2EQLA

Crystallographic studies of a calcium binding lysozyme from equine milk at 2.5 angstroms resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
129
structure length
129
Chain Sequence
KVFSKCELAHKLKAQEMDGFGGYSLANWVCMAEYESNFNTRAFNGKNANGSSDYGLFQLNNKWWCKDNKRSSSNACNIMCSKLLDENIDDDISCAKRVVRDPKGMSAWKAWVKHCKDKDLSEYLASCNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords HORSE MILK LYSOZYME
publication title Crystallographic studies of a calcium binding lysozyme from equine milk at 2.5 A resolution.
pubmed rcsb
source organism Equus caballus
total genus 41
structure length 129
sequence length 129
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 1994-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00062 Lys C-type lysozyme/alpha-lactalbumin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 2eqlA00
1EQEA 1LHMA 3TXHA 4C3WA 5F14A 1XEKA 5B06A 4NG1A 3AZ6A 4RW1A 2ZILA 4QEQA 2A7DA 3AYQA 2H5ZA 1WQQA 4H91A 1LZAA 4Z98A 4H1PA 1YKYX 4WO6A 3E3DA 5B07A 3W6CA 4FDYA 5LAGA 1IR9A 3AGGG 1OP9B 4WG7A 5KXTA 1VDSA 1YAOA 1RJCB 3RNXA 2LYOA 1GBZA 1JPOA 2MEFA 1LMTA 2LYMA 5LA8A 1OQMA 4WLDA 5DN4A 5FHWA 1UIDA 1XGPC 4XENA 4N1CC 1GFTA 4KT3A 1FKQA 1DPXA 5JENB 3B0IA 4NSGA 2I25L 3CSRA 1G7IC 1LJEA 1IP3A 2YBLA 3CSZA 1B7SA 3B0OA 1HEWA 1JTOL 1ZVYB 2BQAA 4NHTA 4AXTA 4R0FA 1LKRA 1LZBA 3WUAA 1OUBA 3OJPA 1GFVA 5K7OA 1B7NA 2DKVA 2RSCA 1UIBA 3RU5A 2MEBA 5B1GA 1GE2A 2I26L 1OUJA 4WG1A 5F9UA 1GE3A 1WVVA 4GCBA 1REXA 1HFZA 4UWNA 4J0LA 1LHLA 3TMVA 3J6KA 1YKXX 4NGZA 4NGIA 4OWEA 1LJ4A 1QDTA 1WQOA 4X3BA 4EMNA 2BLYA 2ZWBA 1IC4Y 5DL9A 1LSPA 2DQIY 1BB4A 2MECA 2CJLA 1OUCA 1IOCA 1LMOA 1GDWA 1BHZA 1VAUA 1KIRC 4H9BA 2XTHA 4NEBA 4HTNA 3TMXA 4HP0A 2Z18A 4NGJA 1GFAA 1HSXA 1W6ZA 4IATA 1BB5A 4B4JA 1CNSA 1CKCA 3HFMY 1DPWA 1IC7Y 3A3RX 4ZFPA 2YSSC 4R6CA 5APEA 1BVXA 4WM1A 1IWYA 1IP4A 2C8PA 4XJDA 2MEIA 1BWJA 1LSEA 5AMYA 4D9ZA 4CJ2A 2G4PA 2W1MA 2DQCY 1IWTA 3WU7A 5DLAA 5KXLA 1UBZA 2BQLA 1LZ8A 1CJ6A 2F4AA 5A3ZA 5IHGA 2Z2EA 1RI8B 1LZSA 4WM2A 4DT3A 1GWDA 3AGHA 4N1EI 2Z12A 1GEVA 2BLXA 5D5FA 2DBTA 1IWWA 1QUTA 1GBSA 4NHSA 4NFVA 1LCNA 1GF8A 1BB3A 2VB1A 1QQYA 4PHIA 3WULA 1D9UA 2DQJY 3TXGA 1HFXA 1XSFA 4ML7A 4DDAA 1UCOA 1GB7A 2CDSA 2DQFC 4E3UA 1LJFA 2Z2FA 1OUIA 1GFUA 3M18B 1LOZA 1GB8A 2DQEY 4HPIA 2WARA 1NQIA 2B5ZA 2I6ZA 3QNGA 4H92A 3TXKA 5HLLA 1OUFA 2Z39A 4O34A 1IWVA 1LMQA 2A7FA 4DDCA 1B7RA 1JSFA 3A90A 3A91A 3WU8A 1NWGA 2EQLA 5KXKA 3CT5A 3EBAB 1YL1X 1LSAA 2DQGY 3LZTA 5L3HA 1LJIA 2BQHA 2MEAA 1WQRA 3CSQA 2HECA 1YILA 3M3UA 1GBOA 1GBWA 1V7SA 4IASA 4NIJA 4RDSA 3A67Y 4PRUA 2HEAA 1REZA 1A2YC 132LA 1FBIX 3GXRA 4N8ZA 2LZTA 1T6VL 3W6EA 1IVMA 1CJ7A 4GCDA 3LZ2A 194LA 1UUZC 3WUMA 2N5ZA 3B0KA 4B0DA 5LA5A 1JKDA 3AGIA 5FELA 3WH1A 1BGIA 2F2NA 1IWXA 3HBEX 5KKJA 3LYMA 4G4HA 4LGKA 4MCKA 4PPOA 4HJZA 4XN6A 5HMVA 1LMAA 3J4GA 4PGJB 5LVGA 3N9EA 1H6MA 1XGRC 3AJNA 2MEHA 4MSTA 3TMUA 3TXEA 5B59A 2IHLA 1NHEA 4N0JA 1NKHA 1GPQC 1GAYA 1REYA 4CFOA 4DWXA 4DC4A 1INUA 3ZVQA 4GLVA 3FE0A 1AM7A 1JJ3A 2Z38A 4YF2A 1CKDA 1JHLA 4LYTA 1AT5A 1HFYA 1LJ3A 1RFPA 1VDPA 3D3DA 1HSWA 2D6BA 2BQOA 4U3XB 3EMSA 6LYTA 5I4WA 4I8SA 1JEFA 4ET9A 5C6IA 5HNCA 4OW1A 4MR1A 2BQCA 4ETCA 4A7DA 1LZ6A 1LZRA 1IY4A 1I1ZA 4YOPA 1LJHA 1RCMA 3WUNA 2D4IA 1NBYC 1QDRA 1FLWA 1GB3A 4YENA 3ULRA 4DYGA 3ATOA 2HEDA 1BVKC 3A6CY 1D0MA 208LA 1XGQC 1UIFA 2W1YA 1J1PY 1I56A 5IELA 1B5YA 4LFPA 3W6BA 4HTKA 4YM8A 1GB5A 1SQ2L 1MELL 4TX7A 1NDGC 1F0WA 4ZIXA 1IP6A 2FBBA 1LMCA 4WMGA 3CT1A 3EXDA 4H8XA 5B1FA 1TAYA 1LSFA 4Z46A 2X0AA 1DI3A 1C10A 1EQ4A 1QSWA 4ANRA 2YVBA 1JTTL 2H9KA 2Z37A 5KXXA 5KKIA 4XYYA 4KL7A 1QTEA 1IOTA 1JITA 5A3EA 3GXKA 4XJBA 2BQGA 3WW5A 2FYDA 2D4KA 3ATNA 4H9CA 4H8ZA 4TTDA 3A96A 5C6JA 1UIAA 2BQIA 1VFBC 1E8LA 1LZYA 1GF0A 4BS7A 2BQMA 4WLYA 1B5UA 1UIHA 3LHMA 2HEBA 3RT5X 3ZVQB 1DKKA 4WL7A 1WQPA 1B7OA 5HMJA 1HMLA 4GN5C 1WTNA 5LXWA 4L41A 1BB7A 4RLNA 3WVXA 4ETEA 1GXV2 1C45A 207LA 4H94A 1UIGA 1LZ9A 2DQHY 1LYYA 5FDJA 5KXOA 5FSTA 1B7MA 3N9CA 3WXTA 1HENA 1KXXA 1QSAA 4WM6A 135LA 2YBJA 2Z19A 2IFFY 4H8YA 1HF4A 1B7PA 3D9AC 1NDMC 2ZIKA 4LYCA 4NG8A 1IOSA 1GF5A 2F4GA 2YBNA 1PS5A 1LSZA 1GFEA 4N9RA 4Z41A 3W6DA 1IP7A 3AW6A 3IWRA 3P65A 4UWVA 1LJGA 2HTXA 1HC0A 1GE4A 3HBDA 4NSIA 3AZ4A 4OWAA 3CB7A 5LINA 2MEGA 1LSMA 2BQJA 1LTMA 4ETDA 5M1YA 4LT1A 1CKHA 1FDLY 1J1OY 3A3QA 4NWHA 1JKCA 2ZNXY 1W08A 1HEMA 4HV1A 5KXNA 1WQNA 1DZBX 4M4OA 4HTQA 3A95A 1DQJC 5LAFA 1HEQA 4G49A 3WMKA 4C5FA 1KXWA 1ZVHL 1TEWA 5KXSA 1JTPL 2G4NA 1AT6A 3WVYA 1VEDA 4J7VA 4WL6A 3AB6A 3TXFA 1C43A 3QE8A 1UA6Y 5KXMA 4YEOA 1AKIA 5APDA 4I0CA 1LZ4A 4WM3A 1UIEA 4WO9A 3VWOA 1CKGA 4H9HA 1B0DA 5FCPA 1BWIA 2D4JA 4LFXA 4HSFA 4HJVA 3WU9A 2EIZC 4H90A 4OOTA 1GF9A 1IX0A 3G3AB 2BQBA 1H87A 3WPJA 4NY5A 4QY9A 1FLYA 3N9AA 4RLMA 2BQKA 1IR7A 1QIOA 3WW6A 1B7LA 4GLAA 1LSBA 1IP5A 1UC0A 1YKZX 4ZEEA 5F9XA 1WTMA 5LVKA 4CHXA 3EO5A 2LYZA 5D5CA 3G3BB 1G7LC 1SLYA 3A93A 4DD1A 2H9JA 1KIQC 1A4VA 1D6QA 2CGIA 3T36A 1GE0A 4GCFA 5DN5A 4QGZA 1TBYA 5KXYA 1LJKA 1V7TA 3QY4A 2YBHA 4NGVA 5E9RA 1HNLA 2G4QA 1C7PA 2LZ2A 2ZQ3A 5T3FA 3T6UA 1VDQA 1LJNA 4DD9A 4DDBA 4N5RA 2Y8PA 1GFGA 1J1XY 5LVHA 4Z3MA 1B5ZA 1IEEA 1WQMA 4GN4A 4WM5A 2BAAA 1YQVY 1GDXA 4XJFA 1XFPL 1REMA 2W1XA 1LYZA 4H9FA 1GBYA 1IOQA 5FEKA 1JWRA 1QUSA 3TXDA 3P68A 4BADA 3IJVA 3P4ZA 1JISA 4ETAA 1D6PA 1N4FA 1LKSA 1JSEA 4QDNA 2HU3A 4J1AA 1LSNA 3A94A 2GV0A 2DQDY 193LA 1LAAA 1GB6A 1VATA 2ZIJA 4NGLA 4RW2A 4H9AA 1HELA 4PJ2C 1LHKA 3WL2A 1T3PA 1B7QA 1FKVA 4NWEA 1YAMA 3SP3A 4WOAA 4AGAA 1QTKA 5LYZA 3MGWA 1IIZA 1XGUC 2BQDA 1UACY 1JKAA 1IR8A 1CKFA 1ALCA 1GB0A 2XBSA 4TUNA 7LYZA 1NF5A 1PZYA 1DXJA 1F10A 1G7JC 2ZYPA 4NGYA 1LZCA 4TSCA 2AUBA 3CT0A 4PRQA 3A34A 1LZDA 3LYOA 2BPUA 4NHPA 3RZ4A 3BKHA 3IJUA 1YAPA 4NHIA 1B5WA 4B49A 1IO5A 5LYMA 9LYZA 4M6DA 3W6AA 5L3IA 2YBMA 3RW8A 1KXYA 1CJ8A 4NGOA 1LSCA 2EKSC 4LT2A 3ZEKA 3TXBA 3OK0A 2BQEA 1IC5Y 1D0KA 2HU1A 5C6LA 3BKVA 5KXRA 3AZ7A 3LYZA 1YL0X 1LMPA 2HEEA 154LA 1FN5A 1GBXA 2C8OA 4ETBA 4W94A 4KXIA 5I5QA 2YBIA 2W1LA 1GB2A 1OUGA 5F81A 5KXPA 1AZFA 3F6ZA 2ZNWY 4OWCA 1IWUA 2HUBA 2PC2A 2HEFA 5ILCA 1GFKA 4P2EA 4TSBA 5F16A 4NSHA 4DD7A 5KJ9A 4XJIA 1GAZA 1YROA 4EOFA 3LN2A 4BAPA 1LZEA 1RE2A 4B4EA 1EL1A 3W6FA 1DI5A 3B72A 5HNLA 1YANA 4TWSA 4WM4A 1P2CC 4FJRA 5I54A 1GFRA 1GF7A 5I4XA 1LHJA 1IP2A 8LYZA 4WLXA 1LSGA 1LMNA 1OUHA 1GF6A 1HERA 2CWIA 5II3A 2FBDA 5E4PA 4DD2A 1LSYA 3FI7A 3A92A 4GN3A 2DQAA 1I20A 1GD6A 1HHLA 5ILFA 4CGEA 4LYBA 1GFJA 4IJ4A 1XEIA 4G9SA 3CQLA 4DD0A 1LZNA 1LZTA 3P66A 4XJHA 2YDGA 2ZYCA 4NGKA 1LYOA 4HJYA 1XGTC 4UWUA 1IORA 5DM9A 2XJWA 1LPIA 4LT3A 5IDDA 1JIYA 1LHIA 1ZV5L 4H9IA 4II8A 3TMWA 5LVJA 1JUGA 1O23A 5L9JA 4OOOA 1JKBA 1BWHA 4J1BA 1MLCE 1VDTA 4XADA 1NMMA 4NHQA 5I4YA 3B6LA 1OUEA 1UICA 2FYCA 3LYTA 1JJ0A 2ZQ4A 3TXIA 1HEPA 4NSJA 1JJ1A 2XBRA 4DD3A 2BQNA 4LT0A 2MEDA 3WPKA 1F6RA 4GCEA 133LA 4GCCA 4G4BA 1GHLA 1BB6A 1GXXA 4KPMA 4OWHA 1GE1A 2MEEA 4OWBA 3W3EA 3AZ5A 1IWZA 1YAQA 1YIKA 3WYHA 1G7MC 4CFPA 5LYTA 153LA 5EBHA 5HQ1A 5APFA 1LZGA 1OUDA 5B05A 4ET8A 4WLTA 4LZTA 2BQFA 2EPEA 5KXWA 5LIOA 1B5VA 1BQLY 5J7CA 1HEOA 4XJGA 4G4CA 1B5XA 1OUAA 1LZ1A 3HBHA 5I53A 4LYMA 1WVUA 1G7HC 1TDYA 1FLUA 1B9OA 2LHMA 5KY1A 3P64A 1D0LA 1F6SA 1DI4A 4LYOA 2Q0MX 4BAFA 6LYZA 1GEZA 3AW7A 4H9EA 1LHHA 3A8ZA 134LA 4HV2A 3WXUA 4YEMA 4LYZA 1LJJA 2D91A 1LSDA 3TXJA 1GB9A 1KIPC 1C46A 1Z55A 1NBZC 4W96A 4B1AA 5LVIA 4H93A 5KXZA 4NGWA 3WPLA 1GF3A 3K3TA 3A6BY 1C08C 1TCYA 2NWDX 5APCA 2F30A 1ZMYL 4HPEA 1LYSA 1GFHA 1GF4A 1IY3A 1B2KA 1CJ9A 1DKJA 3KAMA 1LZ5A 1HMKA 1EQ5A 4B4IA 1XEJA 1IP1A 1FLQA
chains in the Genus database with same CATH superfamily
1EQEA 4NG1A 4RW1A 1L06A 1DYCA 4QEQA 2A7DA 189LA 1YKYX 1PQDA 3E3DA 5B07A 1OP9B 4ARMB 3OE0A 1L04A 2MEFA 1OQMA 1QUHA 1UIDA 4XENA 1L22A 1DPXA 221LA 3B0OA 1JTOL 228LA 1LZBA 122LA 3OJPA 2RSCA 1L11A 161LA 1GE2A 1L73A 1OUJA 1QTZA 174LA 4W54A 1HFZA 2RBNA 3SB5A 4J0LA 1LHLA 222LA 4NGIA 1L30A 4X3BA 1QTBA 2BLYA 2ZWBA 4W51A 5DL9A 1OWYA 3C81A 1KIRC 4H9BA 1LI3A 2B6YA 1P5CA 4HP0A 2Z18A 4NGJA 3HFMY 1IC7Y 112LA 1QT3A 1BWJA 5AMYA 2G4PA 1IWTA 1D3JA 223LA 5IHGA 259LA 1C6NA 2RB0X 1L91A 1LCNA 1PQKA 1QQYA 2DQJY 1XSFA 4DDAA 2CDSA 2RAZX 1L59A 2RBQA 3M18B 1GB8A 2DQEY 1L94A 3HTDA 2A7FA 3CDOA 1L15A 1NWGA 1YL1X 3LZTA 2MEAA 1V7SA 4RDSA 4NIJA 4PRUA 3DN2A 4LZMA 1L74A 1A2YC 1JQUA 1IVMA 1LGWA 4GCDA 3AGIA 4G4HA 3AJNA 1KS3A 3GULA 2IHLA 1REYA 1GAYA 1L36A 4CFOA 2Z38A 1CKDA 1HFYA 1RFPA 1HSWA 2D6BA 6LYTA 5I4WA 1JEFA 4ET9A 1L23A 4OW1A 4MR1A 2BQCA 3GUMA 4ETCA 1IY4A 4I7QA 118LA 1C6TA 1EPYA 2RBRA 3K2RA 1GB3A 224LA 4W56A 1J1PY 1B5YA 3W6BA 1SQ2L 1SSWA 3CT1A 2X0AA 1C10A 1P56A 190LA 3ODUA 5KKIA 4XYYA 1IOTA 4XJBA 1KNIA 4TTDA 2RBPA 2BQIA 1OVHA 2HEBA 103LA 1L13A 4GN5C 1BB7A 4ETEA 4LDEA 4ARQB 1UIGA 1LYYA 3N9CA 1KXXA 1QSAA 1DYEA 1B7PA 3D9AC 4NG8A 2YBNA 1PS5A 4N9RA 113LA 4Z41A 1L47A 3P65A 4UWVA 1HC0A 1GE4A 3HBDA 3CB7A 1LSMA 1LWGA 1LTMA 4LT1A 4W52A 3A3QA 1G0LA 4NWHA 2ZNXY 4HTQA 5LAFA 1G06A 4DKLA 1JTPL 2G4NA 4WL6A 1L99A 1UA6Y 4H9HA 1B0DA 5FCPA 1L95A 4H90A 1GF9A 3D4SA 260LA 2BQBA 1H87A 2B6XA 1G07A 1FLYA 3N9AA 3NYAA 1WTHA 1CV3A 1UC0A 4ZEEA 2H9JA 1A4VA 1D6QA 1L03A 4GCFA 4S0WA 3DN0A 5E9RA 1C7PA 2LZ2A 4DD9A 1LJNA 4N5RA 3HUAA 1GFGA 1J1XY 1B5ZA 1NHBA 2BAAA 1L86A 213LA 2QARC 2W1XA 1CU3A 1LYEA 1L32A 3TXDA 3IJVA 1CUQA 2HU3A 4NGLA 2GV0A 1LAAA 2RB2X 4PJ2C 184LA 168LA 1L77A 1C6QA 3MGWA 1IIZA 1GB0A 2XBSA 1LYDA 1F10A 1G7JC 4PRQA 3A34A 1QTDA 2BPUA 4NHPA 1L63A 1YAPA 1B5WA 9LYZA 1I6SA 1CJ8A 4LT2A 1LGXA 3OK0A 1QTVA 1L98A 1YL0X 2HEEA 1L50A 2C8OA 2B6WA 1OUGA 3HU9A 2ZNWY 244LA 2PC2A 4EOFA 4B4EA 1EL1A 3DN3A 4WM4A 3DMZA 1GFRA 5I4XA 1LHJA 1LMNA 1HERA 1D3NA 4EPFA 5ILFA 1GD6A 1HHLA 1L90A 4CGEA 4LYBA 1GFJA 4DD0A 3UONA 1LZTA 3P66A 4XJHA 4HJYA 4UWUA 1LPIA 4II8A 3TMWA 209LA 1JUGA 4OOOA 1JKBA 3GUKA 1MLCE 2Q9EA 3B6LA 1JJ1A 129LA 219LA 4GCEA 1BB6A 4OWHA 4ARMA 1LGUA 3AZ5A 1YAQA 1G7MC 1L53A 1LYFA 1LZGA 4ET8A 5LIOA 5J7CA 1HEOA 4I7TA 4DQJA 1LZ1A 3HBHA 5I14A 216LA 1G7HC 2LHMA 1L83A 1C64A 3TXJA 1C46A 1C6DA 1NBZC 4H93A 4NGWA 3K3TA 247LA 4W58A 1B2KA 1C6IA 3KAMA 1HMKA 4H9FA 1LHMA 3TXHA 165LA 1D3FA 1DYAA 1XEKA 3AYQA 1WQQA 1LZAA 4WO6A 157LA 1IR9A 3AGGG 4WG7A 1VDSA 3RNXA 2LYOA 5FHWA 1XGPC 4N1CC 1DYGA 3B0IA 2YBLA 3CSZA 141LA 1B7SA 1HEWA 1L21A 1QT6A 1ZVYB 2BQAA 5K7OA 1UIBA 5B1GA 1C62A 1CV6A 229LA 1L14A 3GUOA 253LA 1REXA 4UWNA 3L64A 4EMNA 1WQOA 1LSPA 2DQIY 2MECA 4EXMA 1GDWA 1BHZA 1VAUA 3LZMA 4HTNA 126LA 1HSXA 4W53A 4EPIA 1CKCA 1G0GA 1DPWA 1SWZA 4R6CA 1BVXA 4WM1A 1IP4A 2C8PA 4XJDA 3V2YA 4CJ2A 1LSEA 166LA 3WU7A 5LZMA 2Z2EA 4DT3A 3AGHA 2Z12A 1T6HA 1L64A 5D5FA 1IWWA 1QUTA 3SBAA 1GF8A 1BB3A 1L26A 1GB7A 2DQFC 1LJFA 1T97A 1GFUA 1NQIA 5HLLA 2Z39A 1L24A 4O34A 1B7RA 1L01A 3A91A 3WU8A 2EQLA 3CT5A 3EBAB 2DQGY 5L3HA 4I7PA 1L10A 2BQHA 3CSQA 2HECA 4EKSA 1GBOA 1GBWA 3A67Y 3GXRA 3LZ2A 194LA 3WUMA 1JKDA 4GRVA 3WH1A 3HBEX 5KKJA 3LYMA 4XN6A 3J4GA 5LVGA 5B59A 1P3NA 3TMUA 1NKHA 1GPQC 4GLVA 1AM7A 1JJ3A 4YF2A 1JHLA 2Z6BA 4AQNA 156LA 3EMSA 3F8VA 4I8SA 163LA 4ARQA 4YOPA 3WUNA 1FLWA 1L92A 199LA 1C6EA 5IELA 1D9WA 4HTKA 4YM8A 1MELL 4ZIXA 1C67A 1LMCA 4WMGA 2XQOA 1C68A 4H8XA 5B1FA 1C6GA 4Z46A 4I7JA 1EQ4A 1QSWA 4ANRA 1JTTL 2H9KA 5KXXA 1JITA 5A3EA 1T8AA 4H9CA 3A96A 5C6JA 2B75A 1E8LA 4BS7A 3LHMA 1QUGA 1HMLA 237LA 1LZ9A 2DQHY 2B7XA 1B7MA 4WM6A 2Z19A 107LA 2RH1A 1IP7A 3IWRA 2HTXA 2MEGA 2BQJA 5M1YA 1CKHA 1J1OY 1JKCA 1ZYTA 1QSQA 1WQNA 1DZBX 138LA 1L56A 3WMKA 1L38A 4J7VA 5KXMA 3AB6A 1C43A 3QE8A 4WM3A 1L25A 4E97A 1BWIA 4HSFA 3WU9A 1IX0A 3HH5A 158LA 4NY5A 1XJTA 4DQ7A 1IR7A 252LA 3WW6A 1B7LA 1G0MA 4GLAA 261LA 5F9XA 5LVKA 2LYZA 1C6LA 1G7LC 4DD1A 1KIQC 3T36A 1L79A 5KXYA 3QY4A 1JTNA 5T3FA 2G4QA 2ZQ3A 1C6PA 4Z3MA 3V2WA 1WQMA 1GDXA 1XFPL 4ARLA 1REMA 1IOQA 249LA 3OE9A 3HTGA 3P4ZA 1JISA 220LA 1JSEA 1LSNA 3A94A 4RW2A 2ZIJA 4H9AA 1HELA 3WL2A 3C7ZA 1T3PA 4NWEA 1YAMA 4WOAA 1QTKA 2BQDA 1L68A 1JKAA 1IR8A 162LA 3C8SA 7LYZA 3NY9A 2ZYPA 1LZCA 1L18A 3QAKA 3LYOA 2RBSA 246LA 1L43A 1QUDA 1KW5A 4M6DA 3W6AA 2OEAX 5C6LA 6LZMA 248LA 3LYZA 4YXCA 175LA 154LA 1G0PA 4KXIA 2YBIA 2W1LA 5F81A 169LA 4W57A 1L16A 4OWCA 1IWUA 5F16A 4NSHA 4DD7A 1GAZA 127LA 1RE2A 3W6FA 3B72A 1YANA 4TWSA 1G1WA 5I54A 177LA 1GF7A 2QB0B 155LA 1L82A 4WLXA 2OU9A 3DN4A 1CV5A 5II3A 2FBDA 5E4PA 4DD2A 3NY8A 1LSYA 4GN3A 4IJ4A 3G3XA 1QTCA 1LZNA 1C69A 2ZYCA 1IORA 2XJWA 1C6KA 4H9IA 5LVJA 1CU2A 1BWHA 1L42A 4J1BA 3RZEA 1NMMA 5I4YA 1OUEA 1UICA 3LYTA 4I7MA 240LA 2ZQ4A 1HEPA 2XBRA 1L08A 4DD3A 2BQNA 3HH6A 1ZURA 4KPMA 2MEEA 4LDOA 1IWZA 1YIKA 4CFPA 226LA 5EBHA 238LA 1QTHA 5HQ1A 188LA 5APFA 4OO9A 2BQFA 5KXWA 3DN8A 1BQLY 1CV1A 2LC9A 1B5XA 5I53A 3SB6A 1KY0A 4LYMA 1TDYA 1CU6A 1D0LA 1DI4A 4BAFA 2Q0MX 134LA 4HV2A 3HTFA 3WXUA 4YEMA 1LJJA 1LSDA 1GB9A 1D2YA 139LA 5LVIA 1C60A 1C08C 2NWDX 2F2QA 1GF4A 2NTGA 1DKJA 1L75A 1EQ5A 4B4IA 1XEJA 1FLQA 1L66A 1DYFA 5F14A 1C6BA 1LWKA 1G1VA 2H5ZA 4H91A 3HUKA 3W6CA 143LA 5KXTA 1YAOA 1L09A 1JPOA 1XEPA 4WLDA 5DN4A 1C63A 4KT3A 1FKQA 1SX2A 4NSGA 1OVKA 2I25L 1G7IC 1C65A 4NHTA 2ANVA 1B7NA 2DKVA 1L20A 1C6JA 1KY1A 1GE3A 1WVVA 4GCBA 4I7SA 245LA 3J6KA 4OWEA 1L80A 130LA 1LJ4A 1QDTA 3CDQA 1L28A 1IC4Y 2CJLA 2B73A 1OUCA 1LMOA 1L41A 1GFAA 1L12A 3HT6A 114LA 176LA 3A3RX 5APEA 2OTYX 2DQCY 5DLAA 3OE8A 1C61A 3F9LA 196LA 1LZ8A 2F4AA 5A3ZA 123LA 1G0KA 1LZSA 2BLXA 152LA 2DBTA 4NHSA 4YX7C 2VB1A 4PHIA 3WULA 1D9UA 3TXGA 1HFXA 4ML7A 241LA 2LZMA 1LOZA 251LA 4HPIA 111LA 2WARA 2I6ZA 4H92A 3TXKA 1CVKA 4DDCA 3HDFA 4IASA 178LA 2HEAA 3C82A 4N8ZA 1CTWA 1CJ7A 4B0DA 3B0KA 1L0JA 5FELA 3HU8A 1BGIA 1IWXA 4MCKA 1SWYA 5HMVA 1LMAA 3N9EA 1H6MA 3TXEA 4MSTA 3HUQA 1CX7A 1NHEA 4N0JA 4DWXA 125LA 3FE0A 1CU5A 4LYTA 1AT5A 1LJ3A 3D3DA 2BQOA 2F47A 186LA 1L29A 1L57A 3PBLA 5C6IA 4DQ5A 2D4IA 1NBYC 3ULRA 2HEDA 4PJZA 1UIFA 120LA 1L35A 197LA 4LFPA 256LA 4TX7A 1NDGC 1L17A 234LA 104LA 1OWZA 3EXDA 1TAYA 1LSFA 2YVBA 2Z37A 1L97A 4KL7A 3GXKA 3WW5A 181LA 2FYDA 2D4KA 3ATNA 4H8ZA 1UIAA 149LA 1VFBC 1LZYA 2BQMA 1B5UA 3RT5X 3ZVQB 4WL7A 5LXWA 1L0KA 1GXV2 1C45A 2HULA 4I7KA 5KXOA 183LA 1HENA 135LA 2YBJA 4H8YA 2NTHA 1NDMC 2HUKA 2ZIKA 4LYCA 2F4GA 1LSZA 1LI2A 3W6DA 3AW6A 233LA 1LJGA 235LA 1OYUA 4NSIA 1CUPA 217LA 1QS9A 1OVJA 1FDLY 4ZPUA 5KXNA 110LA 1HEMA 1CV4A 3A95A 1DQJC 1HEQA 4G49A 1B6IA 4C5FA 172LA 1AT6A 1VEDA 1AKIA 4I0CA 1UIEA 3VWOA 1CKGA 250LA 148LE 3GUPA 4LFXA 4EKQA 1G0QA 4DJHA 4OOTA 4I7RA 4QY9A 1L93A 1QIOA 1WTMA 3EO5A 5D5CA 3A93A 1ZWNA 1QS5A 3GUNA 1GE0A 1TBYA 4NGVA 1HNLA 257LA 1LYGA 1VDQA 1LW9A 5LVHA 3DN6A 4GN4A 1IEEA 1P36A 4XJFA 1LYZA 1KW7A 1QUSA 3P68A 1L52A 4BADA 4ETAA 3DMVA 2HUMA 4QDNA 1QT5A 193LA 4EKPA 142LA 3GUIA 2B74A 1C6CA 192LA 137LA 4W55A 4AGAA 5LYZA 1XGUC 4TUNA 1CKFA 1ALCA 3FA0A 1DXJA 4NGYA 4TSCA 2AUBA 3CT0A 1LZDA 3SN6R 3BKHA 3IJUA 4B49A 1IO5A 232LA 171LA 1L27A 2YBMA 3RW8A 3HT9A 1KXYA 2HU1A 1D0KA 2CUUA 3AZ7A 1P37A 4ETBA 2IGCA 1QT7A 2O79A 1AZFA 3F6ZA 2HEFA 5ILCA 4P2EA 4TSBA 1YROA 4BAPA 2RAYX 150LA 1DI5A 5HNLA 1L87A 1P2CC 3HH4A 4I7LA 1L55A 1LSGA 1PQIA 2CWIA 3FI7A 3A92A 2DQAA 1I20A 182LA 3GUJA 146LA 2YDGA 7LZMA 1XGTC 5DM9A 1L71A 1JIYA 1LHIA 2ANXA 4LDLA 1O23A 5L9JA 4XADA 1C6HA 1PQJA 3TXIA 4NSJA 201LA 2MEDA 1F6RA 133LA 4GCCA 1GXXA 1T8FA 2OE4X 3W3EA 3WYHA 1LI6A 3HT7A 5LYTA 1OUDA 5B05A 4WLTA 4LZTA 167LA 2EPEA 4XJGA 254LA 1DYBA 1OUAA 5KY1A 1B9OA 3HT8A 1F6SA 4LYOA 2OE7X 6LYZA 4H9EA 1LHHA 3A8ZA 4LYZA 1KIPC 1Z55A 3WPLA 1C6AA 1OV7A 1P6YA 1LYSA 1IY3A 1CJ9A 1LZ5A 1P64A 4C3WA 5B06A 3AZ6A 2ZILA 3C7YA 4Z98A 4H1PA 211LA 2RBOA 1L40A 4FDYA 5LAGA 170LA 210LA 1RJCB 1GBZA 119LA 1LMTA 2LYMA 5LA8A 1D3MA 1GFTA 5JENB 3CSRA 1LJEA 191LA 1IP3A 4AXTA 1L19A 4R0FA 1LKRA 3WUAA 1OUBA 1GFVA 1L58A 3RU5A 2MEBA 2I26L 4WG1A 1L84A 1L76A 5F9UA 212LA 3TMVA 4NGZA 1YKXX 3C83A 1BB4A 1IOCA 231LA 115LA 2XTHA 3CDTA 4NEBA 1QT8A 3TMXA 1W6ZA 4B4JA 4IATA 1BB5A 205LA 1CNSA 1C6FA 2YSSC 4ZFPA 1IWYA 2MEIA 164LA 4D9ZA 2W1MA 1OV5A 131LA 5KXLA 1UBZA 2BQLA 1CJ6A 3RUNA 1L54A 1RI8B 4WM2A 1GWDA 4N1EI 1GEVA 206LA 1GBSA 4NFVA 1L51A 4ARJA 4EJ4A 3SB8A 1L69A 1UCOA 4E3UA 2Z2FA 3CDRA 1OUIA 3SBBC 262LA 2F32A 2B5ZA 3QNGA 4YXAC 1OUFA 1IWVA 1LMQA 1JSFA 3A90A 1QT4A 5KXKA 1LSAA 2O7AA 1LJIA 1WQRA 3M3UA 1YILA 1REZA 132LA 1FBIX 2LZTA 1T6VL 3W6EA 1L85A 1LLHA 2RB1X 1UUZC 2N5ZA 5LA5A 227LA 2F2NA 4PPOA 4LGKA 4HJZA 4PGJB 1XGRC 2MEHA 3HTBA 102LA 4DC4A 1INUA 3ZVQA 1K28A 3FADA 1VDPA 195LA 4U3XB 180LA 1L05A 5HNCA 1QUOA 4A7DA 1LZ6A 1LZRA 1I1ZA 1LJHA 1RCMA 1P2LA 2OU8A 1QDRA 3HDEA 4YENA 1DYDA 4DYGA 3ATOA 1BVKC 3A6CY 1D0MA 208LA 1TLAA 1XGQC 2W1YA 1I56A 1GB5A 1F0WA 1IP6A 1P46A 2B70A 1P2RA 2FBBA 1DI3A 230LA 3HWLA 3G3WA 3SB7A 3DKEX 1QTEA 1XJUA 2BQGA 2O4WA 3C80A 1GF0A 4WLYA 1UIHA 1L61A 1DKKA 1WQPA 1B7OA 1P7SA 3HH3A 2B72A 5HMJA 242LA 1WTNA 147LA 4L41A 4RLNA 3WVXA 207LA 4H94A 1L89A 5FDJA 5FSTA 2LCBA 3WXTA 1PQMA 2IFFY 1HF4A 1L48A 200LA 140LA 1IOSA 1GF5A 145LA 1L49A 1GFEA 3AZ4A 4OWAA 5LINA 1L88A 218LA 4ETDA 255LA 1W08A 4HV1A 4M4OA 258LA 1KXWA 1ZVHL 1TEWA 1CX6A 3EMLA 5KXSA 3WVYA 3TXFA 4YEOA 5APDA 1LZ4A 4WO9A 2D4JA 4HJVA 160LA 2EIZC 144LA 4EKRA 108LA 3G3AB 3WPJA 4RLMA 2BQKA 2B6TA 3JR6A 187LA 4IAPA 1LSBA 159LA 185LA 1IP5A 173LA 1L60A 1YKZX 1QSBA 1JTMA 4CHXA 3G3BB 1L67A 1L37A 1SLYA 2CGIA 1D2WA 1SSYA 4QGZA 5DN5A 2A4TA 1LJKA 1V7TA 2YBHA 3T6UA 215LA 4DDBA 2Y8PA 4WM5A 1YQVY 3L2XA 1G0JA 1GBYA 5FEKA 1JWRA 1C6MA 225LA 1D6PA 1N4FA 1LKSA 2OTZX 4J1AA 2DQDY 1VATA 1GB6A 1T8GA 1CV0A 236LA 1LHKA 1L00A 1B7QA 1FKVA 1PQOA 3C7WA 1LYJA 3SP3A 1L34A 1UACY 1NF5A 1PZYA 1LPYA 1L33A 239LA 3RZ4A 4NHIA 1LYHA 5LYMA 5L3IA 151LA 4NGOA 1LSCA 2EKSC 2OE9X 4I7OA 3ZEKA 3TXBA 1LYIA 1L02A 2BQEA 1IC5Y 3PDSA 3BKVA 5KXRA 3CDVA 4K5YA 1L70A 1LMPA 1L81A 1FN5A 1GBXA 4I7NA 4W94A 3C8QA 5I5QA 3G3VA 1GB2A 5KXPA 2HUBA 3FI5A 1GFKA 5KJ9A 4XJIA 2Q9DA 3LN2A 214LA 1LZEA 1CU0A 4FJRA 1IP2A 8LYZA 2L78A 1OUHA 1GF6A 4W59A 3DN1A 1L44A 4PK0A 1SX7A 1XEIA 3SB9A 3DNAA 4G9SA 2OU0X 3CQLA 4ARPA 109LA 4NGKA 1LYOA 4DAJA 4LT3A 5IDDA 1ZV5L 4GBRB 1L31A 1L62A 1VDTA 4NHQA 3OE6A 2FYCA 198LA 1JJ0A 4LT0A 3WPKA 4G4BA 1GHLA 1GE1A 4OWBA 153LA 1L65A 1L72A 1L45A 1L46A 1C66A 1B5VA 4G4CA 3VW7A 1L39A 1WVUA 1FLUA 3P64A 1L07A 243LA 1GEZA 3AW7A 2D91A 4W96A 4B1AA 5KXZA 1GF3A 3A6BY 1TCYA 5APCA 1L96A 2F30A 1ZMYL 4HPEA 3C8RA 1GFHA 128LA 3DMXA 2B6ZA 1IP1A
chains in the Genus database with same CATH topology
1EQEA 4NG1A 4RW1A 1L06A 1DYCA 4QEQA 2A7DA 189LA 1YKYX 1PQDA 3E3DA 5B07A 1OP9B 4ARMB 3OE0A 1L04A 2MEFA 1OQMA 1QUHA 1UIDA 4XENA 1L22A 1DPXA 221LA 3B0OA 1JTOL 228LA 1LZBA 122LA 3OJPA 2RSCA 1L11A 161LA 1GE2A 1L73A 1OUJA 1QTZA 174LA 4W54A 1HFZA 2RBNA 3SB5A 4J0LA 1LHLA 222LA 4NGIA 1L30A 4X3BA 1QTBA 2BLYA 2ZWBA 4W51A 5DL9A 1OWYA 3C81A 1KIRC 4H9BA 1LI3A 2B6YA 1P5CA 4HP0A 2Z18A 4NGJA 3HFMY 1IC7Y 112LA 1QT3A 1BWJA 5AMYA 2G4PA 1IWTA 1D3JA 223LA 5IHGA 259LA 1C6NA 2RB0X 1L91A 1LCNA 1PQKA 1QQYA 2DQJY 1XSFA 4DDAA 2CDSA 2RAZX 1L59A 2RBQA 3M18B 1GB8A 2DQEY 1L94A 3HTDA 2A7FA 3CDOA 1L15A 1NWGA 1YL1X 3LZTA 2MEAA 1V7SA 4RDSA 4NIJA 4PRUA 3DN2A 4LZMA 1L74A 1A2YC 1JQUA 1IVMA 1LGWA 4GCDA 3AGIA 4G4HA 3AJNA 1KS3A 3GULA 2IHLA 1REYA 1GAYA 1L36A 4CFOA 2Z38A 1CKDA 1HFYA 1RFPA 1HSWA 2D6BA 6LYTA 5I4WA 1JEFA 4ET9A 1L23A 4OW1A 4MR1A 2BQCA 3GUMA 4ETCA 1IY4A 4I7QA 118LA 1C6TA 1EPYA 2RBRA 3K2RA 1GB3A 224LA 4W56A 1J1PY 1B5YA 3W6BA 1SQ2L 1SSWA 3CT1A 2X0AA 1C10A 1P56A 190LA 3ODUA 5KKIA 4XYYA 1IOTA 4XJBA 1KNIA 4TTDA 2RBPA 2BQIA 1OVHA 2HEBA 103LA 1L13A 4GN5C 1BB7A 4ETEA 4LDEA 4ARQB 1UIGA 1LYYA 3N9CA 1KXXA 1QSAA 1DYEA 1B7PA 3D9AC 4NG8A 2YBNA 1PS5A 4N9RA 113LA 4Z41A 1L47A 3P65A 4UWVA 1HC0A 1GE4A 3HBDA 3CB7A 1LSMA 1LWGA 1LTMA 4LT1A 4W52A 3A3QA 1G0LA 4NWHA 2ZNXY 4HTQA 5LAFA 1G06A 4DKLA 1JTPL 2G4NA 4WL6A 1L99A 1UA6Y 4H9HA 1B0DA 5FCPA 1L95A 4H90A 1GF9A 3D4SA 260LA 2BQBA 1H87A 2B6XA 1G07A 1FLYA 3N9AA 3NYAA 1WTHA 1CV3A 1UC0A 4ZEEA 2H9JA 1A4VA 1D6QA 1L03A 4GCFA 4S0WA 3DN0A 5E9RA 1C7PA 2LZ2A 4DD9A 1LJNA 4N5RA 3HUAA 1GFGA 1J1XY 1B5ZA 1NHBA 2BAAA 1L86A 213LA 2QARC 2W1XA 1CU3A 1LYEA 1L32A 3TXDA 3IJVA 1CUQA 2HU3A 4NGLA 2GV0A 1LAAA 2RB2X 4PJ2C 184LA 168LA 1L77A 1C6QA 3MGWA 1IIZA 1GB0A 2XBSA 1LYDA 1F10A 1G7JC 4PRQA 3A34A 1QTDA 2BPUA 4NHPA 1L63A 1YAPA 1B5WA 9LYZA 1I6SA 1CJ8A 4LT2A 1LGXA 3OK0A 1QTVA 1L98A 1YL0X 2HEEA 1L50A 2C8OA 2B6WA 1OUGA 3HU9A 2ZNWY 244LA 2PC2A 4EOFA 4B4EA 1EL1A 3DN3A 4WM4A 3DMZA 1GFRA 5I4XA 1LHJA 1LMNA 1HERA 1D3NA 4EPFA 5ILFA 1GD6A 1HHLA 1L90A 4CGEA 4LYBA 1GFJA 4DD0A 3UONA 1LZTA 3P66A 4XJHA 4HJYA 4UWUA 1LPIA 4II8A 3TMWA 209LA 1JUGA 4OOOA 1JKBA 3GUKA 1MLCE 2Q9EA 3B6LA 1JJ1A 129LA 219LA 4GCEA 1BB6A 4OWHA 4ARMA 1LGUA 3AZ5A 1YAQA 1G7MC 1L53A 1LYFA 1LZGA 4ET8A 5LIOA 5J7CA 1HEOA 4I7TA 4DQJA 1LZ1A 3HBHA 5I14A 216LA 1G7HC 2LHMA 1L83A 1C64A 3TXJA 1C46A 1C6DA 1NBZC 4H93A 4NGWA 3K3TA 247LA 4W58A 1B2KA 1C6IA 3KAMA 1HMKA 4H9FA 1LHMA 3TXHA 165LA 1D3FA 1DYAA 1XEKA 3AYQA 1WQQA 1LZAA 4WO6A 157LA 1IR9A 3AGGG 4WG7A 1VDSA 3RNXA 2LYOA 5FHWA 1XGPC 4N1CC 1DYGA 3B0IA 2YBLA 3CSZA 141LA 1B7SA 1HEWA 1L21A 1QT6A 1ZVYB 2BQAA 5K7OA 1UIBA 5B1GA 1C62A 1CV6A 229LA 1L14A 3GUOA 253LA 1REXA 4UWNA 3L64A 4EMNA 1WQOA 1LSPA 2DQIY 2MECA 4EXMA 1GDWA 1BHZA 1VAUA 3LZMA 4HTNA 126LA 1HSXA 4W53A 4EPIA 1CKCA 1G0GA 1DPWA 1SWZA 4R6CA 1BVXA 4WM1A 1IP4A 2C8PA 4XJDA 3V2YA 4CJ2A 1LSEA 166LA 3WU7A 5LZMA 2Z2EA 4DT3A 3AGHA 2Z12A 1T6HA 1L64A 5D5FA 1IWWA 1QUTA 3SBAA 1GF8A 1BB3A 1L26A 1GB7A 2DQFC 1LJFA 1T97A 1GFUA 1NQIA 5HLLA 2Z39A 1L24A 4O34A 1B7RA 1L01A 3A91A 3WU8A 2EQLA 3CT5A 3EBAB 2DQGY 5L3HA 4I7PA 1L10A 2BQHA 3CSQA 2HECA 4EKSA 1GBOA 1GBWA 3A67Y 3GXRA 3LZ2A 194LA 3WUMA 1JKDA 4GRVA 3WH1A 3HBEX 5KKJA 3LYMA 4XN6A 3J4GA 5LVGA 5B59A 1P3NA 3TMUA 1NKHA 1GPQC 4GLVA 1AM7A 1JJ3A 4YF2A 1JHLA 2Z6BA 4AQNA 156LA 3EMSA 3F8VA 4I8SA 163LA 4ARQA 4YOPA 3WUNA 1FLWA 1L92A 199LA 1C6EA 5IELA 1D9WA 4HTKA 4YM8A 1MELL 4ZIXA 1C67A 1LMCA 4WMGA 2XQOA 1C68A 4H8XA 5B1FA 1C6GA 4Z46A 4I7JA 1EQ4A 1QSWA 4ANRA 1JTTL 2H9KA 5KXXA 1JITA 5A3EA 1T8AA 4H9CA 3A96A 5C6JA 2B75A 1E8LA 4BS7A 3LHMA 1QUGA 1HMLA 237LA 1LZ9A 2DQHY 2B7XA 1B7MA 4WM6A 2Z19A 107LA 2RH1A 1IP7A 3IWRA 2HTXA 2MEGA 2BQJA 5M1YA 1CKHA 1J1OY 1JKCA 1ZYTA 1QSQA 1WQNA 1DZBX 138LA 1L56A 3WMKA 1L38A 4J7VA 5KXMA 3AB6A 1C43A 3QE8A 4WM3A 1L25A 4E97A 1BWIA 4HSFA 3WU9A 1IX0A 3HH5A 158LA 4NY5A 1XJTA 4DQ7A 1IR7A 252LA 3WW6A 1B7LA 1G0MA 4GLAA 261LA 5F9XA 5LVKA 2LYZA 1C6LA 1G7LC 4DD1A 1KIQC 3T36A 1L79A 5KXYA 3QY4A 1JTNA 5T3FA 2G4QA 2ZQ3A 1C6PA 4Z3MA 3V2WA 1WQMA 1GDXA 1XFPL 4ARLA 1REMA 1IOQA 249LA 3OE9A 3HTGA 3P4ZA 1JISA 220LA 1JSEA 1LSNA 3A94A 4RW2A 2ZIJA 4H9AA 1HELA 3WL2A 3C7ZA 1T3PA 4NWEA 1YAMA 4WOAA 1QTKA 2BQDA 1L68A 1JKAA 1IR8A 162LA 3C8SA 7LYZA 3NY9A 2ZYPA 1LZCA 1L18A 3QAKA 3LYOA 2RBSA 246LA 1L43A 1QUDA 1KW5A 4M6DA 3W6AA 2OEAX 5C6LA 6LZMA 248LA 3LYZA 4YXCA 175LA 154LA 1G0PA 4KXIA 2YBIA 2W1LA 5F81A 169LA 4W57A 1L16A 4OWCA 1IWUA 5F16A 4NSHA 4DD7A 1GAZA 127LA 1RE2A 3W6FA 3B72A 1YANA 4TWSA 1G1WA 5I54A 177LA 1GF7A 2QB0B 155LA 1L82A 4WLXA 2OU9A 3DN4A 1CV5A 5II3A 2FBDA 5E4PA 4DD2A 3NY8A 1LSYA 4GN3A 4IJ4A 3G3XA 1QTCA 1LZNA 1C69A 2ZYCA 1IORA 2XJWA 1C6KA 4H9IA 5LVJA 1CU2A 1BWHA 1L42A 4J1BA 3RZEA 1NMMA 5I4YA 1OUEA 1UICA 3LYTA 4I7MA 240LA 2ZQ4A 1HEPA 2XBRA 1L08A 4DD3A 2BQNA 3HH6A 1ZURA 4KPMA 2MEEA 4LDOA 1IWZA 1YIKA 4CFPA 226LA 5EBHA 238LA 1QTHA 5HQ1A 188LA 5APFA 4OO9A 2BQFA 5KXWA 3DN8A 1BQLY 1CV1A 2LC9A 1B5XA 5I53A 3SB6A 1KY0A 4LYMA 1TDYA 1CU6A 1D0LA 1DI4A 4BAFA 2Q0MX 134LA 4HV2A 3HTFA 3WXUA 4YEMA 1LJJA 1LSDA 1GB9A 1D2YA 139LA 5LVIA 1C60A 1C08C 2NWDX 2F2QA 1GF4A 2NTGA 1DKJA 1L75A 1EQ5A 4B4IA 1XEJA 1FLQA 1L66A 1DYFA 5F14A 1C6BA 1LWKA 1G1VA 2H5ZA 4H91A 3HUKA 3W6CA 143LA 5KXTA 1YAOA 1L09A 1JPOA 1XEPA 4WLDA 5DN4A 1C63A 4KT3A 1FKQA 1SX2A 4NSGA 1OVKA 2I25L 1G7IC 1C65A 4NHTA 2ANVA 1B7NA 2DKVA 1L20A 1C6JA 1KY1A 1GE3A 1WVVA 4GCBA 4I7SA 245LA 3J6KA 4OWEA 1L80A 130LA 1LJ4A 1QDTA 3CDQA 1L28A 1IC4Y 2CJLA 2B73A 1OUCA 1LMOA 1L41A 1GFAA 1L12A 3HT6A 114LA 176LA 3A3RX 5APEA 2OTYX 2DQCY 5DLAA 3OE8A 1C61A 3F9LA 196LA 1LZ8A 2F4AA 5A3ZA 123LA 1G0KA 1LZSA 2BLXA 152LA 2DBTA 4NHSA 4YX7C 2VB1A 4PHIA 3WULA 1D9UA 3TXGA 1HFXA 4ML7A 241LA 2LZMA 1LOZA 251LA 4HPIA 111LA 2WARA 2I6ZA 4H92A 3TXKA 1CVKA 4DDCA 3HDFA 4IASA 178LA 2HEAA 3C82A 4N8ZA 1CTWA 1CJ7A 4B0DA 3B0KA 1L0JA 5FELA 3HU8A 1BGIA 1IWXA 4MCKA 1SWYA 5HMVA 1LMAA 3N9EA 1H6MA 3TXEA 4MSTA 3HUQA 1CX7A 1NHEA 4N0JA 4DWXA 125LA 3FE0A 1CU5A 4LYTA 1AT5A 1LJ3A 3D3DA 2BQOA 2F47A 186LA 1L29A 1L57A 3PBLA 5C6IA 4DQ5A 2D4IA 1NBYC 3ULRA 2HEDA 4PJZA 1UIFA 120LA 1L35A 197LA 4LFPA 256LA 4TX7A 1NDGC 1L17A 234LA 104LA 1OWZA 3EXDA 1TAYA 1LSFA 2YVBA 2Z37A 1L97A 4KL7A 3GXKA 3WW5A 181LA 2FYDA 2D4KA 3ATNA 4H8ZA 1UIAA 149LA 1VFBC 1LZYA 2BQMA 1B5UA 3RT5X 3ZVQB 4WL7A 5LXWA 1L0KA 1GXV2 1C45A 2HULA 4I7KA 5KXOA 183LA 1HENA 135LA 2YBJA 4H8YA 2NTHA 1NDMC 2HUKA 2ZIKA 4LYCA 2F4GA 1LSZA 1LI2A 3W6DA 3AW6A 233LA 1LJGA 235LA 1OYUA 4NSIA 1CUPA 217LA 1QS9A 1OVJA 1FDLY 4ZPUA 5KXNA 110LA 1HEMA 1CV4A 3A95A 1DQJC 1HEQA 4G49A 1B6IA 4C5FA 172LA 1AT6A 1VEDA 1AKIA 4I0CA 1UIEA 3VWOA 1CKGA 250LA 148LE 3GUPA 4LFXA 4EKQA 1G0QA 4DJHA 4OOTA 4I7RA 4QY9A 1L93A 1QIOA 1WTMA 3EO5A 5D5CA 3A93A 1ZWNA 1QS5A 3GUNA 1GE0A 1TBYA 4NGVA 1HNLA 257LA 1LYGA 1VDQA 1LW9A 5LVHA 3DN6A 4GN4A 1IEEA 1P36A 4XJFA 1LYZA 1KW7A 1QUSA 3P68A 1L52A 4BADA 4ETAA 3DMVA 2HUMA 4QDNA 1QT5A 193LA 4EKPA 142LA 3GUIA 2B74A 1C6CA 192LA 137LA 4W55A 4AGAA 5LYZA 1XGUC 4TUNA 1CKFA 1ALCA 3FA0A 1DXJA 4NGYA 4TSCA 2AUBA 3CT0A 1LZDA 3SN6R 3BKHA 3IJUA 4B49A 1IO5A 232LA 171LA 1L27A 2YBMA 3RW8A 3HT9A 1KXYA 2HU1A 1D0KA 2CUUA 3AZ7A 1P37A 4ETBA 2IGCA 1QT7A 2O79A 1AZFA 3F6ZA 2HEFA 5ILCA 4P2EA 4TSBA 1YROA 4BAPA 2RAYX 150LA 1DI5A 5HNLA 1L87A 1P2CC 3HH4A 4I7LA 1L55A 1LSGA 1PQIA 2CWIA 3FI7A 3A92A 2DQAA 1I20A 182LA 3GUJA 146LA 2YDGA 7LZMA 1XGTC 5DM9A 1L71A 1JIYA 1LHIA 2ANXA 4LDLA 1O23A 5L9JA 4XADA 1C6HA 1PQJA 3TXIA 4NSJA 201LA 2MEDA 1F6RA 133LA 4GCCA 1GXXA 1T8FA 2OE4X 3W3EA 3WYHA 1LI6A 3HT7A 5LYTA 1OUDA 5B05A 4WLTA 4LZTA 167LA 2EPEA 4XJGA 254LA 1DYBA 1OUAA 5KY1A 1B9OA 3HT8A 1F6SA 4LYOA 2OE7X 6LYZA 4H9EA 1LHHA 3A8ZA 4LYZA 1KIPC 1Z55A 3WPLA 1C6AA 1OV7A 1P6YA 1LYSA 1IY3A 1CJ9A 1LZ5A 1P64A 4C3WA 5B06A 3AZ6A 2ZILA 3C7YA 4Z98A 4H1PA 211LA 2RBOA 1L40A 4FDYA 5LAGA 170LA 210LA 1RJCB 1GBZA 119LA 1LMTA 2LYMA 5LA8A 1D3MA 1GFTA 5JENB 3CSRA 1LJEA 191LA 1IP3A 4AXTA 1L19A 4R0FA 1LKRA 3WUAA 1OUBA 1GFVA 1L58A 3RU5A 2MEBA 2I26L 4WG1A 1L84A 1L76A 5F9UA 212LA 3TMVA 4NGZA 1YKXX 3C83A 1BB4A 1IOCA 231LA 115LA 2XTHA 3CDTA 4NEBA 1QT8A 3TMXA 1W6ZA 4B4JA 4IATA 1BB5A 205LA 1CNSA 1C6FA 2YSSC 4ZFPA 1IWYA 2MEIA 164LA 4D9ZA 2W1MA 1OV5A 131LA 5KXLA 1UBZA 2BQLA 1CJ6A 3RUNA 1L54A 1RI8B 4WM2A 1GWDA 4N1EI 1GEVA 206LA 1GBSA 4NFVA 1L51A 4ARJA 4EJ4A 3SB8A 1L69A 1UCOA 4E3UA 2Z2FA 3CDRA 1OUIA 3SBBC 262LA 2F32A 2B5ZA 3QNGA 4YXAC 1OUFA 1IWVA 1LMQA 1JSFA 3A90A 1QT4A 5KXKA 1LSAA 2O7AA 1LJIA 1WQRA 3M3UA 1YILA 1REZA 132LA 1FBIX 2LZTA 1T6VL 3W6EA 1L85A 1LLHA 2RB1X 1UUZC 2N5ZA 5LA5A 227LA 2F2NA 4PPOA 4LGKA 4HJZA 4PGJB 1XGRC 2MEHA 3HTBA 102LA 4DC4A 1INUA 3ZVQA 1K28A 3FADA 1VDPA 195LA 4U3XB 180LA 1L05A 5HNCA 1QUOA 4A7DA 1LZ6A 1LZRA 1I1ZA 1LJHA 1RCMA 1P2LA 2OU8A 1QDRA 3HDEA 4YENA 1DYDA 4DYGA 3ATOA 1BVKC 3A6CY 1D0MA 208LA 1TLAA 1XGQC 2W1YA 1I56A 1GB5A 1F0WA 1IP6A 1P46A 2B70A 1P2RA 2FBBA 1DI3A 230LA 3HWLA 3G3WA 3SB7A 3DKEX 1QTEA 1XJUA 2BQGA 2O4WA 3C80A 1GF0A 4WLYA 1UIHA 1L61A 1DKKA 1WQPA 1B7OA 1P7SA 3HH3A 2B72A 5HMJA 242LA 1WTNA 147LA 4L41A 4RLNA 3WVXA 207LA 4H94A 1L89A 5FDJA 5FSTA 2LCBA 3WXTA 1PQMA 2IFFY 1HF4A 1L48A 200LA 140LA 1IOSA 1GF5A 145LA 1L49A 1GFEA 3AZ4A 4OWAA 5LINA 1L88A 218LA 4ETDA 255LA 1W08A 4HV1A 4M4OA 258LA 1KXWA 1ZVHL 1TEWA 1CX6A 3EMLA 5KXSA 3WVYA 3TXFA 4YEOA 5APDA 1LZ4A 4WO9A 2D4JA 4HJVA 160LA 2EIZC 144LA 4EKRA 108LA 3G3AB 3WPJA 4RLMA 2BQKA 2B6TA 3JR6A 187LA 4IAPA 1LSBA 159LA 185LA 1IP5A 173LA 1L60A 1YKZX 1QSBA 1JTMA 4CHXA 3G3BB 1L67A 1L37A 1SLYA 2CGIA 1D2WA 1SSYA 4QGZA 5DN5A 2A4TA 1LJKA 1V7TA 2YBHA 3T6UA 215LA 4DDBA 2Y8PA 4WM5A 1YQVY 3L2XA 1G0JA 1GBYA 5FEKA 1JWRA 1C6MA 225LA 1D6PA 1N4FA 1LKSA 2OTZX 4J1AA 2DQDY 1VATA 1GB6A 1T8GA 1CV0A 236LA 1LHKA 1L00A 1B7QA 1FKVA 1PQOA 3C7WA 1LYJA 3SP3A 1L34A 1UACY 1NF5A 1PZYA 1LPYA 1L33A 239LA 3RZ4A 4NHIA 1LYHA 5LYMA 5L3IA 151LA 4NGOA 1LSCA 2EKSC 2OE9X 4I7OA 3ZEKA 3TXBA 1LYIA 1L02A 2BQEA 1IC5Y 3PDSA 3BKVA 5KXRA 3CDVA 4K5YA 1L70A 1LMPA 1L81A 1FN5A 1GBXA 4I7NA 4W94A 3C8QA 5I5QA 3G3VA 1GB2A 5KXPA 2HUBA 3FI5A 1GFKA 5KJ9A 4XJIA 2Q9DA 3LN2A 214LA 1LZEA 1CU0A 4FJRA 1IP2A 8LYZA 2L78A 1OUHA 1GF6A 4W59A 3DN1A 1L44A 4PK0A 1SX7A 1XEIA 3SB9A 3DNAA 4G9SA 2OU0X 3CQLA 4ARPA 109LA 4NGKA 1LYOA 4DAJA 4LT3A 5IDDA 1ZV5L 4GBRB 1L31A 1L62A 1VDTA 4NHQA 3OE6A 2FYCA 198LA 1JJ0A 4LT0A 3WPKA 4G4BA 1GHLA 1GE1A 4OWBA 153LA 1L65A 1L72A 1L45A 1L46A 1C66A 1B5VA 4G4CA 3VW7A 1L39A 1WVUA 1FLUA 3P64A 1L07A 243LA 1GEZA 3AW7A 2D91A 4W96A 4B1AA 5KXZA 1GF3A 3A6BY 1TCYA 5APCA 1L96A 2F30A 1ZMYL 4HPEA 3C8RA 1GFHA 128LA 3DMXA 2B6ZA 1IP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQE A;  1LHM A;  3TXH A;  4C3W A;  5F14 A;  1XEK A;  5B06 A;  4NG1 A;  3AZ6 A;  4RW1 A;  2ZIL A;  4QEQ A;  2A7D A;  3AYQ A;  2H5Z A;  1WQQ A;  4H91 A;  1LZA A;  4Z98 A;  4H1P A;  1YKY X;  4WO6 A;  3E3D A;  5B07 A;  3W6C A;  4FDY A;  5LAG A;  1IR9 A;  3AGG G;  1OP9 B;  4WG7 A;  5KXT A;  1VDS A;  1YAO A;  1RJC B;  3RNX A;  2LYO A;  1GBZ A;  1JPO A;  2MEF A;  1LMT A;  2LYM A;  5LA8 A;  1OQM A;  4WLD A;  5DN4 A;  5FHW A;  1UID A;  1XGP C;  4XEN A;  4N1C C;  1GFT A;  4KT3 A;  1FKQ A;  1DPX A;  5JEN B;  3B0I A;  4NSG A;  2I25 L;  3CSR A;  1G7I C;  1LJE A;  1IP3 A;  2YBL A;  3CSZ A;  1B7S A;  3B0O A;  1HEW A;  1JTO L;  1ZVY B;  2BQA A;  4NHT A;  4AXT A;  4R0F A;  1LKR A;  1LZB A;  3WUA A;  1OUB A;  3OJP A;  1GFV A;  5K7O A;  1B7N A;  2DKV A;  2RSC A;  1UIB A;  3RU5 A;  2MEB A;  5B1G A;  1GE2 A;  2I26 L;  1OUJ A;  4WG1 A;  5F9U A;  1GE3 A;  1WVV A;  4GCB A;  1REX A;  1HFZ A;  4UWN A;  4J0L A;  1LHL A;  3TMV A;  3J6K A;  1YKX X;  4NGZ A;  4NGI A;  4OWE A;  1LJ4 A;  1QDT A;  1WQO A;  4X3B A;  4EMN A;  2BLY A;  2ZWB A;  1IC4 Y;  5DL9 A;  1LSP A;  2DQI Y;  1BB4 A;  2MEC A;  2CJL A;  1OUC A;  1IOC A;  1LMO A;  1GDW A;  1BHZ A;  1VAU A;  1KIR C;  4H9B A;  2XTH A;  4NEB A;  4HTN A;  3TMX A;  4HP0 A;  2Z18 A;  4NGJ A;  1GFA A;  1HSX A;  1W6Z A;  4IAT A;  1BB5 A;  4B4J A;  1CNS A;  1CKC A;  3HFM Y;  1DPW A;  1IC7 Y;  3A3R X;  4ZFP A;  2YSS C;  4R6C A;  5APE A;  1BVX A;  4WM1 A;  1IWY A;  1IP4 A;  2C8P A;  4XJD A;  2MEI A;  1BWJ A;  1LSE A;  5AMY A;  4D9Z A;  4CJ2 A;  2G4P A;  2W1M A;  2DQC Y;  1IWT A;  3WU7 A;  5DLA A;  5KXL A;  1UBZ A;  2BQL A;  1LZ8 A;  1CJ6 A;  2F4A A;  5A3Z A;  5IHG A;  2Z2E A;  1RI8 B;  1LZS A;  4WM2 A;  4DT3 A;  1GWD A;  3AGH A;  4N1E I;  2Z12 A;  1GEV A;  2BLX A;  5D5F A;  2DBT A;  1IWW A;  1QUT A;  1GBS A;  4NHS A;  4NFV A;  1LCN A;  1GF8 A;  1BB3 A;  2VB1 A;  1QQY A;  4PHI A;  3WUL A;  1D9U A;  2DQJ Y;  3TXG A;  1HFX A;  1XSF A;  4ML7 A;  4DDA A;  1UCO A;  1GB7 A;  2CDS A;  2DQF C;  4E3U A;  1LJF A;  2Z2F A;  1OUI A;  1GFU A;  3M18 B;  1LOZ A;  1GB8 A;  2DQE Y;  4HPI A;  2WAR A;  1NQI A;  2B5Z A;  2I6Z A;  3QNG A;  4H92 A;  3TXK A;  5HLL A;  1OUF A;  2Z39 A;  4O34 A;  1IWV A;  1LMQ A;  2A7F A;  4DDC A;  1B7R A;  1JSF A;  3A90 A;  3A91 A;  3WU8 A;  1NWG A;  2EQL A;  5KXK A;  3CT5 A;  3EBA B;  1YL1 X;  1LSA A;  2DQG Y;  3LZT A;  5L3H A;  1LJI A;  2BQH A;  2MEA A;  1WQR A;  3CSQ A;  2HEC A;  1YIL A;  3M3U A;  1GBO A;  1GBW A;  1V7S A;  4IAS A;  4NIJ A;  4RDS A;  3A67 Y;  4PRU A;  2HEA A;  1REZ A;  1A2Y C;  132L A;  1FBI X;  3GXR A;  4N8Z A;  2LZT A;  1T6V L;  3W6E A;  1IVM A;  1CJ7 A;  4GCD A;  3LZ2 A;  194L A;  1UUZ C;  3WUM A;  2N5Z A;  3B0K A;  4B0D A;  5LA5 A;  1JKD A;  3AGI A;  5FEL A;  3WH1 A;  1BGI A;  2F2N A;  1IWX A;  3HBE X;  5KKJ A;  3LYM A;  4G4H A;  4LGK A;  4MCK A;  4PPO A;  4HJZ A;  4XN6 A;  5HMV A;  1LMA A;  3J4G A;  4PGJ B;  5LVG A;  3N9E A;  1H6M A;  1XGR C;  3AJN A;  2MEH A;  4MST A;  3TMU A;  3TXE A;  5B59 A;  2IHL A;  1NHE A;  4N0J A;  1NKH A;  1GPQ C;  1GAY A;  1REY A;  4CFO A;  4DWX A;  4DC4 A;  1INU A;  3ZVQ A;  4GLV A;  3FE0 A;  1AM7 A;  1JJ3 A;  2Z38 A;  4YF2 A;  1CKD A;  1JHL A;  4LYT A;  1AT5 A;  1HFY A;  1LJ3 A;  1RFP A;  1VDP A;  3D3D A;  1HSW A;  2D6B A;  2BQO A;  4U3X B;  3EMS A;  6LYT A;  5I4W A;  4I8S A;  1JEF A;  4ET9 A;  5C6I A;  5HNC A;  4OW1 A;  4MR1 A;  2BQC A;  4ETC A;  4A7D A;  1LZ6 A;  1LZR A;  1IY4 A;  1I1Z A;  4YOP A;  1LJH A;  1RCM A;  3WUN A;  2D4I A;  1NBY C;  1QDR A;  1FLW A;  1GB3 A;  4YEN A;  3ULR A;  4DYG A;  3ATO A;  2HED A;  1BVK C;  3A6C Y;  1D0M A;  208L A;  1XGQ C;  1UIF A;  2W1Y A;  1J1P Y;  1I56 A;  5IEL A;  1B5Y A;  4LFP A;  3W6B A;  4HTK A;  4YM8 A;  1GB5 A;  1SQ2 L;  1MEL L;  4TX7 A;  1NDG C;  1F0W A;  4ZIX A;  1IP6 A;  2FBB A;  1LMC A;  4WMG A;  3CT1 A;  3EXD A;  4H8X A;  5B1F A;  1TAY A;  1LSF A;  4Z46 A;  2X0A A;  1DI3 A;  1C10 A;  1EQ4 A;  1QSW A;  4ANR A;  2YVB A;  1JTT L;  2H9K A;  2Z37 A;  5KXX A;  5KKI A;  4XYY A;  4KL7 A;  1QTE A;  1IOT A;  1JIT A;  5A3E A;  3GXK A;  4XJB A;  2BQG A;  3WW5 A;  2FYD A;  2D4K A;  3ATN A;  4H9C A;  4H8Z A;  4TTD A;  3A96 A;  5C6J A;  1UIA A;  2BQI A;  1VFB C;  1E8L A;  1LZY A;  1GF0 A;  4BS7 A;  2BQM A;  4WLY A;  1B5U A;  1UIH A;  3LHM A;  2HEB A;  3RT5 X;  3ZVQ B;  1DKK A;  4WL7 A;  1WQP A;  1B7O A;  5HMJ A;  1HML A;  4GN5 C;  1WTN A;  5LXW A;  4L41 A;  1BB7 A;  4RLN A;  3WVX A;  4ETE A;  1GXV 2;  1C45 A;  207L A;  4H94 A;  1UIG A;  1LZ9 A;  2DQH Y;  1LYY A;  5FDJ A;  5KXO A;  5FST A;  1B7M A;  3N9C A;  3WXT A;  1HEN A;  1KXX A;  1QSA A;  4WM6 A;  135L A;  2YBJ A;  2Z19 A;  2IFF Y;  4H8Y A;  1HF4 A;  1B7P A;  3D9A C;  1NDM C;  2ZIK A;  4LYC A;  4NG8 A;  1IOS A;  1GF5 A;  2F4G A;  2YBN A;  1PS5 A;  1LSZ A;  1GFE A;  4N9R A;  4Z41 A;  3W6D A;  1IP7 A;  3AW6 A;  3IWR A;  3P65 A;  4UWV A;  1LJG A;  2HTX A;  1HC0 A;  1GE4 A;  3HBD A;  4NSI A;  3AZ4 A;  4OWA A;  3CB7 A;  5LIN A;  2MEG A;  1LSM A;  2BQJ A;  1LTM A;  4ETD A;  5M1Y A;  4LT1 A;  1CKH A;  1FDL Y;  1J1O Y;  3A3Q A;  4NWH A;  1JKC A;  2ZNX Y;  1W08 A;  1HEM A;  4HV1 A;  5KXN A;  1WQN A;  1DZB X;  4M4O A;  4HTQ A;  3A95 A;  1DQJ C;  5LAF A;  1HEQ A;  4G49 A;  3WMK A;  4C5F A;  1KXW A;  1ZVH L;  1TEW A;  5KXS A;  1JTP L;  2G4N A;  1AT6 A;  3WVY A;  1VED A;  4J7V A;  4WL6 A;  3AB6 A;  3TXF A;  1C43 A;  3QE8 A;  1UA6 Y;  5KXM A;  4YEO A;  1AKI A;  5APD A;  4I0C A;  1LZ4 A;  4WM3 A;  1UIE A;  4WO9 A;  3VWO A;  1CKG A;  4H9H A;  1B0D A;  5FCP A;  1BWI A;  2D4J A;  4LFX A;  4HSF A;  4HJV A;  3WU9 A;  2EIZ C;  4H90 A;  4OOT A;  1GF9 A;  1IX0 A;  3G3A B;  2BQB A;  1H87 A;  3WPJ A;  4NY5 A;  4QY9 A;  1FLY A;  3N9A A;  4RLM A;  2BQK A;  1IR7 A;  1QIO A;  3WW6 A;  1B7L A;  4GLA A;  1LSB A;  1IP5 A;  1UC0 A;  1YKZ X;  4ZEE A;  5F9X A;  1WTM A;  5LVK A;  4CHX A;  3EO5 A;  2LYZ A;  5D5C A;  3G3B B;  1G7L C;  1SLY A;  3A93 A;  4DD1 A;  2H9J A;  1KIQ C;  1A4V A;  1D6Q A;  2CGI A;  3T36 A;  1GE0 A;  4GCF A;  5DN5 A;  4QGZ A;  1TBY A;  5KXY A;  1LJK A;  1V7T A;  3QY4 A;  2YBH A;  4NGV A;  5E9R A;  1HNL A;  2G4Q A;  1C7P A;  2LZ2 A;  2ZQ3 A;  5T3F A;  3T6U A;  1VDQ A;  1LJN A;  4DD9 A;  4DDB A;  4N5R A;  2Y8P A;  1GFG A;  1J1X Y;  5LVH A;  4Z3M A;  1B5Z A;  1IEE A;  1WQM A;  4GN4 A;  4WM5 A;  2BAA A;  1YQV Y;  1GDX A;  4XJF A;  1XFP L;  1REM A;  2W1X A;  1LYZ A;  4H9F A;  1GBY A;  1IOQ A;  5FEK A;  1JWR A;  1QUS A;  3TXD A;  3P68 A;  4BAD A;  3IJV A;  3P4Z A;  1JIS A;  4ETA A;  1D6P A;  1N4F A;  1LKS A;  1JSE A;  4QDN A;  2HU3 A;  4J1A A;  1LSN A;  3A94 A;  2GV0 A;  2DQD Y;  193L A;  1LAA A;  1GB6 A;  1VAT A;  2ZIJ A;  4NGL A;  4RW2 A;  4H9A A;  1HEL A;  4PJ2 C;  1LHK A;  3WL2 A;  1T3P A;  1B7Q A;  1FKV A;  4NWE A;  1YAM A;  3SP3 A;  4WOA A;  4AGA A;  1QTK A;  5LYZ A;  3MGW A;  1IIZ A;  1XGU C;  2BQD A;  1UAC Y;  1JKA A;  1IR8 A;  1CKF A;  1ALC A;  1GB0 A;  2XBS A;  4TUN A;  7LYZ A;  1NF5 A;  1PZY A;  1DXJ A;  1F10 A;  1G7J C;  2ZYP A;  4NGY A;  1LZC A;  4TSC A;  2AUB A;  3CT0 A;  4PRQ A;  3A34 A;  1LZD A;  3LYO A;  2BPU A;  4NHP A;  3RZ4 A;  3BKH A;  3IJU A;  1YAP A;  4NHI A;  1B5W A;  4B49 A;  1IO5 A;  5LYM A;  9LYZ A;  4M6D A;  3W6A A;  5L3I A;  2YBM A;  3RW8 A;  1KXY A;  1CJ8 A;  4NGO A;  1LSC A;  2EKS C;  4LT2 A;  3ZEK A;  3TXB A;  3OK0 A;  2BQE A;  1IC5 Y;  1D0K A;  2HU1 A;  5C6L A;  3BKV A;  5KXR A;  3AZ7 A;  3LYZ A;  1YL0 X;  1LMP A;  2HEE A;  154L A;  1FN5 A;  1GBX A;  2C8O A;  4ETB A;  4W94 A;  4KXI A;  5I5Q A;  2YBI A;  2W1L A;  1GB2 A;  1OUG A;  5F81 A;  5KXP A;  1AZF A;  3F6Z A;  2ZNW Y;  4OWC A;  1IWU A;  2HUB A;  2PC2 A;  2HEF A;  5ILC A;  1GFK A;  4P2E A;  4TSB A;  5F16 A;  4NSH A;  4DD7 A;  5KJ9 A;  4XJI A;  1GAZ A;  1YRO A;  4EOF A;  3LN2 A;  4BAP A;  1LZE A;  1RE2 A;  4B4E A;  1EL1 A;  3W6F A;  1DI5 A;  3B72 A;  5HNL A;  1YAN A;  4TWS A;  4WM4 A;  1P2C C;  4FJR A;  5I54 A;  1GFR A;  1GF7 A;  5I4X A;  1LHJ A;  1IP2 A;  8LYZ A;  4WLX A;  1LSG A;  1LMN A;  1OUH A;  1GF6 A;  1HER A;  2CWI A;  5II3 A;  2FBD A;  5E4P A;  4DD2 A;  1LSY A;  3FI7 A;  3A92 A;  4GN3 A;  2DQA A;  1I20 A;  1GD6 A;  1HHL A;  5ILF A;  4CGE A;  4LYB A;  1GFJ A;  4IJ4 A;  1XEI A;  4G9S A;  3CQL A;  4DD0 A;  1LZN A;  1LZT A;  3P66 A;  4XJH A;  2YDG A;  2ZYC A;  4NGK A;  1LYO A;  4HJY A;  1XGT C;  4UWU A;  1IOR A;  5DM9 A;  2XJW A;  1LPI A;  4LT3 A;  5IDD A;  1JIY A;  1LHI A;  1ZV5 L;  4H9I A;  4II8 A;  3TMW A;  5LVJ A;  1JUG A;  1O23 A;  5L9J A;  4OOO A;  1JKB A;  1BWH A;  4J1B A;  1MLC E;  1VDT A;  4XAD A;  1NMM A;  4NHQ A;  5I4Y A;  3B6L A;  1OUE A;  1UIC A;  2FYC A;  3LYT A;  1JJ0 A;  2ZQ4 A;  3TXI A;  1HEP A;  4NSJ A;  1JJ1 A;  2XBR A;  4DD3 A;  2BQN A;  4LT0 A;  2MED A;  3WPK A;  1F6R A;  4GCE A;  133L A;  4GCC A;  4G4B A;  1GHL A;  1BB6 A;  1GXX A;  4KPM A;  4OWH A;  1GE1 A;  2MEE A;  4OWB A;  3W3E A;  3AZ5 A;  1IWZ A;  1YAQ A;  1YIK A;  3WYH A;  1G7M C;  4CFP A;  5LYT A;  153L A;  5EBH A;  5HQ1 A;  5APF A;  1LZG A;  1OUD A;  5B05 A;  4ET8 A;  4WLT A;  4LZT A;  2BQF A;  2EPE A;  5KXW A;  5LIO A;  1B5V A;  1BQL Y;  5J7C A;  1HEO A;  4XJG A;  4G4C A;  1B5X A;  1OUA A;  1LZ1 A;  3HBH A;  5I53 A;  4LYM A;  1WVU A;  1G7H C;  1TDY A;  1FLU A;  1B9O A;  2LHM A;  5KY1 A;  3P64 A;  1D0L A;  1F6S A;  1DI4 A;  4LYO A;  2Q0M X;  4BAF A;  6LYZ A;  1GEZ A;  3AW7 A;  4H9E A;  1LHH A;  3A8Z A;  134L A;  4HV2 A;  3WXU A;  4YEM A;  4LYZ A;  1LJJ A;  2D91 A;  1LSD A;  3TXJ A;  1GB9 A;  1KIP C;  1C46 A;  1Z55 A;  1NBZ C;  4W96 A;  4B1A A;  5LVI A;  4H93 A;  5KXZ A;  4NGW A;  3WPL A;  1GF3 A;  3K3T A;  3A6B Y;  1C08 C;  1TCY A;  2NWD X;  5APC A;  2F30 A;  1ZMY L;  4HPE A;  1LYS A;  1GFH A;  1GF4 A;  1IY3 A;  1B2K A;  1CJ9 A;  1DKJ A;  3KAM A;  1LZ5 A;  1HMK A;  1EQ5 A;  4B4I A;  1XEJ A;  1IP1 A;  1FLQ A; 
#chains in the Genus database with same CATH topology
 1EQE A;  4NG1 A;  4RW1 A;  1L06 A;  1DYC A;  4QEQ A;  2A7D A;  189L A;  1YKY X;  1PQD A;  3E3D A;  5B07 A;  1OP9 B;  4ARM B;  3OE0 A;  1L04 A;  2MEF A;  1OQM A;  1QUH A;  1UID A;  4XEN A;  1L22 A;  1DPX A;  221L A;  3B0O A;  1JTO L;  228L A;  1LZB A;  122L A;  3OJP A;  2RSC A;  1L11 A;  161L A;  1GE2 A;  1L73 A;  1OUJ A;  1QTZ A;  174L A;  4W54 A;  1HFZ A;  2RBN A;  3SB5 A;  4J0L A;  1LHL A;  222L A;  4NGI A;  1L30 A;  4X3B A;  1QTB A;  2BLY A;  2ZWB A;  4W51 A;  5DL9 A;  1OWY A;  3C81 A;  1KIR C;  4H9B A;  1LI3 A;  2B6Y A;  1P5C A;  4HP0 A;  2Z18 A;  4NGJ A;  3HFM Y;  1IC7 Y;  112L A;  1QT3 A;  1BWJ A;  5AMY A;  2G4P A;  1IWT A;  1D3J A;  223L A;  5IHG A;  259L A;  1C6N A;  2RB0 X;  1L91 A;  1LCN A;  1PQK A;  1QQY A;  2DQJ Y;  1XSF A;  4DDA A;  2CDS A;  2RAZ X;  1L59 A;  2RBQ A;  3M18 B;  1GB8 A;  2DQE Y;  1L94 A;  3HTD A;  2A7F A;  3CDO A;  1L15 A;  1NWG A;  1YL1 X;  3LZT A;  2MEA A;  1V7S A;  4RDS A;  4NIJ A;  4PRU A;  3DN2 A;  4LZM A;  1L74 A;  1A2Y C;  1JQU A;  1IVM A;  1LGW A;  4GCD A;  3AGI A;  4G4H A;  3AJN A;  1KS3 A;  3GUL A;  2IHL A;  1REY A;  1GAY A;  1L36 A;  4CFO A;  2Z38 A;  1CKD A;  1HFY A;  1RFP A;  1HSW A;  2D6B A;  6LYT A;  5I4W A;  1JEF A;  4ET9 A;  1L23 A;  4OW1 A;  4MR1 A;  2BQC A;  3GUM A;  4ETC A;  1IY4 A;  4I7Q A;  118L A;  1C6T A;  1EPY A;  2RBR A;  3K2R A;  1GB3 A;  224L A;  4W56 A;  1J1P Y;  1B5Y A;  3W6B A;  1SQ2 L;  1SSW A;  3CT1 A;  2X0A A;  1C10 A;  1P56 A;  190L A;  3ODU A;  5KKI A;  4XYY A;  1IOT A;  4XJB A;  1KNI A;  4TTD A;  2RBP A;  2BQI A;  1OVH A;  2HEB A;  103L A;  1L13 A;  4GN5 C;  1BB7 A;  4ETE A;  4LDE A;  4ARQ B;  1UIG A;  1LYY A;  3N9C A;  1KXX A;  1QSA A;  1DYE A;  1B7P A;  3D9A C;  4NG8 A;  2YBN A;  1PS5 A;  4N9R A;  113L A;  4Z41 A;  1L47 A;  3P65 A;  4UWV A;  1HC0 A;  1GE4 A;  3HBD A;  3CB7 A;  1LSM A;  1LWG A;  1LTM A;  4LT1 A;  4W52 A;  3A3Q A;  1G0L A;  4NWH A;  2ZNX Y;  4HTQ A;  5LAF A;  1G06 A;  4DKL A;  1JTP L;  2G4N A;  4WL6 A;  1L99 A;  1UA6 Y;  4H9H A;  1B0D A;  5FCP A;  1L95 A;  4H90 A;  1GF9 A;  3D4S A;  260L A;  2BQB A;  1H87 A;  2B6X A;  1G07 A;  1FLY A;  3N9A A;  3NYA A;  1WTH A;  1CV3 A;  1UC0 A;  4ZEE A;  2H9J A;  1A4V A;  1D6Q A;  1L03 A;  4GCF A;  4S0W A;  3DN0 A;  5E9R A;  1C7P A;  2LZ2 A;  4DD9 A;  1LJN A;  4N5R A;  3HUA A;  1GFG A;  1J1X Y;  1B5Z A;  1NHB A;  2BAA A;  1L86 A;  213L A;  2QAR C;  2W1X A;  1CU3 A;  1LYE A;  1L32 A;  3TXD A;  3IJV A;  1CUQ A;  2HU3 A;  4NGL A;  2GV0 A;  1LAA A;  2RB2 X;  4PJ2 C;  184L A;  168L A;  1L77 A;  1C6Q A;  3MGW A;  1IIZ A;  1GB0 A;  2XBS A;  1LYD A;  1F10 A;  1G7J C;  4PRQ A;  3A34 A;  1QTD A;  2BPU A;  4NHP A;  1L63 A;  1YAP A;  1B5W A;  9LYZ A;  1I6S A;  1CJ8 A;  4LT2 A;  1LGX A;  3OK0 A;  1QTV A;  1L98 A;  1YL0 X;  2HEE A;  1L50 A;  2C8O A;  2B6W A;  1OUG A;  3HU9 A;  2ZNW Y;  244L A;  2PC2 A;  4EOF A;  4B4E A;  1EL1 A;  3DN3 A;  4WM4 A;  3DMZ A;  1GFR A;  5I4X A;  1LHJ A;  1LMN A;  1HER A;  1D3N A;  4EPF A;  5ILF A;  1GD6 A;  1HHL A;  1L90 A;  4CGE A;  4LYB A;  1GFJ A;  4DD0 A;  3UON A;  1LZT A;  3P66 A;  4XJH A;  4HJY A;  4UWU A;  1LPI A;  4II8 A;  3TMW A;  209L A;  1JUG A;  4OOO A;  1JKB A;  3GUK A;  1MLC E;  2Q9E A;  3B6L A;  1JJ1 A;  129L A;  219L A;  4GCE A;  1BB6 A;  4OWH A;  4ARM A;  1LGU A;  3AZ5 A;  1YAQ A;  1G7M C;  1L53 A;  1LYF A;  1LZG A;  4ET8 A;  5LIO A;  5J7C A;  1HEO A;  4I7T A;  4DQJ A;  1LZ1 A;  3HBH A;  5I14 A;  216L A;  1G7H C;  2LHM A;  1L83 A;  1C64 A;  3TXJ A;  1C46 A;  1C6D A;  1NBZ C;  4H93 A;  4NGW A;  3K3T A;  247L A;  4W58 A;  1B2K A;  1C6I A;  3KAM A;  1HMK A;  4H9F A;  1LHM A;  3TXH A;  165L A;  1D3F A;  1DYA A;  1XEK A;  3AYQ A;  1WQQ A;  1LZA A;  4WO6 A;  157L A;  1IR9 A;  3AGG G;  4WG7 A;  1VDS A;  3RNX A;  2LYO A;  5FHW A;  1XGP C;  4N1C C;  1DYG A;  3B0I A;  2YBL A;  3CSZ A;  141L A;  1B7S A;  1HEW A;  1L21 A;  1QT6 A;  1ZVY B;  2BQA A;  5K7O A;  1UIB A;  5B1G A;  1C62 A;  1CV6 A;  229L A;  1L14 A;  3GUO A;  253L A;  1REX A;  4UWN A;  3L64 A;  4EMN A;  1WQO A;  1LSP A;  2DQI Y;  2MEC A;  4EXM A;  1GDW A;  1BHZ A;  1VAU A;  3LZM A;  4HTN A;  126L A;  1HSX A;  4W53 A;  4EPI A;  1CKC A;  1G0G A;  1DPW A;  1SWZ A;  4R6C A;  1BVX A;  4WM1 A;  1IP4 A;  2C8P A;  4XJD A;  3V2Y A;  4CJ2 A;  1LSE A;  166L A;  3WU7 A;  5LZM A;  2Z2E A;  4DT3 A;  3AGH A;  2Z12 A;  1T6H A;  1L64 A;  5D5F A;  1IWW A;  1QUT A;  3SBA A;  1GF8 A;  1BB3 A;  1L26 A;  1GB7 A;  2DQF C;  1LJF A;  1T97 A;  1GFU A;  1NQI A;  5HLL A;  2Z39 A;  1L24 A;  4O34 A;  1B7R A;  1L01 A;  3A91 A;  3WU8 A;  2EQL A;  3CT5 A;  3EBA B;  2DQG Y;  5L3H A;  4I7P A;  1L10 A;  2BQH A;  3CSQ A;  2HEC A;  4EKS A;  1GBO A;  1GBW A;  3A67 Y;  3GXR A;  3LZ2 A;  194L A;  3WUM A;  1JKD A;  4GRV A;  3WH1 A;  3HBE X;  5KKJ A;  3LYM A;  4XN6 A;  3J4G A;  5LVG A;  5B59 A;  1P3N A;  3TMU A;  1NKH A;  1GPQ C;  4GLV A;  1AM7 A;  1JJ3 A;  4YF2 A;  1JHL A;  2Z6B A;  4AQN A;  156L A;  3EMS A;  3F8V A;  4I8S A;  163L A;  4ARQ A;  4YOP A;  3WUN A;  1FLW A;  1L92 A;  199L A;  1C6E A;  5IEL A;  1D9W A;  4HTK A;  4YM8 A;  1MEL L;  4ZIX A;  1C67 A;  1LMC A;  4WMG A;  2XQO A;  1C68 A;  4H8X A;  5B1F A;  1C6G A;  4Z46 A;  4I7J A;  1EQ4 A;  1QSW A;  4ANR A;  1JTT L;  2H9K A;  5KXX A;  1JIT A;  5A3E A;  1T8A A;  4H9C A;  3A96 A;  5C6J A;  2B75 A;  1E8L A;  4BS7 A;  3LHM A;  1QUG A;  1HML A;  237L A;  1LZ9 A;  2DQH Y;  2B7X A;  1B7M A;  4WM6 A;  2Z19 A;  107L A;  2RH1 A;  1IP7 A;  3IWR A;  2HTX A;  2MEG A;  2BQJ A;  5M1Y A;  1CKH A;  1J1O Y;  1JKC A;  1ZYT A;  1QSQ A;  1WQN A;  1DZB X;  138L A;  1L56 A;  3WMK A;  1L38 A;  4J7V A;  5KXM A;  3AB6 A;  1C43 A;  3QE8 A;  4WM3 A;  1L25 A;  4E97 A;  1BWI A;  4HSF A;  3WU9 A;  1IX0 A;  3HH5 A;  158L A;  4NY5 A;  1XJT A;  4DQ7 A;  1IR7 A;  252L A;  3WW6 A;  1B7L A;  1G0M A;  4GLA A;  261L A;  5F9X A;  5LVK A;  2LYZ A;  1C6L A;  1G7L C;  4DD1 A;  1KIQ C;  3T36 A;  1L79 A;  5KXY A;  3QY4 A;  1JTN A;  5T3F A;  2G4Q A;  2ZQ3 A;  1C6P A;  4Z3M A;  3V2W A;  1WQM A;  1GDX A;  1XFP L;  4ARL A;  1REM A;  1IOQ A;  249L A;  3OE9 A;  3HTG A;  3P4Z A;  1JIS A;  220L A;  1JSE A;  1LSN A;  3A94 A;  4RW2 A;  2ZIJ A;  4H9A A;  1HEL A;  3WL2 A;  3C7Z A;  1T3P A;  4NWE A;  1YAM A;  4WOA A;  1QTK A;  2BQD A;  1L68 A;  1JKA A;  1IR8 A;  162L A;  3C8S A;  7LYZ A;  3NY9 A;  2ZYP A;  1LZC A;  1L18 A;  3QAK A;  3LYO A;  2RBS A;  246L A;  1L43 A;  1QUD A;  1KW5 A;  4M6D A;  3W6A A;  2OEA X;  5C6L A;  6LZM A;  248L A;  3LYZ A;  4YXC A;  175L A;  154L A;  1G0P A;  4KXI A;  2YBI A;  2W1L A;  5F81 A;  169L A;  4W57 A;  1L16 A;  4OWC A;  1IWU A;  5F16 A;  4NSH A;  4DD7 A;  1GAZ A;  127L A;  1RE2 A;  3W6F A;  3B72 A;  1YAN A;  4TWS A;  1G1W A;  5I54 A;  177L A;  1GF7 A;  2QB0 B;  155L A;  1L82 A;  4WLX A;  2OU9 A;  3DN4 A;  1CV5 A;  5II3 A;  2FBD A;  5E4P A;  4DD2 A;  3NY8 A;  1LSY A;  4GN3 A;  4IJ4 A;  3G3X A;  1QTC A;  1LZN A;  1C69 A;  2ZYC A;  1IOR A;  2XJW A;  1C6K A;  4H9I A;  5LVJ A;  1CU2 A;  1BWH A;  1L42 A;  4J1B A;  3RZE A;  1NMM A;  5I4Y A;  1OUE A;  1UIC A;  3LYT A;  4I7M A;  240L A;  2ZQ4 A;  1HEP A;  2XBR A;  1L08 A;  4DD3 A;  2BQN A;  3HH6 A;  1ZUR A;  4KPM A;  2MEE A;  4LDO A;  1IWZ A;  1YIK A;  4CFP A;  226L A;  5EBH A;  238L A;  1QTH A;  5HQ1 A;  188L A;  5APF A;  4OO9 A;  2BQF A;  5KXW A;  3DN8 A;  1BQL Y;  1CV1 A;  2LC9 A;  1B5X A;  5I53 A;  3SB6 A;  1KY0 A;  4LYM A;  1TDY A;  1CU6 A;  1D0L A;  1DI4 A;  4BAF A;  2Q0M X;  134L A;  4HV2 A;  3HTF A;  3WXU A;  4YEM A;  1LJJ A;  1LSD A;  1GB9 A;  1D2Y A;  139L A;  5LVI A;  1C60 A;  1C08 C;  2NWD X;  2F2Q A;  1GF4 A;  2NTG A;  1DKJ A;  1L75 A;  1EQ5 A;  4B4I A;  1XEJ A;  1FLQ A;  1L66 A;  1DYF A;  5F14 A;  1C6B A;  1LWK A;  1G1V A;  2H5Z A;  4H91 A;  3HUK A;  3W6C A;  143L A;  5KXT A;  1YAO A;  1L09 A;  1JPO A;  1XEP A;  4WLD A;  5DN4 A;  1C63 A;  4KT3 A;  1FKQ A;  1SX2 A;  4NSG A;  1OVK A;  2I25 L;  1G7I C;  1C65 A;  4NHT A;  2ANV A;  1B7N A;  2DKV A;  1L20 A;  1C6J A;  1KY1 A;  1GE3 A;  1WVV A;  4GCB A;  4I7S A;  245L A;  3J6K A;  4OWE A;  1L80 A;  130L A;  1LJ4 A;  1QDT A;  3CDQ A;  1L28 A;  1IC4 Y;  2CJL A;  2B73 A;  1OUC A;  1LMO A;  1L41 A;  1GFA A;  1L12 A;  3HT6 A;  114L A;  176L A;  3A3R X;  5APE A;  2OTY X;  2DQC Y;  5DLA A;  3OE8 A;  1C61 A;  3F9L A;  196L A;  1LZ8 A;  2F4A A;  5A3Z A;  123L A;  1G0K A;  1LZS A;  2BLX A;  152L A;  2DBT A;  4NHS A;  4YX7 C;  2VB1 A;  4PHI A;  3WUL A;  1D9U A;  3TXG A;  1HFX A;  4ML7 A;  241L A;  2LZM A;  1LOZ A;  251L A;  4HPI A;  111L A;  2WAR A;  2I6Z A;  4H92 A;  3TXK A;  1CVK A;  4DDC A;  3HDF A;  4IAS A;  178L A;  2HEA A;  3C82 A;  4N8Z A;  1CTW A;  1CJ7 A;  4B0D A;  3B0K A;  1L0J A;  5FEL A;  3HU8 A;  1BGI A;  1IWX A;  4MCK A;  1SWY A;  5HMV A;  1LMA A;  3N9E A;  1H6M A;  3TXE A;  4MST A;  3HUQ A;  1CX7 A;  1NHE A;  4N0J A;  4DWX A;  125L A;  3FE0 A;  1CU5 A;  4LYT A;  1AT5 A;  1LJ3 A;  3D3D A;  2BQO A;  2F47 A;  186L A;  1L29 A;  1L57 A;  3PBL A;  5C6I A;  4DQ5 A;  2D4I A;  1NBY C;  3ULR A;  2HED A;  4PJZ A;  1UIF A;  120L A;  1L35 A;  197L A;  4LFP A;  256L A;  4TX7 A;  1NDG C;  1L17 A;  234L A;  104L A;  1OWZ A;  3EXD A;  1TAY A;  1LSF A;  2YVB A;  2Z37 A;  1L97 A;  4KL7 A;  3GXK A;  3WW5 A;  181L A;  2FYD A;  2D4K A;  3ATN A;  4H8Z A;  1UIA A;  149L A;  1VFB C;  1LZY A;  2BQM A;  1B5U A;  3RT5 X;  3ZVQ B;  4WL7 A;  5LXW A;  1L0K A;  1GXV 2;  1C45 A;  2HUL A;  4I7K A;  5KXO A;  183L A;  1HEN A;  135L A;  2YBJ A;  4H8Y A;  2NTH A;  1NDM C;  2HUK A;  2ZIK A;  4LYC A;  2F4G A;  1LSZ A;  1LI2 A;  3W6D A;  3AW6 A;  233L A;  1LJG A;  235L A;  1OYU A;  4NSI A;  1CUP A;  217L A;  1QS9 A;  1OVJ A;  1FDL Y;  4ZPU A;  5KXN A;  110L A;  1HEM A;  1CV4 A;  3A95 A;  1DQJ C;  1HEQ A;  4G49 A;  1B6I A;  4C5F A;  172L A;  1AT6 A;  1VED A;  1AKI A;  4I0C A;  1UIE A;  3VWO A;  1CKG A;  250L A;  148L E;  3GUP A;  4LFX A;  4EKQ A;  1G0Q A;  4DJH A;  4OOT A;  4I7R A;  4QY9 A;  1L93 A;  1QIO A;  1WTM A;  3EO5 A;  5D5C A;  3A93 A;  1ZWN A;  1QS5 A;  3GUN A;  1GE0 A;  1TBY A;  4NGV A;  1HNL A;  257L A;  1LYG A;  1VDQ A;  1LW9 A;  5LVH A;  3DN6 A;  4GN4 A;  1IEE A;  1P36 A;  4XJF A;  1LYZ A;  1KW7 A;  1QUS A;  3P68 A;  1L52 A;  4BAD A;  4ETA A;  3DMV A;  2HUM A;  4QDN A;  1QT5 A;  193L A;  4EKP A;  142L A;  3GUI A;  2B74 A;  1C6C A;  192L A;  137L A;  4W55 A;  4AGA A;  5LYZ A;  1XGU C;  4TUN A;  1CKF A;  1ALC A;  3FA0 A;  1DXJ A;  4NGY A;  4TSC A;  2AUB A;  3CT0 A;  1LZD A;  3SN6 R;  3BKH A;  3IJU A;  4B49 A;  1IO5 A;  232L A;  171L A;  1L27 A;  2YBM A;  3RW8 A;  3HT9 A;  1KXY A;  2HU1 A;  1D0K A;  2CUU A;  3AZ7 A;  1P37 A;  4ETB A;  2IGC A;  1QT7 A;  2O79 A;  1AZF A;  3F6Z A;  2HEF A;  5ILC A;  4P2E A;  4TSB A;  1YRO A;  4BAP A;  2RAY X;  150L A;  1DI5 A;  5HNL A;  1L87 A;  1P2C C;  3HH4 A;  4I7L A;  1L55 A;  1LSG A;  1PQI A;  2CWI A;  3FI7 A;  3A92 A;  2DQA A;  1I20 A;  182L A;  3GUJ A;  146L A;  2YDG A;  7LZM A;  1XGT C;  5DM9 A;  1L71 A;  1JIY A;  1LHI A;  2ANX A;  4LDL A;  1O23 A;  5L9J A;  4XAD A;  1C6H A;  1PQJ A;  3TXI A;  4NSJ A;  201L A;  2MED A;  1F6R A;  133L A;  4GCC A;  1GXX A;  1T8F A;  2OE4 X;  3W3E A;  3WYH A;  1LI6 A;  3HT7 A;  5LYT A;  1OUD A;  5B05 A;  4WLT A;  4LZT A;  167L A;  2EPE A;  4XJG A;  254L A;  1DYB A;  1OUA A;  5KY1 A;  1B9O A;  3HT8 A;  1F6S A;  4LYO A;  2OE7 X;  6LYZ A;  4H9E A;  1LHH A;  3A8Z A;  4LYZ A;  1KIP C;  1Z55 A;  3WPL A;  1C6A A;  1OV7 A;  1P6Y A;  1LYS A;  1IY3 A;  1CJ9 A;  1LZ5 A;  1P64 A;  4C3W A;  5B06 A;  3AZ6 A;  2ZIL A;  3C7Y A;  4Z98 A;  4H1P A;  211L A;  2RBO A;  1L40 A;  4FDY A;  5LAG A;  170L A;  210L A;  1RJC B;  1GBZ A;  119L A;  1LMT A;  2LYM A;  5LA8 A;  1D3M A;  1GFT A;  5JEN B;  3CSR A;  1LJE A;  191L A;  1IP3 A;  4AXT A;  1L19 A;  4R0F A;  1LKR A;  3WUA A;  1OUB A;  1GFV A;  1L58 A;  3RU5 A;  2MEB A;  2I26 L;  4WG1 A;  1L84 A;  1L76 A;  5F9U A;  212L A;  3TMV A;  4NGZ A;  1YKX X;  3C83 A;  1BB4 A;  1IOC A;  231L A;  115L A;  2XTH A;  3CDT A;  4NEB A;  1QT8 A;  3TMX A;  1W6Z A;  4B4J A;  4IAT A;  1BB5 A;  205L A;  1CNS A;  1C6F A;  2YSS C;  4ZFP A;  1IWY A;  2MEI A;  164L A;  4D9Z A;  2W1M A;  1OV5 A;  131L A;  5KXL A;  1UBZ A;  2BQL A;  1CJ6 A;  3RUN A;  1L54 A;  1RI8 B;  4WM2 A;  1GWD A;  4N1E I;  1GEV A;  206L A;  1GBS A;  4NFV A;  1L51 A;  4ARJ A;  4EJ4 A;  3SB8 A;  1L69 A;  1UCO A;  4E3U A;  2Z2F A;  3CDR A;  1OUI A;  3SBB C;  262L A;  2F32 A;  2B5Z A;  3QNG A;  4YXA C;  1OUF A;  1IWV A;  1LMQ A;  1JSF A;  3A90 A;  1QT4 A;  5KXK A;  1LSA A;  2O7A A;  1LJI A;  1WQR A;  3M3U A;  1YIL A;  1REZ A;  132L A;  1FBI X;  2LZT A;  1T6V L;  3W6E A;  1L85 A;  1LLH A;  2RB1 X;  1UUZ C;  2N5Z A;  5LA5 A;  227L A;  2F2N A;  4PPO A;  4LGK A;  4HJZ A;  4PGJ B;  1XGR C;  2MEH A;  3HTB A;  102L A;  4DC4 A;  1INU A;  3ZVQ A;  1K28 A;  3FAD A;  1VDP A;  195L A;  4U3X B;  180L A;  1L05 A;  5HNC A;  1QUO A;  4A7D A;  1LZ6 A;  1LZR A;  1I1Z A;  1LJH A;  1RCM A;  1P2L A;  2OU8 A;  1QDR A;  3HDE A;  4YEN A;  1DYD A;  4DYG A;  3ATO A;  1BVK C;  3A6C Y;  1D0M A;  208L A;  1TLA A;  1XGQ C;  2W1Y A;  1I56 A;  1GB5 A;  1F0W A;  1IP6 A;  1P46 A;  2B70 A;  1P2R A;  2FBB A;  1DI3 A;  230L A;  3HWL A;  3G3W A;  3SB7 A;  3DKE X;  1QTE A;  1XJU A;  2BQG A;  2O4W A;  3C80 A;  1GF0 A;  4WLY A;  1UIH A;  1L61 A;  1DKK A;  1WQP A;  1B7O A;  1P7S A;  3HH3 A;  2B72 A;  5HMJ A;  242L A;  1WTN A;  147L A;  4L41 A;  4RLN A;  3WVX A;  207L A;  4H94 A;  1L89 A;  5FDJ A;  5FST A;  2LCB A;  3WXT A;  1PQM A;  2IFF Y;  1HF4 A;  1L48 A;  200L A;  140L A;  1IOS A;  1GF5 A;  145L A;  1L49 A;  1GFE A;  3AZ4 A;  4OWA A;  5LIN A;  1L88 A;  218L A;  4ETD A;  255L A;  1W08 A;  4HV1 A;  4M4O A;  258L A;  1KXW A;  1ZVH L;  1TEW A;  1CX6 A;  3EML A;  5KXS A;  3WVY A;  3TXF A;  4YEO A;  5APD A;  1LZ4 A;  4WO9 A;  2D4J A;  4HJV A;  160L A;  2EIZ C;  144L A;  4EKR A;  108L A;  3G3A B;  3WPJ A;  4RLM A;  2BQK A;  2B6T A;  3JR6 A;  187L A;  4IAP A;  1LSB A;  159L A;  185L A;  1IP5 A;  173L A;  1L60 A;  1YKZ X;  1QSB A;  1JTM A;  4CHX A;  3G3B B;  1L67 A;  1L37 A;  1SLY A;  2CGI A;  1D2W A;  1SSY A;  4QGZ A;  5DN5 A;  2A4T A;  1LJK A;  1V7T A;  2YBH A;  3T6U A;  215L A;  4DDB A;  2Y8P A;  4WM5 A;  1YQV Y;  3L2X A;  1G0J A;  1GBY A;  5FEK A;  1JWR A;  1C6M A;  225L A;  1D6P A;  1N4F A;  1LKS A;  2OTZ X;  4J1A A;  2DQD Y;  1VAT A;  1GB6 A;  1T8G A;  1CV0 A;  236L A;  1LHK A;  1L00 A;  1B7Q A;  1FKV A;  1PQO A;  3C7W A;  1LYJ A;  3SP3 A;  1L34 A;  1UAC Y;  1NF5 A;  1PZY A;  1LPY A;  1L33 A;  239L A;  3RZ4 A;  4NHI A;  1LYH A;  5LYM A;  5L3I A;  151L A;  4NGO A;  1LSC A;  2EKS C;  2OE9 X;  4I7O A;  3ZEK A;  3TXB A;  1LYI A;  1L02 A;  2BQE A;  1IC5 Y;  3PDS A;  3BKV A;  5KXR A;  3CDV A;  4K5Y A;  1L70 A;  1LMP A;  1L81 A;  1FN5 A;  1GBX A;  4I7N A;  4W94 A;  3C8Q A;  5I5Q A;  3G3V A;  1GB2 A;  5KXP A;  2HUB A;  3FI5 A;  1GFK A;  5KJ9 A;  4XJI A;  2Q9D A;  3LN2 A;  214L A;  1LZE A;  1CU0 A;  4FJR A;  1IP2 A;  8LYZ A;  2L78 A;  1OUH A;  1GF6 A;  4W59 A;  3DN1 A;  1L44 A;  4PK0 A;  1SX7 A;  1XEI A;  3SB9 A;  3DNA A;  4G9S A;  2OU0 X;  3CQL A;  4ARP A;  109L A;  4NGK A;  1LYO A;  4DAJ A;  4LT3 A;  5IDD A;  1ZV5 L;  4GBR B;  1L31 A;  1L62 A;  1VDT A;  4NHQ A;  3OE6 A;  2FYC A;  198L A;  1JJ0 A;  4LT0 A;  3WPK A;  4G4B A;  1GHL A;  1GE1 A;  4OWB A;  153L A;  1L65 A;  1L72 A;  1L45 A;  1L46 A;  1C66 A;  1B5V A;  4G4C A;  3VW7 A;  1L39 A;  1WVU A;  1FLU A;  3P64 A;  1L07 A;  243L A;  1GEZ A;  3AW7 A;  2D91 A;  4W96 A;  4B1A A;  5KXZ A;  1GF3 A;  3A6B Y;  1TCY A;  5APC A;  1L96 A;  2F30 A;  1ZMY L;  4HPE A;  3C8R A;  1GFH A;  128L A;  3DMX A;  2B6Z A;  1IP1 A; 
#chains in the Genus database with same CATH homology
 1EQE A;  4NG1 A;  4RW1 A;  1L06 A;  1DYC A;  4QEQ A;  2A7D A;  189L A;  1YKY X;  1PQD A;  3E3D A;  5B07 A;  1OP9 B;  4ARM B;  3OE0 A;  1L04 A;  2MEF A;  1OQM A;  1QUH A;  1UID A;  4XEN A;  1L22 A;  1DPX A;  221L A;  3B0O A;  1JTO L;  228L A;  1LZB A;  122L A;  3OJP A;  2RSC A;  1L11 A;  161L A;  1GE2 A;  1L73 A;  1OUJ A;  1QTZ A;  174L A;  4W54 A;  1HFZ A;  2RBN A;  3SB5 A;  4J0L A;  1LHL A;  222L A;  4NGI A;  1L30 A;  4X3B A;  1QTB A;  2BLY A;  2ZWB A;  4W51 A;  5DL9 A;  1OWY A;  3C81 A;  1KIR C;  4H9B A;  1LI3 A;  2B6Y A;  1P5C A;  4HP0 A;  2Z18 A;  4NGJ A;  3HFM Y;  1IC7 Y;  112L A;  1QT3 A;  1BWJ A;  5AMY A;  2G4P A;  1IWT A;  1D3J A;  223L A;  5IHG A;  259L A;  1C6N A;  2RB0 X;  1L91 A;  1LCN A;  1PQK A;  1QQY A;  2DQJ Y;  1XSF A;  4DDA A;  2CDS A;  2RAZ X;  1L59 A;  2RBQ A;  3M18 B;  1GB8 A;  2DQE Y;  1L94 A;  3HTD A;  2A7F A;  3CDO A;  1L15 A;  1NWG A;  1YL1 X;  3LZT A;  2MEA A;  1V7S A;  4RDS A;  4NIJ A;  4PRU A;  3DN2 A;  4LZM A;  1L74 A;  1A2Y C;  1JQU A;  1IVM A;  1LGW A;  4GCD A;  3AGI A;  4G4H A;  3AJN A;  1KS3 A;  3GUL A;  2IHL A;  1REY A;  1GAY A;  1L36 A;  4CFO A;  2Z38 A;  1CKD A;  1HFY A;  1RFP A;  1HSW A;  2D6B A;  6LYT A;  5I4W A;  1JEF A;  4ET9 A;  1L23 A;  4OW1 A;  4MR1 A;  2BQC A;  3GUM A;  4ETC A;  1IY4 A;  4I7Q A;  118L A;  1C6T A;  1EPY A;  2RBR A;  3K2R A;  1GB3 A;  224L A;  4W56 A;  1J1P Y;  1B5Y A;  3W6B A;  1SQ2 L;  1SSW A;  3CT1 A;  2X0A A;  1C10 A;  1P56 A;  190L A;  3ODU A;  5KKI A;  4XYY A;  1IOT A;  4XJB A;  1KNI A;  4TTD A;  2RBP A;  2BQI A;  1OVH A;  2HEB A;  103L A;  1L13 A;  4GN5 C;  1BB7 A;  4ETE A;  4LDE A;  4ARQ B;  1UIG A;  1LYY A;  3N9C A;  1KXX A;  1QSA A;  1DYE A;  1B7P A;  3D9A C;  4NG8 A;  2YBN A;  1PS5 A;  4N9R A;  113L A;  4Z41 A;  1L47 A;  3P65 A;  4UWV A;  1HC0 A;  1GE4 A;  3HBD A;  3CB7 A;  1LSM A;  1LWG A;  1LTM A;  4LT1 A;  4W52 A;  3A3Q A;  1G0L A;  4NWH A;  2ZNX Y;  4HTQ A;  5LAF A;  1G06 A;  4DKL A;  1JTP L;  2G4N A;  4WL6 A;  1L99 A;  1UA6 Y;  4H9H A;  1B0D A;  5FCP A;  1L95 A;  4H90 A;  1GF9 A;  3D4S A;  260L A;  2BQB A;  1H87 A;  2B6X A;  1G07 A;  1FLY A;  3N9A A;  3NYA A;  1WTH A;  1CV3 A;  1UC0 A;  4ZEE A;  2H9J A;  1A4V A;  1D6Q A;  1L03 A;  4GCF A;  4S0W A;  3DN0 A;  5E9R A;  1C7P A;  2LZ2 A;  4DD9 A;  1LJN A;  4N5R A;  3HUA A;  1GFG A;  1J1X Y;  1B5Z A;  1NHB A;  2BAA A;  1L86 A;  213L A;  2QAR C;  2W1X A;  1CU3 A;  1LYE A;  1L32 A;  3TXD A;  3IJV A;  1CUQ A;  2HU3 A;  4NGL A;  2GV0 A;  1LAA A;  2RB2 X;  4PJ2 C;  184L A;  168L A;  1L77 A;  1C6Q A;  3MGW A;  1IIZ A;  1GB0 A;  2XBS A;  1LYD A;  1F10 A;  1G7J C;  4PRQ A;  3A34 A;  1QTD A;  2BPU A;  4NHP A;  1L63 A;  1YAP A;  1B5W A;  9LYZ A;  1I6S A;  1CJ8 A;  4LT2 A;  1LGX A;  3OK0 A;  1QTV A;  1L98 A;  1YL0 X;  2HEE A;  1L50 A;  2C8O A;  2B6W A;  1OUG A;  3HU9 A;  2ZNW Y;  244L A;  2PC2 A;  4EOF A;  4B4E A;  1EL1 A;  3DN3 A;  4WM4 A;  3DMZ A;  1GFR A;  5I4X A;  1LHJ A;  1LMN A;  1HER A;  1D3N A;  4EPF A;  5ILF A;  1GD6 A;  1HHL A;  1L90 A;  4CGE A;  4LYB A;  1GFJ A;  4DD0 A;  3UON A;  1LZT A;  3P66 A;  4XJH A;  4HJY A;  4UWU A;  1LPI A;  4II8 A;  3TMW A;  209L A;  1JUG A;  4OOO A;  1JKB A;  3GUK A;  1MLC E;  2Q9E A;  3B6L A;  1JJ1 A;  129L A;  219L A;  4GCE A;  1BB6 A;  4OWH A;  4ARM A;  1LGU A;  3AZ5 A;  1YAQ A;  1G7M C;  1L53 A;  1LYF A;  1LZG A;  4ET8 A;  5LIO A;  5J7C A;  1HEO A;  4I7T A;  4DQJ A;  1LZ1 A;  3HBH A;  5I14 A;  216L A;  1G7H C;  2LHM A;  1L83 A;  1C64 A;  3TXJ A;  1C46 A;  1C6D A;  1NBZ C;  4H93 A;  4NGW A;  3K3T A;  247L A;  4W58 A;  1B2K A;  1C6I A;  3KAM A;  1HMK A;  4H9F A;  1LHM A;  3TXH A;  165L A;  1D3F A;  1DYA A;  1XEK A;  3AYQ A;  1WQQ A;  1LZA A;  4WO6 A;  157L A;  1IR9 A;  3AGG G;  4WG7 A;  1VDS A;  3RNX A;  2LYO A;  5FHW A;  1XGP C;  4N1C C;  1DYG A;  3B0I A;  2YBL A;  3CSZ A;  141L A;  1B7S A;  1HEW A;  1L21 A;  1QT6 A;  1ZVY B;  2BQA A;  5K7O A;  1UIB A;  5B1G A;  1C62 A;  1CV6 A;  229L A;  1L14 A;  3GUO A;  253L A;  1REX A;  4UWN A;  3L64 A;  4EMN A;  1WQO A;  1LSP A;  2DQI Y;  2MEC A;  4EXM A;  1GDW A;  1BHZ A;  1VAU A;  3LZM A;  4HTN A;  126L A;  1HSX A;  4W53 A;  4EPI A;  1CKC A;  1G0G A;  1DPW A;  1SWZ A;  4R6C A;  1BVX A;  4WM1 A;  1IP4 A;  2C8P A;  4XJD A;  3V2Y A;  4CJ2 A;  1LSE A;  166L A;  3WU7 A;  5LZM A;  2Z2E A;  4DT3 A;  3AGH A;  2Z12 A;  1T6H A;  1L64 A;  5D5F A;  1IWW A;  1QUT A;  3SBA A;  1GF8 A;  1BB3 A;  1L26 A;  1GB7 A;  2DQF C;  1LJF A;  1T97 A;  1GFU A;  1NQI A;  5HLL A;  2Z39 A;  1L24 A;  4O34 A;  1B7R A;  1L01 A;  3A91 A;  3WU8 A;  2EQL A;  3CT5 A;  3EBA B;  2DQG Y;  5L3H A;  4I7P A;  1L10 A;  2BQH A;  3CSQ A;  2HEC A;  4EKS A;  1GBO A;  1GBW A;  3A67 Y;  3GXR A;  3LZ2 A;  194L A;  3WUM A;  1JKD A;  4GRV A;  3WH1 A;  3HBE X;  5KKJ A;  3LYM A;  4XN6 A;  3J4G A;  5LVG A;  5B59 A;  1P3N A;  3TMU A;  1NKH A;  1GPQ C;  4GLV A;  1AM7 A;  1JJ3 A;  4YF2 A;  1JHL A;  2Z6B A;  4AQN A;  156L A;  3EMS A;  3F8V A;  4I8S A;  163L A;  4ARQ A;  4YOP A;  3WUN A;  1FLW A;  1L92 A;  199L A;  1C6E A;  5IEL A;  1D9W A;  4HTK A;  4YM8 A;  1MEL L;  4ZIX A;  1C67 A;  1LMC A;  4WMG A;  2XQO A;  1C68 A;  4H8X A;  5B1F A;  1C6G A;  4Z46 A;  4I7J A;  1EQ4 A;  1QSW A;  4ANR A;  1JTT L;  2H9K A;  5KXX A;  1JIT A;  5A3E A;  1T8A A;  4H9C A;  3A96 A;  5C6J A;  2B75 A;  1E8L A;  4BS7 A;  3LHM A;  1QUG A;  1HML A;  237L A;  1LZ9 A;  2DQH Y;  2B7X A;  1B7M A;  4WM6 A;  2Z19 A;  107L A;  2RH1 A;  1IP7 A;  3IWR A;  2HTX A;  2MEG A;  2BQJ A;  5M1Y A;  1CKH A;  1J1O Y;  1JKC A;  1ZYT A;  1QSQ A;  1WQN A;  1DZB X;  138L A;  1L56 A;  3WMK A;  1L38 A;  4J7V A;  5KXM A;  3AB6 A;  1C43 A;  3QE8 A;  4WM3 A;  1L25 A;  4E97 A;  1BWI A;  4HSF A;  3WU9 A;  1IX0 A;  3HH5 A;  158L A;  4NY5 A;  1XJT A;  4DQ7 A;  1IR7 A;  252L A;  3WW6 A;  1B7L A;  1G0M A;  4GLA A;  261L A;  5F9X A;  5LVK A;  2LYZ A;  1C6L A;  1G7L C;  4DD1 A;  1KIQ C;  3T36 A;  1L79 A;  5KXY A;  3QY4 A;  1JTN A;  5T3F A;  2G4Q A;  2ZQ3 A;  1C6P A;  4Z3M A;  3V2W A;  1WQM A;  1GDX A;  1XFP L;  4ARL A;  1REM A;  1IOQ A;  249L A;  3OE9 A;  3HTG A;  3P4Z A;  1JIS A;  220L A;  1JSE A;  1LSN A;  3A94 A;  4RW2 A;  2ZIJ A;  4H9A A;  1HEL A;  3WL2 A;  3C7Z A;  1T3P A;  4NWE A;  1YAM A;  4WOA A;  1QTK A;  2BQD A;  1L68 A;  1JKA A;  1IR8 A;  162L A;  3C8S A;  7LYZ A;  3NY9 A;  2ZYP A;  1LZC A;  1L18 A;  3QAK A;  3LYO A;  2RBS A;  246L A;  1L43 A;  1QUD A;  1KW5 A;  4M6D A;  3W6A A;  2OEA X;  5C6L A;  6LZM A;  248L A;  3LYZ A;  4YXC A;  175L A;  154L A;  1G0P A;  4KXI A;  2YBI A;  2W1L A;  5F81 A;  169L A;  4W57 A;  1L16 A;  4OWC A;  1IWU A;  5F16 A;  4NSH A;  4DD7 A;  1GAZ A;  127L A;  1RE2 A;  3W6F A;  3B72 A;  1YAN A;  4TWS A;  1G1W A;  5I54 A;  177L A;  1GF7 A;  2QB0 B;  155L A;  1L82 A;  4WLX A;  2OU9 A;  3DN4 A;  1CV5 A;  5II3 A;  2FBD A;  5E4P A;  4DD2 A;  3NY8 A;  1LSY A;  4GN3 A;  4IJ4 A;  3G3X A;  1QTC A;  1LZN A;  1C69 A;  2ZYC A;  1IOR A;  2XJW A;  1C6K A;  4H9I A;  5LVJ A;  1CU2 A;  1BWH A;  1L42 A;  4J1B A;  3RZE A;  1NMM A;  5I4Y A;  1OUE A;  1UIC A;  3LYT A;  4I7M A;  240L A;  2ZQ4 A;  1HEP A;  2XBR A;  1L08 A;  4DD3 A;  2BQN A;  3HH6 A;  1ZUR A;  4KPM A;  2MEE A;  4LDO A;  1IWZ A;  1YIK A;  4CFP A;  226L A;  5EBH A;  238L A;  1QTH A;  5HQ1 A;  188L A;  5APF A;  4OO9 A;  2BQF A;  5KXW A;  3DN8 A;  1BQL Y;  1CV1 A;  2LC9 A;  1B5X A;  5I53 A;  3SB6 A;  1KY0 A;  4LYM A;  1TDY A;  1CU6 A;  1D0L A;  1DI4 A;  4BAF A;  2Q0M X;  134L A;  4HV2 A;  3HTF A;  3WXU A;  4YEM A;  1LJJ A;  1LSD A;  1GB9 A;  1D2Y A;  139L A;  5LVI A;  1C60 A;  1C08 C;  2NWD X;  2F2Q A;  1GF4 A;  2NTG A;  1DKJ A;  1L75 A;  1EQ5 A;  4B4I A;  1XEJ A;  1FLQ A;  1L66 A;  1DYF A;  5F14 A;  1C6B A;  1LWK A;  1G1V A;  2H5Z A;  4H91 A;  3HUK A;  3W6C A;  143L A;  5KXT A;  1YAO A;  1L09 A;  1JPO A;  1XEP A;  4WLD A;  5DN4 A;  1C63 A;  4KT3 A;  1FKQ A;  1SX2 A;  4NSG A;  1OVK A;  2I25 L;  1G7I C;  1C65 A;  4NHT A;  2ANV A;  1B7N A;  2DKV A;  1L20 A;  1C6J A;  1KY1 A;  1GE3 A;  1WVV A;  4GCB A;  4I7S A;  245L A;  3J6K A;  4OWE A;  1L80 A;  130L A;  1LJ4 A;  1QDT A;  3CDQ A;  1L28 A;  1IC4 Y;  2CJL A;  2B73 A;  1OUC A;  1LMO A;  1L41 A;  1GFA A;  1L12 A;  3HT6 A;  114L A;  176L A;  3A3R X;  5APE A;  2OTY X;  2DQC Y;  5DLA A;  3OE8 A;  1C61 A;  3F9L A;  196L A;  1LZ8 A;  2F4A A;  5A3Z A;  123L A;  1G0K A;  1LZS A;  2BLX A;  152L A;  2DBT A;  4NHS A;  4YX7 C;  2VB1 A;  4PHI A;  3WUL A;  1D9U A;  3TXG A;  1HFX A;  4ML7 A;  241L A;  2LZM A;  1LOZ A;  251L A;  4HPI A;  111L A;  2WAR A;  2I6Z A;  4H92 A;  3TXK A;  1CVK A;  4DDC A;  3HDF A;  4IAS A;  178L A;  2HEA A;  3C82 A;  4N8Z A;  1CTW A;  1CJ7 A;  4B0D A;  3B0K A;  1L0J A;  5FEL A;  3HU8 A;  1BGI A;  1IWX A;  4MCK A;  1SWY A;  5HMV A;  1LMA A;  3N9E A;  1H6M A;  3TXE A;  4MST A;  3HUQ A;  1CX7 A;  1NHE A;  4N0J A;  4DWX A;  125L A;  3FE0 A;  1CU5 A;  4LYT A;  1AT5 A;  1LJ3 A;  3D3D A;  2BQO A;  2F47 A;  186L A;  1L29 A;  1L57 A;  3PBL A;  5C6I A;  4DQ5 A;  2D4I A;  1NBY C;  3ULR A;  2HED A;  4PJZ A;  1UIF A;  120L A;  1L35 A;  197L A;  4LFP A;  256L A;  4TX7 A;  1NDG C;  1L17 A;  234L A;  104L A;  1OWZ A;  3EXD A;  1TAY A;  1LSF A;  2YVB A;  2Z37 A;  1L97 A;  4KL7 A;  3GXK A;  3WW5 A;  181L A;  2FYD A;  2D4K A;  3ATN A;  4H8Z A;  1UIA A;  149L A;  1VFB C;  1LZY A;  2BQM A;  1B5U A;  3RT5 X;  3ZVQ B;  4WL7 A;  5LXW A;  1L0K A;  1GXV 2;  1C45 A;  2HUL A;  4I7K A;  5KXO A;  183L A;  1HEN A;  135L A;  2YBJ A;  4H8Y A;  2NTH A;  1NDM C;  2HUK A;  2ZIK A;  4LYC A;  2F4G A;  1LSZ A;  1LI2 A;  3W6D A;  3AW6 A;  233L A;  1LJG A;  235L A;  1OYU A;  4NSI A;  1CUP A;  217L A;  1QS9 A;  1OVJ A;  1FDL Y;  4ZPU A;  5KXN A;  110L A;  1HEM A;  1CV4 A;  3A95 A;  1DQJ C;  1HEQ A;  4G49 A;  1B6I A;  4C5F A;  172L A;  1AT6 A;  1VED A;  1AKI A;  4I0C A;  1UIE A;  3VWO A;  1CKG A;  250L A;  148L E;  3GUP A;  4LFX A;  4EKQ A;  1G0Q A;  4DJH A;  4OOT A;  4I7R A;  4QY9 A;  1L93 A;  1QIO A;  1WTM A;  3EO5 A;  5D5C A;  3A93 A;  1ZWN A;  1QS5 A;  3GUN A;  1GE0 A;  1TBY A;  4NGV A;  1HNL A;  257L A;  1LYG A;  1VDQ A;  1LW9 A;  5LVH A;  3DN6 A;  4GN4 A;  1IEE A;  1P36 A;  4XJF A;  1LYZ A;  1KW7 A;  1QUS A;  3P68 A;  1L52 A;  4BAD A;  4ETA A;  3DMV A;  2HUM A;  4QDN A;  1QT5 A;  193L A;  4EKP A;  142L A;  3GUI A;  2B74 A;  1C6C A;  192L A;  137L A;  4W55 A;  4AGA A;  5LYZ A;  1XGU C;  4TUN A;  1CKF A;  1ALC A;  3FA0 A;  1DXJ A;  4NGY A;  4TSC A;  2AUB A;  3CT0 A;  1LZD A;  3SN6 R;  3BKH A;  3IJU A;  4B49 A;  1IO5 A;  232L A;  171L A;  1L27 A;  2YBM A;  3RW8 A;  3HT9 A;  1KXY A;  2HU1 A;  1D0K A;  2CUU A;  3AZ7 A;  1P37 A;  4ETB A;  2IGC A;  1QT7 A;  2O79 A;  1AZF A;  3F6Z A;  2HEF A;  5ILC A;  4P2E A;  4TSB A;  1YRO A;  4BAP A;  2RAY X;  150L A;  1DI5 A;  5HNL A;  1L87 A;  1P2C C;  3HH4 A;  4I7L A;  1L55 A;  1LSG A;  1PQI A;  2CWI A;  3FI7 A;  3A92 A;  2DQA A;  1I20 A;  182L A;  3GUJ A;  146L A;  2YDG A;  7LZM A;  1XGT C;  5DM9 A;  1L71 A;  1JIY A;  1LHI A;  2ANX A;  4LDL A;  1O23 A;  5L9J A;  4XAD A;  1C6H A;  1PQJ A;  3TXI A;  4NSJ A;  201L A;  2MED A;  1F6R A;  133L A;  4GCC A;  1GXX A;  1T8F A;  2OE4 X;  3W3E A;  3WYH A;  1LI6 A;  3HT7 A;  5LYT A;  1OUD A;  5B05 A;  4WLT A;  4LZT A;  167L A;  2EPE A;  4XJG A;  254L A;  1DYB A;  1OUA A;  5KY1 A;  1B9O A;  3HT8 A;  1F6S A;  4LYO A;  2OE7 X;  6LYZ A;  4H9E A;  1LHH A;  3A8Z A;  4LYZ A;  1KIP C;  1Z55 A;  3WPL A;  1C6A A;  1OV7 A;  1P6Y A;  1LYS A;  1IY3 A;  1CJ9 A;  1LZ5 A;  1P64 A;  4C3W A;  5B06 A;  3AZ6 A;  2ZIL A;  3C7Y A;  4Z98 A;  4H1P A;  211L A;  2RBO A;  1L40 A;  4FDY A;  5LAG A;  170L A;  210L A;  1RJC B;  1GBZ A;  119L A;  1LMT A;  2LYM A;  5LA8 A;  1D3M A;  1GFT A;  5JEN B;  3CSR A;  1LJE A;  191L A;  1IP3 A;  4AXT A;  1L19 A;  4R0F A;  1LKR A;  3WUA A;  1OUB A;  1GFV A;  1L58 A;  3RU5 A;  2MEB A;  2I26 L;  4WG1 A;  1L84 A;  1L76 A;  5F9U A;  212L A;  3TMV A;  4NGZ A;  1YKX X;  3C83 A;  1BB4 A;  1IOC A;  231L A;  115L A;  2XTH A;  3CDT A;  4NEB A;  1QT8 A;  3TMX A;  1W6Z A;  4B4J A;  4IAT A;  1BB5 A;  205L A;  1CNS A;  1C6F A;  2YSS C;  4ZFP A;  1IWY A;  2MEI A;  164L A;  4D9Z A;  2W1M A;  1OV5 A;  131L A;  5KXL A;  1UBZ A;  2BQL A;  1CJ6 A;  3RUN A;  1L54 A;  1RI8 B;  4WM2 A;  1GWD A;  4N1E I;  1GEV A;  206L A;  1GBS A;  4NFV A;  1L51 A;  4ARJ A;  4EJ4 A;  3SB8 A;  1L69 A;  1UCO A;  4E3U A;  2Z2F A;  3CDR A;  1OUI A;  3SBB C;  262L A;  2F32 A;  2B5Z A;  3QNG A;  4YXA C;  1OUF A;  1IWV A;  1LMQ A;  1JSF A;  3A90 A;  1QT4 A;  5KXK A;  1LSA A;  2O7A A;  1LJI A;  1WQR A;  3M3U A;  1YIL A;  1REZ A;  132L A;  1FBI X;  2LZT A;  1T6V L;  3W6E A;  1L85 A;  1LLH A;  2RB1 X;  1UUZ C;  2N5Z A;  5LA5 A;  227L A;  2F2N A;  4PPO A;  4LGK A;  4HJZ A;  4PGJ B;  1XGR C;  2MEH A;  3HTB A;  102L A;  4DC4 A;  1INU A;  3ZVQ A;  1K28 A;  3FAD A;  1VDP A;  195L A;  4U3X B;  180L A;  1L05 A;  5HNC A;  1QUO A;  4A7D A;  1LZ6 A;  1LZR A;  1I1Z A;  1LJH A;  1RCM A;  1P2L A;  2OU8 A;  1QDR A;  3HDE A;  4YEN A;  1DYD A;  4DYG A;  3ATO A;  1BVK C;  3A6C Y;  1D0M A;  208L A;  1TLA A;  1XGQ C;  2W1Y A;  1I56 A;  1GB5 A;  1F0W A;  1IP6 A;  1P46 A;  2B70 A;  1P2R A;  2FBB A;  1DI3 A;  230L A;  3HWL A;  3G3W A;  3SB7 A;  3DKE X;  1QTE A;  1XJU A;  2BQG A;  2O4W A;  3C80 A;  1GF0 A;  4WLY A;  1UIH A;  1L61 A;  1DKK A;  1WQP A;  1B7O A;  1P7S A;  3HH3 A;  2B72 A;  5HMJ A;  242L A;  1WTN A;  147L A;  4L41 A;  4RLN A;  3WVX A;  207L A;  4H94 A;  1L89 A;  5FDJ A;  5FST A;  2LCB A;  3WXT A;  1PQM A;  2IFF Y;  1HF4 A;  1L48 A;  200L A;  140L A;  1IOS A;  1GF5 A;  145L A;  1L49 A;  1GFE A;  3AZ4 A;  4OWA A;  5LIN A;  1L88 A;  218L A;  4ETD A;  255L A;  1W08 A;  4HV1 A;  4M4O A;  258L A;  1KXW A;  1ZVH L;  1TEW A;  1CX6 A;  3EML A;  5KXS A;  3WVY A;  3TXF A;  4YEO A;  5APD A;  1LZ4 A;  4WO9 A;  2D4J A;  4HJV A;  160L A;  2EIZ C;  144L A;  4EKR A;  108L A;  3G3A B;  3WPJ A;  4RLM A;  2BQK A;  2B6T A;  3JR6 A;  187L A;  4IAP A;  1LSB A;  159L A;  185L A;  1IP5 A;  173L A;  1L60 A;  1YKZ X;  1QSB A;  1JTM A;  4CHX A;  3G3B B;  1L67 A;  1L37 A;  1SLY A;  2CGI A;  1D2W A;  1SSY A;  4QGZ A;  5DN5 A;  2A4T A;  1LJK A;  1V7T A;  2YBH A;  3T6U A;  215L A;  4DDB A;  2Y8P A;  4WM5 A;  1YQV Y;  3L2X A;  1G0J A;  1GBY A;  5FEK A;  1JWR A;  1C6M A;  225L A;  1D6P A;  1N4F A;  1LKS A;  2OTZ X;  4J1A A;  2DQD Y;  1VAT A;  1GB6 A;  1T8G A;  1CV0 A;  236L A;  1LHK A;  1L00 A;  1B7Q A;  1FKV A;  1PQO A;  3C7W A;  1LYJ A;  3SP3 A;  1L34 A;  1UAC Y;  1NF5 A;  1PZY A;  1LPY A;  1L33 A;  239L A;  3RZ4 A;  4NHI A;  1LYH A;  5LYM A;  5L3I A;  151L A;  4NGO A;  1LSC A;  2EKS C;  2OE9 X;  4I7O A;  3ZEK A;  3TXB A;  1LYI A;  1L02 A;  2BQE A;  1IC5 Y;  3PDS A;  3BKV A;  5KXR A;  3CDV A;  4K5Y A;  1L70 A;  1LMP A;  1L81 A;  1FN5 A;  1GBX A;  4I7N A;  4W94 A;  3C8Q A;  5I5Q A;  3G3V A;  1GB2 A;  5KXP A;  2HUB A;  3FI5 A;  1GFK A;  5KJ9 A;  4XJI A;  2Q9D A;  3LN2 A;  214L A;  1LZE A;  1CU0 A;  4FJR A;  1IP2 A;  8LYZ A;  2L78 A;  1OUH A;  1GF6 A;  4W59 A;  3DN1 A;  1L44 A;  4PK0 A;  1SX7 A;  1XEI A;  3SB9 A;  3DNA A;  4G9S A;  2OU0 X;  3CQL A;  4ARP A;  109L A;  4NGK A;  1LYO A;  4DAJ A;  4LT3 A;  5IDD A;  1ZV5 L;  4GBR B;  1L31 A;  1L62 A;  1VDT A;  4NHQ A;  3OE6 A;  2FYC A;  198L A;  1JJ0 A;  4LT0 A;  3WPK A;  4G4B A;  1GHL A;  1GE1 A;  4OWB A;  153L A;  1L65 A;  1L72 A;  1L45 A;  1L46 A;  1C66 A;  1B5V A;  4G4C A;  3VW7 A;  1L39 A;  1WVU A;  1FLU A;  3P64 A;  1L07 A;  243L A;  1GEZ A;  3AW7 A;  2D91 A;  4W96 A;  4B1A A;  5KXZ A;  1GF3 A;  3A6B Y;  1TCY A;  5APC A;  1L96 A;  2F30 A;  1ZMY L;  4HPE A;  3C8R A;  1GFH A;  128L A;  3DMX A;  2B6Z A;  1IP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...