1JEFA 3AB6A 1L81A 1L0KA 3NY9A 3WU8A 1LHKA 3SBBC 1IWYA 1LJ3A 1GEZA 5L9JA 1FN5A 4H9HA 5I4XA 1VFBC 230LA 4NGWA 2ZQ4A 1YKZX 1OVJA 3ULRA 1EQ4A 1NKHA 5A3EA 5LA8A 4QDNA 2HU3A 1G0MA 2HEFA 1BQLY 5AMYA 4GRVA 178LA 4II8A 1DKKA 4GCEA 4HV2A 4DD0A 2NTGA 1WQNA 5HNLA 1GF6A 1OP9B 2B73A 4LZTA 1FLQA 1C62A 1XGUC 1IR7A 4G4BA 4NGIA 1NBZC 249LA 4HSFA 4UWVA 205LA 4C3WA 1XEKA 2YVBA 5II3A 3SN6R 3C8QA 1G7HC 3FADA 3HT6A 3L64A 1L95A 1C64A 1QSAA 3A34A 1T6HA 3TXJA 1LZ5A 1UIDA 2MEFA 4CFOA 1L87A 3A91A 1BWJA 1QUSA 1LSFA 1ZURA 1B7LA 1LYEA 4CJ2A 4H1PA 4I7KA 4NFVA 4QEQA 1SLYA 3W6BA 235LA 5KXWA 1OYUA 2C8PA 2F4GA 4EXMA 1LZCA 4L41A 3A94A 4OWEA 2GV0A 3D9AC 1KXXA 1CV3A 6LZMA 1QSWA 1L22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 191L A;  2B74 A;  1G1V A;  247L A;  1B6I A;  1L90 A;  1D3N A;  1L67 A;  2OE7 X;  1CU0 A;  215L A;  187L A;  1PQO A;  1L50 A;  1DYC A;  168L A;  1PQK A;  1QUO A;  4DKL A;  112L A;  1L51 A;  3SB7 A;  1QTD A;  2B6Z A;  3RUN A;  1SSY A;  146L A;  4PK0 A;  1QTZ A;  2B70 A;  1L73 A;  2RBO A;  3HUQ A;  1EPY A;  1L29 A;  3V2Y A;  2HUL A;  3C81 A;  1LGW A;  143L A;  1C6M A;  1LI3 A;  2OTZ X;  217L A;  261L A;  2NTH A;  1OWY A;  3GUP A;  1L17 A;  1L68 A;  1P7S A;  212L A;  1L24 A;  4S0W A;  1SX7 A;  1L93 A;  3FI5 A;  174L A;  1D3M A;  222L A;  245L A;  1KS3 A;  3HT9 A;  1L49 A;  138L A;  1P6Y A;  4ARJ A;  1L45 A;  4YXA C;  1L19 A;  1L97 A;  3HTB A;  1L18 A;  2A4T A;  1QUD A;  258L A;  1L53 A;  1L66 A;  162L A;  1LYD A;  188L A;  1LWG A;  1P5C A;  1C6E A;  140L A;  1L09 A;  226L A;  2B6T A;  1KW7 A;  2RBS A;  151L A;  110L A;  4ARQ A;  1G06 A;  1XJU A;  3CDO A;  144L A;  1G1W A;  149L A;  1LW9 A;  3DN0 A;  2B6Y A;  238L A;  227L A;  3DNA A;  1C67 A;  3RZE A;  3DKE X;  236L A;  2F2Q A;  254L A;  1XEP A;  1C6B A;  1CUP A;  1DYA A;  1QT3 A;  2O79 A;  2ANX A;  1L86 A;  4EKS A;  175L A;  3G3X A;  3OE6 A;  3DMZ A;  225L A;  1C6L A;  1ZWN A;  181L A;  190L A;  103L A;  1C6I A;  1L96 A;  1OV7 A;  102L A;  2Q9E A;  2RB1 X;  3CDR A;  1LYI A;  4I7J A;  260L A;  115L A;  4ZPU A;  1L60 A;  1L74 A;  262L A;  1L55 A;  5LZM A;  1QT7 A;  1QT5 A;  1P36 A;  1C6G A;  232L A;  210L A;  2IGC A;  3HDE A;  1CU6 A;  2B7X A;  147L A;  1L92 A;  3GUM A;  3C7Z A;  1L28 A;  1I6S A;  3C7W A;  211L A;  1L12 A;  1T8F A;  3HTG A;  1L71 A;  1T8A A;  1NHB A;  186L A;  1L98 A;  2Z6B A;  7LZM A;  4EKQ A;  1OWZ A;  2OU8 A;  1CV4 A;  4I7L A;  1C6K A;  1CVK A;  1G0K A;  1L06 A;  233L A;  109L A;  1T97 A;  3SB6 A;  242L A;  118L A;  1L26 A;  256L A;  1L38 A;  1SSW A;  3CDQ A;  259L A;  2B72 A;  1L64 A;  1C6D A;  1DYE A;  141L A;  4W56 A;  111L A;  1CV5 A;  3VW7 A;  1KY0 A;  3FA0 A;  1PQI A;  2HUM A;  1ZYT A;  3HWL A;  108L A;  164L A;  1L52 A;  1QT6 A;  1TLA A;  4I7O A;  1JTN A;  1L72 A;  3GUI A;  165L A;  1QT4 A;  128L A;  4DAJ A;  1L23 A;  2RAY X;  1L02 A;  1QT8 A;  1C60 A;  1L89 A;  1G07 A;  1D2W A;  1QTV A;  4EPF A;  1DYB A;  1L13 A;  1L47 A;  1LLH A;  4OO9 A;  166L A;  2OTY X;  4ARP A;  2F47 A;  4ARQ B;  2L78 A;  1CUQ A;  1CU3 A;  3ODU A;  1L00 A;  1C6J A;  3LZM A;  155L A;  1QUG A;  3HH3 A;  253L A;  3C80 A;  1L20 A;  1P3N A;  2QAR C;  1L16 A;  1L33 A;  1L46 A;  4W52 A;  4YX7 C;  3PDS A;  3CDV A;  123L A;  3L2X A;  1L0J A;  4LDL A;  159L A;  1PQM A;  1P2L A;  241L A;  142L A;  1CU5 A;  1QTC A;  216L A;  1DYD A;  219L A;  2LC9 A;  3SB5 A;  1L08 A;  1C6Q A;  251L A;  1L10 A;  1L30 A;  1WTH A;  1L88 A;  173L A;  4EPI A;  130L A;  198L A;  1L36 A;  1L69 A;  160L A;  3D4S A;  2F32 A;  206L A;  218L A;  1L65 A;  113L A;  1SWZ A;  3HT7 A;  2RBN A;  2B75 A;  1OVK A;  1L57 A;  248L A;  1SX2 A;  2RB2 X;  1D3F A;  3DMV A;  1L31 A;  4W55 A;  1L70 A;  4IAP A;  120L A;  1C61 A;  1KNI A;  1L22 A;  250L A;  1L11 A;  3HH5 A;  3GUK A;  1CX6 A;  3DN1 A;  1LGX A;  257L A;  3CDT A;  150L A;  5I14 A;  2HUK A;  1D2Y A;  1L75 A;  184L A;  127L A;  1SWY A;  1L99 A;  1C6A A;  119L A;  1C65 A;  2RBR A;  3DN2 A;  3SBA A;  2OE9 X;  1L21 A;  3HH4 A;  1C6T A;  240L A;  3DN6 A;  201L A;  2LCB A;  2Q9D A;  4I7P A;  157L A;  1L83 A;  4E97 A;  252L A;  3HTF A;  1L54 A;  1CTW A;  1G0J A;  3C83 A;  1C68 A;  1L43 A;  2OE4 X;  1L62 A;  192L A;  1L01 A;  1L79 A;  3GUL A;  3OE8 A;  129L A;  104L A;  1G0G A;  1L94 A;  3EML A;  4I7T A;  4I7Q A;  1L41 A;  185L A;  1L04 A;  3UON A;  3C82 A;  4W54 A;  228L A;  1G0L A;  3DMX A;  145L A;  1CV6 A;  1K28 A;  213L A;  3K2R A;  199L A;  1QSB A;  2ANV A;  4I7M A;  1G0P A;  3DN8 A;  4LDE A;  4ARL A;  3HUK A;  1G0Q A;  3NYA A;  1CU2 A;  3GUO A;  172L A;  4LZM A;  1LI2 A;  1PQJ A;  1L35 A;  2RBQ A;  4ARM A;  1P46 A;  1DYG A;  1L58 A;  3V2W A;  243L A;  1L91 A;  1OVH A;  3OE9 A;  4DJH A;  1C6N A;  126L A;  1L48 A;  2RBP A;  3DN3 A;  3DN4 A;  170L A;  1XJT A;  1L61 A;  3HT8 A;  4PJZ A;  156L A;  4EKR A;  3QAK A;  196L A;  1QTB A;  158L A;  1KW5 A;  3G3V A;  1L82 A;  1P64 A;  1QTH A;  1LPY A;  1QS5 A;  2OU9 A;  1L25 A;  1P2R A;  4YXC A;  1L40 A;  1T8G A;  189L A;  183L A;  1L05 A;  1P56 A;  1JTM A;  107L A;  4EJ4 A;  1L14 A;  3C8R A;  209L A;  3C7Y A;  223L A;  1L32 A;  1LYH A;  1CV1 A;  1L84 A;  171L A;  1C6H A;  1C6C A;  220L A;  1C6F A;  1LYJ A;  1L81 A;  1KY1 A;  1L0K A;  3NY9 A;  122L A;  2CUU A;  229L A;  4AQN A;  1L34 A;  1L76 A;  4LDO A;  3SBB C;  1QS9 A;  4K5Y A;  152L A;  237L A;  1LI6 A;  167L A;  1L44 A;  4W53 A;  1LYG A;  200L A;  1L77 A;  1P37 A;  230L A;  3HTD A;  4GBR B;  3GUJ A;  177L A;  1OVJ A;  1QUH A;  4I7S A;  1L42 A;  244L A;  2QB0 B;  2OEA X;  3HU9 A;  1C63 A;  214L A;  1L27 A;  1L63 A;  1D3J A;  2B6W A;  1C69 A;  234L A;  161L A;  3PBL A;  231L A;  137L A;  4EKP A;  1G0M A;  3OE0 A;  125L A;  4I7N A;  1L80 A;  1CX7 A;  1L03 A;  2RH1 A;  3GUN A;  2RAZ X;  4GRV A;  178L A;  1OV5 A;  3C8S A;  1L07 A;  4W51 A;  2RB0 X;  195L A;  2NTG A;  2LZM A;  1L15 A;  2B73 A;  1L85 A;  1LWK A;  3SB8 A;  197L A;  4ARM B;  1C62 A;  1DYF A;  3JR6 A;  1L39 A;  224L A;  148L E;  1D9W A;  131L A;  176L A;  1JQU A;  249L A;  246L A;  205L A;  169L A;  4W59 A;  1L59 A;  180L A;  163L A;  3SN6 R;  3NY8 A;  3C8Q A;  1QSQ A;  3F9L A;  3FAD A;  3HT6 A;  1C6P A;  3L64 A;  1L95 A;  1C64 A;  114L A;  1T6H A;  4W57 A;  139L A;  2O4W A;  3HU8 A;  1C66 A;  3HUA A;  1L56 A;  1L87 A;  1LYF A;  221L A;  239L A;  1ZUR A;  1LYE A;  4I7K A;  2OU0 X;  235L A;  2B6X A;  3F8V A;  4I7R A;  1OYU A;  1PQD A;  4EXM A;  3HH6 A;  2O7A A;  1L37 A;  255L A;  3HDF A;  3SB9 A;  182L A;  1CV3 A;  4W58 A;  1CV0 A;  6LZM A;  3G3W A;  1LGU A; 
#chains in the Genus database with same CATH topology
 1DPW A;  2B74 A;  2MEG A;  4WL7 A;  3LHM A;  1B6I A;  4RLN A;  1D3N A;  1L67 A;  1CU0 A;  4NHT A;  1DYC A;  4DKL A;  1ZVY B;  1B5X A;  3SB7 A;  4UWU A;  2B6Z A;  3E3D A;  1GE1 A;  1UIC A;  1QUT A;  146L A;  5IEL A;  1QTZ A;  2B70 A;  2LYM A;  4LYT A;  1HFZ A;  3C81 A;  1LGW A;  2OTZ X;  2ZIK A;  1B5Y A;  2BQG A;  1L68 A;  1UIH A;  1VDT A;  1IO5 A;  1L24 A;  4XAD A;  2XBR A;  4H8Y A;  1SX7 A;  1L93 A;  1QTK A;  1HEO A;  4TWS A;  1KS3 A;  1LSZ A;  2FBB A;  4MST A;  1L45 A;  1GFH A;  1L97 A;  3HTB A;  1QUD A;  2NWD X;  1Z55 A;  3A96 A;  1LYD A;  1LWG A;  1C45 A;  1C6E A;  1B2K A;  151L A;  110L A;  1G06 A;  5FDJ A;  5LIO A;  3DN0 A;  3F6Z A;  5HMJ A;  4J1A A;  3RZE A;  1LSP A;  4GLV A;  1QDT A;  236L A;  1CKD A;  2F2Q A;  1HSX A;  1WVU A;  3RW8 A;  5LIN A;  4PPO A;  1L96 A;  2Q9E A;  4I7J A;  1NBY C;  5C6J A;  260L A;  115L A;  4U3X B;  3WL2 A;  1L60 A;  262L A;  4RDS A;  3K3T A;  5APF A;  5LZM A;  1JKC A;  4NSH A;  4ANR A;  4AXT A;  2BQF A;  3W6E A;  1CU6 A;  147L A;  3GUM A;  1I6S A;  2Z2F A;  1LZB A;  1JWR A;  1GB8 A;  4YEM A;  1FBI X;  1YIL A;  1GB3 A;  4EKQ A;  1CVK A;  1G0K A;  4QGZ A;  5KXO A;  1DI4 A;  118L A;  1GB9 A;  1L38 A;  1SSW A;  3CDQ A;  259L A;  1DYE A;  5LA5 A;  1LZS A;  4H9B A;  1GB2 A;  1V7S A;  207L A;  164L A;  1L52 A;  4I7O A;  4MCK A;  1JTN A;  165L A;  1XEJ A;  1IOC A;  1C60 A;  4GCD A;  1G07 A;  1L13 A;  4W96 A;  1IP7 A;  4TUN A;  1LLH A;  166L A;  2OTY X;  4ARQ B;  3AW6 A;  4G4H A;  2DQC Y;  4WLD A;  5C6I A;  1CU3 A;  5F14 A;  3AZ7 A;  155L A;  2LYO A;  3AZ5 A;  1LZ1 A;  1P3N A;  2QAR C;  1L33 A;  1O23 A;  4WL6 A;  3PDS A;  4YM8 A;  3L2X A;  3MGW A;  3T36 A;  4H90 A;  2BQI A;  1LHM A;  3AZ4 A;  1D9U A;  2H9K A;  1IP4 A;  1NWG A;  1WTH A;  173L A;  4EPI A;  1UC0 A;  5KXK A;  3TMU A;  2RSC A;  3LYT A;  3HT7 A;  2RBN A;  248L A;  2RB2 X;  3DMV A;  1L31 A;  1D0K A;  4PRQ A;  1KNI A;  3LN2 A;  4E3U A;  4H94 A;  3A67 Y;  2MEH A;  3HH5 A;  1CX6 A;  257L A;  3A3Q A;  2F4A A;  4OOO A;  4PGJ B;  1A2Y C;  4G4C A;  3BKH A;  2Q9D A;  3WPL A;  4TSB A;  3HTF A;  3RU5 A;  3WPK A;  1G0J A;  2OE4 X;  1L79 A;  3OE8 A;  1D6P A;  1IP5 A;  1GDX A;  2HEE A;  1G0G A;  1L94 A;  4DD3 A;  4I7T A;  1ZV5 L;  2EPE A;  1JSE A;  4NY5 A;  4W54 A;  228L A;  1G0L A;  3DMX A;  145L A;  1CV6 A;  1K28 A;  1QSB A;  2YBI A;  2BQO A;  4ARL A;  3WYH A;  3VWO A;  4DQ5 A;  5APE A;  1LI2 A;  4HPI A;  1BWH A;  2RBQ A;  134L A;  1DYG A;  3W6C A;  3V2W A;  243L A;  2RBP A;  1N4F A;  3A92 A;  4GN4 A;  4HTK A;  3QAK A;  2CDS A;  2Z39 A;  3WUA A;  1GB7 A;  1LSG A;  4HTN A;  5LVI A;  4LYM A;  1P64 A;  4NG8 A;  4HJV A;  1B7M A;  3WXU A;  1I20 A;  3WVX A;  1LCN A;  4WLY A;  183L A;  4WLX A;  1V7T A;  1L05 A;  4DD1 A;  3C7Y A;  1KIP C;  1D0L A;  2MEI A;  2BQK A;  2EIZ C;  1L84 A;  4UWN A;  171L A;  2BQA A;  220L A;  4WM5 A;  1IOQ A;  2DQD Y;  1BVK C;  3ATO A;  3W6D A;  5FCP A;  1INU A;  1L34 A;  1LAA A;  1T6V L;  3OJP A;  4LDO A;  4ETA A;  152L A;  237L A;  1LI6 A;  1L44 A;  3TMV A;  1JUG A;  1C46 A;  1LYG A;  200L A;  1GBX A;  1JTT L;  3WU9 A;  3GUJ A;  5F81 A;  2W1L A;  1QUH A;  1WQO A;  244L A;  1FDL Y;  1UIF A;  1GBW A;  3HU9 A;  4GN3 A;  214L A;  1L27 A;  2ZIJ A;  1D3J A;  2B6W A;  2LZ2 A;  2MEA A;  161L A;  231L A;  4CGE A;  1IIZ A;  3AYQ A;  4EKP A;  1L80 A;  1CX7 A;  1L03 A;  4ET8 A;  2EKS C;  4NSI A;  1L07 A;  195L A;  2PC2 A;  1REY A;  1L15 A;  2YSS C;  4LYO A;  4WM1 A;  4WM2 A;  1HEN A;  3SB8 A;  4ARM B;  1DYF A;  5ILF A;  3EMS A;  148L E;  1D9W A;  176L A;  1JQU A;  3TMW A;  1JJ0 A;  163L A;  2DQJ Y;  4J1B A;  4NGO A;  1WQQ A;  4W57 A;  1WTN A;  1LMO A;  1ZVH L;  4NGK A;  1L56 A;  221L A;  1G7J C;  1GWD A;  1LKS A;  4KPM A;  3HH6 A;  1JTO L;  5F16 A;  1A4V A;  3CSZ A;  194L A;  2DBT A;  2LZT A;  1CV0 A;  1DPX A;  5LVG A;  1VAU A;  4B4J A;  5LAG A;  1CJ9 A;  4BAF A;  247L A;  4B0D A;  1GFG A;  2OE7 X;  187L A;  1PQO A;  3AW7 A;  1IWU A;  1PQK A;  2ZYP A;  1QUO A;  1YIK A;  112L A;  3TXD A;  1LJH A;  4PJ2 C;  4B1A A;  1OUI A;  1JKB A;  2HEA A;  4PK0 A;  3HBH A;  1L73 A;  2RBO A;  4ET9 A;  1L29 A;  4GLA A;  143L A;  217L A;  1LZ9 A;  3G3A B;  4S0W A;  4BS7 A;  1D3M A;  1W6Z A;  245L A;  1IP2 A;  1GF0 A;  1L49 A;  138L A;  1P6Y A;  4ARJ A;  4YXA C;  3QY4 A;  1XEI A;  1OUD A;  4IJ4 A;  2A4T A;  258L A;  3EXD A;  1L66 A;  5C6L A;  2BQL A;  188L A;  1HMK A;  1P5C A;  140L A;  1L09 A;  1GE0 A;  2B6T A;  1KW7 A;  149L A;  1LZT A;  238L A;  2DQI Y;  3WU7 A;  1YRO A;  2ZNX Y;  1XGP C;  1LSA A;  1GD6 A;  1XEP A;  4XN6 A;  1CUP A;  1DYA A;  2CGI A;  3CT0 A;  208L A;  1QT3 A;  2ANX A;  4GCF A;  175L A;  2Y8P A;  1VDQ A;  3DMZ A;  225L A;  4G9S A;  1C6L A;  1ZWN A;  4H9E A;  3P66 A;  3CDR A;  1LYI A;  2BLY A;  4ZPU A;  4C5F A;  1XFP L;  1LSE A;  2D4K A;  3LYO A;  4LYZ A;  1L74 A;  1J1P Y;  4H9A A;  1B7Q A;  2B5Z A;  1QT5 A;  3CSQ A;  1P36 A;  153L A;  232L A;  1IVM A;  1GB5 A;  1MLC E;  4NGY A;  1DXJ A;  1T3P A;  3C7Z A;  5T3F A;  1L12 A;  4NGJ A;  1T8F A;  4B49 A;  1J1O Y;  3AZ6 A;  2IHL A;  1L98 A;  1CV4 A;  4ETC A;  1WTM A;  3SB6 A;  1T97 A;  2HED A;  4NSJ A;  3GXK A;  1LZR A;  1UIA A;  1LJK A;  1L26 A;  5F9X A;  5M1Y A;  1UIG A;  1YAP A;  3VW7 A;  1YAO A;  1ZYT A;  4R6C A;  4TSC A;  4XJF A;  3GUI A;  4DAJ A;  2RAY X;  1RFP A;  1IWW A;  1D2W A;  1LZE A;  4GN5 C;  5B1G A;  4OO9 A;  5KXM A;  4ARP A;  4RW1 A;  1JSF A;  1CUQ A;  1TEW A;  3RT5 X;  1L00 A;  1C6J A;  3HH3 A;  4N5R A;  1L20 A;  1L16 A;  4W52 A;  4N0J A;  4LDL A;  3IJV A;  1PQM A;  241L A;  1G7I C;  4YEN A;  1QTC A;  1DYD A;  6LYT A;  4P2E A;  1GFK A;  2AUB A;  1L08 A;  4DD2 A;  1L10 A;  1L30 A;  4YEO A;  2MED A;  1NF5 A;  1B0D A;  3W6A A;  1L36 A;  4NWE A;  160L A;  1LHI A;  132L A;  218L A;  1L65 A;  113L A;  3ZVQ A;  1YQV Y;  1IWX A;  4W55 A;  1L70 A;  120L A;  1IEE A;  4Z41 A;  4H9I A;  1AKI A;  1HEQ A;  2ZYC A;  4XYY A;  1GB0 A;  1LHH A;  1GE2 A;  127L A;  1NDG C;  3N9A A;  2RBR A;  2OE9 X;  5DL9 A;  5B59 A;  1C43 A;  5B05 A;  240L A;  3WMK A;  1UIB A;  5I4Y A;  1LJG A;  4WOA A;  4I7P A;  1RE2 A;  3TMX A;  1C7P A;  1B5Z A;  1L83 A;  1CTW A;  1MEL L;  3P68 A;  1C68 A;  1L62 A;  3GUL A;  1GDW A;  1L01 A;  3EBA B;  3SP3 A;  129L A;  1LZN A;  1JJ1 A;  104L A;  1LZY A;  1LSY A;  2XBS A;  2Z2E A;  3EML A;  1DZB X;  185L A;  3UON A;  1HC0 A;  5KXX A;  1B7R A;  3K2R A;  1HNL A;  2ANV A;  4OWA A;  4N8Z A;  1CU2 A;  4WM3 A;  172L A;  1PQJ A;  1L35 A;  1LJ4 A;  1P46 A;  3CT5 A;  1L58 A;  3A6C Y;  1CJ6 A;  1LTM A;  4DJH A;  126L A;  1L48 A;  3DN4 A;  1WQP A;  3HT8 A;  156L A;  4DQ7 A;  4EKR A;  1JJ3 A;  196L A;  1VED A;  4NGV A;  1QTB A;  1KW5 A;  3G3V A;  1L82 A;  4WG1 A;  4ZEE A;  5LVK A;  4XJH A;  2OU9 A;  4YXC A;  1B5W A;  4I0C A;  189L A;  1DKJ A;  5DN4 A;  2CWI A;  1HEL A;  1P56 A;  1PZY A;  209L A;  5LXW A;  5I54 A;  5KXN A;  1CKF A;  3WUL A;  2D91 A;  1LZ6 A;  1C6C A;  4BAD A;  1C6F A;  1JIS A;  1HER A;  1LHJ A;  1UBZ A;  2F2N A;  1LSC A;  1BWI A;  2N5Z A;  2D4I A;  1JIT A;  122L A;  2CUU A;  2FYD A;  229L A;  4AQN A;  4Z98 A;  1QS9 A;  2MEC A;  4N1E I;  1CJ7 A;  4H92 A;  1LYY A;  1P37 A;  2LYZ A;  3HTD A;  1LZA A;  1F10 A;  4I7S A;  3N9E A;  4M4O A;  2ZNW Y;  4HTQ A;  2A7D A;  1GFA A;  5APD A;  234L A;  3PBL A;  4XJB A;  5KKJ A;  3T6U A;  3OE0 A;  125L A;  1YKX X;  4I7N A;  9LYZ A;  2RAZ X;  2F30 A;  5I4W A;  1HFX A;  3C8S A;  2RB0 X;  4D9Z A;  3WXT A;  2LZM A;  3LYM A;  2HEB A;  3LYZ A;  1GEV A;  3JR6 A;  2MEB A;  1OUH A;  3J6K A;  4EMN A;  4W59 A;  1BB6 A;  1L59 A;  180L A;  1B5V A;  4LT1 A;  114L A;  139L A;  2O4W A;  3HU8 A;  1C66 A;  3HUA A;  4DT3 A;  5FEK A;  239L A;  4NHS A;  2OU0 X;  133L A;  1GFT A;  3IWR A;  4WG7 A;  2HUB A;  4BAP A;  1GFE A;  2B6X A;  3F8V A;  4I7R A;  1PQD A;  1RI8 B;  2FYC A;  1GXV 2;  1L37 A;  255L A;  3SB9 A;  5E9R A;  182L A;  3G3W A;  4NGZ A;  1UA6 Y;  2Z38 A;  1G1V A;  1L90 A;  1DI3 A;  215L A;  1QIO A;  3FI7 A;  2YBJ A;  1L50 A;  1L51 A;  5APC A;  3RUN A;  4DD9 A;  1SSY A;  4LT2 A;  4H9F A;  5FST A;  1EPY A;  1I1Z A;  4DDC A;  1OUC A;  3V2Y A;  2WAR A;  1XGR C;  1C6M A;  1W08 A;  4NIJ A;  261L A;  3IJU A;  1OWY A;  3GUP A;  1DI5 A;  1L17 A;  1NDM C;  3FI5 A;  1KXY A;  3HBE X;  3HT9 A;  3WW6 A;  4ZFP A;  3OK0 A;  1L53 A;  1QTE A;  4ARQ A;  1XJU A;  1C08 C;  4HPE A;  144L A;  1G1W A;  2B6Y A;  4CHX A;  1LJJ A;  3DNA A;  3DKE X;  1FLU A;  254L A;  1LSN A;  3EO5 A;  4NGL A;  5LAF A;  4M6D A;  2O79 A;  1NQI A;  1L86 A;  3QNG A;  2ZQ3 A;  2BQJ A;  4EKS A;  3AGH A;  4PHI A;  3OE6 A;  1UUZ C;  1GXX A;  181L A;  190L A;  5KXS A;  1C6I A;  1OV7 A;  2BLX A;  3TXF A;  4OW1 A;  3WUM A;  1LMN A;  1QT7 A;  2Z37 A;  1LJI A;  1C6G A;  1LYZ A;  1GBO A;  5DN5 A;  1ALC A;  3B0K A;  3HDE A;  4B4I A;  1IC4 Y;  2Z19 A;  1L28 A;  1LMC A;  3C7W A;  211L A;  3HTG A;  1DQJ C;  2BQM A;  1XGT C;  3B72 A;  186L A;  2Z6B A;  7LZM A;  1AT6 A;  1OWZ A;  3M18 B;  4I7L A;  1L06 A;  233L A;  109L A;  4X3B A;  1AT5 A;  1VDP A;  256L A;  2Q0M X;  1LSD A;  5IHG A;  141L A;  1EQ5 A;  4DD7 A;  4W56 A;  1CV5 A;  3TXG A;  3FA0 A;  1JPO A;  1TLA A;  1D6Q A;  1GPQ C;  3BKV A;  1J1X Y;  128L A;  2LHM A;  1LYS A;  2W1M A;  4J0L A;  3WH1 A;  1QT8 A;  1L89 A;  1QTV A;  3A95 A;  4EPF A;  3P65 A;  3G3B B;  3N9C A;  1EQE A;  1OUA A;  1OUB A;  3ODU A;  1GF9 A;  1GF8 A;  1QUG A;  253L A;  3C80 A;  1LMQ A;  3CDV A;  123L A;  6LYZ A;  1L0J A;  4WO6 A;  1GHL A;  219L A;  1B7P A;  4I8S A;  1LSM A;  4ML7 A;  1BB5 A;  3P64 A;  2F32 A;  206L A;  1NHE A;  3WUN A;  1SWZ A;  4GCB A;  2B75 A;  1OVK A;  1BHZ A;  1QDR A;  1D3F A;  1RCM A;  2BAA A;  1C61 A;  250L A;  1L11 A;  1LGX A;  1OUF A;  3CDT A;  4G49 A;  4HP0 A;  5I14 A;  2HUK A;  4WM6 A;  1IX0 A;  1L75 A;  5I53 A;  184L A;  1SWY A;  1L99 A;  1YAQ A;  119L A;  1REM A;  3DN2 A;  3SBA A;  1LPI A;  1C6T A;  4YOP A;  1IR9 A;  2W1X A;  201L A;  4Z3M A;  157L A;  4R0F A;  2I6Z A;  252L A;  2BQC A;  2HTX A;  1HEM A;  4YF2 A;  192L A;  1XGQ C;  1C10 A;  3ATN A;  4LFP A;  1LYO A;  1HEW A;  1L41 A;  4GCC A;  1GAY A;  1L04 A;  3C82 A;  2DKV A;  4FDY A;  2BQH A;  1GF4 A;  199L A;  1OQM A;  2ZWB A;  7LYZ A;  1G0P A;  5KKI A;  3W3E A;  1YAN A;  3RZ4 A;  1OUG A;  1LZG A;  5LVJ A;  1REX A;  1JTP L;  5KXT A;  4ARM A;  2BQE A;  4DDB A;  1L91 A;  4W94 A;  2I25 L;  1OVH A;  3OE9 A;  2X0A A;  3DN3 A;  4OOT A;  1LSB A;  1XJT A;  1L61 A;  1GE4 A;  3HFM Y;  4XEN A;  1IR8 A;  158L A;  1JKA A;  1QTH A;  3WPJ A;  1L25 A;  1P2R A;  1L40 A;  1T8G A;  4NG1 A;  5E4P A;  1QQY A;  1JTM A;  1IY4 A;  3B6L A;  1L32 A;  1GFJ A;  1WQR A;  2C8O A;  2VB1 A;  1UIE A;  3CQL A;  4OWC A;  1C6H A;  4TTD A;  5D5F A;  1LYJ A;  1KY1 A;  1YL1 X;  1B5U A;  1LMA A;  3TXI A;  4Z46 A;  4H8Z A;  1L76 A;  1LHL A;  1LZD A;  1IWZ A;  4NSG A;  4K5Y A;  5LVH A;  167L A;  2YBH A;  1HSW A;  4W53 A;  1L77 A;  154L A;  4GBR B;  1IOS A;  177L A;  1IY3 A;  2BQB A;  1CNS A;  2MEE A;  1L42 A;  2QB0 B;  1YL0 X;  2OEA X;  4N9R A;  1C63 A;  1L63 A;  1JKD A;  1C69 A;  1I56 A;  1GF5 A;  2HU1 A;  137L A;  1ZMY L;  2RH1 A;  3GUN A;  3AGG G;  1OV5 A;  4LGK A;  4W51 A;  3WVY A;  1L85 A;  1LWK A;  3LZT A;  197L A;  3RNX A;  8LYZ A;  4DC4 A;  2YBN A;  1L39 A;  3LZ2 A;  224L A;  131L A;  1TBY A;  246L A;  1IP6 A;  4N1C C;  169L A;  4LFX A;  1GBS A;  3NY8 A;  4A7D A;  1LJN A;  1QSQ A;  5I5Q A;  1FLW A;  3F9L A;  1C6P A;  4LYB A;  2DQG Y;  1SQ2 L;  1CKG A;  4DQJ A;  2D4J A;  1LYF A;  4HJZ A;  3CB7 A;  1IC7 Y;  2ZIL A;  2O7A A;  3HDF A;  1B7S A;  4W58 A;  3GXR A;  1LGU A;  2D6B A;  4EOF A;  191L A;  2A7F A;  4CFP A;  1BB4 A;  1B7O A;  4NHQ A;  1H6M A;  4WM4 A;  1G7M C;  168L A;  5KXL A;  1LOZ A;  4OWB A;  3A93 A;  1QTD A;  4O34 A;  2Z18 A;  1GF7 A;  4H93 A;  1FKV A;  4DWX A;  1KIQ C;  2H5Z A;  2DQE Y;  4WO9 A;  3HUQ A;  1OUJ A;  1WQM A;  4KT3 A;  4KXI A;  3CT1 A;  2HUL A;  4AGA A;  1LI3 A;  1OUE A;  3FE0 A;  2NTH A;  1P7S A;  1IWV A;  1UCO A;  212L A;  3B0O A;  5HMV A;  174L A;  1IC5 Y;  4NWH A;  4XJG A;  1VAT A;  1CKC A;  222L A;  2XTH A;  4XJI A;  1TCY A;  5JEN B;  5KXY A;  1YKY X;  1L19 A;  5HLL A;  1L18 A;  4PRU A;  1P2C C;  1CKH A;  1REZ A;  162L A;  226L A;  5KXR A;  2RBS A;  3CDO A;  1LW9 A;  5D5C A;  1JIY A;  2CJL A;  2H9J A;  227L A;  1C67 A;  1HF4 A;  3TXE A;  1C6B A;  4NEB A;  5IDD A;  3G3X A;  2I26 L;  2XQO A;  103L A;  4HJY A;  102L A;  2RB1 X;  3P4Z A;  4IAS A;  1VDS A;  4NHP A;  1L55 A;  193L A;  4OWH A;  1HML A;  210L A;  2IGC A;  1GB6 A;  2B7X A;  1L92 A;  4B4E A;  3D3D A;  3B0I A;  3WW5 A;  4QY9 A;  1L71 A;  1HEP A;  1T8A A;  1GF3 A;  1NHB A;  2FBD A;  5B1F A;  1LZ4 A;  4WMG A;  2G4P A;  2OU8 A;  5DM9 A;  4DDA A;  1C6K A;  1IP3 A;  3CSR A;  4KL7 A;  4RW2 A;  242L A;  4LYC A;  4HV1 A;  5EBH A;  2B72 A;  1L64 A;  4LT3 A;  1KXW A;  4ETE A;  1IP1 A;  1C6D A;  5HQ1 A;  5F9U A;  111L A;  2W1Y A;  5FHW A;  1KY0 A;  1PQI A;  2HUM A;  1BB3 A;  3HWL A;  108L A;  1H87 A;  1XSF A;  1QT6 A;  4FJR A;  1RJC B;  1L72 A;  1QT4 A;  1GFU A;  5KXP A;  1AM7 A;  5DLA A;  1L23 A;  1L02 A;  2YBL A;  4RLM A;  2YBM A;  4DYG A;  1DYB A;  1L47 A;  4ETB A;  1KIR C;  1NMM A;  1G7L C;  2F47 A;  3A90 A;  1YAM A;  2L78 A;  5A3Z A;  3LZM A;  1L46 A;  4YX7 C;  2Z12 A;  159L A;  1GFV A;  1P2L A;  142L A;  1CU5 A;  216L A;  4XJD A;  2XJW A;  3A6B Y;  2LC9 A;  3SB5 A;  1C6Q A;  2DQH Y;  1LJE A;  251L A;  4IAT A;  1L88 A;  4MR1 A;  130L A;  1IOR A;  1BGI A;  1L69 A;  5KY1 A;  5L3I A;  198L A;  3ZEK A;  3D4S A;  2G4N A;  4ETD A;  1LMT A;  1LJF A;  4NHI A;  3TXK A;  1L57 A;  1TDY A;  1SX2 A;  2HEC A;  4IAP A;  5LYM A;  2DQF C;  2EQL A;  1PS5 A;  2BQD A;  2IFF Y;  1GBZ A;  1UAC Y;  2DQA A;  1F0W A;  3GUK A;  3DN1 A;  5LYZ A;  150L A;  1LMP A;  1D2Y A;  135L A;  4J7V A;  1C6A A;  1C65 A;  4ZIX A;  1L21 A;  3HH4 A;  1GBY A;  4H8X A;  5ILC A;  1B7N A;  3DN6 A;  2LCB A;  5KXZ A;  4E97 A;  4H9C A;  1L54 A;  1F6S A;  3C83 A;  2BQN A;  1L43 A;  4TX7 A;  1LKR A;  1EL1 A;  1TAY A;  5FEL A;  4I7Q A;  1IWT A;  5HNC A;  5KJ9 A;  4H91 A;  1GAZ A;  1F6R A;  3HBD A;  213L A;  1GFR A;  4I7M A;  3DN8 A;  4LDE A;  3J4G A;  3HUK A;  1G0Q A;  3A3R X;  3NYA A;  1FLY A;  3TXH A;  1LZ8 A;  3GUO A;  1D0M A;  4LZM A;  5K7O A;  1WVV A;  5J7C A;  5L3H A;  1FKQ A;  2BPU A;  1C6N A;  1GE3 A;  170L A;  1E8L A;  3A8Z A;  4PJZ A;  1B9O A;  3AJN A;  1BB7 A;  3TXB A;  2YDG A;  3AGI A;  1LPY A;  3QE8 A;  5B07 A;  1QS5 A;  3KAM A;  3ZVQ B;  1JHL A;  1HFY A;  2G4Q A;  107L A;  4EJ4 A;  1HHL A;  1L14 A;  3C8R A;  1CJ8 A;  1AZF A;  223L A;  3W6F A;  1IOT A;  1LYH A;  1CV1 A;  5B06 A;  1BVX A;  4WLT A;  3M3U A;  4LT0 A;  5LYT A;  1JEF A;  3AB6 A;  1L81 A;  1L0K A;  3NY9 A;  3WU8 A;  1LHK A;  3SBB C;  1IWY A;  1LJ3 A;  1GEZ A;  5L9J A;  1FN5 A;  4H9H A;  5I4X A;  1VFB C;  230L A;  4NGW A;  2ZQ4 A;  1YKZ X;  1OVJ A;  3ULR A;  1EQ4 A;  1NKH A;  5A3E A;  5LA8 A;  4QDN A;  2HU3 A;  1G0M A;  2HEF A;  1BQL Y;  5AMY A;  4GRV A;  178L A;  4II8 A;  1DKK A;  4GCE A;  4HV2 A;  4DD0 A;  2NTG A;  1WQN A;  5HNL A;  1GF6 A;  1OP9 B;  2B73 A;  4LZT A;  1FLQ A;  1C62 A;  1XGU C;  1IR7 A;  4G4B A;  4NGI A;  1NBZ C;  249L A;  4HSF A;  4UWV A;  205L A;  4C3W A;  1XEK A;  2YVB A;  5II3 A;  3SN6 R;  3C8Q A;  1G7H C;  3FAD A;  3HT6 A;  3L64 A;  1L95 A;  1C64 A;  1QSA A;  3A34 A;  1T6H A;  3TXJ A;  1LZ5 A;  1UID A;  2MEF A;  4CFO A;  1L87 A;  3A91 A;  1BWJ A;  1QUS A;  1LSF A;  1ZUR A;  1B7L A;  1LYE A;  4CJ2 A;  4H1P A;  4I7K A;  4NFV A;  4QEQ A;  1SLY A;  3W6B A;  235L A;  5KXW A;  1OYU A;  2C8P A;  2F4G A;  4EXM A;  1LZC A;  4L41 A;  3A94 A;  4OWE A;  2GV0 A;  3D9A C;  1KXX A;  1CV3 A;  6LZM A;  1QSW A;  1L22 A; 
#chains in the Genus database with same CATH homology
 1DPW A;  2B74 A;  2MEG A;  4WL7 A;  3LHM A;  1B6I A;  4RLN A;  1D3N A;  1L67 A;  1CU0 A;  4NHT A;  1DYC A;  4DKL A;  1ZVY B;  1B5X A;  3SB7 A;  4UWU A;  2B6Z A;  3E3D A;  1GE1 A;  1UIC A;  1QUT A;  146L A;  5IEL A;  1QTZ A;  2B70 A;  2LYM A;  4LYT A;  1HFZ A;  3C81 A;  1LGW A;  2OTZ X;  2ZIK A;  1B5Y A;  2BQG A;  1L68 A;  1UIH A;  1VDT A;  1IO5 A;  1L24 A;  4XAD A;  2XBR A;  4H8Y A;  1SX7 A;  1L93 A;  1QTK A;  1HEO A;  4TWS A;  1KS3 A;  1LSZ A;  2FBB A;  4MST A;  1L45 A;  1GFH A;  1L97 A;  3HTB A;  1QUD A;  2NWD X;  1Z55 A;  3A96 A;  1LYD A;  1LWG A;  1C45 A;  1C6E A;  1B2K A;  151L A;  110L A;  1G06 A;  5FDJ A;  5LIO A;  3DN0 A;  3F6Z A;  5HMJ A;  4J1A A;  3RZE A;  1LSP A;  4GLV A;  1QDT A;  236L A;  1CKD A;  2F2Q A;  1HSX A;  1WVU A;  3RW8 A;  5LIN A;  4PPO A;  1L96 A;  2Q9E A;  4I7J A;  1NBY C;  5C6J A;  260L A;  115L A;  4U3X B;  3WL2 A;  1L60 A;  262L A;  4RDS A;  3K3T A;  5APF A;  5LZM A;  1JKC A;  4NSH A;  4ANR A;  4AXT A;  2BQF A;  3W6E A;  1CU6 A;  147L A;  3GUM A;  1I6S A;  2Z2F A;  1LZB A;  1JWR A;  1GB8 A;  4YEM A;  1FBI X;  1YIL A;  1GB3 A;  4EKQ A;  1CVK A;  1G0K A;  4QGZ A;  5KXO A;  1DI4 A;  118L A;  1GB9 A;  1L38 A;  1SSW A;  3CDQ A;  259L A;  1DYE A;  5LA5 A;  1LZS A;  4H9B A;  1GB2 A;  1V7S A;  207L A;  164L A;  1L52 A;  4I7O A;  4MCK A;  1JTN A;  165L A;  1XEJ A;  1IOC A;  1C60 A;  4GCD A;  1G07 A;  1L13 A;  4W96 A;  1IP7 A;  4TUN A;  1LLH A;  166L A;  2OTY X;  4ARQ B;  3AW6 A;  4G4H A;  2DQC Y;  4WLD A;  5C6I A;  1CU3 A;  5F14 A;  3AZ7 A;  155L A;  2LYO A;  3AZ5 A;  1LZ1 A;  1P3N A;  2QAR C;  1L33 A;  1O23 A;  4WL6 A;  3PDS A;  4YM8 A;  3L2X A;  3MGW A;  3T36 A;  4H90 A;  2BQI A;  1LHM A;  3AZ4 A;  1D9U A;  2H9K A;  1IP4 A;  1NWG A;  1WTH A;  173L A;  4EPI A;  1UC0 A;  5KXK A;  3TMU A;  2RSC A;  3LYT A;  3HT7 A;  2RBN A;  248L A;  2RB2 X;  3DMV A;  1L31 A;  1D0K A;  4PRQ A;  1KNI A;  3LN2 A;  4E3U A;  4H94 A;  3A67 Y;  2MEH A;  3HH5 A;  1CX6 A;  257L A;  3A3Q A;  2F4A A;  4OOO A;  4PGJ B;  1A2Y C;  4G4C A;  3BKH A;  2Q9D A;  3WPL A;  4TSB A;  3HTF A;  3RU5 A;  3WPK A;  1G0J A;  2OE4 X;  1L79 A;  3OE8 A;  1D6P A;  1IP5 A;  1GDX A;  2HEE A;  1G0G A;  1L94 A;  4DD3 A;  4I7T A;  1ZV5 L;  2EPE A;  1JSE A;  4NY5 A;  4W54 A;  228L A;  1G0L A;  3DMX A;  145L A;  1CV6 A;  1K28 A;  1QSB A;  2YBI A;  2BQO A;  4ARL A;  3WYH A;  3VWO A;  4DQ5 A;  5APE A;  1LI2 A;  4HPI A;  1BWH A;  2RBQ A;  134L A;  1DYG A;  3W6C A;  3V2W A;  243L A;  2RBP A;  1N4F A;  3A92 A;  4GN4 A;  4HTK A;  3QAK A;  2CDS A;  2Z39 A;  3WUA A;  1GB7 A;  1LSG A;  4HTN A;  5LVI A;  4LYM A;  1P64 A;  4NG8 A;  4HJV A;  1B7M A;  3WXU A;  1I20 A;  3WVX A;  1LCN A;  4WLY A;  183L A;  4WLX A;  1V7T A;  1L05 A;  4DD1 A;  3C7Y A;  1KIP C;  1D0L A;  2MEI A;  2BQK A;  2EIZ C;  1L84 A;  4UWN A;  171L A;  2BQA A;  220L A;  4WM5 A;  1IOQ A;  2DQD Y;  1BVK C;  3ATO A;  3W6D A;  5FCP A;  1INU A;  1L34 A;  1LAA A;  1T6V L;  3OJP A;  4LDO A;  4ETA A;  152L A;  237L A;  1LI6 A;  1L44 A;  3TMV A;  1JUG A;  1C46 A;  1LYG A;  200L A;  1GBX A;  1JTT L;  3WU9 A;  3GUJ A;  5F81 A;  2W1L A;  1QUH A;  1WQO A;  244L A;  1FDL Y;  1UIF A;  1GBW A;  3HU9 A;  4GN3 A;  214L A;  1L27 A;  2ZIJ A;  1D3J A;  2B6W A;  2LZ2 A;  2MEA A;  161L A;  231L A;  4CGE A;  1IIZ A;  3AYQ A;  4EKP A;  1L80 A;  1CX7 A;  1L03 A;  4ET8 A;  2EKS C;  4NSI A;  1L07 A;  195L A;  2PC2 A;  1REY A;  1L15 A;  2YSS C;  4LYO A;  4WM1 A;  4WM2 A;  1HEN A;  3SB8 A;  4ARM B;  1DYF A;  5ILF A;  3EMS A;  148L E;  1D9W A;  176L A;  1JQU A;  3TMW A;  1JJ0 A;  163L A;  2DQJ Y;  4J1B A;  4NGO A;  1WQQ A;  4W57 A;  1WTN A;  1LMO A;  1ZVH L;  4NGK A;  1L56 A;  221L A;  1G7J C;  1GWD A;  1LKS A;  4KPM A;  3HH6 A;  1JTO L;  5F16 A;  1A4V A;  3CSZ A;  194L A;  2DBT A;  2LZT A;  1CV0 A;  1DPX A;  5LVG A;  1VAU A;  4B4J A;  5LAG A;  1CJ9 A;  4BAF A;  247L A;  4B0D A;  1GFG A;  2OE7 X;  187L A;  1PQO A;  3AW7 A;  1IWU A;  1PQK A;  2ZYP A;  1QUO A;  1YIK A;  112L A;  3TXD A;  1LJH A;  4PJ2 C;  4B1A A;  1OUI A;  1JKB A;  2HEA A;  4PK0 A;  3HBH A;  1L73 A;  2RBO A;  4ET9 A;  1L29 A;  4GLA A;  143L A;  217L A;  1LZ9 A;  3G3A B;  4S0W A;  4BS7 A;  1D3M A;  1W6Z A;  245L A;  1IP2 A;  1GF0 A;  1L49 A;  138L A;  1P6Y A;  4ARJ A;  4YXA C;  3QY4 A;  1XEI A;  1OUD A;  4IJ4 A;  2A4T A;  258L A;  3EXD A;  1L66 A;  5C6L A;  2BQL A;  188L A;  1HMK A;  1P5C A;  140L A;  1L09 A;  1GE0 A;  2B6T A;  1KW7 A;  149L A;  1LZT A;  238L A;  2DQI Y;  3WU7 A;  1YRO A;  2ZNX Y;  1XGP C;  1LSA A;  1GD6 A;  1XEP A;  4XN6 A;  1CUP A;  1DYA A;  2CGI A;  3CT0 A;  208L A;  1QT3 A;  2ANX A;  4GCF A;  175L A;  2Y8P A;  1VDQ A;  3DMZ A;  225L A;  4G9S A;  1C6L A;  1ZWN A;  4H9E A;  3P66 A;  3CDR A;  1LYI A;  2BLY A;  4ZPU A;  4C5F A;  1XFP L;  1LSE A;  2D4K A;  3LYO A;  4LYZ A;  1L74 A;  1J1P Y;  4H9A A;  1B7Q A;  2B5Z A;  1QT5 A;  3CSQ A;  1P36 A;  153L A;  232L A;  1IVM A;  1GB5 A;  1MLC E;  4NGY A;  1DXJ A;  1T3P A;  3C7Z A;  5T3F A;  1L12 A;  4NGJ A;  1T8F A;  4B49 A;  1J1O Y;  3AZ6 A;  2IHL A;  1L98 A;  1CV4 A;  4ETC A;  1WTM A;  3SB6 A;  1T97 A;  2HED A;  4NSJ A;  3GXK A;  1LZR A;  1UIA A;  1LJK A;  1L26 A;  5F9X A;  5M1Y A;  1UIG A;  1YAP A;  3VW7 A;  1YAO A;  1ZYT A;  4R6C A;  4TSC A;  4XJF A;  3GUI A;  4DAJ A;  2RAY X;  1RFP A;  1IWW A;  1D2W A;  1LZE A;  4GN5 C;  5B1G A;  4OO9 A;  5KXM A;  4ARP A;  4RW1 A;  1JSF A;  1CUQ A;  1TEW A;  3RT5 X;  1L00 A;  1C6J A;  3HH3 A;  4N5R A;  1L20 A;  1L16 A;  4W52 A;  4N0J A;  4LDL A;  3IJV A;  1PQM A;  241L A;  1G7I C;  4YEN A;  1QTC A;  1DYD A;  6LYT A;  4P2E A;  1GFK A;  2AUB A;  1L08 A;  4DD2 A;  1L10 A;  1L30 A;  4YEO A;  2MED A;  1NF5 A;  1B0D A;  3W6A A;  1L36 A;  4NWE A;  160L A;  1LHI A;  132L A;  218L A;  1L65 A;  113L A;  3ZVQ A;  1YQV Y;  1IWX A;  4W55 A;  1L70 A;  120L A;  1IEE A;  4Z41 A;  4H9I A;  1AKI A;  1HEQ A;  2ZYC A;  4XYY A;  1GB0 A;  1LHH A;  1GE2 A;  127L A;  1NDG C;  3N9A A;  2RBR A;  2OE9 X;  5DL9 A;  5B59 A;  1C43 A;  5B05 A;  240L A;  3WMK A;  1UIB A;  5I4Y A;  1LJG A;  4WOA A;  4I7P A;  1RE2 A;  3TMX A;  1C7P A;  1B5Z A;  1L83 A;  1CTW A;  1MEL L;  3P68 A;  1C68 A;  1L62 A;  3GUL A;  1GDW A;  1L01 A;  3EBA B;  3SP3 A;  129L A;  1LZN A;  1JJ1 A;  104L A;  1LZY A;  1LSY A;  2XBS A;  2Z2E A;  3EML A;  1DZB X;  185L A;  3UON A;  1HC0 A;  5KXX A;  1B7R A;  3K2R A;  1HNL A;  2ANV A;  4OWA A;  4N8Z A;  1CU2 A;  4WM3 A;  172L A;  1PQJ A;  1L35 A;  1LJ4 A;  1P46 A;  3CT5 A;  1L58 A;  3A6C Y;  1CJ6 A;  1LTM A;  4DJH A;  126L A;  1L48 A;  3DN4 A;  1WQP A;  3HT8 A;  156L A;  4DQ7 A;  4EKR A;  1JJ3 A;  196L A;  1VED A;  4NGV A;  1QTB A;  1KW5 A;  3G3V A;  1L82 A;  4WG1 A;  4ZEE A;  5LVK A;  4XJH A;  2OU9 A;  4YXC A;  1B5W A;  4I0C A;  189L A;  1DKJ A;  5DN4 A;  2CWI A;  1HEL A;  1P56 A;  1PZY A;  209L A;  5LXW A;  5I54 A;  5KXN A;  1CKF A;  3WUL A;  2D91 A;  1LZ6 A;  1C6C A;  4BAD A;  1C6F A;  1JIS A;  1HER A;  1LHJ A;  1UBZ A;  2F2N A;  1LSC A;  1BWI A;  2N5Z A;  2D4I A;  1JIT A;  122L A;  2CUU A;  2FYD A;  229L A;  4AQN A;  4Z98 A;  1QS9 A;  2MEC A;  4N1E I;  1CJ7 A;  4H92 A;  1LYY A;  1P37 A;  2LYZ A;  3HTD A;  1LZA A;  1F10 A;  4I7S A;  3N9E A;  4M4O A;  2ZNW Y;  4HTQ A;  2A7D A;  1GFA A;  5APD A;  234L A;  3PBL A;  4XJB A;  5KKJ A;  3T6U A;  3OE0 A;  125L A;  1YKX X;  4I7N A;  9LYZ A;  2RAZ X;  2F30 A;  5I4W A;  1HFX A;  3C8S A;  2RB0 X;  4D9Z A;  3WXT A;  2LZM A;  3LYM A;  2HEB A;  3LYZ A;  1GEV A;  3JR6 A;  2MEB A;  1OUH A;  3J6K A;  4EMN A;  4W59 A;  1BB6 A;  1L59 A;  180L A;  1B5V A;  4LT1 A;  114L A;  139L A;  2O4W A;  3HU8 A;  1C66 A;  3HUA A;  4DT3 A;  5FEK A;  239L A;  4NHS A;  2OU0 X;  133L A;  1GFT A;  3IWR A;  4WG7 A;  2HUB A;  4BAP A;  1GFE A;  2B6X A;  3F8V A;  4I7R A;  1PQD A;  1RI8 B;  2FYC A;  1GXV 2;  1L37 A;  255L A;  3SB9 A;  5E9R A;  182L A;  3G3W A;  4NGZ A;  1UA6 Y;  2Z38 A;  1G1V A;  1L90 A;  1DI3 A;  215L A;  1QIO A;  3FI7 A;  2YBJ A;  1L50 A;  1L51 A;  5APC A;  3RUN A;  4DD9 A;  1SSY A;  4LT2 A;  4H9F A;  5FST A;  1EPY A;  1I1Z A;  4DDC A;  1OUC A;  3V2Y A;  2WAR A;  1XGR C;  1C6M A;  1W08 A;  4NIJ A;  261L A;  3IJU A;  1OWY A;  3GUP A;  1DI5 A;  1L17 A;  1NDM C;  3FI5 A;  1KXY A;  3HBE X;  3HT9 A;  3WW6 A;  4ZFP A;  3OK0 A;  1L53 A;  1QTE A;  4ARQ A;  1XJU A;  1C08 C;  4HPE A;  144L A;  1G1W A;  2B6Y A;  4CHX A;  1LJJ A;  3DNA A;  3DKE X;  1FLU A;  254L A;  1LSN A;  3EO5 A;  4NGL A;  5LAF A;  4M6D A;  2O79 A;  1NQI A;  1L86 A;  3QNG A;  2ZQ3 A;  2BQJ A;  4EKS A;  3AGH A;  4PHI A;  3OE6 A;  1UUZ C;  1GXX A;  181L A;  190L A;  5KXS A;  1C6I A;  1OV7 A;  2BLX A;  3TXF A;  4OW1 A;  3WUM A;  1LMN A;  1QT7 A;  2Z37 A;  1LJI A;  1C6G A;  1LYZ A;  1GBO A;  5DN5 A;  1ALC A;  3B0K A;  3HDE A;  4B4I A;  1IC4 Y;  2Z19 A;  1L28 A;  1LMC A;  3C7W A;  211L A;  3HTG A;  1DQJ C;  2BQM A;  1XGT C;  3B72 A;  186L A;  2Z6B A;  7LZM A;  1AT6 A;  1OWZ A;  3M18 B;  4I7L A;  1L06 A;  233L A;  109L A;  4X3B A;  1AT5 A;  1VDP A;  256L A;  2Q0M X;  1LSD A;  5IHG A;  141L A;  1EQ5 A;  4DD7 A;  4W56 A;  1CV5 A;  3TXG A;  3FA0 A;  1JPO A;  1TLA A;  1D6Q A;  1GPQ C;  3BKV A;  1J1X Y;  128L A;  2LHM A;  1LYS A;  2W1M A;  4J0L A;  3WH1 A;  1QT8 A;  1L89 A;  1QTV A;  3A95 A;  4EPF A;  3P65 A;  3G3B B;  3N9C A;  1EQE A;  1OUA A;  1OUB A;  3ODU A;  1GF9 A;  1GF8 A;  1QUG A;  253L A;  3C80 A;  1LMQ A;  3CDV A;  123L A;  6LYZ A;  1L0J A;  4WO6 A;  1GHL A;  219L A;  1B7P A;  4I8S A;  1LSM A;  4ML7 A;  1BB5 A;  3P64 A;  2F32 A;  206L A;  1NHE A;  3WUN A;  1SWZ A;  4GCB A;  2B75 A;  1OVK A;  1BHZ A;  1QDR A;  1D3F A;  1RCM A;  2BAA A;  1C61 A;  250L A;  1L11 A;  1LGX A;  1OUF A;  3CDT A;  4G49 A;  4HP0 A;  5I14 A;  2HUK A;  4WM6 A;  1IX0 A;  1L75 A;  5I53 A;  184L A;  1SWY A;  1L99 A;  1YAQ A;  119L A;  1REM A;  3DN2 A;  3SBA A;  1LPI A;  1C6T A;  4YOP A;  1IR9 A;  2W1X A;  201L A;  4Z3M A;  157L A;  4R0F A;  2I6Z A;  252L A;  2BQC A;  2HTX A;  1HEM A;  4YF2 A;  192L A;  1XGQ C;  1C10 A;  3ATN A;  4LFP A;  1LYO A;  1HEW A;  1L41 A;  4GCC A;  1GAY A;  1L04 A;  3C82 A;  2DKV A;  4FDY A;  2BQH A;  1GF4 A;  199L A;  1OQM A;  2ZWB A;  7LYZ A;  1G0P A;  5KKI A;  3W3E A;  1YAN A;  3RZ4 A;  1OUG A;  1LZG A;  5LVJ A;  1REX A;  1JTP L;  5KXT A;  4ARM A;  2BQE A;  4DDB A;  1L91 A;  4W94 A;  2I25 L;  1OVH A;  3OE9 A;  2X0A A;  3DN3 A;  4OOT A;  1LSB A;  1XJT A;  1L61 A;  1GE4 A;  3HFM Y;  4XEN A;  1IR8 A;  158L A;  1JKA A;  1QTH A;  3WPJ A;  1L25 A;  1P2R A;  1L40 A;  1T8G A;  4NG1 A;  5E4P A;  1QQY A;  1JTM A;  1IY4 A;  3B6L A;  1L32 A;  1GFJ A;  1WQR A;  2C8O A;  2VB1 A;  1UIE A;  3CQL A;  4OWC A;  1C6H A;  4TTD A;  5D5F A;  1LYJ A;  1KY1 A;  1YL1 X;  1B5U A;  1LMA A;  3TXI A;  4Z46 A;  4H8Z A;  1L76 A;  1LHL A;  1LZD A;  1IWZ A;  4NSG A;  4K5Y A;  5LVH A;  167L A;  2YBH A;  1HSW A;  4W53 A;  1L77 A;  154L A;  4GBR B;  1IOS A;  177L A;  1IY3 A;  2BQB A;  1CNS A;  2MEE A;  1L42 A;  2QB0 B;  1YL0 X;  2OEA X;  4N9R A;  1C63 A;  1L63 A;  1JKD A;  1C69 A;  1I56 A;  1GF5 A;  2HU1 A;  137L A;  1ZMY L;  2RH1 A;  3GUN A;  3AGG G;  1OV5 A;  4LGK A;  4W51 A;  3WVY A;  1L85 A;  1LWK A;  3LZT A;  197L A;  3RNX A;  8LYZ A;  4DC4 A;  2YBN A;  1L39 A;  3LZ2 A;  224L A;  131L A;  1TBY A;  246L A;  1IP6 A;  4N1C C;  169L A;  4LFX A;  1GBS A;  3NY8 A;  4A7D A;  1LJN A;  1QSQ A;  5I5Q A;  1FLW A;  3F9L A;  1C6P A;  4LYB A;  2DQG Y;  1SQ2 L;  1CKG A;  4DQJ A;  2D4J A;  1LYF A;  4HJZ A;  3CB7 A;  1IC7 Y;  2ZIL A;  2O7A A;  3HDF A;  1B7S A;  4W58 A;  3GXR A;  1LGU A;  2D6B A;  4EOF A;  191L A;  2A7F A;  4CFP A;  1BB4 A;  1B7O A;  4NHQ A;  1H6M A;  4WM4 A;  1G7M C;  168L A;  5KXL A;  1LOZ A;  4OWB A;  3A93 A;  1QTD A;  4O34 A;  2Z18 A;  1GF7 A;  4H93 A;  1FKV A;  4DWX A;  1KIQ C;  2H5Z A;  2DQE Y;  4WO9 A;  3HUQ A;  1OUJ A;  1WQM A;  4KT3 A;  4KXI A;  3CT1 A;  2HUL A;  4AGA A;  1LI3 A;  1OUE A;  3FE0 A;  2NTH A;  1P7S A;  1IWV A;  1UCO A;  212L A;  3B0O A;  5HMV A;  174L A;  1IC5 Y;  4NWH A;  4XJG A;  1VAT A;  1CKC A;  222L A;  2XTH A;  4XJI A;  1TCY A;  5JEN B;  5KXY A;  1YKY X;  1L19 A;  5HLL A;  1L18 A;  4PRU A;  1P2C C;  1CKH A;  1REZ A;  162L A;  226L A;  5KXR A;  2RBS A;  3CDO A;  1LW9 A;  5D5C A;  1JIY A;  2CJL A;  2H9J A;  227L A;  1C67 A;  1HF4 A;  3TXE A;  1C6B A;  4NEB A;  5IDD A;  3G3X A;  2I26 L;  2XQO A;  103L A;  4HJY A;  102L A;  2RB1 X;  3P4Z A;  4IAS A;  1VDS A;  4NHP A;  1L55 A;  193L A;  4OWH A;  1HML A;  210L A;  2IGC A;  1GB6 A;  2B7X A;  1L92 A;  4B4E A;  3D3D A;  3B0I A;  3WW5 A;  4QY9 A;  1L71 A;  1HEP A;  1T8A A;  1GF3 A;  1NHB A;  2FBD A;  5B1F A;  1LZ4 A;  4WMG A;  2G4P A;  2OU8 A;  5DM9 A;  4DDA A;  1C6K A;  1IP3 A;  3CSR A;  4KL7 A;  4RW2 A;  242L A;  4LYC A;  4HV1 A;  5EBH A;  2B72 A;  1L64 A;  4LT3 A;  1KXW A;  4ETE A;  1IP1 A;  1C6D A;  5HQ1 A;  5F9U A;  111L A;  2W1Y A;  5FHW A;  1KY0 A;  1PQI A;  2HUM A;  1BB3 A;  3HWL A;  108L A;  1H87 A;  1XSF A;  1QT6 A;  4FJR A;  1RJC B;  1L72 A;  1QT4 A;  1GFU A;  5KXP A;  1AM7 A;  5DLA A;  1L23 A;  1L02 A;  2YBL A;  4RLM A;  2YBM A;  4DYG A;  1DYB A;  1L47 A;  4ETB A;  1KIR C;  1NMM A;  1G7L C;  2F47 A;  3A90 A;  1YAM A;  2L78 A;  5A3Z A;  3LZM A;  1L46 A;  4YX7 C;  2Z12 A;  159L A;  1GFV A;  1P2L A;  142L A;  1CU5 A;  216L A;  4XJD A;  2XJW A;  3A6B Y;  2LC9 A;  3SB5 A;  1C6Q A;  2DQH Y;  1LJE A;  251L A;  4IAT A;  1L88 A;  4MR1 A;  130L A;  1IOR A;  1BGI A;  1L69 A;  5KY1 A;  5L3I A;  198L A;  3ZEK A;  3D4S A;  2G4N A;  4ETD A;  1LMT A;  1LJF A;  4NHI A;  3TXK A;  1L57 A;  1TDY A;  1SX2 A;  2HEC A;  4IAP A;  5LYM A;  2DQF C;  2EQL A;  1PS5 A;  2BQD A;  2IFF Y;  1GBZ A;  1UAC Y;  2DQA A;  1F0W A;  3GUK A;  3DN1 A;  5LYZ A;  150L A;  1LMP A;  1D2Y A;  135L A;  4J7V A;  1C6A A;  1C65 A;  4ZIX A;  1L21 A;  3HH4 A;  1GBY A;  4H8X A;  5ILC A;  1B7N A;  3DN6 A;  2LCB A;  5KXZ A;  4E97 A;  4H9C A;  1L54 A;  1F6S A;  3C83 A;  2BQN A;  1L43 A;  4TX7 A;  1LKR A;  1EL1 A;  1TAY A;  5FEL A;  4I7Q A;  1IWT A;  5HNC A;  5KJ9 A;  4H91 A;  1GAZ A;  1F6R A;  3HBD A;  213L A;  1GFR A;  4I7M A;  3DN8 A;  4LDE A;  3J4G A;  3HUK A;  1G0Q A;  3A3R X;  3NYA A;  1FLY A;  3TXH A;  1LZ8 A;  3GUO A;  1D0M A;  4LZM A;  5K7O A;  1WVV A;  5J7C A;  5L3H A;  1FKQ A;  2BPU A;  1C6N A;  1GE3 A;  170L A;  1E8L A;  3A8Z A;  4PJZ A;  1B9O A;  3AJN A;  1BB7 A;  3TXB A;  2YDG A;  3AGI A;  1LPY A;  3QE8 A;  5B07 A;  1QS5 A;  3KAM A;  3ZVQ B;  1JHL A;  1HFY A;  2G4Q A;  107L A;  4EJ4 A;  1HHL A;  1L14 A;  3C8R A;  1CJ8 A;  1AZF A;  223L A;  3W6F A;  1IOT A;  1LYH A;  1CV1 A;  5B06 A;  1BVX A;  4WLT A;  3M3U A;  4LT0 A;  5LYT A;  1JEF A;  3AB6 A;  1L81 A;  1L0K A;  3NY9 A;  3WU8 A;  1LHK A;  3SBB C;  1IWY A;  1LJ3 A;  1GEZ A;  5L9J A;  1FN5 A;  4H9H A;  5I4X A;  1VFB C;  230L A;  4NGW A;  2ZQ4 A;  1YKZ X;  1OVJ A;  3ULR A;  1EQ4 A;  1NKH A;  5A3E A;  5LA8 A;  4QDN A;  2HU3 A;  1G0M A;  2HEF A;  1BQL Y;  5AMY A;  4GRV A;  178L A;  4II8 A;  1DKK A;  4GCE A;  4HV2 A;  4DD0 A;  2NTG A;  1WQN A;  5HNL A;  1GF6 A;  1OP9 B;  2B73 A;  4LZT A;  1FLQ A;  1C62 A;  1XGU C;  1IR7 A;  4G4B A;  4NGI A;  1NBZ C;  249L A;  4HSF A;  4UWV A;  205L A;  4C3W A;  1XEK A;  2YVB A;  5II3 A;  3SN6 R;  3C8Q A;  1G7H C;  3FAD A;  3HT6 A;  3L64 A;  1L95 A;  1C64 A;  1QSA A;  3A34 A;  1T6H A;  3TXJ A;  1LZ5 A;  1UID A;  2MEF A;  4CFO A;  1L87 A;  3A91 A;  1BWJ A;  1QUS A;  1LSF A;  1ZUR A;  1B7L A;  1LYE A;  4CJ2 A;  4H1P A;  4I7K A;  4NFV A;  4QEQ A;  1SLY A;  3W6B A;  235L A;  5KXW A;  1OYU A;  2C8P A;  2F4G A;  4EXM A;  1LZC A;  4L41 A;  3A94 A;  4OWE A;  2GV0 A;  3D9A C;  1KXX A;  1CV3 A;  6LZM A;  1QSW A;  1L22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...