224LA

The energetic cost and the structural consequences of burying a hydroxyl group within the core of a protein determined from ala to ser and val to thr substitutions in t4 lysozyme
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
162
structure length
162
Chain Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDSVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords T4 LYSOZYME
publication title Energetic cost and structural consequences of burying a hydroxyl group within the core of a protein determined from Ala-->Ser and Val-->Thr substitutions in T4 lysozyme.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 60
structure length 162
sequence length 162
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 1993-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 224lA00
2RB1X 3GUNA 1T97A 4LDEA 1DYBA 3SBAA 252LA 4LDLA 1CX6A 1L30A 1EPYA 232LA 4OO9A 4I7PA 1QS9A 3C8SA 3DN4A 156LA 159LA 158LA 2Q9EA 213LA 2RAZX 1L35A 180LA 256LA 1CV5A 250LA 221LA 2QARC 1C6HA 4LDOA 178LA 1SX7A 181LA 239LA 2B7XA 3DN0A 4PK0A 215LA 1LPYA 1KW5A 3OE6A 168LA 130LA 4EPIA 3DMVA 4DKLA 4W59A 2QB0B 1C62A 1QUGA 162LA 139LA 160LA 1G0KA 1CV3A 184LA 1G0MA 3SB7A 125LA 3FI5A 3V2WA 1L96A 4EKQA 4W56A 3HTBA 1DYFA 223LA 225LA 183LA 1C6LA 4W53A 6LZMA 3C7WA 1LYJA 115LA 1L12A 3C81A 155LA 119LA 2B74A 235LA 1KS3A 189LA 108LA 4E97A 222LA 1CV1A 1G0QA 1L05A 110LA 1KNIA 1L48A 191LA 1CV6A 3HU8A 1QUHA 206LA 4K5YA 1QTDA 1L66A 1C6KA 1L99A 1LI2A 2OE7X 140LA 169LA 1C61A 1L03A 1L25A 1C60A 3OE9A 2OE9X 1L54A 1P46A 1C6CA 4S0WA 1L52A 4I7LA 1L18A 1D9WA 1D3MA 255LA 3GUIA 182LA 112LA 161LA 2RBSA 1CUQA 1L0JA 3C7YA 246LA 1L11A 176LA 4GBRB 1QT5A 4W51A 3RZEA 4IAPA 4ARLA 1L94A 4EKRA 1PQOA 1QT6A 3SB6A 150LA 109LA 1P37A 3CDOA 2F47A 1JQUA 243LA 2RB0X 114LA 1ZURA 2HUKA 4I7JA 224LA 197LA 1PQMA 262LA 1OV5A 2F32A 1OWYA 1NHBA 143LA 186LA 216LA 1KW7A 1L70A 1L86A 172LA 238LA 1QTVA 1L23A 1L01A 261LA 1QT4A 3UONA 1WTHA 7LZMA 3NY8A 4YX7C 1G1WA 3F8VA 2B70A 1L04A 1QS5A 1L67A 1D3FA 1L16A 1SSYA 1L62A 2LC9A 3JR6A 1DYCA 257LA 1L64A 3CDQA 1P64A 1CU5A 1QTZA 190LA 1PQDA 102LA 1LWGA 1T8GA 145LA 3F9LA 1C63A 1L69A 1C6TA 1L87A 1L15A 1CU3A 1L93A 1DYAA 1L44A 253LA 1L28A 1D2YA 3HH5A 1ZWNA 230LA 247LA 2IGCA 1LYGA 1L85A 4I7RA 111LA 3HDEA 1C65A 1L49A 3ODUA 1L06A 1QUOA 1LYDA 3HWLA 2HULA 1C6NA 3HT8A 1C6JA 1L47A 3CDVA 1T8FA 1G1VA 4W57A 1L79A 3G3VA 1L10A 228LA 1C64A 151LA 241LA 1C67A 244LA 2O7AA 3DN6A 226LA 3GULA 1L41A 1L76A 1LI6A 1L68A 1L00A 1XJUA 4EJ4A 3GUPA 3RUNA 1PQJA 104LA 1QSBA 3G3XA 3LZMA 1L65A 1DYEA 185LA 149LA 1L63A 103LA 1C69A 2A4TA 2RBPA 3DN8A 2B6YA 131LA 1XJTA 1T6HA 3DKEX 3HDFA 248LA 3GUMA 120LA 1L89A 4I7SA 3HTFA 152LA 1L45A 1LYEA 212LA 3GUJA 4ARQB 1P7SA 2LZMA 3HH4A 122LA 1G06A 1QT3A 1SSWA 2LCBA 177LA 1C6BA 3K2RA 1CX7A 4I7OA 1L56A 1L59A 4ARJA 227LA 1L80A 2HUMA 1QTBA 4W55A 2O79A 1L29A 1L0KA 1QUDA 1C6GA 3HTDA 1L50A 1P2LA 1L14A 3NY9A 1OV7A 1P2RA 1L73A 1L81A 3L64A 137LA 1DYGA 1CU0A 1XEPA 4ARQA 2ANVA 3L2XA 1C66A 3SB8A 1P36A 171LA 1L08A 1LGXA 1LWKA 4ARMB 3PDSA 3G3WA 3HUKA 1C6IA 2RBOA 174LA 129LA 2OU9A 1C6QA 2NTGA 1DYDA 2Q9DA 2Z6BA 1L82A 1QTHA 3OE0A 4I7QA 4PJZA 3SB9A 195LA 4I7MA 157LA 2RH1A 1L24A 3C7ZA 1C6DA 4EPFA 167LA 3DNAA 1L71A 1L31A 1L34A 245LA 2OE4X 1P3NA 1PQIA 1QT7A 1ZYTA 141LA 3HT7A 233LA 1OYUA 258LA 3QAKA 1L02A 3SB5A 1LYIA 148LE 1CTWA 3OE8A 1CV0A 1LYHA 2F2QA 126LA 1C68A 1G07A 1L88A 1L46A 3DN2A 1L38A 1L17A 4I7NA 5I14A 2B6XA 4ARPA 198LA 1L39A 1L37A 236LA 2RBNA 1L60A 2OU0X 3DN1A 3DMZA 1I6SA 4W54A 3GUOA 211LA 3CDTA 1L36A 1C6AA 2OU8A 1D3JA 123LA 1L58A 1LI3A 2B75A 170LA 1L40A 1L43A 4ZPUA 3HH6A 1L90A 200LA 220LA 1L21A 1L09A 1L22A 1K28A 2RBQA 196LA 1L13A 209LA 1SX2A 3SN6R 1L32A 1JTNA 2L78A 166LA 2B6ZA 251LA 3SBBC 1L55A 260LA 3HT6A 4I7TA 3C8QA 2RB2X 3EMLA 1L97A 3HU9A 1TLAA 118LA 1L26A 1LGUA 1P56A 3V2YA 3VW7A 175LA 146LA 165LA 187LA 1C6MA 1L42A 188LA 3D4SA 1CUPA 1L57A 1L74A 234LA 2B73A 4I7KA 219LA 1G0LA 1OVJA 242LA 1L20A 1PQKA 3HTGA 1D3NA 1C6FA 138LA 1C6PA 164LA 1QT8A 237LA 2NTHA 1CU6A 2O4WA 3FA0A 3FADA 1G0GA 4YXAC 3NYAA 1SWZA 4AQNA 2B72A 1L27A 127LA 1CU2A 4W52A 4DAJA 3DN3A 1JTMA 107LA 2OTZX 1L92A 1L75A 1L72A 1OWZA 4W58A 2OEAX 1T8AA 249LA 1L61A 1L98A 173LA 1L84A 3C82A 1L51A 240LA 229LA 218LA 259LA 205LA 1LW9A 3C8RA 3HH3A 128LA 1CV4A 1LYFA 2OTYX 1G0JA 2ANXA 3C80A 113LA 3CDRA 1KY0A 1L95A 142LA 1CVKA 199LA 3HUAA 1OVHA 1OVKA 254LA 231LA 5LZMA 163LA 210LA 192LA 2RBRA 2CUUA 4EXMA 1QTCA 1B6IA 217LA 4GRVA 2B6TA 1C6EA 3PBLA 144LA 3C83A 1D2WA 4YXCA 214LA 1L19A 1LLHA 4EKPA 3HT9A 3HUQA 4EKSA 1SWYA 1P5CA 2B6WA 4LZMA 1L83A 3DMXA 1LGWA 1L53A 4ARMA 201LA 1G0PA 1KY1A 4DJHA 2RAYX 1L91A 147LA 1QSQA 1P6YA 1L07A 3GUKA 1L77A 1L33A
chains in the Genus database with same CATH superfamily
2RB1X 1LHIA 1T97A 1QTKA 2DQCY 3P68A 4XENA 252LA 1L30A 1EPYA 1IR8A 232LA 4I7PA 4OO9A 4M4OA 2B5ZA 256LA 1FKQA 1V7SA 4G49A 239LA 2LYMA 5FEKA 3DN0A 1GXV2 4ET8A 3OE6A 1I20A 130LA 5B59A 3DMVA 4W59A 2DQHY 2ZILA 1C62A 5FHWA 1F6SA 160LA 1I1ZA 3FI5A 3V2WA 1UUZC 5HQ1A 1LMPA 1RI8B 1REYA 3A92A 3AZ6A 225LA 3K3TA 1LYJA 4XJDA 1L12A 155LA 3M18B 4GN3A 3A6CY 2HTXA 1B0DA 2DQFC 2DQGY 1G0QA 4LT0A 2BQIA 1CV6A 3HU8A 1JSEA 1OUJA 4LYOA 3EBAB 5HNLA 3CT5A 4RDSA 4K5YA 1JUGA 4N0JA 1LI2A 2OE7X 140LA 2XQOA 1C60A 1D6QA 1B5YA 4XYYA 2MEDA 112LA 1CUQA 2Z37A 3W6AA 2HECA 1YAMA 3RZEA 1IP2A 1W08A 4EKRA 1QT6A 4NSJA 1GE0A 1GB5A 3IWRA 4X3BA 4WM1A 4NHIA 4I7JA 1PQMA 1OV5A 2F32A 1OWYA 1NHBA 1FLQA 1L70A 172LA 1GFEA 1KXYA 238LA 3NY8A 4WLDA 2BQFA 2ZQ4A 3A34A 4N5RA 2MEGA 5C6JA 4H8ZA 1SSYA 3W6EA 1XSFA 5DLAA 4LGKA 4DWXA 4B4JA 1LSYA 1NKHA 1QTZA 4HTNA 2MEFA 1CJ7A 3F9LA 4H9EA 1L87A 2FYCA 1L44A 253LA 1GB2A 1HFXA 230LA 1B5ZA 2IGCA 5LA5A 1LJHA 1OUGA 4I7RA 111LA 1FKVA 4B4IA 3ODUA 1LSDA 4ETBA 2D6BA 5LXWA 1HEWA 3HT8A 5I4WA 3CDVA 1QSWA 4W57A 1L79A 3P66A 1OUBA 5LAFA 3GULA 1OUEA 1LSEA 1SQ2L 4EJ4A 3RUNA 1QSBA 5KJ9A 1H87A 4DQ7A 1JTPL 3WUAA 2RBPA 3DN8A 4LT1A 1D6PA 4OWEA 2PC2A 3HDFA 1JPOA 1BVKC 152LA 1L45A 2H9JA 1DQJC 5APCA 4ARQB 1P7SA 3HFMY 1QT3A 1SSWA 1GBWA 1C6BA 1B2KA 4AGAA 1JJ3A 1LMTA 1L59A 4NSGA 1L80A 1WQQA 1QTBA 1L29A 1L0KA 3LN2A 1C6GA 1XGQC 1L14A 4C5FA 153LA 4LFPA 5KY1A 1L81A 1GBZA 1XEPA 1C66A 3SB8A 1GFRA 3G3WA 2VB1A 2NTGA 1DYDA 4QGZA 2Q9DA 1QTHA 4ETDA 4KXIA 3OE0A 4I7QA 4PJZA 195LA 3A90A 4I7MA 1EQEA 157LA 4NGVA 2RH1A 3CSQA 1LSMA 1L71A 3AZ5A 3WUMA 207LA 2BQBA 1XGPC 4GCBA 3QAKA 1L02A 1E8LA 2LHMA 3OE8A 3WXUA 1CV0A 2CJLA 4NWHA 2F2NA 1C68A 1L38A 1L17A 2YBHA 1AT6A 4H8XA 1IP6A 198LA 3QY4A 1L37A 1LJIA 211LA 1C46A 4G9SA 1JJ1A 1L58A 2BQOA 2GV0A 1LKSA 5I5QA 2B75A 1L43A 3CSZA 220LA 1L09A 1K28A 196LA 1MLCE 1ZVYB 1WQMA 1GBSA 3SN6R 2ZNWY 4KT3A 2L78A 3GXKA 251LA 260LA 3C8QA 2RB2X 3AB6A 118LA 1L26A 3V2YA 1HSXA 5KXTA 1L42A 1BB6A 1UICA 2BQAA 242LA 1GEZA 1YL1X 4WMGA 4OOTA 2HEAA 4H9HA 4E3UA 3TMVA 5T3FA 4DAJA 1JTMA 1ZV5L 107LA 2OTZX 1V7TA 3W6CA 3TXFA 1JIYA 1L84A 1REMA 9LYZA 229LA 205LA 1OUIA 1LYFA 4B49A 5KXYA 5L3IA 2H9KA 2OTYX 3CDRA 1GDWA 1LSGA 2H5ZA 142LA 3HUAA 2YBJA 1P2CC 1BVXA 1LSPA 1LAAA 163LA 1IP4A 4GCDA 192LA 2CUUA 1QTCA 1QDRA 3WXTA 1CJ6A 1C6EA 1F0WA 4LZTA 5AMYA 1L19A 5FSTA 5LINA 4HP0A 3HUQA 1GF8A 4EKSA 1VATA 1SWYA 2NWDX 1WQPA 5L9JA 4ARMA 201LA 3HBEX 1GPQC 1TEWA 4NFVA 4DYGA 1DPXA 4G4HA 6LYTA 2BLYA 1L33A 1GF0A 3CB7A 4LDEA 1LYSA 4YF2A 1JJ0A 2XTHA 1DYBA 4TX7A 4LDLA 1GE2A 1HHLA 1JKAA 1XFPL 1VAUA 1B7PA 1UIFA 4N9RA 156LA 4ETAA 213LA 4ANRA 135LA 2F4GA 180LA 250LA 1GF3A 4LDOA 2BQHA 4IJ4A 2B7XA 3WMKA 4OOOA 3A6BY 3VWOA 1QUSA 5JENB 4J1BA 5LVKA 4CJ2A 168LA 2HEBA 3D9AC 1REXA 5B1GA 1GFHA 3RNXA 1IR9A 4B1AA 1JTOL 1CV3A 184LA 1G0MA 5D5CA 2LYOA 1LOZA 1KXWA 3F6ZA 4TTDA 5LAGA 1IWVA 1C6LA 6LZMA 1C10A 1CJ9A 2DBTA 3RW8A 119LA 235LA 1B7LA 1QQYA 4WO9A 4OWBA 191LA 4RLMA 1F10A 1QUHA 4ZFPA 1L99A 169LA 1L03A 1L25A 2LZTA 4LYCA 1B7MA 2OE9X 2HU3A 4S0WA 1L52A 4I7LA 4HPEA 5KXPA 182LA 4Z41A 1BWJA 161LA 2RBSA 4NHQA 1RJCB 1L11A 3B72A 3QNGA 1D0LA 1HEMA 3AW7A 1W6ZA 1PQOA 1P37A 1HFZA 2Z18A 1JQUA 1LHMA 243LA 3HBDA 1ZURA 2HUKA 197LA 262LA 1IR7A 1GF4A 186LA 1C08C 2BAAA 4LFXA 1QTVA 1AM7A 1L01A 3W6BA 7LZMA 5I53A 5APDA 3A3RX 1L67A 3EO5A 4DD7A 3JR6A 1L62A 5HNCA 3W6DA 5B07A 257LA 4LYTA 1P64A 2W1MA 190LA 1GWDA 1NBYC 145LA 1CU3A 1L93A 4ML7A 3A8ZA 3ZEKA 4PRQA 1LYGA 4WO6A 3TXHA 3WU9A 1B5XA 1C65A 1GBOA 1EQ4A 1JKDA 4Z46A 1QUOA 3WYHA 1UIDA 5HMVA 4DDCA 1C6JA 1L47A 2W1XA 4BAPA 1G1VA 1SLYA 4NHSA 1GE4A 228LA 1LMOA 3G3VA 5C6LA 3P65A 2ZNXY 3OJPA 1FDLY 1LMNA 1LZ5A 3GUPA 2D4KA 5KXSA 4DD9A 3LZMA 3G3XA 4U3XB 1G7LC 4PHIA 4WLXA 3QE8A 1UIAA 1VDTA 1C69A 5APEA 1LSCA 1VFBC 3W3EA 5KXMA 4GLVA 2B6YA 1IWXA 4H9CA 131LA 5F14A 5LYZA 1HEPA 1T6HA 1GFVA 2HEFA 5C6IA 3HTFA 2IFFY 1LYEA 2MECA 3GUJA 1YKXX 2LZMA 1LZ8A 1DXJA 4YEMA 1XEIA 2LCBA 3K2RA 1HEOA 1JWRA 4ARJA 5L3HA 4DD2A 2HUMA 1LZCA 4P2EA 4W55A 2O79A 5LYTA 3TMUA 1L50A 3NY9A 1OV7A 1P2RA 1WVUA 2LYZA 1CKHA 2Z38A 4NGOA 137LA 1B7OA 1GFJA 3LZ2A 4ARQA 2ANVA 3WW6A 1OUCA 1L08A 1JEFA 1LHKA 4DC4A 5FCPA 1C6IA 174LA 1LZBA 3WVYA 1G7MC 1DI4A 2Z6BA 3AZ7A 4TUNA 3SB9A 4XADA 5F9XA 3C7ZA 167LA 1L31A 1L34A 1ZMYL 5KXNA 5KXZA 4FJRA 4CFPA 4CFOA 4XJHA 4NHTA 1OYUA 1QIOA 258LA 2YSSC 1C7PA 4QEQA 4M6DA 1XGUC 5IDDA 1FN5A 1JSFA 208LA 1JKCA 236LA 1B7SA 3DMZA 2FBBA 3TMWA 1Z55A 4D9ZA 4NSIA 1YILA 4NG1A 5A3ZA 1NBZC 170LA 2F4AA 1L40A 4ZPUA 1L90A 1AZFA 3HBHA 1NWGA 1UC0A 3B0KA 3ATOA 5D5FA 1JTNA 4DDAA 5B06A 4RLNA 2EQLA 4RW1A 3SBBC 4DT3A 4HPIA 4I7TA 3HU9A 1LSFA 1LZRA 165LA 1C6MA 2D91A 2YBNA 2YVBA 4ET9A 2EIZC 1CUPA 1H6MA 1HMKA 2WARA 234LA 1HEQA 1GE3A 2ZQ3A 3J6KA 3ZVQA 4DD1A 3HTGA 1HC0A 2A7DA 3FADA 1CU6A 1G0GA 1IWUA 1J1OY 2B72A 1L27A 1LZGA 3DN3A 1L75A 1INUA 4IASA 1REZA 1IWYA 1T8AA 249LA 1L98A 3TXGA 173LA 240LA 1I56A 1TCYA 218LA 1GB8A 3TXBA 3ULRA 128LA 2ANXA 113LA 1KY0A 199LA 231LA 4PGJB 5LZMA 3A96A 4EXMA 217LA 4I8SA 3GXRA 4HV1A 144LA 4XJIA 4YXCA 2BLXA 1LZEA 3HT9A 4L41A 1GB6A 3TMXA 3FI7A 3DMXA 3TXKA 1LGWA 1ALCA 1HENA 1G0PA 1KY1A 1B7NA 1LZ1A 4J0LA 4WL6A 2D4IA 1QSQA 1WQNA 1BB4A 2RSCA 1L07A 3GUKA 1GEVA 5LYMA 4PPOA 4MR1A 1LJNA 2D4JA 2DQJY 4NGWA 2BQNA 3E3DA 4HTKA 1LSAA 5LVGA 2Q9EA 1LZAA 2QARC 1C6HA 178LA 1XGTC 4BADA 1SX7A 3ATNA 181LA 3KAMA 4PK0A 2YBMA 4R6CA 2CGIA 1IOSA 215LA 1LZSA 1LPYA 4DKLA 1HFYA 2QB0B 1GF7A 2BQGA 3OK0A 3P4ZA 162LA 1IWZA 1HF4A 1G0KA 5FELA 1LYOA 2YDGA 4I0CA 4EKQA 3HTBA 3RZ4A 1DYFA 223LA 1QTEA 4W53A 5B05A 115LA 4WLYA 1KS3A 108LA 1BHZA 1CV1A 1A2YC 5IHGA 1L05A 1YROA 1KNIA 1L48A 1WVVA 1IP3A 1PZYA 2MEEA 4J1AA 1GF6A 4KPMA 1XEKA 2X0AA 4OWCA 1GAYA 3OE9A 4GCCA 1P46A 4OWAA 4EOFA 1L18A 1D9WA 1D3MA 255LA 3C7YA 1LJ4A 1LZNA 1D0KA 4GBRB 1QT5A 4W51A 1IX0A 4NGIA 3EMSA 1LJGA 1L94A 4GCFA 1FLWA 1OP9B 2EPEA 3EXDA 1JITA 5LVJA 3CDOA 2F47A 3WL2A 1IORA 2RB0X 2XJWA 5M1YA 1PS5A 224LA 5LVHA 5KXXA 3TXIA 1KW7A 4DD3A 4H9BA 4WG1A 1L86A 3CSRA 1JISA 1RFPA 4B4EA 2I26L 261LA 1QT4A 4YX7C 4AXTA 3G3BB 2B70A 1D3FA 4GN4A 1L16A 2BQJA 2LC9A 1DYCA 3CT1A 3M3UA 1LYYA 5F81A 4ZIXA 3BKHA 2DQEY 1LMAA 1LWGA 4W94A 3W6FA 3J4GA 5J7CA 1LCNA 1LZ6A 1C63A 1L69A 1C6TA 1BWHA 1LJJA 1B5VA 1L28A 3HH5A 1BB5A 1IP7A 1ZWNA 2Z2FA 2Z39A 247LA 1L85A 1KIRC 2BQMA 1LJ3A 1L49A 2ZIKA 4H92A 2HULA 1C6NA 2BQDA 151LA 1C67A 4PRUA 244LA 2O7AA 3DN6A 1L41A 1L76A 1LI6A 1CKFA 1L68A 1L00A 1XJUA 1PQJA 1WTMA 104LA 1L65A 1DYEA 1IWWA 4TWSA 1GF9A 1L63A 1JKBA 103LA 2XBRA 1AKIA 1YKZX 3AGGG 5DM9A 4GCEA 3DKEX 248LA 3GUMA 4WM5A 212LA 1WTNA 3LHMA 1LSBA 5KXWA 2YBIA 1JTTL 5K7OA 1EL1A 4YEOA 122LA 4QY9A 1CX7A 4N8ZA 1L56A 1FLUA 133LA 1IEEA 1TDYA 1QUDA 1OUDA 4XJFA 4HTQA 2N5ZA 1J1XY 4TSBA 3L2XA 1DKJA 4DD0A 1P36A 2BQCA 4UWUA 4ARMB 4GN5C 2RBOA 3N9EA 4LYBA 129LA 2OU9A 4HJZA 1C6QA 4NG8A 1HNLA 1L82A 1LJFA 4YM8A 1C6DA 4EPFA 1A4VA 3DNAA 3LYZA 4LT2A 5A3EA 1QT7A 1ZYTA 141LA 3HT7A 1VDSA 3SP3A 1LYIA 4NIJA 148LE 1LZ9A 2Y8PA 1LYHA 126LA 1C43A 1L46A 4ZEEA 3DN2A 1C45A 1LZTA 4I7NA 2B6XA 2C8OA 4A7DA 4ARPA 1DI3A 5F16A 1L39A 1YQVY 2RBNA 1I6SA 4W54A 3GUOA 4C3WA 3CDTA 1L36A 1KIQC 1C6AA 4OW1A 1OQMA 1D3JA 3P64A 5FDJA 1NHEA 1IC4Y 1NF5A 4II8A 200LA 1HERA 4CGEA 1L22A 2RBQA 1L13A 209LA 1OUAA 1L32A 4UWVA 1BB3A 4ETEA 1CKCA 2B6ZA 3HT6A 4YOPA 3A95A 1LGUA 1G7IC 1VEDA 175LA 1BGIA 146LA 1GHLA 187LA 3D4SA 1L57A 1L74A 3T36A 2BQKA 2G4QA 3CT0A 4I7KA 219LA 1G0LA 1LJKA 3A67Y 1D3NA 1C6FA 1QT8A 1C6PA 164LA 2NTHA 3A93A 3FA0A 4HSFA 4WM4A 3SB6A 4AQNA 1GD6A 4WM2A 4W52A 1GXXA 3LYTA 2Z2EA 1RCMA 3RT5X 4W58A 1LZ4A 3C82A 3WULA 1L51A 3AW6A 4UWNA 259LA 1LW9A 2MEHA 1CV4A 1B7QA 2W1LA 3C80A 4NGJA 1L95A 6LYZA 1CVKA 4N1CC 1OVHA 1OVKA 1BWIA 4WG7A 1B9OA 2RBRA 1HELA 2F30A 2HUBA 3WH1A 3PBLA 4G4BA 2BQLA 1D2WA 214LA 1YIKA 1IVMA 1MELL 2B6WA 2A7FA 3CQLA 3TXDA 3A91A 1D0MA 2RAYX 5APFA 4XJGA 1P6YA 1FLYA 2IHLA 3LYMA 5LVIA 4N1EI 5I54A 1IO5A 3AGHA 3GUNA 4FDYA 3MGWA 4NWEA 1G7HC 3SBAA 1NQIA 134LA 1CX6A 1IC5Y 1KXXA 4HJVA 1CNSA 1QS9A 3C8SA 3DN4A 1EQ5A 1GDXA 159LA 158LA 4NHPA 2RAZX 1LHJA 1L35A 1CV5A 1CJ8A 221LA 5II3A 2FBDA 4W96A 4PJ2C 1GB7A 3AZ4A 1UACY 4H8YA 1KW5A 3WVXA 4EPIA 1UIEA 1QUGA 139LA 3AYQA 3SB7A 2C8PA 125LA 1L96A 4W56A 183LA 2HEDA 3C7WA 4LT3A 4YENA 3C81A 2B74A 2AUBA 2MEIA 189LA 4E97A 222LA 7LYZA 1UIGA 5F9UA 110LA 4H9AA 2MEAA 1J1PY 4DQ5A 4XN6A 206LA 1UCOA 1QTDA 1L66A 1IY3A 1C6KA 3FE0A 1C61A 3TXJA 4DQJA 2I6ZA 1AT5A 1L54A 1C6CA 5EBHA 1OUFA 3GUIA 3WUNA 5KXLA 1L0JA 3N9AA 4H93A 246LA 5DL9A 176LA 4OWHA 4H9FA 1LSZA 4IAPA 4ARLA 150LA 109LA 1B5UA 1LTMA 5I4YA 114LA 1XGRC 5ILCA 143LA 216LA 5KKJA 2HEEA 5HMJA 1L23A 2MEBA 3UONA 5B1FA 1GBYA 1WTHA 4H91A 1LPIA 1G1WA 3F8VA 4CHXA 1L04A 1QS5A 1GAZA 3IJUA 2ZIJA 2G4PA 1LYZA 3D3DA 1GFKA 1L64A 3CDQA 1QUTA 4G4CA 1CU5A 1UIBA 1GFTA 1PQDA 3B0IA 4KL7A 102LA 1T8GA 1CKGA 1FBIX 1TAYA 4NY5A 194LA 1L15A 4NSHA 1DZBX 1DYAA 1JHLA 5HLLA 1D2YA 1IP1A 3BKVA 2G4NA 1BQLY 4LYMA 1LKRA 3HDEA 3T6UA 2ZWBA 4WOAA 1L06A 1LYDA 3HWLA 1OUHA 1T8FA 5E4PA 1L10A 2DKVA 1C64A 241LA 4BAFA 226LA 1YAQA 3ZVQB 2Z12A 4WL7A 4MSTA 2HU1A 4O34A 2EKSC 1B5WA 3RU5A 132LA 185LA 149LA 1TBYA 2A4TA 1GFGA 1IC7Y 4H9IA 1XJTA 4DDBA 1IIZA 4I7SA 120LA 1L89A 2DQDY 4H90A 4RW2A 1LHHA 3HH4A 1F6RA 1G06A 5KXKA 1GFUA 177LA 1GB0A 2DQAA 4XJBA 5KXOA 3WPKA 4I7OA 4R0FA 1UIHA 3G3AB 227LA 1G7JC 3LYOA 4QDNA 3HTDA 5DN4A 3WPJA 1P2LA 1NDGC 1L73A 1YANA 3L64A 1DYGA 1CU0A 1T6VL 171LA 3WU7A 3TXEA 1LGXA 1LWKA 4MCKA 3PDSA 3HUKA 1LMQA 3B0OA 4EMNA 3WU8A 1L24A 3WW5A 1IOTA 5LA8A 4H1PA 2CWIA 245LA 2OE4X 1P3NA 1PQIA 233LA 1YKYX 1O23A 3SB5A 1CTWA 2W1YA 2F2QA 4Z98A 1G07A 1L88A 5I14A 2ZYPA 4NGZA 5E9RA 1L60A 2OU0X 3DN1A 1NMMA 3N9CA 1CKDA 2OU8A 1VDPA 123LA 5IELA 5ILFA 1LI3A 1RE2A 3HH6A 1HMLA 1IP5A 1L21A 1IOQA 5KKIA 2XBSA 1SX2A 4H94A 2I25L 1DPWA 4IATA 4WM3A 1GFAA 3B6LA 166LA 3AGIA 1L55A 3EMLA 1HSWA 1L97A 4GLAA 1D9UA 1TLAA 5KXRA 1LZYA 1P56A 1IOCA 4NGYA 3VW7A 4B0DA 4Z3MA 1DKKA 188LA 2ZYCA 1VDQA 1LMCA 4BS7A 2B73A 4WLTA 1OVJA 1DI5A 1LJEA 1YAPA 2FYDA 1L20A 2CDSA 4LYZA 154LA 1PQKA 2BPUA 237LA 138LA 1UBZA 193LA 2O4WA 1LSNA 4YXAC 3NYAA 2DQIY 1SWZA 3A3QA 127LA 1CU2A 2BQEA 1IY4A 1L92A 1LHLA 1L72A 3LZTA 1OWZA 1BB7A 2OEAX 1KIPC 1L61A 2LZ2A 1GE1A 5I4XA 4NEBA 3IJVA 1N4FA 8LYZA 3C8RA 3HH3A 1QDTA 1G0JA 4WM6A 4TSCA 1UA6Y 1YAOA 1XEJA 254LA 1YL0X 1QSAA 4ETCA 210LA 1GBXA 2YBLA 1B6IA 4GRVA 1GB9A 4NGKA 2B6TA 2Q0MX 1GF5A 3WPLA 1WQRA 3C83A 1NDMC 3A94A 2Z19A 1LLHA 4EKPA 1WQOA 4HJYA 5DN5A 1T3PA 1P5CA 4LZMA 1L83A 5LIOA 1L53A 1LZDA 4J7VA 1B7RA 4DJHA 3AJNA 4HV2A 1IWTA 1L91A 1ZVHL 1GB3A 147LA 4NGLA 1L77A
chains in the Genus database with same CATH topology
2RB1X 1LHIA 1T97A 1QTKA 2DQCY 3P68A 4XENA 252LA 1L30A 1EPYA 1IR8A 232LA 4I7PA 4OO9A 4M4OA 2B5ZA 256LA 1FKQA 1V7SA 4G49A 239LA 2LYMA 5FEKA 3DN0A 1GXV2 4ET8A 3OE6A 1I20A 130LA 5B59A 3DMVA 4W59A 2DQHY 2ZILA 1C62A 5FHWA 1F6SA 160LA 1I1ZA 3FI5A 3V2WA 1UUZC 5HQ1A 1LMPA 1RI8B 1REYA 3A92A 3AZ6A 225LA 3K3TA 1LYJA 4XJDA 1L12A 155LA 3M18B 4GN3A 3A6CY 2HTXA 1B0DA 2DQFC 2DQGY 1G0QA 4LT0A 2BQIA 1CV6A 3HU8A 1JSEA 1OUJA 4LYOA 3EBAB 5HNLA 3CT5A 4RDSA 4K5YA 1JUGA 4N0JA 1LI2A 2OE7X 140LA 2XQOA 1C60A 1D6QA 1B5YA 4XYYA 2MEDA 112LA 1CUQA 2Z37A 3W6AA 2HECA 1YAMA 3RZEA 1IP2A 1W08A 4EKRA 1QT6A 4NSJA 1GE0A 1GB5A 3IWRA 4X3BA 4WM1A 4NHIA 4I7JA 1PQMA 1OV5A 2F32A 1OWYA 1NHBA 1FLQA 1L70A 172LA 1GFEA 1KXYA 238LA 3NY8A 4WLDA 2BQFA 2ZQ4A 3A34A 4N5RA 2MEGA 5C6JA 4H8ZA 1SSYA 3W6EA 1XSFA 5DLAA 4LGKA 4DWXA 4B4JA 1LSYA 1NKHA 1QTZA 4HTNA 2MEFA 1CJ7A 3F9LA 4H9EA 1L87A 2FYCA 1L44A 253LA 1GB2A 1HFXA 230LA 1B5ZA 2IGCA 5LA5A 1LJHA 1OUGA 4I7RA 111LA 1FKVA 4B4IA 3ODUA 1LSDA 4ETBA 2D6BA 5LXWA 1HEWA 3HT8A 5I4WA 3CDVA 1QSWA 4W57A 1L79A 3P66A 1OUBA 5LAFA 3GULA 1OUEA 1LSEA 1SQ2L 4EJ4A 3RUNA 1QSBA 5KJ9A 1H87A 4DQ7A 1JTPL 3WUAA 2RBPA 3DN8A 4LT1A 1D6PA 4OWEA 2PC2A 3HDFA 1JPOA 1BVKC 152LA 1L45A 2H9JA 1DQJC 5APCA 4ARQB 1P7SA 3HFMY 1QT3A 1SSWA 1GBWA 1C6BA 1B2KA 4AGAA 1JJ3A 1LMTA 1L59A 4NSGA 1L80A 1WQQA 1QTBA 1L29A 1L0KA 3LN2A 1C6GA 1XGQC 1L14A 4C5FA 153LA 4LFPA 5KY1A 1L81A 1GBZA 1XEPA 1C66A 3SB8A 1GFRA 3G3WA 2VB1A 2NTGA 1DYDA 4QGZA 2Q9DA 1QTHA 4ETDA 4KXIA 3OE0A 4I7QA 4PJZA 195LA 3A90A 4I7MA 1EQEA 157LA 4NGVA 2RH1A 3CSQA 1LSMA 1L71A 3AZ5A 3WUMA 207LA 2BQBA 1XGPC 4GCBA 3QAKA 1L02A 1E8LA 2LHMA 3OE8A 3WXUA 1CV0A 2CJLA 4NWHA 2F2NA 1C68A 1L38A 1L17A 2YBHA 1AT6A 4H8XA 1IP6A 198LA 3QY4A 1L37A 1LJIA 211LA 1C46A 4G9SA 1JJ1A 1L58A 2BQOA 2GV0A 1LKSA 5I5QA 2B75A 1L43A 3CSZA 220LA 1L09A 1K28A 196LA 1MLCE 1ZVYB 1WQMA 1GBSA 3SN6R 2ZNWY 4KT3A 2L78A 3GXKA 251LA 260LA 3C8QA 2RB2X 3AB6A 118LA 1L26A 3V2YA 1HSXA 5KXTA 1L42A 1BB6A 1UICA 2BQAA 242LA 1GEZA 1YL1X 4WMGA 4OOTA 2HEAA 4H9HA 4E3UA 3TMVA 5T3FA 4DAJA 1JTMA 1ZV5L 107LA 2OTZX 1V7TA 3W6CA 3TXFA 1JIYA 1L84A 1REMA 9LYZA 229LA 205LA 1OUIA 1LYFA 4B49A 5KXYA 5L3IA 2H9KA 2OTYX 3CDRA 1GDWA 1LSGA 2H5ZA 142LA 3HUAA 2YBJA 1P2CC 1BVXA 1LSPA 1LAAA 163LA 1IP4A 4GCDA 192LA 2CUUA 1QTCA 1QDRA 3WXTA 1CJ6A 1C6EA 1F0WA 4LZTA 5AMYA 1L19A 5FSTA 5LINA 4HP0A 3HUQA 1GF8A 4EKSA 1VATA 1SWYA 2NWDX 1WQPA 5L9JA 4ARMA 201LA 3HBEX 1GPQC 1TEWA 4NFVA 4DYGA 1DPXA 4G4HA 6LYTA 2BLYA 1L33A 1GF0A 3CB7A 4LDEA 1LYSA 4YF2A 1JJ0A 2XTHA 1DYBA 4TX7A 4LDLA 1GE2A 1HHLA 1JKAA 1XFPL 1VAUA 1B7PA 1UIFA 4N9RA 156LA 4ETAA 213LA 4ANRA 135LA 2F4GA 180LA 250LA 1GF3A 4LDOA 2BQHA 4IJ4A 2B7XA 3WMKA 4OOOA 3A6BY 3VWOA 1QUSA 5JENB 4J1BA 5LVKA 4CJ2A 168LA 2HEBA 3D9AC 1REXA 5B1GA 1GFHA 3RNXA 1IR9A 4B1AA 1JTOL 1CV3A 184LA 1G0MA 5D5CA 2LYOA 1LOZA 1KXWA 3F6ZA 4TTDA 5LAGA 1IWVA 1C6LA 6LZMA 1C10A 1CJ9A 2DBTA 3RW8A 119LA 235LA 1B7LA 1QQYA 4WO9A 4OWBA 191LA 4RLMA 1F10A 1QUHA 4ZFPA 1L99A 169LA 1L03A 1L25A 2LZTA 4LYCA 1B7MA 2OE9X 2HU3A 4S0WA 1L52A 4I7LA 4HPEA 5KXPA 182LA 4Z41A 1BWJA 161LA 2RBSA 4NHQA 1RJCB 1L11A 3B72A 3QNGA 1D0LA 1HEMA 3AW7A 1W6ZA 1PQOA 1P37A 1HFZA 2Z18A 1JQUA 1LHMA 243LA 3HBDA 1ZURA 2HUKA 197LA 262LA 1IR7A 1GF4A 186LA 1C08C 2BAAA 4LFXA 1QTVA 1AM7A 1L01A 3W6BA 7LZMA 5I53A 5APDA 3A3RX 1L67A 3EO5A 4DD7A 3JR6A 1L62A 5HNCA 3W6DA 5B07A 257LA 4LYTA 1P64A 2W1MA 190LA 1GWDA 1NBYC 145LA 1CU3A 1L93A 4ML7A 3A8ZA 3ZEKA 4PRQA 1LYGA 4WO6A 3TXHA 3WU9A 1B5XA 1C65A 1GBOA 1EQ4A 1JKDA 4Z46A 1QUOA 3WYHA 1UIDA 5HMVA 4DDCA 1C6JA 1L47A 2W1XA 4BAPA 1G1VA 1SLYA 4NHSA 1GE4A 228LA 1LMOA 3G3VA 5C6LA 3P65A 2ZNXY 3OJPA 1FDLY 1LMNA 1LZ5A 3GUPA 2D4KA 5KXSA 4DD9A 3LZMA 3G3XA 4U3XB 1G7LC 4PHIA 4WLXA 3QE8A 1UIAA 1VDTA 1C69A 5APEA 1LSCA 1VFBC 3W3EA 5KXMA 4GLVA 2B6YA 1IWXA 4H9CA 131LA 5F14A 5LYZA 1HEPA 1T6HA 1GFVA 2HEFA 5C6IA 3HTFA 2IFFY 1LYEA 2MECA 3GUJA 1YKXX 2LZMA 1LZ8A 1DXJA 4YEMA 1XEIA 2LCBA 3K2RA 1HEOA 1JWRA 4ARJA 5L3HA 4DD2A 2HUMA 1LZCA 4P2EA 4W55A 2O79A 5LYTA 3TMUA 1L50A 3NY9A 1OV7A 1P2RA 1WVUA 2LYZA 1CKHA 2Z38A 4NGOA 137LA 1B7OA 1GFJA 3LZ2A 4ARQA 2ANVA 3WW6A 1OUCA 1L08A 1JEFA 1LHKA 4DC4A 5FCPA 1C6IA 174LA 1LZBA 3WVYA 1G7MC 1DI4A 2Z6BA 3AZ7A 4TUNA 3SB9A 4XADA 5F9XA 3C7ZA 167LA 1L31A 1L34A 1ZMYL 5KXNA 5KXZA 4FJRA 4CFPA 4CFOA 4XJHA 4NHTA 1OYUA 1QIOA 258LA 2YSSC 1C7PA 4QEQA 4M6DA 1XGUC 5IDDA 1FN5A 1JSFA 208LA 1JKCA 236LA 1B7SA 3DMZA 2FBBA 3TMWA 1Z55A 4D9ZA 4NSIA 1YILA 4NG1A 5A3ZA 1NBZC 170LA 2F4AA 1L40A 4ZPUA 1L90A 1AZFA 3HBHA 1NWGA 1UC0A 3B0KA 3ATOA 5D5FA 1JTNA 4DDAA 5B06A 4RLNA 2EQLA 4RW1A 3SBBC 4DT3A 4HPIA 4I7TA 3HU9A 1LSFA 1LZRA 165LA 1C6MA 2D91A 2YBNA 2YVBA 4ET9A 2EIZC 1CUPA 1H6MA 1HMKA 2WARA 234LA 1HEQA 1GE3A 2ZQ3A 3J6KA 3ZVQA 4DD1A 3HTGA 1HC0A 2A7DA 3FADA 1CU6A 1G0GA 1IWUA 1J1OY 2B72A 1L27A 1LZGA 3DN3A 1L75A 1INUA 4IASA 1REZA 1IWYA 1T8AA 249LA 1L98A 3TXGA 173LA 240LA 1I56A 1TCYA 218LA 1GB8A 3TXBA 3ULRA 128LA 2ANXA 113LA 1KY0A 199LA 231LA 4PGJB 5LZMA 3A96A 4EXMA 217LA 4I8SA 3GXRA 4HV1A 144LA 4XJIA 4YXCA 2BLXA 1LZEA 3HT9A 4L41A 1GB6A 3TMXA 3FI7A 3DMXA 3TXKA 1LGWA 1ALCA 1HENA 1G0PA 1KY1A 1B7NA 1LZ1A 4J0LA 4WL6A 2D4IA 1QSQA 1WQNA 1BB4A 2RSCA 1L07A 3GUKA 1GEVA 5LYMA 4PPOA 4MR1A 1LJNA 2D4JA 2DQJY 4NGWA 2BQNA 3E3DA 4HTKA 1LSAA 5LVGA 2Q9EA 1LZAA 2QARC 1C6HA 178LA 1XGTC 4BADA 1SX7A 3ATNA 181LA 3KAMA 4PK0A 2YBMA 4R6CA 2CGIA 1IOSA 215LA 1LZSA 1LPYA 4DKLA 1HFYA 2QB0B 1GF7A 2BQGA 3OK0A 3P4ZA 162LA 1IWZA 1HF4A 1G0KA 5FELA 1LYOA 2YDGA 4I0CA 4EKQA 3HTBA 3RZ4A 1DYFA 223LA 1QTEA 4W53A 5B05A 115LA 4WLYA 1KS3A 108LA 1BHZA 1CV1A 1A2YC 5IHGA 1L05A 1YROA 1KNIA 1L48A 1WVVA 1IP3A 1PZYA 2MEEA 4J1AA 1GF6A 4KPMA 1XEKA 2X0AA 4OWCA 1GAYA 3OE9A 4GCCA 1P46A 4OWAA 4EOFA 1L18A 1D9WA 1D3MA 255LA 3C7YA 1LJ4A 1LZNA 1D0KA 4GBRB 1QT5A 4W51A 1IX0A 4NGIA 3EMSA 1LJGA 1L94A 4GCFA 1FLWA 1OP9B 2EPEA 3EXDA 1JITA 5LVJA 3CDOA 2F47A 3WL2A 1IORA 2RB0X 2XJWA 5M1YA 1PS5A 224LA 5LVHA 5KXXA 3TXIA 1KW7A 4DD3A 4H9BA 4WG1A 1L86A 3CSRA 1JISA 1RFPA 4B4EA 2I26L 261LA 1QT4A 4YX7C 4AXTA 3G3BB 2B70A 1D3FA 4GN4A 1L16A 2BQJA 2LC9A 1DYCA 3CT1A 3M3UA 1LYYA 5F81A 4ZIXA 3BKHA 2DQEY 1LMAA 1LWGA 4W94A 3W6FA 3J4GA 5J7CA 1LCNA 1LZ6A 1C63A 1L69A 1C6TA 1BWHA 1LJJA 1B5VA 1L28A 3HH5A 1BB5A 1IP7A 1ZWNA 2Z2FA 2Z39A 247LA 1L85A 1KIRC 2BQMA 1LJ3A 1L49A 2ZIKA 4H92A 2HULA 1C6NA 2BQDA 151LA 1C67A 4PRUA 244LA 2O7AA 3DN6A 1L41A 1L76A 1LI6A 1CKFA 1L68A 1L00A 1XJUA 1PQJA 1WTMA 104LA 1L65A 1DYEA 1IWWA 4TWSA 1GF9A 1L63A 1JKBA 103LA 2XBRA 1AKIA 1YKZX 3AGGG 5DM9A 4GCEA 3DKEX 248LA 3GUMA 4WM5A 212LA 1WTNA 3LHMA 1LSBA 5KXWA 2YBIA 1JTTL 5K7OA 1EL1A 4YEOA 122LA 4QY9A 1CX7A 4N8ZA 1L56A 1FLUA 133LA 1IEEA 1TDYA 1QUDA 1OUDA 4XJFA 4HTQA 2N5ZA 1J1XY 4TSBA 3L2XA 1DKJA 4DD0A 1P36A 2BQCA 4UWUA 4ARMB 4GN5C 2RBOA 3N9EA 4LYBA 129LA 2OU9A 4HJZA 1C6QA 4NG8A 1HNLA 1L82A 1LJFA 4YM8A 1C6DA 4EPFA 1A4VA 3DNAA 3LYZA 4LT2A 5A3EA 1QT7A 1ZYTA 141LA 3HT7A 1VDSA 3SP3A 1LYIA 4NIJA 148LE 1LZ9A 2Y8PA 1LYHA 126LA 1C43A 1L46A 4ZEEA 3DN2A 1C45A 1LZTA 4I7NA 2B6XA 2C8OA 4A7DA 4ARPA 1DI3A 5F16A 1L39A 1YQVY 2RBNA 1I6SA 4W54A 3GUOA 4C3WA 3CDTA 1L36A 1KIQC 1C6AA 4OW1A 1OQMA 1D3JA 3P64A 5FDJA 1NHEA 1IC4Y 1NF5A 4II8A 200LA 1HERA 4CGEA 1L22A 2RBQA 1L13A 209LA 1OUAA 1L32A 4UWVA 1BB3A 4ETEA 1CKCA 2B6ZA 3HT6A 4YOPA 3A95A 1LGUA 1G7IC 1VEDA 175LA 1BGIA 146LA 1GHLA 187LA 3D4SA 1L57A 1L74A 3T36A 2BQKA 2G4QA 3CT0A 4I7KA 219LA 1G0LA 1LJKA 3A67Y 1D3NA 1C6FA 1QT8A 1C6PA 164LA 2NTHA 3A93A 3FA0A 4HSFA 4WM4A 3SB6A 4AQNA 1GD6A 4WM2A 4W52A 1GXXA 3LYTA 2Z2EA 1RCMA 3RT5X 4W58A 1LZ4A 3C82A 3WULA 1L51A 3AW6A 4UWNA 259LA 1LW9A 2MEHA 1CV4A 1B7QA 2W1LA 3C80A 4NGJA 1L95A 6LYZA 1CVKA 4N1CC 1OVHA 1OVKA 1BWIA 4WG7A 1B9OA 2RBRA 1HELA 2F30A 2HUBA 3WH1A 3PBLA 4G4BA 2BQLA 1D2WA 214LA 1YIKA 1IVMA 1MELL 2B6WA 2A7FA 3CQLA 3TXDA 3A91A 1D0MA 2RAYX 5APFA 4XJGA 1P6YA 1FLYA 2IHLA 3LYMA 5LVIA 4N1EI 5I54A 1IO5A 3AGHA 3GUNA 4FDYA 3MGWA 4NWEA 1G7HC 3SBAA 1NQIA 134LA 1CX6A 1IC5Y 1KXXA 4HJVA 1CNSA 1QS9A 3C8SA 3DN4A 1EQ5A 1GDXA 159LA 158LA 4NHPA 2RAZX 1LHJA 1L35A 1CV5A 1CJ8A 221LA 5II3A 2FBDA 4W96A 4PJ2C 1GB7A 3AZ4A 1UACY 4H8YA 1KW5A 3WVXA 4EPIA 1UIEA 1QUGA 139LA 3AYQA 3SB7A 2C8PA 125LA 1L96A 4W56A 183LA 2HEDA 3C7WA 4LT3A 4YENA 3C81A 2B74A 2AUBA 2MEIA 189LA 4E97A 222LA 7LYZA 1UIGA 5F9UA 110LA 4H9AA 2MEAA 1J1PY 4DQ5A 4XN6A 206LA 1UCOA 1QTDA 1L66A 1IY3A 1C6KA 3FE0A 1C61A 3TXJA 4DQJA 2I6ZA 1AT5A 1L54A 1C6CA 5EBHA 1OUFA 3GUIA 3WUNA 5KXLA 1L0JA 3N9AA 4H93A 246LA 5DL9A 176LA 4OWHA 4H9FA 1LSZA 4IAPA 4ARLA 150LA 109LA 1B5UA 1LTMA 5I4YA 114LA 1XGRC 5ILCA 143LA 216LA 5KKJA 2HEEA 5HMJA 1L23A 2MEBA 3UONA 5B1FA 1GBYA 1WTHA 4H91A 1LPIA 1G1WA 3F8VA 4CHXA 1L04A 1QS5A 1GAZA 3IJUA 2ZIJA 2G4PA 1LYZA 3D3DA 1GFKA 1L64A 3CDQA 1QUTA 4G4CA 1CU5A 1UIBA 1GFTA 1PQDA 3B0IA 4KL7A 102LA 1T8GA 1CKGA 1FBIX 1TAYA 4NY5A 194LA 1L15A 4NSHA 1DZBX 1DYAA 1JHLA 5HLLA 1D2YA 1IP1A 3BKVA 2G4NA 1BQLY 4LYMA 1LKRA 3HDEA 3T6UA 2ZWBA 4WOAA 1L06A 1LYDA 3HWLA 1OUHA 1T8FA 5E4PA 1L10A 2DKVA 1C64A 241LA 4BAFA 226LA 1YAQA 3ZVQB 2Z12A 4WL7A 4MSTA 2HU1A 4O34A 2EKSC 1B5WA 3RU5A 132LA 185LA 149LA 1TBYA 2A4TA 1GFGA 1IC7Y 4H9IA 1XJTA 4DDBA 1IIZA 4I7SA 120LA 1L89A 2DQDY 4H90A 4RW2A 1LHHA 3HH4A 1F6RA 1G06A 5KXKA 1GFUA 177LA 1GB0A 2DQAA 4XJBA 5KXOA 3WPKA 4I7OA 4R0FA 1UIHA 3G3AB 227LA 1G7JC 3LYOA 4QDNA 3HTDA 5DN4A 3WPJA 1P2LA 1NDGC 1L73A 1YANA 3L64A 1DYGA 1CU0A 1T6VL 171LA 3WU7A 3TXEA 1LGXA 1LWKA 4MCKA 3PDSA 3HUKA 1LMQA 3B0OA 4EMNA 3WU8A 1L24A 3WW5A 1IOTA 5LA8A 4H1PA 2CWIA 245LA 2OE4X 1P3NA 1PQIA 233LA 1YKYX 1O23A 3SB5A 1CTWA 2W1YA 2F2QA 4Z98A 1G07A 1L88A 5I14A 2ZYPA 4NGZA 5E9RA 1L60A 2OU0X 3DN1A 1NMMA 3N9CA 1CKDA 2OU8A 1VDPA 123LA 5IELA 5ILFA 1LI3A 1RE2A 3HH6A 1HMLA 1IP5A 1L21A 1IOQA 5KKIA 2XBSA 1SX2A 4H94A 2I25L 1DPWA 4IATA 4WM3A 1GFAA 3B6LA 166LA 3AGIA 1L55A 3EMLA 1HSWA 1L97A 4GLAA 1D9UA 1TLAA 5KXRA 1LZYA 1P56A 1IOCA 4NGYA 3VW7A 4B0DA 4Z3MA 1DKKA 188LA 2ZYCA 1VDQA 1LMCA 4BS7A 2B73A 4WLTA 1OVJA 1DI5A 1LJEA 1YAPA 2FYDA 1L20A 2CDSA 4LYZA 154LA 1PQKA 2BPUA 237LA 138LA 1UBZA 193LA 2O4WA 1LSNA 4YXAC 3NYAA 2DQIY 1SWZA 3A3QA 127LA 1CU2A 2BQEA 1IY4A 1L92A 1LHLA 1L72A 3LZTA 1OWZA 1BB7A 2OEAX 1KIPC 1L61A 2LZ2A 1GE1A 5I4XA 4NEBA 3IJVA 1N4FA 8LYZA 3C8RA 3HH3A 1QDTA 1G0JA 4WM6A 4TSCA 1UA6Y 1YAOA 1XEJA 254LA 1YL0X 1QSAA 4ETCA 210LA 1GBXA 2YBLA 1B6IA 4GRVA 1GB9A 4NGKA 2B6TA 2Q0MX 1GF5A 3WPLA 1WQRA 3C83A 1NDMC 3A94A 2Z19A 1LLHA 4EKPA 1WQOA 4HJYA 5DN5A 1T3PA 1P5CA 4LZMA 1L83A 5LIOA 1L53A 1LZDA 4J7VA 1B7RA 4DJHA 3AJNA 4HV2A 1IWTA 1L91A 1ZVHL 1GB3A 147LA 4NGLA 1L77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RB1 X;  3GUN A;  1T97 A;  4LDE A;  1DYB A;  3SBA A;  252L A;  4LDL A;  1CX6 A;  1L30 A;  1EPY A;  232L A;  4OO9 A;  4I7P A;  1QS9 A;  3C8S A;  3DN4 A;  156L A;  159L A;  158L A;  2Q9E A;  213L A;  2RAZ X;  1L35 A;  180L A;  256L A;  1CV5 A;  250L A;  221L A;  2QAR C;  1C6H A;  4LDO A;  178L A;  1SX7 A;  181L A;  239L A;  2B7X A;  3DN0 A;  4PK0 A;  215L A;  1LPY A;  1KW5 A;  3OE6 A;  168L A;  130L A;  4EPI A;  3DMV A;  4DKL A;  4W59 A;  2QB0 B;  1C62 A;  1QUG A;  162L A;  139L A;  160L A;  1G0K A;  1CV3 A;  184L A;  1G0M A;  3SB7 A;  125L A;  3FI5 A;  3V2W A;  1L96 A;  4EKQ A;  4W56 A;  3HTB A;  1DYF A;  223L A;  225L A;  183L A;  1C6L A;  4W53 A;  6LZM A;  3C7W A;  1LYJ A;  115L A;  1L12 A;  3C81 A;  155L A;  119L A;  2B74 A;  235L A;  1KS3 A;  189L A;  108L A;  4E97 A;  222L A;  1CV1 A;  1G0Q A;  1L05 A;  110L A;  1KNI A;  1L48 A;  191L A;  1CV6 A;  3HU8 A;  1QUH A;  206L A;  4K5Y A;  1QTD A;  1L66 A;  1C6K A;  1L99 A;  1LI2 A;  2OE7 X;  140L A;  169L A;  1C61 A;  1L03 A;  1L25 A;  1C60 A;  3OE9 A;  2OE9 X;  1L54 A;  1P46 A;  1C6C A;  4S0W A;  1L52 A;  4I7L A;  1L18 A;  1D9W A;  1D3M A;  255L A;  3GUI A;  182L A;  112L A;  161L A;  2RBS A;  1CUQ A;  1L0J A;  3C7Y A;  246L A;  1L11 A;  176L A;  4GBR B;  1QT5 A;  4W51 A;  3RZE A;  4IAP A;  4ARL A;  1L94 A;  4EKR A;  1PQO A;  1QT6 A;  3SB6 A;  150L A;  109L A;  1P37 A;  3CDO A;  2F47 A;  1JQU A;  243L A;  2RB0 X;  114L A;  1ZUR A;  2HUK A;  4I7J A;  224L A;  197L A;  1PQM A;  262L A;  1OV5 A;  2F32 A;  1OWY A;  1NHB A;  143L A;  186L A;  216L A;  1KW7 A;  1L70 A;  1L86 A;  172L A;  238L A;  1QTV A;  1L23 A;  1L01 A;  261L A;  1QT4 A;  3UON A;  1WTH A;  7LZM A;  3NY8 A;  4YX7 C;  1G1W A;  3F8V A;  2B70 A;  1L04 A;  1QS5 A;  1L67 A;  1D3F A;  1L16 A;  1SSY A;  1L62 A;  2LC9 A;  3JR6 A;  1DYC A;  257L A;  1L64 A;  3CDQ A;  1P64 A;  1CU5 A;  1QTZ A;  190L A;  1PQD A;  102L A;  1LWG A;  1T8G A;  145L A;  3F9L A;  1C63 A;  1L69 A;  1C6T A;  1L87 A;  1L15 A;  1CU3 A;  1L93 A;  1DYA A;  1L44 A;  253L A;  1L28 A;  1D2Y A;  3HH5 A;  1ZWN A;  230L A;  247L A;  2IGC A;  1LYG A;  1L85 A;  4I7R A;  111L A;  3HDE A;  1C65 A;  1L49 A;  3ODU A;  1L06 A;  1QUO A;  1LYD A;  3HWL A;  2HUL A;  1C6N A;  3HT8 A;  1C6J A;  1L47 A;  3CDV A;  1T8F A;  1G1V A;  4W57 A;  1L79 A;  3G3V A;  1L10 A;  228L A;  1C64 A;  151L A;  241L A;  1C67 A;  244L A;  2O7A A;  3DN6 A;  226L A;  3GUL A;  1L41 A;  1L76 A;  1LI6 A;  1L68 A;  1L00 A;  1XJU A;  4EJ4 A;  3GUP A;  3RUN A;  1PQJ A;  104L A;  1QSB A;  3G3X A;  3LZM A;  1L65 A;  1DYE A;  185L A;  149L A;  1L63 A;  103L A;  1C69 A;  2A4T A;  2RBP A;  3DN8 A;  2B6Y A;  131L A;  1XJT A;  1T6H A;  3DKE X;  3HDF A;  248L A;  3GUM A;  120L A;  1L89 A;  4I7S A;  3HTF A;  152L A;  1L45 A;  1LYE A;  212L A;  3GUJ A;  4ARQ B;  1P7S A;  2LZM A;  3HH4 A;  122L A;  1G06 A;  1QT3 A;  1SSW A;  2LCB A;  177L A;  1C6B A;  3K2R A;  1CX7 A;  4I7O A;  1L56 A;  1L59 A;  4ARJ A;  227L A;  1L80 A;  2HUM A;  1QTB A;  4W55 A;  2O79 A;  1L29 A;  1L0K A;  1QUD A;  1C6G A;  3HTD A;  1L50 A;  1P2L A;  1L14 A;  3NY9 A;  1OV7 A;  1P2R A;  1L73 A;  1L81 A;  3L64 A;  137L A;  1DYG A;  1CU0 A;  1XEP A;  4ARQ A;  2ANV A;  3L2X A;  1C66 A;  3SB8 A;  1P36 A;  171L A;  1L08 A;  1LGX A;  1LWK A;  4ARM B;  3PDS A;  3G3W A;  3HUK A;  1C6I A;  2RBO A;  174L A;  129L A;  2OU9 A;  1C6Q A;  2NTG A;  1DYD A;  2Q9D A;  2Z6B A;  1L82 A;  1QTH A;  3OE0 A;  4I7Q A;  4PJZ A;  3SB9 A;  195L A;  4I7M A;  157L A;  2RH1 A;  1L24 A;  3C7Z A;  1C6D A;  4EPF A;  167L A;  3DNA A;  1L71 A;  1L31 A;  1L34 A;  245L A;  2OE4 X;  1P3N A;  1PQI A;  1QT7 A;  1ZYT A;  141L A;  3HT7 A;  233L A;  1OYU A;  258L A;  3QAK A;  1L02 A;  3SB5 A;  1LYI A;  148L E;  1CTW A;  3OE8 A;  1CV0 A;  1LYH A;  2F2Q A;  126L A;  1C68 A;  1G07 A;  1L88 A;  1L46 A;  3DN2 A;  1L38 A;  1L17 A;  4I7N A;  5I14 A;  2B6X A;  4ARP A;  198L A;  1L39 A;  1L37 A;  236L A;  2RBN A;  1L60 A;  2OU0 X;  3DN1 A;  3DMZ A;  1I6S A;  4W54 A;  3GUO A;  211L A;  3CDT A;  1L36 A;  1C6A A;  2OU8 A;  1D3J A;  123L A;  1L58 A;  1LI3 A;  2B75 A;  170L A;  1L40 A;  1L43 A;  4ZPU A;  3HH6 A;  1L90 A;  200L A;  220L A;  1L21 A;  1L09 A;  1L22 A;  1K28 A;  2RBQ A;  196L A;  1L13 A;  209L A;  1SX2 A;  3SN6 R;  1L32 A;  1JTN A;  2L78 A;  166L A;  2B6Z A;  251L A;  3SBB C;  1L55 A;  260L A;  3HT6 A;  4I7T A;  3C8Q A;  2RB2 X;  3EML A;  1L97 A;  3HU9 A;  1TLA A;  118L A;  1L26 A;  1LGU A;  1P56 A;  3V2Y A;  3VW7 A;  175L A;  146L A;  165L A;  187L A;  1C6M A;  1L42 A;  188L A;  3D4S A;  1CUP A;  1L57 A;  1L74 A;  234L A;  2B73 A;  4I7K A;  219L A;  1G0L A;  1OVJ A;  242L A;  1L20 A;  1PQK A;  3HTG A;  1D3N A;  1C6F A;  138L A;  1C6P A;  164L A;  1QT8 A;  237L A;  2NTH A;  1CU6 A;  2O4W A;  3FA0 A;  3FAD A;  1G0G A;  4YXA C;  3NYA A;  1SWZ A;  4AQN A;  2B72 A;  1L27 A;  127L A;  1CU2 A;  4W52 A;  4DAJ A;  3DN3 A;  1JTM A;  107L A;  2OTZ X;  1L92 A;  1L75 A;  1L72 A;  1OWZ A;  4W58 A;  2OEA X;  1T8A A;  249L A;  1L61 A;  1L98 A;  173L A;  1L84 A;  3C82 A;  1L51 A;  240L A;  229L A;  218L A;  259L A;  205L A;  1LW9 A;  3C8R A;  3HH3 A;  128L A;  1CV4 A;  1LYF A;  2OTY X;  1G0J A;  2ANX A;  3C80 A;  113L A;  3CDR A;  1KY0 A;  1L95 A;  142L A;  1CVK A;  199L A;  3HUA A;  1OVH A;  1OVK A;  254L A;  231L A;  5LZM A;  163L A;  210L A;  192L A;  2RBR A;  2CUU A;  4EXM A;  1QTC A;  1B6I A;  217L A;  4GRV A;  2B6T A;  1C6E A;  3PBL A;  144L A;  3C83 A;  1D2W A;  4YXC A;  214L A;  1L19 A;  1LLH A;  4EKP A;  3HT9 A;  3HUQ A;  4EKS A;  1SWY A;  1P5C A;  2B6W A;  4LZM A;  1L83 A;  3DMX A;  1LGW A;  1L53 A;  4ARM A;  201L A;  1G0P A;  1KY1 A;  4DJH A;  2RAY X;  1L91 A;  147L A;  1QSQ A;  1P6Y A;  1L07 A;  3GUK A;  1L77 A;  1L33 A; 
#chains in the Genus database with same CATH topology
 2RB1 X;  1LHI A;  1T97 A;  1QTK A;  2DQC Y;  3P68 A;  4XEN A;  252L A;  1L30 A;  1EPY A;  1IR8 A;  232L A;  4I7P A;  4OO9 A;  4M4O A;  2B5Z A;  256L A;  1FKQ A;  1V7S A;  4G49 A;  239L A;  2LYM A;  5FEK A;  3DN0 A;  1GXV 2;  4ET8 A;  3OE6 A;  1I20 A;  130L A;  5B59 A;  3DMV A;  4W59 A;  2DQH Y;  2ZIL A;  1C62 A;  5FHW A;  1F6S A;  160L A;  1I1Z A;  3FI5 A;  3V2W A;  1UUZ C;  5HQ1 A;  1LMP A;  1RI8 B;  1REY A;  3A92 A;  3AZ6 A;  225L A;  3K3T A;  1LYJ A;  4XJD A;  1L12 A;  155L A;  3M18 B;  4GN3 A;  3A6C Y;  2HTX A;  1B0D A;  2DQF C;  2DQG Y;  1G0Q A;  4LT0 A;  2BQI A;  1CV6 A;  3HU8 A;  1JSE A;  1OUJ A;  4LYO A;  3EBA B;  5HNL A;  3CT5 A;  4RDS A;  4K5Y A;  1JUG A;  4N0J A;  1LI2 A;  2OE7 X;  140L A;  2XQO A;  1C60 A;  1D6Q A;  1B5Y A;  4XYY A;  2MED A;  112L A;  1CUQ A;  2Z37 A;  3W6A A;  2HEC A;  1YAM A;  3RZE A;  1IP2 A;  1W08 A;  4EKR A;  1QT6 A;  4NSJ A;  1GE0 A;  1GB5 A;  3IWR A;  4X3B A;  4WM1 A;  4NHI A;  4I7J A;  1PQM A;  1OV5 A;  2F32 A;  1OWY A;  1NHB A;  1FLQ A;  1L70 A;  172L A;  1GFE A;  1KXY A;  238L A;  3NY8 A;  4WLD A;  2BQF A;  2ZQ4 A;  3A34 A;  4N5R A;  2MEG A;  5C6J A;  4H8Z A;  1SSY A;  3W6E A;  1XSF A;  5DLA A;  4LGK A;  4DWX A;  4B4J A;  1LSY A;  1NKH A;  1QTZ A;  4HTN A;  2MEF A;  1CJ7 A;  3F9L A;  4H9E A;  1L87 A;  2FYC A;  1L44 A;  253L A;  1GB2 A;  1HFX A;  230L A;  1B5Z A;  2IGC A;  5LA5 A;  1LJH A;  1OUG A;  4I7R A;  111L A;  1FKV A;  4B4I A;  3ODU A;  1LSD A;  4ETB A;  2D6B A;  5LXW A;  1HEW A;  3HT8 A;  5I4W A;  3CDV A;  1QSW A;  4W57 A;  1L79 A;  3P66 A;  1OUB A;  5LAF A;  3GUL A;  1OUE A;  1LSE A;  1SQ2 L;  4EJ4 A;  3RUN A;  1QSB A;  5KJ9 A;  1H87 A;  4DQ7 A;  1JTP L;  3WUA A;  2RBP A;  3DN8 A;  4LT1 A;  1D6P A;  4OWE A;  2PC2 A;  3HDF A;  1JPO A;  1BVK C;  152L A;  1L45 A;  2H9J A;  1DQJ C;  5APC A;  4ARQ B;  1P7S A;  3HFM Y;  1QT3 A;  1SSW A;  1GBW A;  1C6B A;  1B2K A;  4AGA A;  1JJ3 A;  1LMT A;  1L59 A;  4NSG A;  1L80 A;  1WQQ A;  1QTB A;  1L29 A;  1L0K A;  3LN2 A;  1C6G A;  1XGQ C;  1L14 A;  4C5F A;  153L A;  4LFP A;  5KY1 A;  1L81 A;  1GBZ A;  1XEP A;  1C66 A;  3SB8 A;  1GFR A;  3G3W A;  2VB1 A;  2NTG A;  1DYD A;  4QGZ A;  2Q9D A;  1QTH A;  4ETD A;  4KXI A;  3OE0 A;  4I7Q A;  4PJZ A;  195L A;  3A90 A;  4I7M A;  1EQE A;  157L A;  4NGV A;  2RH1 A;  3CSQ A;  1LSM A;  1L71 A;  3AZ5 A;  3WUM A;  207L A;  2BQB A;  1XGP C;  4GCB A;  3QAK A;  1L02 A;  1E8L A;  2LHM A;  3OE8 A;  3WXU A;  1CV0 A;  2CJL A;  4NWH A;  2F2N A;  1C68 A;  1L38 A;  1L17 A;  2YBH A;  1AT6 A;  4H8X A;  1IP6 A;  198L A;  3QY4 A;  1L37 A;  1LJI A;  211L A;  1C46 A;  4G9S A;  1JJ1 A;  1L58 A;  2BQO A;  2GV0 A;  1LKS A;  5I5Q A;  2B75 A;  1L43 A;  3CSZ A;  220L A;  1L09 A;  1K28 A;  196L A;  1MLC E;  1ZVY B;  1WQM A;  1GBS A;  3SN6 R;  2ZNW Y;  4KT3 A;  2L78 A;  3GXK A;  251L A;  260L A;  3C8Q A;  2RB2 X;  3AB6 A;  118L A;  1L26 A;  3V2Y A;  1HSX A;  5KXT A;  1L42 A;  1BB6 A;  1UIC A;  2BQA A;  242L A;  1GEZ A;  1YL1 X;  4WMG A;  4OOT A;  2HEA A;  4H9H A;  4E3U A;  3TMV A;  5T3F A;  4DAJ A;  1JTM A;  1ZV5 L;  107L A;  2OTZ X;  1V7T A;  3W6C A;  3TXF A;  1JIY A;  1L84 A;  1REM A;  9LYZ A;  229L A;  205L A;  1OUI A;  1LYF A;  4B49 A;  5KXY A;  5L3I A;  2H9K A;  2OTY X;  3CDR A;  1GDW A;  1LSG A;  2H5Z A;  142L A;  3HUA A;  2YBJ A;  1P2C C;  1BVX A;  1LSP A;  1LAA A;  163L A;  1IP4 A;  4GCD A;  192L A;  2CUU A;  1QTC A;  1QDR A;  3WXT A;  1CJ6 A;  1C6E A;  1F0W A;  4LZT A;  5AMY A;  1L19 A;  5FST A;  5LIN A;  4HP0 A;  3HUQ A;  1GF8 A;  4EKS A;  1VAT A;  1SWY A;  2NWD X;  1WQP A;  5L9J A;  4ARM A;  201L A;  3HBE X;  1GPQ C;  1TEW A;  4NFV A;  4DYG A;  1DPX A;  4G4H A;  6LYT A;  2BLY A;  1L33 A;  1GF0 A;  3CB7 A;  4LDE A;  1LYS A;  4YF2 A;  1JJ0 A;  2XTH A;  1DYB A;  4TX7 A;  4LDL A;  1GE2 A;  1HHL A;  1JKA A;  1XFP L;  1VAU A;  1B7P A;  1UIF A;  4N9R A;  156L A;  4ETA A;  213L A;  4ANR A;  135L A;  2F4G A;  180L A;  250L A;  1GF3 A;  4LDO A;  2BQH A;  4IJ4 A;  2B7X A;  3WMK A;  4OOO A;  3A6B Y;  3VWO A;  1QUS A;  5JEN B;  4J1B A;  5LVK A;  4CJ2 A;  168L A;  2HEB A;  3D9A C;  1REX A;  5B1G A;  1GFH A;  3RNX A;  1IR9 A;  4B1A A;  1JTO L;  1CV3 A;  184L A;  1G0M A;  5D5C A;  2LYO A;  1LOZ A;  1KXW A;  3F6Z A;  4TTD A;  5LAG A;  1IWV A;  1C6L A;  6LZM A;  1C10 A;  1CJ9 A;  2DBT A;  3RW8 A;  119L A;  235L A;  1B7L A;  1QQY A;  4WO9 A;  4OWB A;  191L A;  4RLM A;  1F10 A;  1QUH A;  4ZFP A;  1L99 A;  169L A;  1L03 A;  1L25 A;  2LZT A;  4LYC A;  1B7M A;  2OE9 X;  2HU3 A;  4S0W A;  1L52 A;  4I7L A;  4HPE A;  5KXP A;  182L A;  4Z41 A;  1BWJ A;  161L A;  2RBS A;  4NHQ A;  1RJC B;  1L11 A;  3B72 A;  3QNG A;  1D0L A;  1HEM A;  3AW7 A;  1W6Z A;  1PQO A;  1P37 A;  1HFZ A;  2Z18 A;  1JQU A;  1LHM A;  243L A;  3HBD A;  1ZUR A;  2HUK A;  197L A;  262L A;  1IR7 A;  1GF4 A;  186L A;  1C08 C;  2BAA A;  4LFX A;  1QTV A;  1AM7 A;  1L01 A;  3W6B A;  7LZM A;  5I53 A;  5APD A;  3A3R X;  1L67 A;  3EO5 A;  4DD7 A;  3JR6 A;  1L62 A;  5HNC A;  3W6D A;  5B07 A;  257L A;  4LYT A;  1P64 A;  2W1M A;  190L A;  1GWD A;  1NBY C;  145L A;  1CU3 A;  1L93 A;  4ML7 A;  3A8Z A;  3ZEK A;  4PRQ A;  1LYG A;  4WO6 A;  3TXH A;  3WU9 A;  1B5X A;  1C65 A;  1GBO A;  1EQ4 A;  1JKD A;  4Z46 A;  1QUO A;  3WYH A;  1UID A;  5HMV A;  4DDC A;  1C6J A;  1L47 A;  2W1X A;  4BAP A;  1G1V A;  1SLY A;  4NHS A;  1GE4 A;  228L A;  1LMO A;  3G3V A;  5C6L A;  3P65 A;  2ZNX Y;  3OJP A;  1FDL Y;  1LMN A;  1LZ5 A;  3GUP A;  2D4K A;  5KXS A;  4DD9 A;  3LZM A;  3G3X A;  4U3X B;  1G7L C;  4PHI A;  4WLX A;  3QE8 A;  1UIA A;  1VDT A;  1C69 A;  5APE A;  1LSC A;  1VFB C;  3W3E A;  5KXM A;  4GLV A;  2B6Y A;  1IWX A;  4H9C A;  131L A;  5F14 A;  5LYZ A;  1HEP A;  1T6H A;  1GFV A;  2HEF A;  5C6I A;  3HTF A;  2IFF Y;  1LYE A;  2MEC A;  3GUJ A;  1YKX X;  2LZM A;  1LZ8 A;  1DXJ A;  4YEM A;  1XEI A;  2LCB A;  3K2R A;  1HEO A;  1JWR A;  4ARJ A;  5L3H A;  4DD2 A;  2HUM A;  1LZC A;  4P2E A;  4W55 A;  2O79 A;  5LYT A;  3TMU A;  1L50 A;  3NY9 A;  1OV7 A;  1P2R A;  1WVU A;  2LYZ A;  1CKH A;  2Z38 A;  4NGO A;  137L A;  1B7O A;  1GFJ A;  3LZ2 A;  4ARQ A;  2ANV A;  3WW6 A;  1OUC A;  1L08 A;  1JEF A;  1LHK A;  4DC4 A;  5FCP A;  1C6I A;  174L A;  1LZB A;  3WVY A;  1G7M C;  1DI4 A;  2Z6B A;  3AZ7 A;  4TUN A;  3SB9 A;  4XAD A;  5F9X A;  3C7Z A;  167L A;  1L31 A;  1L34 A;  1ZMY L;  5KXN A;  5KXZ A;  4FJR A;  4CFP A;  4CFO A;  4XJH A;  4NHT A;  1OYU A;  1QIO A;  258L A;  2YSS C;  1C7P A;  4QEQ A;  4M6D A;  1XGU C;  5IDD A;  1FN5 A;  1JSF A;  208L A;  1JKC A;  236L A;  1B7S A;  3DMZ A;  2FBB A;  3TMW A;  1Z55 A;  4D9Z A;  4NSI A;  1YIL A;  4NG1 A;  5A3Z A;  1NBZ C;  170L A;  2F4A A;  1L40 A;  4ZPU A;  1L90 A;  1AZF A;  3HBH A;  1NWG A;  1UC0 A;  3B0K A;  3ATO A;  5D5F A;  1JTN A;  4DDA A;  5B06 A;  4RLN A;  2EQL A;  4RW1 A;  3SBB C;  4DT3 A;  4HPI A;  4I7T A;  3HU9 A;  1LSF A;  1LZR A;  165L A;  1C6M A;  2D91 A;  2YBN A;  2YVB A;  4ET9 A;  2EIZ C;  1CUP A;  1H6M A;  1HMK A;  2WAR A;  234L A;  1HEQ A;  1GE3 A;  2ZQ3 A;  3J6K A;  3ZVQ A;  4DD1 A;  3HTG A;  1HC0 A;  2A7D A;  3FAD A;  1CU6 A;  1G0G A;  1IWU A;  1J1O Y;  2B72 A;  1L27 A;  1LZG A;  3DN3 A;  1L75 A;  1INU A;  4IAS A;  1REZ A;  1IWY A;  1T8A A;  249L A;  1L98 A;  3TXG A;  173L A;  240L A;  1I56 A;  1TCY A;  218L A;  1GB8 A;  3TXB A;  3ULR A;  128L A;  2ANX A;  113L A;  1KY0 A;  199L A;  231L A;  4PGJ B;  5LZM A;  3A96 A;  4EXM A;  217L A;  4I8S A;  3GXR A;  4HV1 A;  144L A;  4XJI A;  4YXC A;  2BLX A;  1LZE A;  3HT9 A;  4L41 A;  1GB6 A;  3TMX A;  3FI7 A;  3DMX A;  3TXK A;  1LGW A;  1ALC A;  1HEN A;  1G0P A;  1KY1 A;  1B7N A;  1LZ1 A;  4J0L A;  4WL6 A;  2D4I A;  1QSQ A;  1WQN A;  1BB4 A;  2RSC A;  1L07 A;  3GUK A;  1GEV A;  5LYM A;  4PPO A;  4MR1 A;  1LJN A;  2D4J A;  2DQJ Y;  4NGW A;  2BQN A;  3E3D A;  4HTK A;  1LSA A;  5LVG A;  2Q9E A;  1LZA A;  2QAR C;  1C6H A;  178L A;  1XGT C;  4BAD A;  1SX7 A;  3ATN A;  181L A;  3KAM A;  4PK0 A;  2YBM A;  4R6C A;  2CGI A;  1IOS A;  215L A;  1LZS A;  1LPY A;  4DKL A;  1HFY A;  2QB0 B;  1GF7 A;  2BQG A;  3OK0 A;  3P4Z A;  162L A;  1IWZ A;  1HF4 A;  1G0K A;  5FEL A;  1LYO A;  2YDG A;  4I0C A;  4EKQ A;  3HTB A;  3RZ4 A;  1DYF A;  223L A;  1QTE A;  4W53 A;  5B05 A;  115L A;  4WLY A;  1KS3 A;  108L A;  1BHZ A;  1CV1 A;  1A2Y C;  5IHG A;  1L05 A;  1YRO A;  1KNI A;  1L48 A;  1WVV A;  1IP3 A;  1PZY A;  2MEE A;  4J1A A;  1GF6 A;  4KPM A;  1XEK A;  2X0A A;  4OWC A;  1GAY A;  3OE9 A;  4GCC A;  1P46 A;  4OWA A;  4EOF A;  1L18 A;  1D9W A;  1D3M A;  255L A;  3C7Y A;  1LJ4 A;  1LZN A;  1D0K A;  4GBR B;  1QT5 A;  4W51 A;  1IX0 A;  4NGI A;  3EMS A;  1LJG A;  1L94 A;  4GCF A;  1FLW A;  1OP9 B;  2EPE A;  3EXD A;  1JIT A;  5LVJ A;  3CDO A;  2F47 A;  3WL2 A;  1IOR A;  2RB0 X;  2XJW A;  5M1Y A;  1PS5 A;  224L A;  5LVH A;  5KXX A;  3TXI A;  1KW7 A;  4DD3 A;  4H9B A;  4WG1 A;  1L86 A;  3CSR A;  1JIS A;  1RFP A;  4B4E A;  2I26 L;  261L A;  1QT4 A;  4YX7 C;  4AXT A;  3G3B B;  2B70 A;  1D3F A;  4GN4 A;  1L16 A;  2BQJ A;  2LC9 A;  1DYC A;  3CT1 A;  3M3U A;  1LYY A;  5F81 A;  4ZIX A;  3BKH A;  2DQE Y;  1LMA A;  1LWG A;  4W94 A;  3W6F A;  3J4G A;  5J7C A;  1LCN A;  1LZ6 A;  1C63 A;  1L69 A;  1C6T A;  1BWH A;  1LJJ A;  1B5V A;  1L28 A;  3HH5 A;  1BB5 A;  1IP7 A;  1ZWN A;  2Z2F A;  2Z39 A;  247L A;  1L85 A;  1KIR C;  2BQM A;  1LJ3 A;  1L49 A;  2ZIK A;  4H92 A;  2HUL A;  1C6N A;  2BQD A;  151L A;  1C67 A;  4PRU A;  244L A;  2O7A A;  3DN6 A;  1L41 A;  1L76 A;  1LI6 A;  1CKF A;  1L68 A;  1L00 A;  1XJU A;  1PQJ A;  1WTM A;  104L A;  1L65 A;  1DYE A;  1IWW A;  4TWS A;  1GF9 A;  1L63 A;  1JKB A;  103L A;  2XBR A;  1AKI A;  1YKZ X;  3AGG G;  5DM9 A;  4GCE A;  3DKE X;  248L A;  3GUM A;  4WM5 A;  212L A;  1WTN A;  3LHM A;  1LSB A;  5KXW A;  2YBI A;  1JTT L;  5K7O A;  1EL1 A;  4YEO A;  122L A;  4QY9 A;  1CX7 A;  4N8Z A;  1L56 A;  1FLU A;  133L A;  1IEE A;  1TDY A;  1QUD A;  1OUD A;  4XJF A;  4HTQ A;  2N5Z A;  1J1X Y;  4TSB A;  3L2X A;  1DKJ A;  4DD0 A;  1P36 A;  2BQC A;  4UWU A;  4ARM B;  4GN5 C;  2RBO A;  3N9E A;  4LYB A;  129L A;  2OU9 A;  4HJZ A;  1C6Q A;  4NG8 A;  1HNL A;  1L82 A;  1LJF A;  4YM8 A;  1C6D A;  4EPF A;  1A4V A;  3DNA A;  3LYZ A;  4LT2 A;  5A3E A;  1QT7 A;  1ZYT A;  141L A;  3HT7 A;  1VDS A;  3SP3 A;  1LYI A;  4NIJ A;  148L E;  1LZ9 A;  2Y8P A;  1LYH A;  126L A;  1C43 A;  1L46 A;  4ZEE A;  3DN2 A;  1C45 A;  1LZT A;  4I7N A;  2B6X A;  2C8O A;  4A7D A;  4ARP A;  1DI3 A;  5F16 A;  1L39 A;  1YQV Y;  2RBN A;  1I6S A;  4W54 A;  3GUO A;  4C3W A;  3CDT A;  1L36 A;  1KIQ C;  1C6A A;  4OW1 A;  1OQM A;  1D3J A;  3P64 A;  5FDJ A;  1NHE A;  1IC4 Y;  1NF5 A;  4II8 A;  200L A;  1HER A;  4CGE A;  1L22 A;  2RBQ A;  1L13 A;  209L A;  1OUA A;  1L32 A;  4UWV A;  1BB3 A;  4ETE A;  1CKC A;  2B6Z A;  3HT6 A;  4YOP A;  3A95 A;  1LGU A;  1G7I C;  1VED A;  175L A;  1BGI A;  146L A;  1GHL A;  187L A;  3D4S A;  1L57 A;  1L74 A;  3T36 A;  2BQK A;  2G4Q A;  3CT0 A;  4I7K A;  219L A;  1G0L A;  1LJK A;  3A67 Y;  1D3N A;  1C6F A;  1QT8 A;  1C6P A;  164L A;  2NTH A;  3A93 A;  3FA0 A;  4HSF A;  4WM4 A;  3SB6 A;  4AQN A;  1GD6 A;  4WM2 A;  4W52 A;  1GXX A;  3LYT A;  2Z2E A;  1RCM A;  3RT5 X;  4W58 A;  1LZ4 A;  3C82 A;  3WUL A;  1L51 A;  3AW6 A;  4UWN A;  259L A;  1LW9 A;  2MEH A;  1CV4 A;  1B7Q A;  2W1L A;  3C80 A;  4NGJ A;  1L95 A;  6LYZ A;  1CVK A;  4N1C C;  1OVH A;  1OVK A;  1BWI A;  4WG7 A;  1B9O A;  2RBR A;  1HEL A;  2F30 A;  2HUB A;  3WH1 A;  3PBL A;  4G4B A;  2BQL A;  1D2W A;  214L A;  1YIK A;  1IVM A;  1MEL L;  2B6W A;  2A7F A;  3CQL A;  3TXD A;  3A91 A;  1D0M A;  2RAY X;  5APF A;  4XJG A;  1P6Y A;  1FLY A;  2IHL A;  3LYM A;  5LVI A;  4N1E I;  5I54 A;  1IO5 A;  3AGH A;  3GUN A;  4FDY A;  3MGW A;  4NWE A;  1G7H C;  3SBA A;  1NQI A;  134L A;  1CX6 A;  1IC5 Y;  1KXX A;  4HJV A;  1CNS A;  1QS9 A;  3C8S A;  3DN4 A;  1EQ5 A;  1GDX A;  159L A;  158L A;  4NHP A;  2RAZ X;  1LHJ A;  1L35 A;  1CV5 A;  1CJ8 A;  221L A;  5II3 A;  2FBD A;  4W96 A;  4PJ2 C;  1GB7 A;  3AZ4 A;  1UAC Y;  4H8Y A;  1KW5 A;  3WVX A;  4EPI A;  1UIE A;  1QUG A;  139L A;  3AYQ A;  3SB7 A;  2C8P A;  125L A;  1L96 A;  4W56 A;  183L A;  2HED A;  3C7W A;  4LT3 A;  4YEN A;  3C81 A;  2B74 A;  2AUB A;  2MEI A;  189L A;  4E97 A;  222L A;  7LYZ A;  1UIG A;  5F9U A;  110L A;  4H9A A;  2MEA A;  1J1P Y;  4DQ5 A;  4XN6 A;  206L A;  1UCO A;  1QTD A;  1L66 A;  1IY3 A;  1C6K A;  3FE0 A;  1C61 A;  3TXJ A;  4DQJ A;  2I6Z A;  1AT5 A;  1L54 A;  1C6C A;  5EBH A;  1OUF A;  3GUI A;  3WUN A;  5KXL A;  1L0J A;  3N9A A;  4H93 A;  246L A;  5DL9 A;  176L A;  4OWH A;  4H9F A;  1LSZ A;  4IAP A;  4ARL A;  150L A;  109L A;  1B5U A;  1LTM A;  5I4Y A;  114L A;  1XGR C;  5ILC A;  143L A;  216L A;  5KKJ A;  2HEE A;  5HMJ A;  1L23 A;  2MEB A;  3UON A;  5B1F A;  1GBY A;  1WTH A;  4H91 A;  1LPI A;  1G1W A;  3F8V A;  4CHX A;  1L04 A;  1QS5 A;  1GAZ A;  3IJU A;  2ZIJ A;  2G4P A;  1LYZ A;  3D3D A;  1GFK A;  1L64 A;  3CDQ A;  1QUT A;  4G4C A;  1CU5 A;  1UIB A;  1GFT A;  1PQD A;  3B0I A;  4KL7 A;  102L A;  1T8G A;  1CKG A;  1FBI X;  1TAY A;  4NY5 A;  194L A;  1L15 A;  4NSH A;  1DZB X;  1DYA A;  1JHL A;  5HLL A;  1D2Y A;  1IP1 A;  3BKV A;  2G4N A;  1BQL Y;  4LYM A;  1LKR A;  3HDE A;  3T6U A;  2ZWB A;  4WOA A;  1L06 A;  1LYD A;  3HWL A;  1OUH A;  1T8F A;  5E4P A;  1L10 A;  2DKV A;  1C64 A;  241L A;  4BAF A;  226L A;  1YAQ A;  3ZVQ B;  2Z12 A;  4WL7 A;  4MST A;  2HU1 A;  4O34 A;  2EKS C;  1B5W A;  3RU5 A;  132L A;  185L A;  149L A;  1TBY A;  2A4T A;  1GFG A;  1IC7 Y;  4H9I A;  1XJT A;  4DDB A;  1IIZ A;  4I7S A;  120L A;  1L89 A;  2DQD Y;  4H90 A;  4RW2 A;  1LHH A;  3HH4 A;  1F6R A;  1G06 A;  5KXK A;  1GFU A;  177L A;  1GB0 A;  2DQA A;  4XJB A;  5KXO A;  3WPK A;  4I7O A;  4R0F A;  1UIH A;  3G3A B;  227L A;  1G7J C;  3LYO A;  4QDN A;  3HTD A;  5DN4 A;  3WPJ A;  1P2L A;  1NDG C;  1L73 A;  1YAN A;  3L64 A;  1DYG A;  1CU0 A;  1T6V L;  171L A;  3WU7 A;  3TXE A;  1LGX A;  1LWK A;  4MCK A;  3PDS A;  3HUK A;  1LMQ A;  3B0O A;  4EMN A;  3WU8 A;  1L24 A;  3WW5 A;  1IOT A;  5LA8 A;  4H1P A;  2CWI A;  245L A;  2OE4 X;  1P3N A;  1PQI A;  233L A;  1YKY X;  1O23 A;  3SB5 A;  1CTW A;  2W1Y A;  2F2Q A;  4Z98 A;  1G07 A;  1L88 A;  5I14 A;  2ZYP A;  4NGZ A;  5E9R A;  1L60 A;  2OU0 X;  3DN1 A;  1NMM A;  3N9C A;  1CKD A;  2OU8 A;  1VDP A;  123L A;  5IEL A;  5ILF A;  1LI3 A;  1RE2 A;  3HH6 A;  1HML A;  1IP5 A;  1L21 A;  1IOQ A;  5KKI A;  2XBS A;  1SX2 A;  4H94 A;  2I25 L;  1DPW A;  4IAT A;  4WM3 A;  1GFA A;  3B6L A;  166L A;  3AGI A;  1L55 A;  3EML A;  1HSW A;  1L97 A;  4GLA A;  1D9U A;  1TLA A;  5KXR A;  1LZY A;  1P56 A;  1IOC A;  4NGY A;  3VW7 A;  4B0D A;  4Z3M A;  1DKK A;  188L A;  2ZYC A;  1VDQ A;  1LMC A;  4BS7 A;  2B73 A;  4WLT A;  1OVJ A;  1DI5 A;  1LJE A;  1YAP A;  2FYD A;  1L20 A;  2CDS A;  4LYZ A;  154L A;  1PQK A;  2BPU A;  237L A;  138L A;  1UBZ A;  193L A;  2O4W A;  1LSN A;  4YXA C;  3NYA A;  2DQI Y;  1SWZ A;  3A3Q A;  127L A;  1CU2 A;  2BQE A;  1IY4 A;  1L92 A;  1LHL A;  1L72 A;  3LZT A;  1OWZ A;  1BB7 A;  2OEA X;  1KIP C;  1L61 A;  2LZ2 A;  1GE1 A;  5I4X A;  4NEB A;  3IJV A;  1N4F A;  8LYZ A;  3C8R A;  3HH3 A;  1QDT A;  1G0J A;  4WM6 A;  4TSC A;  1UA6 Y;  1YAO A;  1XEJ A;  254L A;  1YL0 X;  1QSA A;  4ETC A;  210L A;  1GBX A;  2YBL A;  1B6I A;  4GRV A;  1GB9 A;  4NGK A;  2B6T A;  2Q0M X;  1GF5 A;  3WPL A;  1WQR A;  3C83 A;  1NDM C;  3A94 A;  2Z19 A;  1LLH A;  4EKP A;  1WQO A;  4HJY A;  5DN5 A;  1T3P A;  1P5C A;  4LZM A;  1L83 A;  5LIO A;  1L53 A;  1LZD A;  4J7V A;  1B7R A;  4DJH A;  3AJN A;  4HV2 A;  1IWT A;  1L91 A;  1ZVH L;  1GB3 A;  147L A;  4NGL A;  1L77 A; 
#chains in the Genus database with same CATH homology
 2RB1 X;  1LHI A;  1T97 A;  1QTK A;  2DQC Y;  3P68 A;  4XEN A;  252L A;  1L30 A;  1EPY A;  1IR8 A;  232L A;  4I7P A;  4OO9 A;  4M4O A;  2B5Z A;  256L A;  1FKQ A;  1V7S A;  4G49 A;  239L A;  2LYM A;  5FEK A;  3DN0 A;  1GXV 2;  4ET8 A;  3OE6 A;  1I20 A;  130L A;  5B59 A;  3DMV A;  4W59 A;  2DQH Y;  2ZIL A;  1C62 A;  5FHW A;  1F6S A;  160L A;  1I1Z A;  3FI5 A;  3V2W A;  1UUZ C;  5HQ1 A;  1LMP A;  1RI8 B;  1REY A;  3A92 A;  3AZ6 A;  225L A;  3K3T A;  1LYJ A;  4XJD A;  1L12 A;  155L A;  3M18 B;  4GN3 A;  3A6C Y;  2HTX A;  1B0D A;  2DQF C;  2DQG Y;  1G0Q A;  4LT0 A;  2BQI A;  1CV6 A;  3HU8 A;  1JSE A;  1OUJ A;  4LYO A;  3EBA B;  5HNL A;  3CT5 A;  4RDS A;  4K5Y A;  1JUG A;  4N0J A;  1LI2 A;  2OE7 X;  140L A;  2XQO A;  1C60 A;  1D6Q A;  1B5Y A;  4XYY A;  2MED A;  112L A;  1CUQ A;  2Z37 A;  3W6A A;  2HEC A;  1YAM A;  3RZE A;  1IP2 A;  1W08 A;  4EKR A;  1QT6 A;  4NSJ A;  1GE0 A;  1GB5 A;  3IWR A;  4X3B A;  4WM1 A;  4NHI A;  4I7J A;  1PQM A;  1OV5 A;  2F32 A;  1OWY A;  1NHB A;  1FLQ A;  1L70 A;  172L A;  1GFE A;  1KXY A;  238L A;  3NY8 A;  4WLD A;  2BQF A;  2ZQ4 A;  3A34 A;  4N5R A;  2MEG A;  5C6J A;  4H8Z A;  1SSY A;  3W6E A;  1XSF A;  5DLA A;  4LGK A;  4DWX A;  4B4J A;  1LSY A;  1NKH A;  1QTZ A;  4HTN A;  2MEF A;  1CJ7 A;  3F9L A;  4H9E A;  1L87 A;  2FYC A;  1L44 A;  253L A;  1GB2 A;  1HFX A;  230L A;  1B5Z A;  2IGC A;  5LA5 A;  1LJH A;  1OUG A;  4I7R A;  111L A;  1FKV A;  4B4I A;  3ODU A;  1LSD A;  4ETB A;  2D6B A;  5LXW A;  1HEW A;  3HT8 A;  5I4W A;  3CDV A;  1QSW A;  4W57 A;  1L79 A;  3P66 A;  1OUB A;  5LAF A;  3GUL A;  1OUE A;  1LSE A;  1SQ2 L;  4EJ4 A;  3RUN A;  1QSB A;  5KJ9 A;  1H87 A;  4DQ7 A;  1JTP L;  3WUA A;  2RBP A;  3DN8 A;  4LT1 A;  1D6P A;  4OWE A;  2PC2 A;  3HDF A;  1JPO A;  1BVK C;  152L A;  1L45 A;  2H9J A;  1DQJ C;  5APC A;  4ARQ B;  1P7S A;  3HFM Y;  1QT3 A;  1SSW A;  1GBW A;  1C6B A;  1B2K A;  4AGA A;  1JJ3 A;  1LMT A;  1L59 A;  4NSG A;  1L80 A;  1WQQ A;  1QTB A;  1L29 A;  1L0K A;  3LN2 A;  1C6G A;  1XGQ C;  1L14 A;  4C5F A;  153L A;  4LFP A;  5KY1 A;  1L81 A;  1GBZ A;  1XEP A;  1C66 A;  3SB8 A;  1GFR A;  3G3W A;  2VB1 A;  2NTG A;  1DYD A;  4QGZ A;  2Q9D A;  1QTH A;  4ETD A;  4KXI A;  3OE0 A;  4I7Q A;  4PJZ A;  195L A;  3A90 A;  4I7M A;  1EQE A;  157L A;  4NGV A;  2RH1 A;  3CSQ A;  1LSM A;  1L71 A;  3AZ5 A;  3WUM A;  207L A;  2BQB A;  1XGP C;  4GCB A;  3QAK A;  1L02 A;  1E8L A;  2LHM A;  3OE8 A;  3WXU A;  1CV0 A;  2CJL A;  4NWH A;  2F2N A;  1C68 A;  1L38 A;  1L17 A;  2YBH A;  1AT6 A;  4H8X A;  1IP6 A;  198L A;  3QY4 A;  1L37 A;  1LJI A;  211L A;  1C46 A;  4G9S A;  1JJ1 A;  1L58 A;  2BQO A;  2GV0 A;  1LKS A;  5I5Q A;  2B75 A;  1L43 A;  3CSZ A;  220L A;  1L09 A;  1K28 A;  196L A;  1MLC E;  1ZVY B;  1WQM A;  1GBS A;  3SN6 R;  2ZNW Y;  4KT3 A;  2L78 A;  3GXK A;  251L A;  260L A;  3C8Q A;  2RB2 X;  3AB6 A;  118L A;  1L26 A;  3V2Y A;  1HSX A;  5KXT A;  1L42 A;  1BB6 A;  1UIC A;  2BQA A;  242L A;  1GEZ A;  1YL1 X;  4WMG A;  4OOT A;  2HEA A;  4H9H A;  4E3U A;  3TMV A;  5T3F A;  4DAJ A;  1JTM A;  1ZV5 L;  107L A;  2OTZ X;  1V7T A;  3W6C A;  3TXF A;  1JIY A;  1L84 A;  1REM A;  9LYZ A;  229L A;  205L A;  1OUI A;  1LYF A;  4B49 A;  5KXY A;  5L3I A;  2H9K A;  2OTY X;  3CDR A;  1GDW A;  1LSG A;  2H5Z A;  142L A;  3HUA A;  2YBJ A;  1P2C C;  1BVX A;  1LSP A;  1LAA A;  163L A;  1IP4 A;  4GCD A;  192L A;  2CUU A;  1QTC A;  1QDR A;  3WXT A;  1CJ6 A;  1C6E A;  1F0W A;  4LZT A;  5AMY A;  1L19 A;  5FST A;  5LIN A;  4HP0 A;  3HUQ A;  1GF8 A;  4EKS A;  1VAT A;  1SWY A;  2NWD X;  1WQP A;  5L9J A;  4ARM A;  201L A;  3HBE X;  1GPQ C;  1TEW A;  4NFV A;  4DYG A;  1DPX A;  4G4H A;  6LYT A;  2BLY A;  1L33 A;  1GF0 A;  3CB7 A;  4LDE A;  1LYS A;  4YF2 A;  1JJ0 A;  2XTH A;  1DYB A;  4TX7 A;  4LDL A;  1GE2 A;  1HHL A;  1JKA A;  1XFP L;  1VAU A;  1B7P A;  1UIF A;  4N9R A;  156L A;  4ETA A;  213L A;  4ANR A;  135L A;  2F4G A;  180L A;  250L A;  1GF3 A;  4LDO A;  2BQH A;  4IJ4 A;  2B7X A;  3WMK A;  4OOO A;  3A6B Y;  3VWO A;  1QUS A;  5JEN B;  4J1B A;  5LVK A;  4CJ2 A;  168L A;  2HEB A;  3D9A C;  1REX A;  5B1G A;  1GFH A;  3RNX A;  1IR9 A;  4B1A A;  1JTO L;  1CV3 A;  184L A;  1G0M A;  5D5C A;  2LYO A;  1LOZ A;  1KXW A;  3F6Z A;  4TTD A;  5LAG A;  1IWV A;  1C6L A;  6LZM A;  1C10 A;  1CJ9 A;  2DBT A;  3RW8 A;  119L A;  235L A;  1B7L A;  1QQY A;  4WO9 A;  4OWB A;  191L A;  4RLM A;  1F10 A;  1QUH A;  4ZFP A;  1L99 A;  169L A;  1L03 A;  1L25 A;  2LZT A;  4LYC A;  1B7M A;  2OE9 X;  2HU3 A;  4S0W A;  1L52 A;  4I7L A;  4HPE A;  5KXP A;  182L A;  4Z41 A;  1BWJ A;  161L A;  2RBS A;  4NHQ A;  1RJC B;  1L11 A;  3B72 A;  3QNG A;  1D0L A;  1HEM A;  3AW7 A;  1W6Z A;  1PQO A;  1P37 A;  1HFZ A;  2Z18 A;  1JQU A;  1LHM A;  243L A;  3HBD A;  1ZUR A;  2HUK A;  197L A;  262L A;  1IR7 A;  1GF4 A;  186L A;  1C08 C;  2BAA A;  4LFX A;  1QTV A;  1AM7 A;  1L01 A;  3W6B A;  7LZM A;  5I53 A;  5APD A;  3A3R X;  1L67 A;  3EO5 A;  4DD7 A;  3JR6 A;  1L62 A;  5HNC A;  3W6D A;  5B07 A;  257L A;  4LYT A;  1P64 A;  2W1M A;  190L A;  1GWD A;  1NBY C;  145L A;  1CU3 A;  1L93 A;  4ML7 A;  3A8Z A;  3ZEK A;  4PRQ A;  1LYG A;  4WO6 A;  3TXH A;  3WU9 A;  1B5X A;  1C65 A;  1GBO A;  1EQ4 A;  1JKD A;  4Z46 A;  1QUO A;  3WYH A;  1UID A;  5HMV A;  4DDC A;  1C6J A;  1L47 A;  2W1X A;  4BAP A;  1G1V A;  1SLY A;  4NHS A;  1GE4 A;  228L A;  1LMO A;  3G3V A;  5C6L A;  3P65 A;  2ZNX Y;  3OJP A;  1FDL Y;  1LMN A;  1LZ5 A;  3GUP A;  2D4K A;  5KXS A;  4DD9 A;  3LZM A;  3G3X A;  4U3X B;  1G7L C;  4PHI A;  4WLX A;  3QE8 A;  1UIA A;  1VDT A;  1C69 A;  5APE A;  1LSC A;  1VFB C;  3W3E A;  5KXM A;  4GLV A;  2B6Y A;  1IWX A;  4H9C A;  131L A;  5F14 A;  5LYZ A;  1HEP A;  1T6H A;  1GFV A;  2HEF A;  5C6I A;  3HTF A;  2IFF Y;  1LYE A;  2MEC A;  3GUJ A;  1YKX X;  2LZM A;  1LZ8 A;  1DXJ A;  4YEM A;  1XEI A;  2LCB A;  3K2R A;  1HEO A;  1JWR A;  4ARJ A;  5L3H A;  4DD2 A;  2HUM A;  1LZC A;  4P2E A;  4W55 A;  2O79 A;  5LYT A;  3TMU A;  1L50 A;  3NY9 A;  1OV7 A;  1P2R A;  1WVU A;  2LYZ A;  1CKH A;  2Z38 A;  4NGO A;  137L A;  1B7O A;  1GFJ A;  3LZ2 A;  4ARQ A;  2ANV A;  3WW6 A;  1OUC A;  1L08 A;  1JEF A;  1LHK A;  4DC4 A;  5FCP A;  1C6I A;  174L A;  1LZB A;  3WVY A;  1G7M C;  1DI4 A;  2Z6B A;  3AZ7 A;  4TUN A;  3SB9 A;  4XAD A;  5F9X A;  3C7Z A;  167L A;  1L31 A;  1L34 A;  1ZMY L;  5KXN A;  5KXZ A;  4FJR A;  4CFP A;  4CFO A;  4XJH A;  4NHT A;  1OYU A;  1QIO A;  258L A;  2YSS C;  1C7P A;  4QEQ A;  4M6D A;  1XGU C;  5IDD A;  1FN5 A;  1JSF A;  208L A;  1JKC A;  236L A;  1B7S A;  3DMZ A;  2FBB A;  3TMW A;  1Z55 A;  4D9Z A;  4NSI A;  1YIL A;  4NG1 A;  5A3Z A;  1NBZ C;  170L A;  2F4A A;  1L40 A;  4ZPU A;  1L90 A;  1AZF A;  3HBH A;  1NWG A;  1UC0 A;  3B0K A;  3ATO A;  5D5F A;  1JTN A;  4DDA A;  5B06 A;  4RLN A;  2EQL A;  4RW1 A;  3SBB C;  4DT3 A;  4HPI A;  4I7T A;  3HU9 A;  1LSF A;  1LZR A;  165L A;  1C6M A;  2D91 A;  2YBN A;  2YVB A;  4ET9 A;  2EIZ C;  1CUP A;  1H6M A;  1HMK A;  2WAR A;  234L A;  1HEQ A;  1GE3 A;  2ZQ3 A;  3J6K A;  3ZVQ A;  4DD1 A;  3HTG A;  1HC0 A;  2A7D A;  3FAD A;  1CU6 A;  1G0G A;  1IWU A;  1J1O Y;  2B72 A;  1L27 A;  1LZG A;  3DN3 A;  1L75 A;  1INU A;  4IAS A;  1REZ A;  1IWY A;  1T8A A;  249L A;  1L98 A;  3TXG A;  173L A;  240L A;  1I56 A;  1TCY A;  218L A;  1GB8 A;  3TXB A;  3ULR A;  128L A;  2ANX A;  113L A;  1KY0 A;  199L A;  231L A;  4PGJ B;  5LZM A;  3A96 A;  4EXM A;  217L A;  4I8S A;  3GXR A;  4HV1 A;  144L A;  4XJI A;  4YXC A;  2BLX A;  1LZE A;  3HT9 A;  4L41 A;  1GB6 A;  3TMX A;  3FI7 A;  3DMX A;  3TXK A;  1LGW A;  1ALC A;  1HEN A;  1G0P A;  1KY1 A;  1B7N A;  1LZ1 A;  4J0L A;  4WL6 A;  2D4I A;  1QSQ A;  1WQN A;  1BB4 A;  2RSC A;  1L07 A;  3GUK A;  1GEV A;  5LYM A;  4PPO A;  4MR1 A;  1LJN A;  2D4J A;  2DQJ Y;  4NGW A;  2BQN A;  3E3D A;  4HTK A;  1LSA A;  5LVG A;  2Q9E A;  1LZA A;  2QAR C;  1C6H A;  178L A;  1XGT C;  4BAD A;  1SX7 A;  3ATN A;  181L A;  3KAM A;  4PK0 A;  2YBM A;  4R6C A;  2CGI A;  1IOS A;  215L A;  1LZS A;  1LPY A;  4DKL A;  1HFY A;  2QB0 B;  1GF7 A;  2BQG A;  3OK0 A;  3P4Z A;  162L A;  1IWZ A;  1HF4 A;  1G0K A;  5FEL A;  1LYO A;  2YDG A;  4I0C A;  4EKQ A;  3HTB A;  3RZ4 A;  1DYF A;  223L A;  1QTE A;  4W53 A;  5B05 A;  115L A;  4WLY A;  1KS3 A;  108L A;  1BHZ A;  1CV1 A;  1A2Y C;  5IHG A;  1L05 A;  1YRO A;  1KNI A;  1L48 A;  1WVV A;  1IP3 A;  1PZY A;  2MEE A;  4J1A A;  1GF6 A;  4KPM A;  1XEK A;  2X0A A;  4OWC A;  1GAY A;  3OE9 A;  4GCC A;  1P46 A;  4OWA A;  4EOF A;  1L18 A;  1D9W A;  1D3M A;  255L A;  3C7Y A;  1LJ4 A;  1LZN A;  1D0K A;  4GBR B;  1QT5 A;  4W51 A;  1IX0 A;  4NGI A;  3EMS A;  1LJG A;  1L94 A;  4GCF A;  1FLW A;  1OP9 B;  2EPE A;  3EXD A;  1JIT A;  5LVJ A;  3CDO A;  2F47 A;  3WL2 A;  1IOR A;  2RB0 X;  2XJW A;  5M1Y A;  1PS5 A;  224L A;  5LVH A;  5KXX A;  3TXI A;  1KW7 A;  4DD3 A;  4H9B A;  4WG1 A;  1L86 A;  3CSR A;  1JIS A;  1RFP A;  4B4E A;  2I26 L;  261L A;  1QT4 A;  4YX7 C;  4AXT A;  3G3B B;  2B70 A;  1D3F A;  4GN4 A;  1L16 A;  2BQJ A;  2LC9 A;  1DYC A;  3CT1 A;  3M3U A;  1LYY A;  5F81 A;  4ZIX A;  3BKH A;  2DQE Y;  1LMA A;  1LWG A;  4W94 A;  3W6F A;  3J4G A;  5J7C A;  1LCN A;  1LZ6 A;  1C63 A;  1L69 A;  1C6T A;  1BWH A;  1LJJ A;  1B5V A;  1L28 A;  3HH5 A;  1BB5 A;  1IP7 A;  1ZWN A;  2Z2F A;  2Z39 A;  247L A;  1L85 A;  1KIR C;  2BQM A;  1LJ3 A;  1L49 A;  2ZIK A;  4H92 A;  2HUL A;  1C6N A;  2BQD A;  151L A;  1C67 A;  4PRU A;  244L A;  2O7A A;  3DN6 A;  1L41 A;  1L76 A;  1LI6 A;  1CKF A;  1L68 A;  1L00 A;  1XJU A;  1PQJ A;  1WTM A;  104L A;  1L65 A;  1DYE A;  1IWW A;  4TWS A;  1GF9 A;  1L63 A;  1JKB A;  103L A;  2XBR A;  1AKI A;  1YKZ X;  3AGG G;  5DM9 A;  4GCE A;  3DKE X;  248L A;  3GUM A;  4WM5 A;  212L A;  1WTN A;  3LHM A;  1LSB A;  5KXW A;  2YBI A;  1JTT L;  5K7O A;  1EL1 A;  4YEO A;  122L A;  4QY9 A;  1CX7 A;  4N8Z A;  1L56 A;  1FLU A;  133L A;  1IEE A;  1TDY A;  1QUD A;  1OUD A;  4XJF A;  4HTQ A;  2N5Z A;  1J1X Y;  4TSB A;  3L2X A;  1DKJ A;  4DD0 A;  1P36 A;  2BQC A;  4UWU A;  4ARM B;  4GN5 C;  2RBO A;  3N9E A;  4LYB A;  129L A;  2OU9 A;  4HJZ A;  1C6Q A;  4NG8 A;  1HNL A;  1L82 A;  1LJF A;  4YM8 A;  1C6D A;  4EPF A;  1A4V A;  3DNA A;  3LYZ A;  4LT2 A;  5A3E A;  1QT7 A;  1ZYT A;  141L A;  3HT7 A;  1VDS A;  3SP3 A;  1LYI A;  4NIJ A;  148L E;  1LZ9 A;  2Y8P A;  1LYH A;  126L A;  1C43 A;  1L46 A;  4ZEE A;  3DN2 A;  1C45 A;  1LZT A;  4I7N A;  2B6X A;  2C8O A;  4A7D A;  4ARP A;  1DI3 A;  5F16 A;  1L39 A;  1YQV Y;  2RBN A;  1I6S A;  4W54 A;  3GUO A;  4C3W A;  3CDT A;  1L36 A;  1KIQ C;  1C6A A;  4OW1 A;  1OQM A;  1D3J A;  3P64 A;  5FDJ A;  1NHE A;  1IC4 Y;  1NF5 A;  4II8 A;  200L A;  1HER A;  4CGE A;  1L22 A;  2RBQ A;  1L13 A;  209L A;  1OUA A;  1L32 A;  4UWV A;  1BB3 A;  4ETE A;  1CKC A;  2B6Z A;  3HT6 A;  4YOP A;  3A95 A;  1LGU A;  1G7I C;  1VED A;  175L A;  1BGI A;  146L A;  1GHL A;  187L A;  3D4S A;  1L57 A;  1L74 A;  3T36 A;  2BQK A;  2G4Q A;  3CT0 A;  4I7K A;  219L A;  1G0L A;  1LJK A;  3A67 Y;  1D3N A;  1C6F A;  1QT8 A;  1C6P A;  164L A;  2NTH A;  3A93 A;  3FA0 A;  4HSF A;  4WM4 A;  3SB6 A;  4AQN A;  1GD6 A;  4WM2 A;  4W52 A;  1GXX A;  3LYT A;  2Z2E A;  1RCM A;  3RT5 X;  4W58 A;  1LZ4 A;  3C82 A;  3WUL A;  1L51 A;  3AW6 A;  4UWN A;  259L A;  1LW9 A;  2MEH A;  1CV4 A;  1B7Q A;  2W1L A;  3C80 A;  4NGJ A;  1L95 A;  6LYZ A;  1CVK A;  4N1C C;  1OVH A;  1OVK A;  1BWI A;  4WG7 A;  1B9O A;  2RBR A;  1HEL A;  2F30 A;  2HUB A;  3WH1 A;  3PBL A;  4G4B A;  2BQL A;  1D2W A;  214L A;  1YIK A;  1IVM A;  1MEL L;  2B6W A;  2A7F A;  3CQL A;  3TXD A;  3A91 A;  1D0M A;  2RAY X;  5APF A;  4XJG A;  1P6Y A;  1FLY A;  2IHL A;  3LYM A;  5LVI A;  4N1E I;  5I54 A;  1IO5 A;  3AGH A;  3GUN A;  4FDY A;  3MGW A;  4NWE A;  1G7H C;  3SBA A;  1NQI A;  134L A;  1CX6 A;  1IC5 Y;  1KXX A;  4HJV A;  1CNS A;  1QS9 A;  3C8S A;  3DN4 A;  1EQ5 A;  1GDX A;  159L A;  158L A;  4NHP A;  2RAZ X;  1LHJ A;  1L35 A;  1CV5 A;  1CJ8 A;  221L A;  5II3 A;  2FBD A;  4W96 A;  4PJ2 C;  1GB7 A;  3AZ4 A;  1UAC Y;  4H8Y A;  1KW5 A;  3WVX A;  4EPI A;  1UIE A;  1QUG A;  139L A;  3AYQ A;  3SB7 A;  2C8P A;  125L A;  1L96 A;  4W56 A;  183L A;  2HED A;  3C7W A;  4LT3 A;  4YEN A;  3C81 A;  2B74 A;  2AUB A;  2MEI A;  189L A;  4E97 A;  222L A;  7LYZ A;  1UIG A;  5F9U A;  110L A;  4H9A A;  2MEA A;  1J1P Y;  4DQ5 A;  4XN6 A;  206L A;  1UCO A;  1QTD A;  1L66 A;  1IY3 A;  1C6K A;  3FE0 A;  1C61 A;  3TXJ A;  4DQJ A;  2I6Z A;  1AT5 A;  1L54 A;  1C6C A;  5EBH A;  1OUF A;  3GUI A;  3WUN A;  5KXL A;  1L0J A;  3N9A A;  4H93 A;  246L A;  5DL9 A;  176L A;  4OWH A;  4H9F A;  1LSZ A;  4IAP A;  4ARL A;  150L A;  109L A;  1B5U A;  1LTM A;  5I4Y A;  114L A;  1XGR C;  5ILC A;  143L A;  216L A;  5KKJ A;  2HEE A;  5HMJ A;  1L23 A;  2MEB A;  3UON A;  5B1F A;  1GBY A;  1WTH A;  4H91 A;  1LPI A;  1G1W A;  3F8V A;  4CHX A;  1L04 A;  1QS5 A;  1GAZ A;  3IJU A;  2ZIJ A;  2G4P A;  1LYZ A;  3D3D A;  1GFK A;  1L64 A;  3CDQ A;  1QUT A;  4G4C A;  1CU5 A;  1UIB A;  1GFT A;  1PQD A;  3B0I A;  4KL7 A;  102L A;  1T8G A;  1CKG A;  1FBI X;  1TAY A;  4NY5 A;  194L A;  1L15 A;  4NSH A;  1DZB X;  1DYA A;  1JHL A;  5HLL A;  1D2Y A;  1IP1 A;  3BKV A;  2G4N A;  1BQL Y;  4LYM A;  1LKR A;  3HDE A;  3T6U A;  2ZWB A;  4WOA A;  1L06 A;  1LYD A;  3HWL A;  1OUH A;  1T8F A;  5E4P A;  1L10 A;  2DKV A;  1C64 A;  241L A;  4BAF A;  226L A;  1YAQ A;  3ZVQ B;  2Z12 A;  4WL7 A;  4MST A;  2HU1 A;  4O34 A;  2EKS C;  1B5W A;  3RU5 A;  132L A;  185L A;  149L A;  1TBY A;  2A4T A;  1GFG A;  1IC7 Y;  4H9I A;  1XJT A;  4DDB A;  1IIZ A;  4I7S A;  120L A;  1L89 A;  2DQD Y;  4H90 A;  4RW2 A;  1LHH A;  3HH4 A;  1F6R A;  1G06 A;  5KXK A;  1GFU A;  177L A;  1GB0 A;  2DQA A;  4XJB A;  5KXO A;  3WPK A;  4I7O A;  4R0F A;  1UIH A;  3G3A B;  227L A;  1G7J C;  3LYO A;  4QDN A;  3HTD A;  5DN4 A;  3WPJ A;  1P2L A;  1NDG C;  1L73 A;  1YAN A;  3L64 A;  1DYG A;  1CU0 A;  1T6V L;  171L A;  3WU7 A;  3TXE A;  1LGX A;  1LWK A;  4MCK A;  3PDS A;  3HUK A;  1LMQ A;  3B0O A;  4EMN A;  3WU8 A;  1L24 A;  3WW5 A;  1IOT A;  5LA8 A;  4H1P A;  2CWI A;  245L A;  2OE4 X;  1P3N A;  1PQI A;  233L A;  1YKY X;  1O23 A;  3SB5 A;  1CTW A;  2W1Y A;  2F2Q A;  4Z98 A;  1G07 A;  1L88 A;  5I14 A;  2ZYP A;  4NGZ A;  5E9R A;  1L60 A;  2OU0 X;  3DN1 A;  1NMM A;  3N9C A;  1CKD A;  2OU8 A;  1VDP A;  123L A;  5IEL A;  5ILF A;  1LI3 A;  1RE2 A;  3HH6 A;  1HML A;  1IP5 A;  1L21 A;  1IOQ A;  5KKI A;  2XBS A;  1SX2 A;  4H94 A;  2I25 L;  1DPW A;  4IAT A;  4WM3 A;  1GFA A;  3B6L A;  166L A;  3AGI A;  1L55 A;  3EML A;  1HSW A;  1L97 A;  4GLA A;  1D9U A;  1TLA A;  5KXR A;  1LZY A;  1P56 A;  1IOC A;  4NGY A;  3VW7 A;  4B0D A;  4Z3M A;  1DKK A;  188L A;  2ZYC A;  1VDQ A;  1LMC A;  4BS7 A;  2B73 A;  4WLT A;  1OVJ A;  1DI5 A;  1LJE A;  1YAP A;  2FYD A;  1L20 A;  2CDS A;  4LYZ A;  154L A;  1PQK A;  2BPU A;  237L A;  138L A;  1UBZ A;  193L A;  2O4W A;  1LSN A;  4YXA C;  3NYA A;  2DQI Y;  1SWZ A;  3A3Q A;  127L A;  1CU2 A;  2BQE A;  1IY4 A;  1L92 A;  1LHL A;  1L72 A;  3LZT A;  1OWZ A;  1BB7 A;  2OEA X;  1KIP C;  1L61 A;  2LZ2 A;  1GE1 A;  5I4X A;  4NEB A;  3IJV A;  1N4F A;  8LYZ A;  3C8R A;  3HH3 A;  1QDT A;  1G0J A;  4WM6 A;  4TSC A;  1UA6 Y;  1YAO A;  1XEJ A;  254L A;  1YL0 X;  1QSA A;  4ETC A;  210L A;  1GBX A;  2YBL A;  1B6I A;  4GRV A;  1GB9 A;  4NGK A;  2B6T A;  2Q0M X;  1GF5 A;  3WPL A;  1WQR A;  3C83 A;  1NDM C;  3A94 A;  2Z19 A;  1LLH A;  4EKP A;  1WQO A;  4HJY A;  5DN5 A;  1T3P A;  1P5C A;  4LZM A;  1L83 A;  5LIO A;  1L53 A;  1LZD A;  4J7V A;  1B7R A;  4DJH A;  3AJN A;  4HV2 A;  1IWT A;  1L91 A;  1ZVH L;  1GB3 A;  147L A;  4NGL A;  1L77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...