2IHLA

Lysozyme (e.c.3.2.1.17) (japanese quail)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
129
structure length
129
Chain Sequence
KVYGRCELAAAMKRHGLDKYQGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDVHGMNAWVAWRNRCKGTDVNAWIRGCRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords JAPANESE QUAIL EGG WHITE LYSOZYME
publication title Three-dimensional structure of a heteroclitic antigen-antibody cross-reaction complex.
pubmed doi rcsb
source organism Coturnix japonica
total genus 46
structure length 129
sequence length 129
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 1993-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00062 Lys C-type lysozyme/alpha-lactalbumin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 2ihlA00
4WM1A 1AZFA 1GFVA 1CKDA 4DC4A 4X3BA 1IP6A 1LZAA 1GD6A 1UIHA 1XEKA 1XFPL 2YBMA 3A94A 2F4AA 1BB7A 1LMPA 4RW2A 4J7VA 1GF7A 5T3FA 1RCMA 2BQJA 4NSJA 1GB7A 4TTDA 4YM8A 4CGEA 2EIZC 1JJ3A 2AUBA 2DQGY 3GXKA 1HFXA 3LHMA 5KXRA 4ZEEA 5B07A 1LHKA 1LHLA 4TSBA 4ETCA 2BQIA 1LJ3A 1XGQC 4WLYA 1HELA 1JPOA 3M18B 2LZ2A 1LZ5A 3D3DA 5KXLA 2Z18A 5KXWA 5L9JA 1BQLY 1DI4A 1G7IC 1H87A 3HBDA 4G49A 4NGWA 3TXIA 4DD1A 5ILFA 4GN4A 3KAMA 1JSEA 4NY5A 1IP4A 2RSCA 4HJZA 2BQLA 1IC7Y 3EO5A 4U3XB 5I4YA 2BQGA 4XJHA 1ZMYL 1FKVA 1REMA 1J1PY 1BVXA 1LZCA 3N9CA 3QY4A 5I4WA 2XJWA 1WQMA 1T3PA 4QDNA 1B7QA 1GHLA 4RLMA 4WM2A 3WUAA 3P65A 4PGJB 3WXTA 1GB5A 3A67Y 4NSHA 1GF3A 1GBZA 4UWNA 4AGAA 1JIYA 3CSZA 3WVXA 4WG1A 1D9UA 5F9UA 1OUJA 1LHJA 1LZEA 1LZ9A 1B5WA 4H9IA 4ML7A 3B0IA 1GFGA 3WUMA 1B5YA 1JISA 1KIRC 1HHLA 2N5ZA 132LA 1SQ2L 1GBOA 1LZYA 1GB6A 2VB1A 1OP9B 2ZWBA 1YL1X 1VAUA 4LZTA 5KXPA 1JUGA 2XBRA 4TX7A 1JITA 3ZVQB 4QEQA 4DD3A 4BADA 1WVUA 3W3EA 1GB9A 4B4IA 5E4PA 4NGVA 2CDSA 1UA6Y 1BB3A 1QUSA 1GEVA 1GBXA 4GCCA 4NGZA 1LSBA 1OUDA 1EQEA 1LJKA 1C45A 1BWHA 1F6RA 4WG7A 1IR9A 1JTOL 1G7JC 1BB6A 1WVVA 5LA8A 3CB7A 4J0LA 3D9AC 4Z41A 1I20A 5L3HA 1J1XY 5B05A 1IO5A 4XYYA 4H91A 193LA 2LYOA 1NDMC 4H8ZA 5DL9A 1LMQA 1YANA 3W6FA 4H9HA 2Z2FA 1MLCE 2MEGA 4XN6A 5B06A 1OUBA 1JKBA 4DD0A 5DM9A 3A8ZA 3GXRA 1GB8A 1O23A 1FDLY 1LJFA 1GFRA 1V7SA 3AYQA 3WH1A 1UCOA 154LA 3TXJA 1HF4A 3G3BB 3OJPA 4WLDA 1XEIA 2D6BA 2DQCY 4H9BA 4XJBA 4Z46A 3LYZA 3AZ7A 1DZBX 4BAFA 1VDSA 4NHPA 5FELA 1IWYA 4H94A 3TMUA 5I4XA 1LYOA 1VDQA 1DKJA 4G4BA 1IEEA 2I25L 4W94A 1CKHA 3QNGA 1GE0A 1GXV2 5I5QA 1GF4A 4ANRA 5HMVA 1VATA 2W1YA 1D0LA 2BQKA 1BWJA 1Z55A 1GE2A 1YL0X 1FLYA 3A90A 1LZ8A 4NEBA 1AKIA 1DPWA 1B5UA 4GCDA 1HEWA 1BHZA 1LAAA 2HEBA 5IDDA 3WW6A 4DD7A 1D6QA 1HMKA 2ZIKA 4GLVA 4WOAA 1HMLA 2BLYA 3OK0A 5LIOA 5LVKA 4NIJA 1YAQA 2DQFC 3RW8A 2H9JA 5C6LA 1YIKA 1LPIA 4MR1A 5APEA 1IR7A 1LSEA 4LT1A 2Z19A 4H92A 2DQEY 1BB4A 1C7PA 1HENA 1LSPA 1QQYA 4NGJA 1C46A 4ETEA 2ZNWY 1OUHA 3AJNA 4GCFA 4W96A 1GB0A 3A91A 2HECA 3B0KA 5HQ1A 1IWXA 1GDWA 2BQOA 1FLUA 1HSWA 1GBYA 3CSQA 4DDCA 1HEPA 4HTNA 1GE1A 2BLXA 3RU5A 1KIPC 3BKHA 1LOZA 1YQVY 6LYZA 3LZTA 3M3UA 2XTHA 3TXFA 5KKJA 1IVMA 5C6IA 1DI5A 1RI8B 1VDTA 3J6KA 4GCEA 1GFEA 2BPUA 4B0DA 4N9RA 5A3ZA 2DQHY 3HBEX 2YDGA 3TMWA 3ULRA 4MSTA 1GF6A 1YILA 2DKVA 4BAPA 4UWVA 5HLLA 1LYZA 2W1XA 3BKVA 1OQMA 4WLTA 4NHSA 3W6CA 1BGIA 1FLQA 1GF0A 4M6DA 4CHXA 2EKSC 2BQHA 1JTTL 2MEHA 2W1MA 4NHIA 4AXTA 5APFA 3WXUA 1JTPL 1LSCA 2W1LA 2GV0A 4FDYA 1F10A 1A2YC 4H8YA 4NGLA 4NG8A 9LYZA 5D5FA 4D9ZA 4N1CC 1RE2A 1F6SA 3EBAB 4EMNA 1JJ0A 1DPXA 1IX0A 1B5XA 4HPEA 1IR8A 5LAGA 3AGIA 1YAOA 3LYTA 1T6VL 1W6ZA 2I26L 4CFPA 4G4CA 1VFBC 2FYDA 5KY1A 1OUEA 3MGWA 4PRUA 1OUAA 1GFUA 3WUNA 3EXDA 4HTQA 1TCYA 2DQIY 2MEBA 2Z37A 3WW5A 1H6MA 1UIBA 4G9SA 2Z38A 2D91A 4H93A 4B4JA 1TEWA 1EL1A 1WTNA 1LJIA 4PJ2C 3W6AA 1QSWA 5K7OA 2HEAA 1AT5A 1IP1A 1LSAA 2DBTA 4LFXA 1PZYA 1GAZA 4KPMA 5E9RA 5F14A 1ALCA 1HEOA 1WQQA 3CT5A 3AZ4A 1IOSA 2FBBA 4LT3A 1AT6A 2G4PA 5KXOA 1LSFA 4TSCA 5C6JA 5ILCA 1KXXA 1TBYA 1UIEA 4DD9A 1IWTA 1LJEA 2PC2A 4HJVA 1UC0A 3WYHA 1HFZA 3T36A 3TXKA 4IASA 3ZEKA 2YBIA 1LJJA 1LJNA 4LT0A 2DQDY 2YBNA 3A92A 4HJYA 2A7FA 1UIDA 2ZILA 3FE0A 5LAFA 5LYTA 4C5FA 8LYZA 2YBLA 4RW1A 3VWOA 1WQRA 5LYMA 4EOFA 2ZYPA 3CT0A 4DYGA 2MECA 3AZ5A 1B7PA 3WULA 4B4EA 1GEZA 4HV1A 4GLAA 5I54A 1LZDA 1GE3A 194LA 1IWZA 1LMAA 2BQFA 2DQJY 2ZYCA 4N0JA 1NKHA 4TWSA 5A3EA 1JJ1A 1NBZC 2HU1A 2X0AA 3TMXA 4OWEA 4OOTA 1J1OY 1QDRA 2MEDA 4LYZA 3ATOA 5J7CA 5LYZA 4LYBA 4WM6A 5L3IA 1IWWA 1GFHA 1HEMA 5HNLA 1JKCA 2Z12A 3G3AB 2BQBA 4J1AA 4WL6A 4XJDA 5F81A 2I6ZA 3CT1A 5I53A 1UIFA 3WMKA 1CJ6A 4IJ4A 1GE4A 4YENA 2MEAA 1GXXA 1UACY 4P2EA 4UWUA 4LYTA 5LINA 4N8ZA 1F0WA 1YAMA 4NG1A 1I56A 1OUIA 1IOTA 3RZ4A 1JEFA 4GN3A 4TUNA 3IJUA 1HERA 2HTXA 1FLWA 3P68A 1IOQA 1NDGC 4H1PA 2HU3A 4DT3A 2DQAA 1LZGA 1LHHA 135LA 4R6CA 1YKYX 1LSZA 1IC4Y 1D6PA 1G7HC 1NHEA 1OUFA 1WQNA 4LFPA 1LSMA 4OWAA 2LZTA 3RT5X 1QTEA 4WM5A 5JENB 1JSFA 1JWRA 5LVIA 2A7DA 1TDYA 4YEMA 5KJ9A 5IHGA 2BAAA 1INUA 1XGPC 4NGYA 3A93A 1IC5Y 208LA 3W6DA 4CFOA 7LYZA 1I1ZA 1DXJA 5B1FA 3A6BY 5HNCA 1LSGA 4LT2A 3HFMY 1CJ9A 1QIOA 2C8PA 5DLAA 2EPEA 1DKKA 2ZQ4A 1JKDA 1KXYA 2Z39A 3AB6A 4KT3A 4NWEA 5M1YA 4B49A 1CJ7A 1FKQA 1LZ1A 2FYCA 2BQCA 2HEDA 3ZVQA 5F9XA 5KXZA 5LA5A 1LSNA 3WPJA 2ZNXY 5DN5A 4OWCA 4WO6A 2YSSC 1GWDA 2CGIA 3AGHA 1TAYA 1LMNA 5D5CA 1G7MC 1LJGA 3B72A 3A3RX 5APDA 4XENA 1LHIA 4KXIA 4A7DA 2D4KA 5KXKA 4II8A 1GF5A 4H8XA 1GB3A 1V7TA 1LSYA 1IORA 1UICA 1XGUC 2F30A 2HEFA 3CSRA 5KXSA 207LA 2EQLA 4PHIA 4XJIA 1LSDA 5FDJA 1XGTC 3T6UA 4QY9A 3LYMA 1IOCA 3A3QA 1OUGA 1VEDA 1SLYA 2YBHA 1KIQC 2XBSA 2Z2EA 3FI7A 1RFPA 1DI3A 2ZQ3A 1ZVHL 3TMVA 2LYMA 4I0CA 4GCBA 1IP7A 4PPOA 1UIAA 3B6LA 4NWHA 4LGKA 1B9OA 4E3UA 1LZRA 1G7LC 1CKFA 1GBSA 1GB2A 3WL2A 1B5VA 3K3TA 5LVHA 3J4GA 4WM4A 1IY4A 5FCPA 4HTKA 5IELA 4NGOA 5F16A 1KXWA 2IFFY 5B1GA 1LZSA 1NQIA 4MCKA 5KXNA 4H9FA 4O34A 1PS5A 4RLNA 3F6ZA 1DQJC 4Z98A 1GFKA 4DDBA 2CWIA 1B5ZA 1UUZC 5LVJA 5KXTA 1CJ8A 1HFYA 2D4IA 3SP3A 5LVGA 1YKZX 1B7MA 1B2KA 134LA 2BQAA 1NF5A 4LYOA 1D0KA 2NWDX 3P66A 4XJFA 1GDXA 1JHLA 133LA 1REXA 2B5ZA 1NMMA 3B0OA 2IHLA 5AMYA 2YVBA 2C8OA 1YKXX 3LZ2A 2LHMA 4BS7A 4YF2A 4ZIXA 2CJLA 3TXGA 1WTMA 2G4QA 1CKGA 2ZIJA 3RNXA 1IWUA 1IY3A 1GPQC 4Z3MA 1QDTA 2BQNA 1GFJA 4WMGA 1XSFA 4DDAA 2FBDA 3N9EA 3WU8A 1IP2A 4OW1A 5KXXA 1VDPA 1CNSA 1QUTA 2Q0MX 3AGGG 4H9AA 2D4JA 4H9CA 5DN4A 1GFTA 4YEOA 1GF9A 1LKRA 4ETAA 1D0MA 1YAPA 4N1EI 4M4OA 6LYTA 1UIGA 1QSAA 2MEEA 4RDSA 1IWVA 1LTMA 2Y8PA 5EBHA 1RJCB 2BQDA 2YBJA 4ET8A 4H9EA 1C10A 4PRQA 4ZFPA 2HUBA 4WM3A 1LZBA 1LZ4A 4YOPA 4NSGA 5HMJA 3WU7A 1LMTA 2BQMA 3WPKA 4ETDA 1XEJA 1A4VA 3EMSA 4HSFA 4WO9A 4DWXA 1UBZA 3W6BA 4KL7A 4GN5C 3N9AA 1FN5A 4OWBA 5FHWA 5FSTA 1JKAA 3QE8A 3WVYA 2G4NA 1B7OA 5KXYA 2H5ZA 5FEKA 2F2NA 1B7LA 1YROA 4HPIA 1GAYA 5LXWA 1FBIX 4CJ2A 1ZVYB 1BB5A 5KXMA 1OUCA 3A34A 1XGRC 1BVKC 1HSXA 1HEQA 1B7RA 1LKSA 1EQ5A 2F4GA 1C43A 4NGIA 3TXBA 4C3WA 4NHTA 4LYMA 1LHMA 4FJRA 3IJVA 4HP0A 3AW6A 3W6EA 1LMOA 3P64A 1C08C 2HEEA 3E3DA 1GFAA 4IATA 3LN2A 1IIZA 4WLXA 1B0DA 3WPLA 1HC0A 3TXEA 3A96A 1LCNA 4G4HA 1GF8A 2MEFA 1LMCA 3AW7A 4OOOA 4B1AA 4NGKA 5II3A 1REYA 2LYZA 1REZA 1IP5A 4NFVA 4XADA 4QGZA 3LYOA 4L41A 4N5RA 4DD2A 4HV2A 1GBWA 4R0FA 5B59A 4ETBA 1LJ4A 4H90A 1BWIA 1QTKA 4I8SA 1NWGA 5KKIA 1E8LA 1NBYC 1ZV5L 3IWRA 3WU9A 4WL7A 1LYYA 1P2CC 1LJHA 4LYCA 2BQEA 1LYSA 153LA 1EQ4A 4J1BA 3TXDA 3P4ZA 2WARA 3HBHA 3TXHA 1LZTA 1B7SA 1CKCA 4XJGA 4NSIA 1AM7A 1MELL 1W08A 2H9KA 5APCA 4ET9A 3AZ6A 1HNLA 1IP3A 3ATNA 3CQLA 1LZ6A 1B7NA 3A95A 1N4FA 2MEIA 1WQPA 4NHQA 1WQOA 4OWHA 1LZNA 3A6CY
chains in the Genus database with same CATH superfamily
1L07A 2OU9A 1CVKA 1UIHA 1LMPA 4RW2A 4J7VA 1RCMA 4TTDA 2AUBA 2DQGY 4LZMA 1XJUA 1HFXA 3LHMA 1LHKA 3SB7A 1L99A 4WLYA 1LZ5A 1H87A 4NGWA 1D9WA 1JSEA 2RSCA 1DYDA 1IC7Y 2BQGA 1FKVA 3HT9A 1WQMA 1B7QA 4ARQA 1L09A 1GB5A 3DN8A 1GBZA 1L17A 2F32A 1LHJA 1LZ9A 4H9IA 255LA 3B0IA 4EXMA 2B6TA 1SQ2L 1GBOA 1L18A 1GB6A 1JUGA 3HT7A 3ZVQB 1C6DA 3W3EA 4B4IA 2RH1A 2CDSA 3HH5A 1UA6Y 4W56A 1QUSA 1GEVA 4GCCA 1L20A 1QTZA 1L29A 1WVVA 1L47A 5LA8A 240LA 2RBRA 2Z2FA 1G06A 4XN6A 1LJFA 1GFRA 1L45A 3TXJA 113LA 2B6YA 2DQCY 3AZ7A 4BAFA 4NHPA 3TMUA 1VDQA 1C6TA 1DKJA 3CDOA 248LA 4W94A 4NEBA 1B5UA 1BHZA 2HEBA 3SBAA 1D6QA 1HMKA 214LA 3OK0A 5LZMA 2RBOA 1YIKA 1LPIA 4I7NA 1L79A 4LT1A 1QS5A 2OU8A 231LA 2ZNWY 4GCFA 2HECA 1IWXA 245LA 1L89A 1GE1A 3DNAA 3RU5A 1LOZA 6LYZA 1L13A 3M3UA 2XTHA 1DI5A 4GCEA 3J6KA 3C81A 2DQHY 3ULRA 1G0GA 5HLLA 1LYZA 138LA 1L66A 1FLQA 1GF0A 219LA 2OTZX 2MEHA 4W52A 1P46A 4NGLA 4N1CC 1F6SA 4EMNA 4CFPA 1W6ZA 3HTFA 3NY8A 3MGWA 4PRUA 3WUNA 3EXDA 4E97A 3G3XA 3GUNA 1H6MA 4G9SA 1L34A 4H93A 1TEWA 238LA 1LJIA 4PJ2C 1IP1A 1PZYA 5E9RA 5F14A 224LA 3CT5A 2FBBA 1L02A 1AT6A 5KXOA 1L16A 1LSFA 198LA 5C6JA 1KXXA 1TBYA 257LA 1UIEA 4DD9A 165LA 157LA 172LA 1LJNA 3GUOA 4LT0A 3A92A 4HJYA 5LYTA 4RW1A 1L0KA 4W51A 3CT0A 1L94A 4HV1A 2BQFA 1T6HA 1LYHA 2HU1A 4EKSA 2MEDA 4LYBA 4WM6A 5L3IA 5F81A 141LA 3WMKA 2Q9DA 1GXXA 1L05A 3G3WA 4LYTA 1F0WA 182LA 2LCBA 2CUUA 1OUIA 173LA 191LA 3RZ4A 1PQKA 1LWGA 1QT8A 2HTXA 1FLWA 1IOQA 4H1PA 1LHHA 1L57A 3C82A 1IC4Y 4LFPA 225LA 1INUA 1XGPC 7LYZA 1L06A 1LYJA 1LSGA 1L58A 3HFMY 1CJ9A 2ZQ4A 3FI5A 1KXYA 187LA 4NWEA 1CJ7A 1L33A 1ZURA 217LA 2BQCA 5LA5A 2O79A 1LSNA 1KW5A 1C6MA 2CGIA 4DQJA 1LMNA 1OWYA 4XENA 4A7DA 2D4KA 2XQOA 4H8XA 2QB0B 1IORA 1L21A 2HEFA 1L44A 207LA 3A3QA 2YBHA 3ODUA 2Z2EA 1DI3A 3TMVA 2LYMA 1C63A 254LA 3G3VA 4I7RA 221LA 1CU0A 1B5VA 4NGOA 1KXWA 4Z98A 3F6ZA 2ANVA 3GUPA 1LYGA 4DQ5A 1L49A 3RUNA 5KXTA 1CJ8A 3C80A 1SX2A 5LVGA 1YKZX 4K5YA 1B2KA 2BQAA 1NF5A 233LA 3P66A 4XJFA 1GDXA 1D2YA 1JHLA 133LA 1REXA 261LA 4BS7A 1QT4A 1L38A 1LGXA 2ZIJA 1GPQC 1QDTA 1DYGA 1IP2A 1SSWA 1CNSA 3AGGG 1C6GA 230LA 1C66A 1LKRA 119LA 1UIGA 1L85A 4RDSA 1LTMA 251LA 3D4SA 5EBHA 1QS9A 1L95A 222LA 1LZ4A 228LA 1CUQA 1DYAA 1L25A 3C7ZA 252LA 4W57A 1LMTA 1XEJA 1A4VA 237LA 4WO9A 4DWXA 4GN5C 1FN5A 2OE7X 4OWBA 6LZMA 2G4NA 5FEKA 2F2NA 1L41A 4CJ2A 5KXMA 4I7LA 1CV6A 3A34A 1HEQA 4NGIA 1EQ5A 3EMLA 1LHMA 4FJRA 3IJVA 3AW6A 3P64A 3E3DA 223LA 1IIZA 1B0DA 3A96A 1LCNA 2MEFA 3AW7A 1CV4A 111LA 4NFVA 4N5RA 4DD2A 4LDEA 4R0FA 5B59A 1LJ4A 4H90A 1QTKA 4I8SA 5KKIA 1NBYC 3WU9A 4WL7A 1LYYA 1LJHA 4LYCA 4J1BA 2RB1X 3TXHA 1WTHA 1B7SA 4NSIA 1AM7A 1W08A 4ET9A 1B7NA 2MEIA 1WQOA 128LA 4DC4A 4AQNA 1C6LA 3A94A 104LA 2F4AA 1LGWA 188LA 4YM8A 2ANXA 3GULA 1L55A 1KY1A 4ZEEA 5B07A 1LHLA 2F2QA 2OTYX 1NHBA 2BQIA 1LJ3A 1XGQC 148LE 3D3DA 5KXLA 5KXWA 155LA 1BQLY 1C6HA 5ILFA 4HJZA 1L80A 4XJHA 2OE4X 1J1PY 184LA 1BVXA 5I4WA 1D3JA 4WM2A 3CDRA 1KS3A 3WXTA 126LA 1GF3A 1L71A 4UWNA 4WG1A 1L19A 1LZEA 1GFGA 3WUMA 1B5YA 1KIRC 2N5ZA 1HHLA 3GUJA 4LZTA 5KXPA 3L64A 4TX7A 4DD3A 4QEQA 4EPFA 5E4PA 145LA 209LA 1C6AA 1LI2A 1IR9A 5I4YA 1BB6A 4Z41A 1I20A 5L3HA 1PQMA 1IO5A 1CV0A 4DJHA 1L72A 1YANA 1MLCE 2MEGA 4OO9A 1CU2A 5DM9A 3A8ZA 3F8VA 2F47A 3HU9A 1L37A 1XEIA 3SB9A 4XJBA 1KW7A 149LA 1QT3A 1IEEA 2I25L 3C8SA 1GE0A 5I5QA 5HMVA 1VATA 1GE2A 1FLYA 1HEWA 1LAAA 3WW6A 2BLYA 2DQFC 1P56A 1L97A 5C6LA 1IR7A 1OVHA 4H92A 2DQEY 1HENA 1QQYA 1OUHA 3A91A 1L26A 160LA 2BQOA 151LA 1FLUA 1HSWA 1HEPA 1OV7A 3BKHA 1L24A 3CDVA 3TXFA 5KKJA 1IVMA 2B7XA 4N9RA 3TMWA 3HBEX 2YDGA 2B73A 1ZWNA 4MSTA 4DKLA 4BAPA 3DMVA 3BKVA 4NHSA 1BGIA 2O4WA 2NTHA 4M6DA 4CHXA 1L92A 1QUHA 2BQHA 1LPYA 3L2XA 1L52A 177LA 1KNIA 3WXUA 4GRVA 1JTPL 1LSCA 1F10A 2B72A 4NG8A 4YXAC 3EBAB 1JJ0A 1DPXA 2B6XA 1L59A 1IR8A 3AGIA 1YAOA 1T6VL 2I26L 4G4CA 1QTVA 2FYDA 1GFUA 4HTQA 2DQIY 1P2LA 192LA 2Z37A 226LA 1WTNA 3W6AA 1LSAA 3C83A 4KPMA 1WQQA 4LT3A 3OE0A 241LA 1L54A 256LA 3WYHA 3T36A 2YBIA 2ZILA 3FE0A 5LAFA 4EOFA 2MECA 3AZ5A 3SBBC 1GEZA 194LA 1IWZA 2ZYCA 4TWSA 1NBZC 3TMXA 1KY0A 3HTDA 4LYZA 5J7CA 5LYZA 1GFHA 1L40A 5HNLA 3G3AB 4J1AA 4XJDA 2I6ZA 1UIFA 1C68A 1CJ6A 3C7YA 1SWYA 4YENA 1L50A 1L56A 1UACY 5LINA 1YAMA 4NG1A 1I56A 3K2RA 1JEFA 3P68A 1NDGC 4S0WA 2HU3A 1L74A 143LA 1YKYX 1LSZA 4I7TA 3HU8A 4OWAA 1JSFA 4ARQB 4YEMA 3W6DA 4CFOA 1L84A 3OE9A 5B1FA 5HNCA 123LA 1DKKA 1JKDA 185LA 5KXZA 3PDSA 4OWCA 4WO6A 1P2RA 3AGHA 3B72A 5APDA 1V7TA 4W53A 2F30A 1UICA 206LA 247LA 1L30A 1IOCA 3SB8A 1KIQC 1T97A 3FI7A 1RFPA 242LA 3B6LA 1B9OA 4IAPA 4E3UA 1LZRA 1GBSA 3WL2A 180LA 2LC9A 5IELA 5B1GA 4O34A 171LA 1GFKA 4DDBA 2CWIA 5LVJA 1HFYA 134LA 1D0KA 1QSQA 2IHLA 5AMYA 147LA 2LHMA 4YF2A 1LYFA 2G4QA 1IY3A 1L53A 4Z3MA 2BQNA 4DDAA 2FBDA 3WU8A 1QUDA 1C65A 2D4JA 1GFTA 4ETAA 1YAPA 4N1EI 2MEEA 4EJ4A 1IWVA 1RJCB 103LA 4H9EA 4W55A 4WM3A 112LA 4YOPA 1CV5A 1L73A 2RAZX 5HMJA 2BQMA 4ETDA 3QAKA 3N9AA 3QE8A 5KXYA 2H5ZA 259LA 3HTGA 144LA 1YROA 1L82A 1C6IA 1BVKC 1HSXA 1LKSA 3TXBA 4C3WA 169LA 220LA 3W6EA 4HP0A 1L65A 235LA 158LA 1GFAA 1HC0A 4G4HA 4B1AA 137LA 4NGKA 1L83A 1REZA 3OE8A 3LYOA 168LA 4HV2A 1CU3A 1GBWA 4ETBA 1ZV5L 1P2CC 2BQEA 4XJGA 1CTWA 1IP3A 3ATNA 3CQLA 1LZ6A 3A95A 1N4FA 4NHQA 3A6CY 2RBSA 3PBLA 1CKDA 1QUGA 1XEKA 1XFPL 2YBMA 1QTDA 1L81A 1GF7A 1ZYTA 1B6IA 5T3FA 1GB7A 4CGEA 2EIZC 3GXKA 178LA 262LA 4YX7C 4TSBA 1HELA 2Z18A 5L9JA 1DI4A 4DD1A 3HBDA 1LI3A 163LA 4GN4A 3KAMA 2B70A 1IP4A 1C61A 258LA 3EO5A 1T8GA 1ZMYL 3N9CA 1LGUA 1T3PA 162LA 1GHLA 1P7SA 3NYAA 3WUAA 3P65A 4PGJB 1L32A 3A67Y 3HTBA 125LA 1JIYA 3CSZA 4ARMB 1D9UA 5F9UA 3HWLA 4ML7A 1JISA 132LA 2ZWBA 2VB1A 1QSBA 3CDQA 1YL1X 1LI6A 130LA 2A4TA 1WVUA 4NGVA 1QT7A 4NGZA 1LSBA 1OUDA 1LJKA 146LA 1F6RA 4WG7A 1QTHA 1JTOL 1G7JC 5KJ9A 3CB7A 4J0LA 3D9AC 1L00A 1J1XY 4XYYA 127LA 4LDOA 5DL9A 150LA 1LMQA 4H9HA 1OUBA 4DD0A 3GXRA 3DN2A 1V7SA 3WH1A 1UCOA 1PQDA 3G3BB 3OJPA 4H9BA 4Z46A 3RZEA 3LYZA 1L51A 1IWYA 4YXCA 1L14A 4G4BA 140LA 1GF4A 2W1YA 1D0LA 1BWJA 1Z55A 1C62A 1YL0X 3A90A 1LZ8A 156LA 250LA 1AKIA 1DPWA 1P64A 4WOAA 1HMLA 5LVKA 1G0LA 1YAQA 3RW8A 1C64A 4MR1A 2RBQA 1XEPA 1BB4A 139LA 1LSPA 1C46A 1PQIA 1L96A 3AJNA 1OV5A 5HQ1A 2Q9EA 1GDWA 1GBYA 2L78A 1KIPC 3LZTA 1RI8B 1GFEA 4B0DA 5A3ZA 1YILA 2DKVA 239LA 2W1XA 1OQMA 2W1MA 5APFA 1L76A 9LYZA 1A2YC 1C60A 1CU6A 1RE2A 1DYEA 1IX0A 3GUMA 4HPEA 5LAGA 1P36A 1VFBC 1OUEA 1OUAA 1K28A 2B74A 218LA 1L46A 3WW5A 2Z38A 2D91A 1EL1A 1QT5A 1QSWA 2HEAA 2DBTA 1GAZA 1D3NA 2G4PA 2O7AA 1C6FA 5ILCA 1IWTA 4HJVA 2HUKA 3TXKA 4IASA 1LJJA 4DQ7A 2DQDY 2YBNA 2A7FA 2QARC 3SB6A 152LA 8LYZA 5LYMA 1L39A 4ZPUA 1B7PA 4B4EA 3FA0A 1L15A 4GLAA 1LZDA 1GE3A 229LA 2DQJY 1NKHA 5A3EA 1JJ1A 2IGCA 2X0AA 4OOTA 4GBRB 1J1OY 1OWZA 1IWWA 181LA 1C6CA 1JKCA 2Z12A 2BQBA 4WL6A 5I53A 3CT1A 1DYCA 4IJ4A 1GE4A 244LA 4P2EA 1QTBA 3HDFA 1IOTA 4TUNA 4GN3A 2LZMA 1JQUA 4DT3A 2DQAA 1LZGA 4R6CA 4EKQA 1G7HC 1OUFA 3RT5X 1WQNA 1LSMA 5JENB 5LVIA 5IHGA 2BAAA 4NGYA 161LA 1L03A 208LA 1DXJA 4LT2A 1QIOA 2EPEA 1L70A 3AB6A 4I7QA 5M1YA 4B49A 200LA 2FYCA 2HEDA 3ZVQA 1CU5A 3WPJA 1OVJA 4I7MA 5DN5A 4EPIA 1TAYA 1G0QA 5KXKA 4II8A 1C67A 1XGUC 3CSRA 4PHIA 4XJIA 1XGTC 1L23A 3T6UA 3LYMA 1OYUA 1VEDA 1G07A 2XBSA 4ARPA 2ZQ3A 1ZVHL 120LA 4I0CA 4GCBA 1IP7A 1UIAA 159LA 3DMXA 110LA 249LA 1CKFA 1GB2A 5LVHA 246LA 3J4GA 4WM4A 1IY4A 5FCPA 2IFFY 1LZSA 1NQIA 3HT8A 5KXNA 4H9FA 4RLNA 3F9LA 1LWKA 3CDTA 174LA 1B5ZA 4ARJA 1UUZC 3OE6A 2D4IA 1B7MA 1L01A 4LYOA 2NWDX 3SN6R 2B5ZA 2YVBA 1QTCA 1YKXX 2C8OA 3LZ2A 1C6QA 1G1WA 234LA 2CJLA 3TXGA 1WTMA 1CKGA 3RNXA 1IWUA 1GFJA 1G0KA 1XSFA 3N9EA 5KXXA 167LA 1QUTA 115LA 195LA 3C8RA 3V2WA 4YEOA 210LA 1GF9A 5I14A 6LYTA 2BQDA 2YBJA 1C10A 4PRQA 2HUBA 1LZBA 1L67A 1L62A 1L36A 3WPKA 3EMSA 3W6BA 201LA 5FHWA 1L86A 1JKAA 1L04A 3WVYA 1PQJA 1B7OA 1B7LA 1CUPA 4HPIA 1GAYA 1PQOA 5LXWA 1FBIX 1ZVYB 108LA 1CV3A 1OUCA 1L68A 175LA 1LMOA 1LYDA 1C08C 2HEEA 4IATA 1LLHA 1GF8A 4OOOA 1SX7A 1G0MA 2RBPA 5II3A 1BWIA 2B6WA 1L11A 1NWGA 3C8QA 1P37A 129LA 1LYSA 1EQ4A 3TXDA 3HBHA 4W54A 3LZMA 3HUKA 5APCA 3AZ6A 1WQPA 4OWHA 1LZNA 4WM1A 1AZFA 1GFVA 1XJTA 4X3BA 1L87A 1IP6A 1LZAA 1GD6A 3VW7A 1L91A 1BB7A 2BQJA 4NSJA 1JJ3A 1JTNA 199LA 1T8FA 5KXRA 1C6NA 4ETCA 1L61A 1JPOA 3M18B 2LZ2A 2B75A 1C6EA 4I7KA 4G49A 1G7IC 3TXIA 4NY5A 1L93A 2BQLA 4U3XB 1REMA 1LZCA 3QY4A 4DAJA 2XJWA 4QDNA 1QT6A 4RLMA 7LZMA 3HH6A 4NSHA 1C6JA 4AGAA 3WVXA 4I7SA 1OUJA 3V2YA 1B5WA 1SWZA 196LA 1LYEA 1EPYA 118LA 1LZYA 1OP9B 1VAUA 2XBRA 122LA 1JITA 4BADA 1GB9A 1D2WA 1L90A 1BB3A 1GBXA 3DN6A 2Z6BA 1EQEA 189LA 1C45A 1L31A 1BWHA 1L10A 5B05A 4I7OA 4H91A 193LA 2LYOA 1NDMC 4H8ZA 3W6FA 2OU0X 2B6ZA 5B06A 1JKBA 1GB8A 1O23A 1FDLY 3HT6A 3AYQA 154LA 1HF4A 1L63A 4WLDA 2D6BA 1DZBX 102LA 1DYFA 1VDSA 5FELA 5I4XA 4H94A 1TLAA 1LYOA 2RAYX 1CKHA 236LA 3QNGA 186LA 1GXV2 4ANRA 1G0PA 1D3FA 2BQKA 4EKPA 4GCDA 5IDDA 4DD7A 1G1VA 2ZIKA 4GLVA 5LIOA 4NIJA 2H9JA 1L35A 1LYIA 5APEA 4ARMA 1LSEA 2Z19A 1C7PA 4NGJA 4ETEA 4W96A 1GB0A 3B0KA 2NTGA 3CSQA 4DDCA 4HTNA 2BLXA 1YQVY 5C6IA 1VDTA 2OEAX 2OE9X 2BPUA 1L28A 1GF6A 4UWVA 4WLTA 2RB0X 3W6CA 2EKSC 1P3NA 3JR6A 1JTTL 4NHIA 4AXTA 216LA 2W1LA 2GV0A 4FDYA 4H8YA 5D5FA 4D9ZA 1B5XA 1P5CA 3LYTA 5KY1A 1L12A 1TCYA 2MEBA 1UIBA 4B4JA 5K7OA 1AT5A 4LFXA 1I6SA 1ALCA 1HEOA 3AZ4A 1IOSA 1QUOA 3DN0A 4PK0A 4TSCA 114LA 1LJEA 2PC2A 1UC0A 1HFZA 243LA 3ZEKA 211LA 1UIDA 4C5FA 2YBLA 3VWOA 1WQRA 1JTMA 2ZYPA 1D3MA 1L22A 3SB5A 4DYGA 3WULA 1L77A 5I54A 1LMAA 4N0JA 1L75A 4OWEA 1QDRA 3HH4A 3ATOA 1CX6A 1P6YA 1HEMA 3C7WA 1C6KA 1C6PA 190LA 1G0JA 2MEAA 4UWUA 4N8ZA 1OVKA 3IJUA 1HERA 215LA 135LA 1D6PA 1NHEA 4ARLA 2LZTA 1QTEA 4WM5A 1JWRA 2A7DA 1TDYA 3DN1A 3A93A 253LA 1IC5Y 1I1ZA 3A6BY 1L42A 2C8PA 3GUKA 5DLAA 2Z39A 107LA 4KT3A 227LA 1FKQA 1LZ1A 5F9XA 2ZNXY 213LA 2YSSC 1GWDA 4PJZA 5D5CA 1G7MC 1LJGA 131LA 3A3RX 1LHIA 1L27A 4KXIA 205LA 1GF5A 1GB3A 1LSYA 2HULA 183LA 5KXSA 2EQLA 1LSDA 5FDJA 4QY9A 1OUGA 1SLYA 4PPOA 4NWHA 4LGKA 2RB2X 1G7LC 1L48A 176LA 4LDLA 3K3TA 4HTKA 1T8AA 5F16A 3DMZA 4MCKA 1PS5A 3HUQA 1DQJC 1L43A 1LW9A 3SP3A 164LA 232LA 3B0OA 1NMMA 1SSYA 3NY9A 4ZIXA 1L0JA 1L98A 3FADA 4WMGA 4OW1A 142LA 1VDPA 4H9AA 2Q0MX 1L88A 4H9CA 5DN4A 1D0MA 260LA 1L69A 4M4OA 1QSAA 2Y8PA 4ET8A 4ZFPA 2RBNA 1CV1A 1C69A 4W58A 4NSGA 3GUIA 3WU7A 4I7JA 4HSFA 1UBZA 109LA 4KL7A 3DN4A 3HH3A 3DN3A 5FSTA 1L60A 1BB5A 1XGRC 1B7RA 2F4GA 1C43A 4NHTA 4LYMA 3HUAA 1CX7A 1DYBA 4EKRA 3LN2A 4WLXA 3WPLA 3TXEA 197LA 3DKEX 1LMCA 1REYA 2LYZA 1IP5A 4XADA 3UONA 4QGZA 4L41A 170LA 166LA 4W59A 1L08A 3HDEA 1E8LA 3IWRA 153LA 1L64A 3P4ZA 2WARA 1LZTA 1CKCA 1MELL 2H9KA 1HNLA 212LA 1C6BA 2HUMA 4I7PA
chains in the Genus database with same CATH topology
1L07A 2OU9A 1CVKA 1UIHA 1LMPA 4RW2A 4J7VA 1RCMA 4TTDA 2AUBA 2DQGY 4LZMA 1XJUA 1HFXA 3LHMA 1LHKA 3SB7A 1L99A 4WLYA 1LZ5A 1H87A 4NGWA 1D9WA 1JSEA 2RSCA 1DYDA 1IC7Y 2BQGA 1FKVA 3HT9A 1WQMA 1B7QA 4ARQA 1L09A 1GB5A 3DN8A 1GBZA 1L17A 2F32A 1LHJA 1LZ9A 4H9IA 255LA 3B0IA 4EXMA 2B6TA 1SQ2L 1GBOA 1L18A 1GB6A 1JUGA 3HT7A 3ZVQB 1C6DA 3W3EA 4B4IA 2RH1A 2CDSA 3HH5A 1UA6Y 4W56A 1QUSA 1GEVA 4GCCA 1L20A 1QTZA 1L29A 1WVVA 1L47A 5LA8A 240LA 2RBRA 2Z2FA 1G06A 4XN6A 1LJFA 1GFRA 1L45A 3TXJA 113LA 2B6YA 2DQCY 3AZ7A 4BAFA 4NHPA 3TMUA 1VDQA 1C6TA 1DKJA 3CDOA 248LA 4W94A 4NEBA 1B5UA 1BHZA 2HEBA 3SBAA 1D6QA 1HMKA 214LA 3OK0A 5LZMA 2RBOA 1YIKA 1LPIA 4I7NA 1L79A 4LT1A 1QS5A 2OU8A 231LA 2ZNWY 4GCFA 2HECA 1IWXA 245LA 1L89A 1GE1A 3DNAA 3RU5A 1LOZA 6LYZA 1L13A 3M3UA 2XTHA 1DI5A 4GCEA 3J6KA 3C81A 2DQHY 3ULRA 1G0GA 5HLLA 1LYZA 138LA 1L66A 1FLQA 1GF0A 219LA 2OTZX 2MEHA 4W52A 1P46A 4NGLA 4N1CC 1F6SA 4EMNA 4CFPA 1W6ZA 3HTFA 3NY8A 3MGWA 4PRUA 3WUNA 3EXDA 4E97A 3G3XA 3GUNA 1H6MA 4G9SA 1L34A 4H93A 1TEWA 238LA 1LJIA 4PJ2C 1IP1A 1PZYA 5E9RA 5F14A 224LA 3CT5A 2FBBA 1L02A 1AT6A 5KXOA 1L16A 1LSFA 198LA 5C6JA 1KXXA 1TBYA 257LA 1UIEA 4DD9A 165LA 157LA 172LA 1LJNA 3GUOA 4LT0A 3A92A 4HJYA 5LYTA 4RW1A 1L0KA 4W51A 3CT0A 1L94A 4HV1A 2BQFA 1T6HA 1LYHA 2HU1A 4EKSA 2MEDA 4LYBA 4WM6A 5L3IA 5F81A 141LA 3WMKA 2Q9DA 1GXXA 1L05A 3G3WA 4LYTA 1F0WA 182LA 2LCBA 2CUUA 1OUIA 173LA 191LA 3RZ4A 1PQKA 1LWGA 1QT8A 2HTXA 1FLWA 1IOQA 4H1PA 1LHHA 1L57A 3C82A 1IC4Y 4LFPA 225LA 1INUA 1XGPC 7LYZA 1L06A 1LYJA 1LSGA 1L58A 3HFMY 1CJ9A 2ZQ4A 3FI5A 1KXYA 187LA 4NWEA 1CJ7A 1L33A 1ZURA 217LA 2BQCA 5LA5A 2O79A 1LSNA 1KW5A 1C6MA 2CGIA 4DQJA 1LMNA 1OWYA 4XENA 4A7DA 2D4KA 2XQOA 4H8XA 2QB0B 1IORA 1L21A 2HEFA 1L44A 207LA 3A3QA 2YBHA 3ODUA 2Z2EA 1DI3A 3TMVA 2LYMA 1C63A 254LA 3G3VA 4I7RA 221LA 1CU0A 1B5VA 4NGOA 1KXWA 4Z98A 3F6ZA 2ANVA 3GUPA 1LYGA 4DQ5A 1L49A 3RUNA 5KXTA 1CJ8A 3C80A 1SX2A 5LVGA 1YKZX 4K5YA 1B2KA 2BQAA 1NF5A 233LA 3P66A 4XJFA 1GDXA 1D2YA 1JHLA 133LA 1REXA 261LA 4BS7A 1QT4A 1L38A 1LGXA 2ZIJA 1GPQC 1QDTA 1DYGA 1IP2A 1SSWA 1CNSA 3AGGG 1C6GA 230LA 1C66A 1LKRA 119LA 1UIGA 1L85A 4RDSA 1LTMA 251LA 3D4SA 5EBHA 1QS9A 1L95A 222LA 1LZ4A 228LA 1CUQA 1DYAA 1L25A 3C7ZA 252LA 4W57A 1LMTA 1XEJA 1A4VA 237LA 4WO9A 4DWXA 4GN5C 1FN5A 2OE7X 4OWBA 6LZMA 2G4NA 5FEKA 2F2NA 1L41A 4CJ2A 5KXMA 4I7LA 1CV6A 3A34A 1HEQA 4NGIA 1EQ5A 3EMLA 1LHMA 4FJRA 3IJVA 3AW6A 3P64A 3E3DA 223LA 1IIZA 1B0DA 3A96A 1LCNA 2MEFA 3AW7A 1CV4A 111LA 4NFVA 4N5RA 4DD2A 4LDEA 4R0FA 5B59A 1LJ4A 4H90A 1QTKA 4I8SA 5KKIA 1NBYC 3WU9A 4WL7A 1LYYA 1LJHA 4LYCA 4J1BA 2RB1X 3TXHA 1WTHA 1B7SA 4NSIA 1AM7A 1W08A 4ET9A 1B7NA 2MEIA 1WQOA 128LA 4DC4A 4AQNA 1C6LA 3A94A 104LA 2F4AA 1LGWA 188LA 4YM8A 2ANXA 3GULA 1L55A 1KY1A 4ZEEA 5B07A 1LHLA 2F2QA 2OTYX 1NHBA 2BQIA 1LJ3A 1XGQC 148LE 3D3DA 5KXLA 5KXWA 155LA 1BQLY 1C6HA 5ILFA 4HJZA 1L80A 4XJHA 2OE4X 1J1PY 184LA 1BVXA 5I4WA 1D3JA 4WM2A 3CDRA 1KS3A 3WXTA 126LA 1GF3A 1L71A 4UWNA 4WG1A 1L19A 1LZEA 1GFGA 3WUMA 1B5YA 1KIRC 2N5ZA 1HHLA 3GUJA 4LZTA 5KXPA 3L64A 4TX7A 4DD3A 4QEQA 4EPFA 5E4PA 145LA 209LA 1C6AA 1LI2A 1IR9A 5I4YA 1BB6A 4Z41A 1I20A 5L3HA 1PQMA 1IO5A 1CV0A 4DJHA 1L72A 1YANA 1MLCE 2MEGA 4OO9A 1CU2A 5DM9A 3A8ZA 3F8VA 2F47A 3HU9A 1L37A 1XEIA 3SB9A 4XJBA 1KW7A 149LA 1QT3A 1IEEA 2I25L 3C8SA 1GE0A 5I5QA 5HMVA 1VATA 1GE2A 1FLYA 1HEWA 1LAAA 3WW6A 2BLYA 2DQFC 1P56A 1L97A 5C6LA 1IR7A 1OVHA 4H92A 2DQEY 1HENA 1QQYA 1OUHA 3A91A 1L26A 160LA 2BQOA 151LA 1FLUA 1HSWA 1HEPA 1OV7A 3BKHA 1L24A 3CDVA 3TXFA 5KKJA 1IVMA 2B7XA 4N9RA 3TMWA 3HBEX 2YDGA 2B73A 1ZWNA 4MSTA 4DKLA 4BAPA 3DMVA 3BKVA 4NHSA 1BGIA 2O4WA 2NTHA 4M6DA 4CHXA 1L92A 1QUHA 2BQHA 1LPYA 3L2XA 1L52A 177LA 1KNIA 3WXUA 4GRVA 1JTPL 1LSCA 1F10A 2B72A 4NG8A 4YXAC 3EBAB 1JJ0A 1DPXA 2B6XA 1L59A 1IR8A 3AGIA 1YAOA 1T6VL 2I26L 4G4CA 1QTVA 2FYDA 1GFUA 4HTQA 2DQIY 1P2LA 192LA 2Z37A 226LA 1WTNA 3W6AA 1LSAA 3C83A 4KPMA 1WQQA 4LT3A 3OE0A 241LA 1L54A 256LA 3WYHA 3T36A 2YBIA 2ZILA 3FE0A 5LAFA 4EOFA 2MECA 3AZ5A 3SBBC 1GEZA 194LA 1IWZA 2ZYCA 4TWSA 1NBZC 3TMXA 1KY0A 3HTDA 4LYZA 5J7CA 5LYZA 1GFHA 1L40A 5HNLA 3G3AB 4J1AA 4XJDA 2I6ZA 1UIFA 1C68A 1CJ6A 3C7YA 1SWYA 4YENA 1L50A 1L56A 1UACY 5LINA 1YAMA 4NG1A 1I56A 3K2RA 1JEFA 3P68A 1NDGC 4S0WA 2HU3A 1L74A 143LA 1YKYX 1LSZA 4I7TA 3HU8A 4OWAA 1JSFA 4ARQB 4YEMA 3W6DA 4CFOA 1L84A 3OE9A 5B1FA 5HNCA 123LA 1DKKA 1JKDA 185LA 5KXZA 3PDSA 4OWCA 4WO6A 1P2RA 3AGHA 3B72A 5APDA 1V7TA 4W53A 2F30A 1UICA 206LA 247LA 1L30A 1IOCA 3SB8A 1KIQC 1T97A 3FI7A 1RFPA 242LA 3B6LA 1B9OA 4IAPA 4E3UA 1LZRA 1GBSA 3WL2A 180LA 2LC9A 5IELA 5B1GA 4O34A 171LA 1GFKA 4DDBA 2CWIA 5LVJA 1HFYA 134LA 1D0KA 1QSQA 2IHLA 5AMYA 147LA 2LHMA 4YF2A 1LYFA 2G4QA 1IY3A 1L53A 4Z3MA 2BQNA 4DDAA 2FBDA 3WU8A 1QUDA 1C65A 2D4JA 1GFTA 4ETAA 1YAPA 4N1EI 2MEEA 4EJ4A 1IWVA 1RJCB 103LA 4H9EA 4W55A 4WM3A 112LA 4YOPA 1CV5A 1L73A 2RAZX 5HMJA 2BQMA 4ETDA 3QAKA 3N9AA 3QE8A 5KXYA 2H5ZA 259LA 3HTGA 144LA 1YROA 1L82A 1C6IA 1BVKC 1HSXA 1LKSA 3TXBA 4C3WA 169LA 220LA 3W6EA 4HP0A 1L65A 235LA 158LA 1GFAA 1HC0A 4G4HA 4B1AA 137LA 4NGKA 1L83A 1REZA 3OE8A 3LYOA 168LA 4HV2A 1CU3A 1GBWA 4ETBA 1ZV5L 1P2CC 2BQEA 4XJGA 1CTWA 1IP3A 3ATNA 3CQLA 1LZ6A 3A95A 1N4FA 4NHQA 3A6CY 2RBSA 3PBLA 1CKDA 1QUGA 1XEKA 1XFPL 2YBMA 1QTDA 1L81A 1GF7A 1ZYTA 1B6IA 5T3FA 1GB7A 4CGEA 2EIZC 3GXKA 178LA 262LA 4YX7C 4TSBA 1HELA 2Z18A 5L9JA 1DI4A 4DD1A 3HBDA 1LI3A 163LA 4GN4A 3KAMA 2B70A 1IP4A 1C61A 258LA 3EO5A 1T8GA 1ZMYL 3N9CA 1LGUA 1T3PA 162LA 1GHLA 1P7SA 3NYAA 3WUAA 3P65A 4PGJB 1L32A 3A67Y 3HTBA 125LA 1JIYA 3CSZA 4ARMB 1D9UA 5F9UA 3HWLA 4ML7A 1JISA 132LA 2ZWBA 2VB1A 1QSBA 3CDQA 1YL1X 1LI6A 130LA 2A4TA 1WVUA 4NGVA 1QT7A 4NGZA 1LSBA 1OUDA 1LJKA 146LA 1F6RA 4WG7A 1QTHA 1JTOL 1G7JC 5KJ9A 3CB7A 4J0LA 3D9AC 1L00A 1J1XY 4XYYA 127LA 4LDOA 5DL9A 150LA 1LMQA 4H9HA 1OUBA 4DD0A 3GXRA 3DN2A 1V7SA 3WH1A 1UCOA 1PQDA 3G3BB 3OJPA 4H9BA 4Z46A 3RZEA 3LYZA 1L51A 1IWYA 4YXCA 1L14A 4G4BA 140LA 1GF4A 2W1YA 1D0LA 1BWJA 1Z55A 1C62A 1YL0X 3A90A 1LZ8A 156LA 250LA 1AKIA 1DPWA 1P64A 4WOAA 1HMLA 5LVKA 1G0LA 1YAQA 3RW8A 1C64A 4MR1A 2RBQA 1XEPA 1BB4A 139LA 1LSPA 1C46A 1PQIA 1L96A 3AJNA 1OV5A 5HQ1A 2Q9EA 1GDWA 1GBYA 2L78A 1KIPC 3LZTA 1RI8B 1GFEA 4B0DA 5A3ZA 1YILA 2DKVA 239LA 2W1XA 1OQMA 2W1MA 5APFA 1L76A 9LYZA 1A2YC 1C60A 1CU6A 1RE2A 1DYEA 1IX0A 3GUMA 4HPEA 5LAGA 1P36A 1VFBC 1OUEA 1OUAA 1K28A 2B74A 218LA 1L46A 3WW5A 2Z38A 2D91A 1EL1A 1QT5A 1QSWA 2HEAA 2DBTA 1GAZA 1D3NA 2G4PA 2O7AA 1C6FA 5ILCA 1IWTA 4HJVA 2HUKA 3TXKA 4IASA 1LJJA 4DQ7A 2DQDY 2YBNA 2A7FA 2QARC 3SB6A 152LA 8LYZA 5LYMA 1L39A 4ZPUA 1B7PA 4B4EA 3FA0A 1L15A 4GLAA 1LZDA 1GE3A 229LA 2DQJY 1NKHA 5A3EA 1JJ1A 2IGCA 2X0AA 4OOTA 4GBRB 1J1OY 1OWZA 1IWWA 181LA 1C6CA 1JKCA 2Z12A 2BQBA 4WL6A 5I53A 3CT1A 1DYCA 4IJ4A 1GE4A 244LA 4P2EA 1QTBA 3HDFA 1IOTA 4TUNA 4GN3A 2LZMA 1JQUA 4DT3A 2DQAA 1LZGA 4R6CA 4EKQA 1G7HC 1OUFA 3RT5X 1WQNA 1LSMA 5JENB 5LVIA 5IHGA 2BAAA 4NGYA 161LA 1L03A 208LA 1DXJA 4LT2A 1QIOA 2EPEA 1L70A 3AB6A 4I7QA 5M1YA 4B49A 200LA 2FYCA 2HEDA 3ZVQA 1CU5A 3WPJA 1OVJA 4I7MA 5DN5A 4EPIA 1TAYA 1G0QA 5KXKA 4II8A 1C67A 1XGUC 3CSRA 4PHIA 4XJIA 1XGTC 1L23A 3T6UA 3LYMA 1OYUA 1VEDA 1G07A 2XBSA 4ARPA 2ZQ3A 1ZVHL 120LA 4I0CA 4GCBA 1IP7A 1UIAA 159LA 3DMXA 110LA 249LA 1CKFA 1GB2A 5LVHA 246LA 3J4GA 4WM4A 1IY4A 5FCPA 2IFFY 1LZSA 1NQIA 3HT8A 5KXNA 4H9FA 4RLNA 3F9LA 1LWKA 3CDTA 174LA 1B5ZA 4ARJA 1UUZC 3OE6A 2D4IA 1B7MA 1L01A 4LYOA 2NWDX 3SN6R 2B5ZA 2YVBA 1QTCA 1YKXX 2C8OA 3LZ2A 1C6QA 1G1WA 234LA 2CJLA 3TXGA 1WTMA 1CKGA 3RNXA 1IWUA 1GFJA 1G0KA 1XSFA 3N9EA 5KXXA 167LA 1QUTA 115LA 195LA 3C8RA 3V2WA 4YEOA 210LA 1GF9A 5I14A 6LYTA 2BQDA 2YBJA 1C10A 4PRQA 2HUBA 1LZBA 1L67A 1L62A 1L36A 3WPKA 3EMSA 3W6BA 201LA 5FHWA 1L86A 1JKAA 1L04A 3WVYA 1PQJA 1B7OA 1B7LA 1CUPA 4HPIA 1GAYA 1PQOA 5LXWA 1FBIX 1ZVYB 108LA 1CV3A 1OUCA 1L68A 175LA 1LMOA 1LYDA 1C08C 2HEEA 4IATA 1LLHA 1GF8A 4OOOA 1SX7A 1G0MA 2RBPA 5II3A 1BWIA 2B6WA 1L11A 1NWGA 3C8QA 1P37A 129LA 1LYSA 1EQ4A 3TXDA 3HBHA 4W54A 3LZMA 3HUKA 5APCA 3AZ6A 1WQPA 4OWHA 1LZNA 4WM1A 1AZFA 1GFVA 1XJTA 4X3BA 1L87A 1IP6A 1LZAA 1GD6A 3VW7A 1L91A 1BB7A 2BQJA 4NSJA 1JJ3A 1JTNA 199LA 1T8FA 5KXRA 1C6NA 4ETCA 1L61A 1JPOA 3M18B 2LZ2A 2B75A 1C6EA 4I7KA 4G49A 1G7IC 3TXIA 4NY5A 1L93A 2BQLA 4U3XB 1REMA 1LZCA 3QY4A 4DAJA 2XJWA 4QDNA 1QT6A 4RLMA 7LZMA 3HH6A 4NSHA 1C6JA 4AGAA 3WVXA 4I7SA 1OUJA 3V2YA 1B5WA 1SWZA 196LA 1LYEA 1EPYA 118LA 1LZYA 1OP9B 1VAUA 2XBRA 122LA 1JITA 4BADA 1GB9A 1D2WA 1L90A 1BB3A 1GBXA 3DN6A 2Z6BA 1EQEA 189LA 1C45A 1L31A 1BWHA 1L10A 5B05A 4I7OA 4H91A 193LA 2LYOA 1NDMC 4H8ZA 3W6FA 2OU0X 2B6ZA 5B06A 1JKBA 1GB8A 1O23A 1FDLY 3HT6A 3AYQA 154LA 1HF4A 1L63A 4WLDA 2D6BA 1DZBX 102LA 1DYFA 1VDSA 5FELA 5I4XA 4H94A 1TLAA 1LYOA 2RAYX 1CKHA 236LA 3QNGA 186LA 1GXV2 4ANRA 1G0PA 1D3FA 2BQKA 4EKPA 4GCDA 5IDDA 4DD7A 1G1VA 2ZIKA 4GLVA 5LIOA 4NIJA 2H9JA 1L35A 1LYIA 5APEA 4ARMA 1LSEA 2Z19A 1C7PA 4NGJA 4ETEA 4W96A 1GB0A 3B0KA 2NTGA 3CSQA 4DDCA 4HTNA 2BLXA 1YQVY 5C6IA 1VDTA 2OEAX 2OE9X 2BPUA 1L28A 1GF6A 4UWVA 4WLTA 2RB0X 3W6CA 2EKSC 1P3NA 3JR6A 1JTTL 4NHIA 4AXTA 216LA 2W1LA 2GV0A 4FDYA 4H8YA 5D5FA 4D9ZA 1B5XA 1P5CA 3LYTA 5KY1A 1L12A 1TCYA 2MEBA 1UIBA 4B4JA 5K7OA 1AT5A 4LFXA 1I6SA 1ALCA 1HEOA 3AZ4A 1IOSA 1QUOA 3DN0A 4PK0A 4TSCA 114LA 1LJEA 2PC2A 1UC0A 1HFZA 243LA 3ZEKA 211LA 1UIDA 4C5FA 2YBLA 3VWOA 1WQRA 1JTMA 2ZYPA 1D3MA 1L22A 3SB5A 4DYGA 3WULA 1L77A 5I54A 1LMAA 4N0JA 1L75A 4OWEA 1QDRA 3HH4A 3ATOA 1CX6A 1P6YA 1HEMA 3C7WA 1C6KA 1C6PA 190LA 1G0JA 2MEAA 4UWUA 4N8ZA 1OVKA 3IJUA 1HERA 215LA 135LA 1D6PA 1NHEA 4ARLA 2LZTA 1QTEA 4WM5A 1JWRA 2A7DA 1TDYA 3DN1A 3A93A 253LA 1IC5Y 1I1ZA 3A6BY 1L42A 2C8PA 3GUKA 5DLAA 2Z39A 107LA 4KT3A 227LA 1FKQA 1LZ1A 5F9XA 2ZNXY 213LA 2YSSC 1GWDA 4PJZA 5D5CA 1G7MC 1LJGA 131LA 3A3RX 1LHIA 1L27A 4KXIA 205LA 1GF5A 1GB3A 1LSYA 2HULA 183LA 5KXSA 2EQLA 1LSDA 5FDJA 4QY9A 1OUGA 1SLYA 4PPOA 4NWHA 4LGKA 2RB2X 1G7LC 1L48A 176LA 4LDLA 3K3TA 4HTKA 1T8AA 5F16A 3DMZA 4MCKA 1PS5A 3HUQA 1DQJC 1L43A 1LW9A 3SP3A 164LA 232LA 3B0OA 1NMMA 1SSYA 3NY9A 4ZIXA 1L0JA 1L98A 3FADA 4WMGA 4OW1A 142LA 1VDPA 4H9AA 2Q0MX 1L88A 4H9CA 5DN4A 1D0MA 260LA 1L69A 4M4OA 1QSAA 2Y8PA 4ET8A 4ZFPA 2RBNA 1CV1A 1C69A 4W58A 4NSGA 3GUIA 3WU7A 4I7JA 4HSFA 1UBZA 109LA 4KL7A 3DN4A 3HH3A 3DN3A 5FSTA 1L60A 1BB5A 1XGRC 1B7RA 2F4GA 1C43A 4NHTA 4LYMA 3HUAA 1CX7A 1DYBA 4EKRA 3LN2A 4WLXA 3WPLA 3TXEA 197LA 3DKEX 1LMCA 1REYA 2LYZA 1IP5A 4XADA 3UONA 4QGZA 4L41A 170LA 166LA 4W59A 1L08A 3HDEA 1E8LA 3IWRA 153LA 1L64A 3P4ZA 2WARA 1LZTA 1CKCA 1MELL 2H9KA 1HNLA 212LA 1C6BA 2HUMA 4I7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WM1 A;  1AZF A;  1GFV A;  1CKD A;  4DC4 A;  4X3B A;  1IP6 A;  1LZA A;  1GD6 A;  1UIH A;  1XEK A;  1XFP L;  2YBM A;  3A94 A;  2F4A A;  1BB7 A;  1LMP A;  4RW2 A;  4J7V A;  1GF7 A;  5T3F A;  1RCM A;  2BQJ A;  4NSJ A;  1GB7 A;  4TTD A;  4YM8 A;  4CGE A;  2EIZ C;  1JJ3 A;  2AUB A;  2DQG Y;  3GXK A;  1HFX A;  3LHM A;  5KXR A;  4ZEE A;  5B07 A;  1LHK A;  1LHL A;  4TSB A;  4ETC A;  2BQI A;  1LJ3 A;  1XGQ C;  4WLY A;  1HEL A;  1JPO A;  3M18 B;  2LZ2 A;  1LZ5 A;  3D3D A;  5KXL A;  2Z18 A;  5KXW A;  5L9J A;  1BQL Y;  1DI4 A;  1G7I C;  1H87 A;  3HBD A;  4G49 A;  4NGW A;  3TXI A;  4DD1 A;  5ILF A;  4GN4 A;  3KAM A;  1JSE A;  4NY5 A;  1IP4 A;  2RSC A;  4HJZ A;  2BQL A;  1IC7 Y;  3EO5 A;  4U3X B;  5I4Y A;  2BQG A;  4XJH A;  1ZMY L;  1FKV A;  1REM A;  1J1P Y;  1BVX A;  1LZC A;  3N9C A;  3QY4 A;  5I4W A;  2XJW A;  1WQM A;  1T3P A;  4QDN A;  1B7Q A;  1GHL A;  4RLM A;  4WM2 A;  3WUA A;  3P65 A;  4PGJ B;  3WXT A;  1GB5 A;  3A67 Y;  4NSH A;  1GF3 A;  1GBZ A;  4UWN A;  4AGA A;  1JIY A;  3CSZ A;  3WVX A;  4WG1 A;  1D9U A;  5F9U A;  1OUJ A;  1LHJ A;  1LZE A;  1LZ9 A;  1B5W A;  4H9I A;  4ML7 A;  3B0I A;  1GFG A;  3WUM A;  1B5Y A;  1JIS A;  1KIR C;  1HHL A;  2N5Z A;  132L A;  1SQ2 L;  1GBO A;  1LZY A;  1GB6 A;  2VB1 A;  1OP9 B;  2ZWB A;  1YL1 X;  1VAU A;  4LZT A;  5KXP A;  1JUG A;  2XBR A;  4TX7 A;  1JIT A;  3ZVQ B;  4QEQ A;  4DD3 A;  4BAD A;  1WVU A;  3W3E A;  1GB9 A;  4B4I A;  5E4P A;  4NGV A;  2CDS A;  1UA6 Y;  1BB3 A;  1QUS A;  1GEV A;  1GBX A;  4GCC A;  4NGZ A;  1LSB A;  1OUD A;  1EQE A;  1LJK A;  1C45 A;  1BWH A;  1F6R A;  4WG7 A;  1IR9 A;  1JTO L;  1G7J C;  1BB6 A;  1WVV A;  5LA8 A;  3CB7 A;  4J0L A;  3D9A C;  4Z41 A;  1I20 A;  5L3H A;  1J1X Y;  5B05 A;  1IO5 A;  4XYY A;  4H91 A;  193L A;  2LYO A;  1NDM C;  4H8Z A;  5DL9 A;  1LMQ A;  1YAN A;  3W6F A;  4H9H A;  2Z2F A;  1MLC E;  2MEG A;  4XN6 A;  5B06 A;  1OUB A;  1JKB A;  4DD0 A;  5DM9 A;  3A8Z A;  3GXR A;  1GB8 A;  1O23 A;  1FDL Y;  1LJF A;  1GFR A;  1V7S A;  3AYQ A;  3WH1 A;  1UCO A;  154L A;  3TXJ A;  1HF4 A;  3G3B B;  3OJP A;  4WLD A;  1XEI A;  2D6B A;  2DQC Y;  4H9B A;  4XJB A;  4Z46 A;  3LYZ A;  3AZ7 A;  1DZB X;  4BAF A;  1VDS A;  4NHP A;  5FEL A;  1IWY A;  4H94 A;  3TMU A;  5I4X A;  1LYO A;  1VDQ A;  1DKJ A;  4G4B A;  1IEE A;  2I25 L;  4W94 A;  1CKH A;  3QNG A;  1GE0 A;  1GXV 2;  5I5Q A;  1GF4 A;  4ANR A;  5HMV A;  1VAT A;  2W1Y A;  1D0L A;  2BQK A;  1BWJ A;  1Z55 A;  1GE2 A;  1YL0 X;  1FLY A;  3A90 A;  1LZ8 A;  4NEB A;  1AKI A;  1DPW A;  1B5U A;  4GCD A;  1HEW A;  1BHZ A;  1LAA A;  2HEB A;  5IDD A;  3WW6 A;  4DD7 A;  1D6Q A;  1HMK A;  2ZIK A;  4GLV A;  4WOA A;  1HML A;  2BLY A;  3OK0 A;  5LIO A;  5LVK A;  4NIJ A;  1YAQ A;  2DQF C;  3RW8 A;  2H9J A;  5C6L A;  1YIK A;  1LPI A;  4MR1 A;  5APE A;  1IR7 A;  1LSE A;  4LT1 A;  2Z19 A;  4H92 A;  2DQE Y;  1BB4 A;  1C7P A;  1HEN A;  1LSP A;  1QQY A;  4NGJ A;  1C46 A;  4ETE A;  2ZNW Y;  1OUH A;  3AJN A;  4GCF A;  4W96 A;  1GB0 A;  3A91 A;  2HEC A;  3B0K A;  5HQ1 A;  1IWX A;  1GDW A;  2BQO A;  1FLU A;  1HSW A;  1GBY A;  3CSQ A;  4DDC A;  1HEP A;  4HTN A;  1GE1 A;  2BLX A;  3RU5 A;  1KIP C;  3BKH A;  1LOZ A;  1YQV Y;  6LYZ A;  3LZT A;  3M3U A;  2XTH A;  3TXF A;  5KKJ A;  1IVM A;  5C6I A;  1DI5 A;  1RI8 B;  1VDT A;  3J6K A;  4GCE A;  1GFE A;  2BPU A;  4B0D A;  4N9R A;  5A3Z A;  2DQH Y;  3HBE X;  2YDG A;  3TMW A;  3ULR A;  4MST A;  1GF6 A;  1YIL A;  2DKV A;  4BAP A;  4UWV A;  5HLL A;  1LYZ A;  2W1X A;  3BKV A;  1OQM A;  4WLT A;  4NHS A;  3W6C A;  1BGI A;  1FLQ A;  1GF0 A;  4M6D A;  4CHX A;  2EKS C;  2BQH A;  1JTT L;  2MEH A;  2W1M A;  4NHI A;  4AXT A;  5APF A;  3WXU A;  1JTP L;  1LSC A;  2W1L A;  2GV0 A;  4FDY A;  1F10 A;  1A2Y C;  4H8Y A;  4NGL A;  4NG8 A;  9LYZ A;  5D5F A;  4D9Z A;  4N1C C;  1RE2 A;  1F6S A;  3EBA B;  4EMN A;  1JJ0 A;  1DPX A;  1IX0 A;  1B5X A;  4HPE A;  1IR8 A;  5LAG A;  3AGI A;  1YAO A;  3LYT A;  1T6V L;  1W6Z A;  2I26 L;  4CFP A;  4G4C A;  1VFB C;  2FYD A;  5KY1 A;  1OUE A;  3MGW A;  4PRU A;  1OUA A;  1GFU A;  3WUN A;  3EXD A;  4HTQ A;  1TCY A;  2DQI Y;  2MEB A;  2Z37 A;  3WW5 A;  1H6M A;  1UIB A;  4G9S A;  2Z38 A;  2D91 A;  4H93 A;  4B4J A;  1TEW A;  1EL1 A;  1WTN A;  1LJI A;  4PJ2 C;  3W6A A;  1QSW A;  5K7O A;  2HEA A;  1AT5 A;  1IP1 A;  1LSA A;  2DBT A;  4LFX A;  1PZY A;  1GAZ A;  4KPM A;  5E9R A;  5F14 A;  1ALC A;  1HEO A;  1WQQ A;  3CT5 A;  3AZ4 A;  1IOS A;  2FBB A;  4LT3 A;  1AT6 A;  2G4P A;  5KXO A;  1LSF A;  4TSC A;  5C6J A;  5ILC A;  1KXX A;  1TBY A;  1UIE A;  4DD9 A;  1IWT A;  1LJE A;  2PC2 A;  4HJV A;  1UC0 A;  3WYH A;  1HFZ A;  3T36 A;  3TXK A;  4IAS A;  3ZEK A;  2YBI A;  1LJJ A;  1LJN A;  4LT0 A;  2DQD Y;  2YBN A;  3A92 A;  4HJY A;  2A7F A;  1UID A;  2ZIL A;  3FE0 A;  5LAF A;  5LYT A;  4C5F A;  8LYZ A;  2YBL A;  4RW1 A;  3VWO A;  1WQR A;  5LYM A;  4EOF A;  2ZYP A;  3CT0 A;  4DYG A;  2MEC A;  3AZ5 A;  1B7P A;  3WUL A;  4B4E A;  1GEZ A;  4HV1 A;  4GLA A;  5I54 A;  1LZD A;  1GE3 A;  194L A;  1IWZ A;  1LMA A;  2BQF A;  2DQJ Y;  2ZYC A;  4N0J A;  1NKH A;  4TWS A;  5A3E A;  1JJ1 A;  1NBZ C;  2HU1 A;  2X0A A;  3TMX A;  4OWE A;  4OOT A;  1J1O Y;  1QDR A;  2MED A;  4LYZ A;  3ATO A;  5J7C A;  5LYZ A;  4LYB A;  4WM6 A;  5L3I A;  1IWW A;  1GFH A;  1HEM A;  5HNL A;  1JKC A;  2Z12 A;  3G3A B;  2BQB A;  4J1A A;  4WL6 A;  4XJD A;  5F81 A;  2I6Z A;  3CT1 A;  5I53 A;  1UIF A;  3WMK A;  1CJ6 A;  4IJ4 A;  1GE4 A;  4YEN A;  2MEA A;  1GXX A;  1UAC Y;  4P2E A;  4UWU A;  4LYT A;  5LIN A;  4N8Z A;  1F0W A;  1YAM A;  4NG1 A;  1I56 A;  1OUI A;  1IOT A;  3RZ4 A;  1JEF A;  4GN3 A;  4TUN A;  3IJU A;  1HER A;  2HTX A;  1FLW A;  3P68 A;  1IOQ A;  1NDG C;  4H1P A;  2HU3 A;  4DT3 A;  2DQA A;  1LZG A;  1LHH A;  135L A;  4R6C A;  1YKY X;  1LSZ A;  1IC4 Y;  1D6P A;  1G7H C;  1NHE A;  1OUF A;  1WQN A;  4LFP A;  1LSM A;  4OWA A;  2LZT A;  3RT5 X;  1QTE A;  4WM5 A;  5JEN B;  1JSF A;  1JWR A;  5LVI A;  2A7D A;  1TDY A;  4YEM A;  5KJ9 A;  5IHG A;  2BAA A;  1INU A;  1XGP C;  4NGY A;  3A93 A;  1IC5 Y;  208L A;  3W6D A;  4CFO A;  7LYZ A;  1I1Z A;  1DXJ A;  5B1F A;  3A6B Y;  5HNC A;  1LSG A;  4LT2 A;  3HFM Y;  1CJ9 A;  1QIO A;  2C8P A;  5DLA A;  2EPE A;  1DKK A;  2ZQ4 A;  1JKD A;  1KXY A;  2Z39 A;  3AB6 A;  4KT3 A;  4NWE A;  5M1Y A;  4B49 A;  1CJ7 A;  1FKQ A;  1LZ1 A;  2FYC A;  2BQC A;  2HED A;  3ZVQ A;  5F9X A;  5KXZ A;  5LA5 A;  1LSN A;  3WPJ A;  2ZNX Y;  5DN5 A;  4OWC A;  4WO6 A;  2YSS C;  1GWD A;  2CGI A;  3AGH A;  1TAY A;  1LMN A;  5D5C A;  1G7M C;  1LJG A;  3B72 A;  3A3R X;  5APD A;  4XEN A;  1LHI A;  4KXI A;  4A7D A;  2D4K A;  5KXK A;  4II8 A;  1GF5 A;  4H8X A;  1GB3 A;  1V7T A;  1LSY A;  1IOR A;  1UIC A;  1XGU C;  2F30 A;  2HEF A;  3CSR A;  5KXS A;  207L A;  2EQL A;  4PHI A;  4XJI A;  1LSD A;  5FDJ A;  1XGT C;  3T6U A;  4QY9 A;  3LYM A;  1IOC A;  3A3Q A;  1OUG A;  1VED A;  1SLY A;  2YBH A;  1KIQ C;  2XBS A;  2Z2E A;  3FI7 A;  1RFP A;  1DI3 A;  2ZQ3 A;  1ZVH L;  3TMV A;  2LYM A;  4I0C A;  4GCB A;  1IP7 A;  4PPO A;  1UIA A;  3B6L A;  4NWH A;  4LGK A;  1B9O A;  4E3U A;  1LZR A;  1G7L C;  1CKF A;  1GBS A;  1GB2 A;  3WL2 A;  1B5V A;  3K3T A;  5LVH A;  3J4G A;  4WM4 A;  1IY4 A;  5FCP A;  4HTK A;  5IEL A;  4NGO A;  5F16 A;  1KXW A;  2IFF Y;  5B1G A;  1LZS A;  1NQI A;  4MCK A;  5KXN A;  4H9F A;  4O34 A;  1PS5 A;  4RLN A;  3F6Z A;  1DQJ C;  4Z98 A;  1GFK A;  4DDB A;  2CWI A;  1B5Z A;  1UUZ C;  5LVJ A;  5KXT A;  1CJ8 A;  1HFY A;  2D4I A;  3SP3 A;  5LVG A;  1YKZ X;  1B7M A;  1B2K A;  134L A;  2BQA A;  1NF5 A;  4LYO A;  1D0K A;  2NWD X;  3P66 A;  4XJF A;  1GDX A;  1JHL A;  133L A;  1REX A;  2B5Z A;  1NMM A;  3B0O A;  2IHL A;  5AMY A;  2YVB A;  2C8O A;  1YKX X;  3LZ2 A;  2LHM A;  4BS7 A;  4YF2 A;  4ZIX A;  2CJL A;  3TXG A;  1WTM A;  2G4Q A;  1CKG A;  2ZIJ A;  3RNX A;  1IWU A;  1IY3 A;  1GPQ C;  4Z3M A;  1QDT A;  2BQN A;  1GFJ A;  4WMG A;  1XSF A;  4DDA A;  2FBD A;  3N9E A;  3WU8 A;  1IP2 A;  4OW1 A;  5KXX A;  1VDP A;  1CNS A;  1QUT A;  2Q0M X;  3AGG G;  4H9A A;  2D4J A;  4H9C A;  5DN4 A;  1GFT A;  4YEO A;  1GF9 A;  1LKR A;  4ETA A;  1D0M A;  1YAP A;  4N1E I;  4M4O A;  6LYT A;  1UIG A;  1QSA A;  2MEE A;  4RDS A;  1IWV A;  1LTM A;  2Y8P A;  5EBH A;  1RJC B;  2BQD A;  2YBJ A;  4ET8 A;  4H9E A;  1C10 A;  4PRQ A;  4ZFP A;  2HUB A;  4WM3 A;  1LZB A;  1LZ4 A;  4YOP A;  4NSG A;  5HMJ A;  3WU7 A;  1LMT A;  2BQM A;  3WPK A;  4ETD A;  1XEJ A;  1A4V A;  3EMS A;  4HSF A;  4WO9 A;  4DWX A;  1UBZ A;  3W6B A;  4KL7 A;  4GN5 C;  3N9A A;  1FN5 A;  4OWB A;  5FHW A;  5FST A;  1JKA A;  3QE8 A;  3WVY A;  2G4N A;  1B7O A;  5KXY A;  2H5Z A;  5FEK A;  2F2N A;  1B7L A;  1YRO A;  4HPI A;  1GAY A;  5LXW A;  1FBI X;  4CJ2 A;  1ZVY B;  1BB5 A;  5KXM A;  1OUC A;  3A34 A;  1XGR C;  1BVK C;  1HSX A;  1HEQ A;  1B7R A;  1LKS A;  1EQ5 A;  2F4G A;  1C43 A;  4NGI A;  3TXB A;  4C3W A;  4NHT A;  4LYM A;  1LHM A;  4FJR A;  3IJV A;  4HP0 A;  3AW6 A;  3W6E A;  1LMO A;  3P64 A;  1C08 C;  2HEE A;  3E3D A;  1GFA A;  4IAT A;  3LN2 A;  1IIZ A;  4WLX A;  1B0D A;  3WPL A;  1HC0 A;  3TXE A;  3A96 A;  1LCN A;  4G4H A;  1GF8 A;  2MEF A;  1LMC A;  3AW7 A;  4OOO A;  4B1A A;  4NGK A;  5II3 A;  1REY A;  2LYZ A;  1REZ A;  1IP5 A;  4NFV A;  4XAD A;  4QGZ A;  3LYO A;  4L41 A;  4N5R A;  4DD2 A;  4HV2 A;  1GBW A;  4R0F A;  5B59 A;  4ETB A;  1LJ4 A;  4H90 A;  1BWI A;  1QTK A;  4I8S A;  1NWG A;  5KKI A;  1E8L A;  1NBY C;  1ZV5 L;  3IWR A;  3WU9 A;  4WL7 A;  1LYY A;  1P2C C;  1LJH A;  4LYC A;  2BQE A;  1LYS A;  153L A;  1EQ4 A;  4J1B A;  3TXD A;  3P4Z A;  2WAR A;  3HBH A;  3TXH A;  1LZT A;  1B7S A;  1CKC A;  4XJG A;  4NSI A;  1AM7 A;  1MEL L;  1W08 A;  2H9K A;  5APC A;  4ET9 A;  3AZ6 A;  1HNL A;  1IP3 A;  3ATN A;  3CQL A;  1LZ6 A;  1B7N A;  3A95 A;  1N4F A;  2MEI A;  1WQP A;  4NHQ A;  1WQO A;  4OWH A;  1LZN A;  3A6C Y; 
#chains in the Genus database with same CATH topology
 1L07 A;  2OU9 A;  1CVK A;  1UIH A;  1LMP A;  4RW2 A;  4J7V A;  1RCM A;  4TTD A;  2AUB A;  2DQG Y;  4LZM A;  1XJU A;  1HFX A;  3LHM A;  1LHK A;  3SB7 A;  1L99 A;  4WLY A;  1LZ5 A;  1H87 A;  4NGW A;  1D9W A;  1JSE A;  2RSC A;  1DYD A;  1IC7 Y;  2BQG A;  1FKV A;  3HT9 A;  1WQM A;  1B7Q A;  4ARQ A;  1L09 A;  1GB5 A;  3DN8 A;  1GBZ A;  1L17 A;  2F32 A;  1LHJ A;  1LZ9 A;  4H9I A;  255L A;  3B0I A;  4EXM A;  2B6T A;  1SQ2 L;  1GBO A;  1L18 A;  1GB6 A;  1JUG A;  3HT7 A;  3ZVQ B;  1C6D A;  3W3E A;  4B4I A;  2RH1 A;  2CDS A;  3HH5 A;  1UA6 Y;  4W56 A;  1QUS A;  1GEV A;  4GCC A;  1L20 A;  1QTZ A;  1L29 A;  1WVV A;  1L47 A;  5LA8 A;  240L A;  2RBR A;  2Z2F A;  1G06 A;  4XN6 A;  1LJF A;  1GFR A;  1L45 A;  3TXJ A;  113L A;  2B6Y A;  2DQC Y;  3AZ7 A;  4BAF A;  4NHP A;  3TMU A;  1VDQ A;  1C6T A;  1DKJ A;  3CDO A;  248L A;  4W94 A;  4NEB A;  1B5U A;  1BHZ A;  2HEB A;  3SBA A;  1D6Q A;  1HMK A;  214L A;  3OK0 A;  5LZM A;  2RBO A;  1YIK A;  1LPI A;  4I7N A;  1L79 A;  4LT1 A;  1QS5 A;  2OU8 A;  231L A;  2ZNW Y;  4GCF A;  2HEC A;  1IWX A;  245L A;  1L89 A;  1GE1 A;  3DNA A;  3RU5 A;  1LOZ A;  6LYZ A;  1L13 A;  3M3U A;  2XTH A;  1DI5 A;  4GCE A;  3J6K A;  3C81 A;  2DQH Y;  3ULR A;  1G0G A;  5HLL A;  1LYZ A;  138L A;  1L66 A;  1FLQ A;  1GF0 A;  219L A;  2OTZ X;  2MEH A;  4W52 A;  1P46 A;  4NGL A;  4N1C C;  1F6S A;  4EMN A;  4CFP A;  1W6Z A;  3HTF A;  3NY8 A;  3MGW A;  4PRU A;  3WUN A;  3EXD A;  4E97 A;  3G3X A;  3GUN A;  1H6M A;  4G9S A;  1L34 A;  4H93 A;  1TEW A;  238L A;  1LJI A;  4PJ2 C;  1IP1 A;  1PZY A;  5E9R A;  5F14 A;  224L A;  3CT5 A;  2FBB A;  1L02 A;  1AT6 A;  5KXO A;  1L16 A;  1LSF A;  198L A;  5C6J A;  1KXX A;  1TBY A;  257L A;  1UIE A;  4DD9 A;  165L A;  157L A;  172L A;  1LJN A;  3GUO A;  4LT0 A;  3A92 A;  4HJY A;  5LYT A;  4RW1 A;  1L0K A;  4W51 A;  3CT0 A;  1L94 A;  4HV1 A;  2BQF A;  1T6H A;  1LYH A;  2HU1 A;  4EKS A;  2MED A;  4LYB A;  4WM6 A;  5L3I A;  5F81 A;  141L A;  3WMK A;  2Q9D A;  1GXX A;  1L05 A;  3G3W A;  4LYT A;  1F0W A;  182L A;  2LCB A;  2CUU A;  1OUI A;  173L A;  191L A;  3RZ4 A;  1PQK A;  1LWG A;  1QT8 A;  2HTX A;  1FLW A;  1IOQ A;  4H1P A;  1LHH A;  1L57 A;  3C82 A;  1IC4 Y;  4LFP A;  225L A;  1INU A;  1XGP C;  7LYZ A;  1L06 A;  1LYJ A;  1LSG A;  1L58 A;  3HFM Y;  1CJ9 A;  2ZQ4 A;  3FI5 A;  1KXY A;  187L A;  4NWE A;  1CJ7 A;  1L33 A;  1ZUR A;  217L A;  2BQC A;  5LA5 A;  2O79 A;  1LSN A;  1KW5 A;  1C6M A;  2CGI A;  4DQJ A;  1LMN A;  1OWY A;  4XEN A;  4A7D A;  2D4K A;  2XQO A;  4H8X A;  2QB0 B;  1IOR A;  1L21 A;  2HEF A;  1L44 A;  207L A;  3A3Q A;  2YBH A;  3ODU A;  2Z2E A;  1DI3 A;  3TMV A;  2LYM A;  1C63 A;  254L A;  3G3V A;  4I7R A;  221L A;  1CU0 A;  1B5V A;  4NGO A;  1KXW A;  4Z98 A;  3F6Z A;  2ANV A;  3GUP A;  1LYG A;  4DQ5 A;  1L49 A;  3RUN A;  5KXT A;  1CJ8 A;  3C80 A;  1SX2 A;  5LVG A;  1YKZ X;  4K5Y A;  1B2K A;  2BQA A;  1NF5 A;  233L A;  3P66 A;  4XJF A;  1GDX A;  1D2Y A;  1JHL A;  133L A;  1REX A;  261L A;  4BS7 A;  1QT4 A;  1L38 A;  1LGX A;  2ZIJ A;  1GPQ C;  1QDT A;  1DYG A;  1IP2 A;  1SSW A;  1CNS A;  3AGG G;  1C6G A;  230L A;  1C66 A;  1LKR A;  119L A;  1UIG A;  1L85 A;  4RDS A;  1LTM A;  251L A;  3D4S A;  5EBH A;  1QS9 A;  1L95 A;  222L A;  1LZ4 A;  228L A;  1CUQ A;  1DYA A;  1L25 A;  3C7Z A;  252L A;  4W57 A;  1LMT A;  1XEJ A;  1A4V A;  237L A;  4WO9 A;  4DWX A;  4GN5 C;  1FN5 A;  2OE7 X;  4OWB A;  6LZM A;  2G4N A;  5FEK A;  2F2N A;  1L41 A;  4CJ2 A;  5KXM A;  4I7L A;  1CV6 A;  3A34 A;  1HEQ A;  4NGI A;  1EQ5 A;  3EML A;  1LHM A;  4FJR A;  3IJV A;  3AW6 A;  3P64 A;  3E3D A;  223L A;  1IIZ A;  1B0D A;  3A96 A;  1LCN A;  2MEF A;  3AW7 A;  1CV4 A;  111L A;  4NFV A;  4N5R A;  4DD2 A;  4LDE A;  4R0F A;  5B59 A;  1LJ4 A;  4H90 A;  1QTK A;  4I8S A;  5KKI A;  1NBY C;  3WU9 A;  4WL7 A;  1LYY A;  1LJH A;  4LYC A;  4J1B A;  2RB1 X;  3TXH A;  1WTH A;  1B7S A;  4NSI A;  1AM7 A;  1W08 A;  4ET9 A;  1B7N A;  2MEI A;  1WQO A;  128L A;  4DC4 A;  4AQN A;  1C6L A;  3A94 A;  104L A;  2F4A A;  1LGW A;  188L A;  4YM8 A;  2ANX A;  3GUL A;  1L55 A;  1KY1 A;  4ZEE A;  5B07 A;  1LHL A;  2F2Q A;  2OTY X;  1NHB A;  2BQI A;  1LJ3 A;  1XGQ C;  148L E;  3D3D A;  5KXL A;  5KXW A;  155L A;  1BQL Y;  1C6H A;  5ILF A;  4HJZ A;  1L80 A;  4XJH A;  2OE4 X;  1J1P Y;  184L A;  1BVX A;  5I4W A;  1D3J A;  4WM2 A;  3CDR A;  1KS3 A;  3WXT A;  126L A;  1GF3 A;  1L71 A;  4UWN A;  4WG1 A;  1L19 A;  1LZE A;  1GFG A;  3WUM A;  1B5Y A;  1KIR C;  2N5Z A;  1HHL A;  3GUJ A;  4LZT A;  5KXP A;  3L64 A;  4TX7 A;  4DD3 A;  4QEQ A;  4EPF A;  5E4P A;  145L A;  209L A;  1C6A A;  1LI2 A;  1IR9 A;  5I4Y A;  1BB6 A;  4Z41 A;  1I20 A;  5L3H A;  1PQM A;  1IO5 A;  1CV0 A;  4DJH A;  1L72 A;  1YAN A;  1MLC E;  2MEG A;  4OO9 A;  1CU2 A;  5DM9 A;  3A8Z A;  3F8V A;  2F47 A;  3HU9 A;  1L37 A;  1XEI A;  3SB9 A;  4XJB A;  1KW7 A;  149L A;  1QT3 A;  1IEE A;  2I25 L;  3C8S A;  1GE0 A;  5I5Q A;  5HMV A;  1VAT A;  1GE2 A;  1FLY A;  1HEW A;  1LAA A;  3WW6 A;  2BLY A;  2DQF C;  1P56 A;  1L97 A;  5C6L A;  1IR7 A;  1OVH A;  4H92 A;  2DQE Y;  1HEN A;  1QQY A;  1OUH A;  3A91 A;  1L26 A;  160L A;  2BQO A;  151L A;  1FLU A;  1HSW A;  1HEP A;  1OV7 A;  3BKH A;  1L24 A;  3CDV A;  3TXF A;  5KKJ A;  1IVM A;  2B7X A;  4N9R A;  3TMW A;  3HBE X;  2YDG A;  2B73 A;  1ZWN A;  4MST A;  4DKL A;  4BAP A;  3DMV A;  3BKV A;  4NHS A;  1BGI A;  2O4W A;  2NTH A;  4M6D A;  4CHX A;  1L92 A;  1QUH A;  2BQH A;  1LPY A;  3L2X A;  1L52 A;  177L A;  1KNI A;  3WXU A;  4GRV A;  1JTP L;  1LSC A;  1F10 A;  2B72 A;  4NG8 A;  4YXA C;  3EBA B;  1JJ0 A;  1DPX A;  2B6X A;  1L59 A;  1IR8 A;  3AGI A;  1YAO A;  1T6V L;  2I26 L;  4G4C A;  1QTV A;  2FYD A;  1GFU A;  4HTQ A;  2DQI Y;  1P2L A;  192L A;  2Z37 A;  226L A;  1WTN A;  3W6A A;  1LSA A;  3C83 A;  4KPM A;  1WQQ A;  4LT3 A;  3OE0 A;  241L A;  1L54 A;  256L A;  3WYH A;  3T36 A;  2YBI A;  2ZIL A;  3FE0 A;  5LAF A;  4EOF A;  2MEC A;  3AZ5 A;  3SBB C;  1GEZ A;  194L A;  1IWZ A;  2ZYC A;  4TWS A;  1NBZ C;  3TMX A;  1KY0 A;  3HTD A;  4LYZ A;  5J7C A;  5LYZ A;  1GFH A;  1L40 A;  5HNL A;  3G3A B;  4J1A A;  4XJD A;  2I6Z A;  1UIF A;  1C68 A;  1CJ6 A;  3C7Y A;  1SWY A;  4YEN A;  1L50 A;  1L56 A;  1UAC Y;  5LIN A;  1YAM A;  4NG1 A;  1I56 A;  3K2R A;  1JEF A;  3P68 A;  1NDG C;  4S0W A;  2HU3 A;  1L74 A;  143L A;  1YKY X;  1LSZ A;  4I7T A;  3HU8 A;  4OWA A;  1JSF A;  4ARQ B;  4YEM A;  3W6D A;  4CFO A;  1L84 A;  3OE9 A;  5B1F A;  5HNC A;  123L A;  1DKK A;  1JKD A;  185L A;  5KXZ A;  3PDS A;  4OWC A;  4WO6 A;  1P2R A;  3AGH A;  3B72 A;  5APD A;  1V7T A;  4W53 A;  2F30 A;  1UIC A;  206L A;  247L A;  1L30 A;  1IOC A;  3SB8 A;  1KIQ C;  1T97 A;  3FI7 A;  1RFP A;  242L A;  3B6L A;  1B9O A;  4IAP A;  4E3U A;  1LZR A;  1GBS A;  3WL2 A;  180L A;  2LC9 A;  5IEL A;  5B1G A;  4O34 A;  171L A;  1GFK A;  4DDB A;  2CWI A;  5LVJ A;  1HFY A;  134L A;  1D0K A;  1QSQ A;  2IHL A;  5AMY A;  147L A;  2LHM A;  4YF2 A;  1LYF A;  2G4Q A;  1IY3 A;  1L53 A;  4Z3M A;  2BQN A;  4DDA A;  2FBD A;  3WU8 A;  1QUD A;  1C65 A;  2D4J A;  1GFT A;  4ETA A;  1YAP A;  4N1E I;  2MEE A;  4EJ4 A;  1IWV A;  1RJC B;  103L A;  4H9E A;  4W55 A;  4WM3 A;  112L A;  4YOP A;  1CV5 A;  1L73 A;  2RAZ X;  5HMJ A;  2BQM A;  4ETD A;  3QAK A;  3N9A A;  3QE8 A;  5KXY A;  2H5Z A;  259L A;  3HTG A;  144L A;  1YRO A;  1L82 A;  1C6I A;  1BVK C;  1HSX A;  1LKS A;  3TXB A;  4C3W A;  169L A;  220L A;  3W6E A;  4HP0 A;  1L65 A;  235L A;  158L A;  1GFA A;  1HC0 A;  4G4H A;  4B1A A;  137L A;  4NGK A;  1L83 A;  1REZ A;  3OE8 A;  3LYO A;  168L A;  4HV2 A;  1CU3 A;  1GBW A;  4ETB A;  1ZV5 L;  1P2C C;  2BQE A;  4XJG A;  1CTW A;  1IP3 A;  3ATN A;  3CQL A;  1LZ6 A;  3A95 A;  1N4F A;  4NHQ A;  3A6C Y;  2RBS A;  3PBL A;  1CKD A;  1QUG A;  1XEK A;  1XFP L;  2YBM A;  1QTD A;  1L81 A;  1GF7 A;  1ZYT A;  1B6I A;  5T3F A;  1GB7 A;  4CGE A;  2EIZ C;  3GXK A;  178L A;  262L A;  4YX7 C;  4TSB A;  1HEL A;  2Z18 A;  5L9J A;  1DI4 A;  4DD1 A;  3HBD A;  1LI3 A;  163L A;  4GN4 A;  3KAM A;  2B70 A;  1IP4 A;  1C61 A;  258L A;  3EO5 A;  1T8G A;  1ZMY L;  3N9C A;  1LGU A;  1T3P A;  162L A;  1GHL A;  1P7S A;  3NYA A;  3WUA A;  3P65 A;  4PGJ B;  1L32 A;  3A67 Y;  3HTB A;  125L A;  1JIY A;  3CSZ A;  4ARM B;  1D9U A;  5F9U A;  3HWL A;  4ML7 A;  1JIS A;  132L A;  2ZWB A;  2VB1 A;  1QSB A;  3CDQ A;  1YL1 X;  1LI6 A;  130L A;  2A4T A;  1WVU A;  4NGV A;  1QT7 A;  4NGZ A;  1LSB A;  1OUD A;  1LJK A;  146L A;  1F6R A;  4WG7 A;  1QTH A;  1JTO L;  1G7J C;  5KJ9 A;  3CB7 A;  4J0L A;  3D9A C;  1L00 A;  1J1X Y;  4XYY A;  127L A;  4LDO A;  5DL9 A;  150L A;  1LMQ A;  4H9H A;  1OUB A;  4DD0 A;  3GXR A;  3DN2 A;  1V7S A;  3WH1 A;  1UCO A;  1PQD A;  3G3B B;  3OJP A;  4H9B A;  4Z46 A;  3RZE A;  3LYZ A;  1L51 A;  1IWY A;  4YXC A;  1L14 A;  4G4B A;  140L A;  1GF4 A;  2W1Y A;  1D0L A;  1BWJ A;  1Z55 A;  1C62 A;  1YL0 X;  3A90 A;  1LZ8 A;  156L A;  250L A;  1AKI A;  1DPW A;  1P64 A;  4WOA A;  1HML A;  5LVK A;  1G0L A;  1YAQ A;  3RW8 A;  1C64 A;  4MR1 A;  2RBQ A;  1XEP A;  1BB4 A;  139L A;  1LSP A;  1C46 A;  1PQI A;  1L96 A;  3AJN A;  1OV5 A;  5HQ1 A;  2Q9E A;  1GDW A;  1GBY A;  2L78 A;  1KIP C;  3LZT A;  1RI8 B;  1GFE A;  4B0D A;  5A3Z A;  1YIL A;  2DKV A;  239L A;  2W1X A;  1OQM A;  2W1M A;  5APF A;  1L76 A;  9LYZ A;  1A2Y C;  1C60 A;  1CU6 A;  1RE2 A;  1DYE A;  1IX0 A;  3GUM A;  4HPE A;  5LAG A;  1P36 A;  1VFB C;  1OUE A;  1OUA A;  1K28 A;  2B74 A;  218L A;  1L46 A;  3WW5 A;  2Z38 A;  2D91 A;  1EL1 A;  1QT5 A;  1QSW A;  2HEA A;  2DBT A;  1GAZ A;  1D3N A;  2G4P A;  2O7A A;  1C6F A;  5ILC A;  1IWT A;  4HJV A;  2HUK A;  3TXK A;  4IAS A;  1LJJ A;  4DQ7 A;  2DQD Y;  2YBN A;  2A7F A;  2QAR C;  3SB6 A;  152L A;  8LYZ A;  5LYM A;  1L39 A;  4ZPU A;  1B7P A;  4B4E A;  3FA0 A;  1L15 A;  4GLA A;  1LZD A;  1GE3 A;  229L A;  2DQJ Y;  1NKH A;  5A3E A;  1JJ1 A;  2IGC A;  2X0A A;  4OOT A;  4GBR B;  1J1O Y;  1OWZ A;  1IWW A;  181L A;  1C6C A;  1JKC A;  2Z12 A;  2BQB A;  4WL6 A;  5I53 A;  3CT1 A;  1DYC A;  4IJ4 A;  1GE4 A;  244L A;  4P2E A;  1QTB A;  3HDF A;  1IOT A;  4TUN A;  4GN3 A;  2LZM A;  1JQU A;  4DT3 A;  2DQA A;  1LZG A;  4R6C A;  4EKQ A;  1G7H C;  1OUF A;  3RT5 X;  1WQN A;  1LSM A;  5JEN B;  5LVI A;  5IHG A;  2BAA A;  4NGY A;  161L A;  1L03 A;  208L A;  1DXJ A;  4LT2 A;  1QIO A;  2EPE A;  1L70 A;  3AB6 A;  4I7Q A;  5M1Y A;  4B49 A;  200L A;  2FYC A;  2HED A;  3ZVQ A;  1CU5 A;  3WPJ A;  1OVJ A;  4I7M A;  5DN5 A;  4EPI A;  1TAY A;  1G0Q A;  5KXK A;  4II8 A;  1C67 A;  1XGU C;  3CSR A;  4PHI A;  4XJI A;  1XGT C;  1L23 A;  3T6U A;  3LYM A;  1OYU A;  1VED A;  1G07 A;  2XBS A;  4ARP A;  2ZQ3 A;  1ZVH L;  120L A;  4I0C A;  4GCB A;  1IP7 A;  1UIA A;  159L A;  3DMX A;  110L A;  249L A;  1CKF A;  1GB2 A;  5LVH A;  246L A;  3J4G A;  4WM4 A;  1IY4 A;  5FCP A;  2IFF Y;  1LZS A;  1NQI A;  3HT8 A;  5KXN A;  4H9F A;  4RLN A;  3F9L A;  1LWK A;  3CDT A;  174L A;  1B5Z A;  4ARJ A;  1UUZ C;  3OE6 A;  2D4I A;  1B7M A;  1L01 A;  4LYO A;  2NWD X;  3SN6 R;  2B5Z A;  2YVB A;  1QTC A;  1YKX X;  2C8O A;  3LZ2 A;  1C6Q A;  1G1W A;  234L A;  2CJL A;  3TXG A;  1WTM A;  1CKG A;  3RNX A;  1IWU A;  1GFJ A;  1G0K A;  1XSF A;  3N9E A;  5KXX A;  167L A;  1QUT A;  115L A;  195L A;  3C8R A;  3V2W A;  4YEO A;  210L A;  1GF9 A;  5I14 A;  6LYT A;  2BQD A;  2YBJ A;  1C10 A;  4PRQ A;  2HUB A;  1LZB A;  1L67 A;  1L62 A;  1L36 A;  3WPK A;  3EMS A;  3W6B A;  201L A;  5FHW A;  1L86 A;  1JKA A;  1L04 A;  3WVY A;  1PQJ A;  1B7O A;  1B7L A;  1CUP A;  4HPI A;  1GAY A;  1PQO A;  5LXW A;  1FBI X;  1ZVY B;  108L A;  1CV3 A;  1OUC A;  1L68 A;  175L A;  1LMO A;  1LYD A;  1C08 C;  2HEE A;  4IAT A;  1LLH A;  1GF8 A;  4OOO A;  1SX7 A;  1G0M A;  2RBP A;  5II3 A;  1BWI A;  2B6W A;  1L11 A;  1NWG A;  3C8Q A;  1P37 A;  129L A;  1LYS A;  1EQ4 A;  3TXD A;  3HBH A;  4W54 A;  3LZM A;  3HUK A;  5APC A;  3AZ6 A;  1WQP A;  4OWH A;  1LZN A;  4WM1 A;  1AZF A;  1GFV A;  1XJT A;  4X3B A;  1L87 A;  1IP6 A;  1LZA A;  1GD6 A;  3VW7 A;  1L91 A;  1BB7 A;  2BQJ A;  4NSJ A;  1JJ3 A;  1JTN A;  199L A;  1T8F A;  5KXR A;  1C6N A;  4ETC A;  1L61 A;  1JPO A;  3M18 B;  2LZ2 A;  2B75 A;  1C6E A;  4I7K A;  4G49 A;  1G7I C;  3TXI A;  4NY5 A;  1L93 A;  2BQL A;  4U3X B;  1REM A;  1LZC A;  3QY4 A;  4DAJ A;  2XJW A;  4QDN A;  1QT6 A;  4RLM A;  7LZM A;  3HH6 A;  4NSH A;  1C6J A;  4AGA A;  3WVX A;  4I7S A;  1OUJ A;  3V2Y A;  1B5W A;  1SWZ A;  196L A;  1LYE A;  1EPY A;  118L A;  1LZY A;  1OP9 B;  1VAU A;  2XBR A;  122L A;  1JIT A;  4BAD A;  1GB9 A;  1D2W A;  1L90 A;  1BB3 A;  1GBX A;  3DN6 A;  2Z6B A;  1EQE A;  189L A;  1C45 A;  1L31 A;  1BWH A;  1L10 A;  5B05 A;  4I7O A;  4H91 A;  193L A;  2LYO A;  1NDM C;  4H8Z A;  3W6F A;  2OU0 X;  2B6Z A;  5B06 A;  1JKB A;  1GB8 A;  1O23 A;  1FDL Y;  3HT6 A;  3AYQ A;  154L A;  1HF4 A;  1L63 A;  4WLD A;  2D6B A;  1DZB X;  102L A;  1DYF A;  1VDS A;  5FEL A;  5I4X A;  4H94 A;  1TLA A;  1LYO A;  2RAY X;  1CKH A;  236L A;  3QNG A;  186L A;  1GXV 2;  4ANR A;  1G0P A;  1D3F A;  2BQK A;  4EKP A;  4GCD A;  5IDD A;  4DD7 A;  1G1V A;  2ZIK A;  4GLV A;  5LIO A;  4NIJ A;  2H9J A;  1L35 A;  1LYI A;  5APE A;  4ARM A;  1LSE A;  2Z19 A;  1C7P A;  4NGJ A;  4ETE A;  4W96 A;  1GB0 A;  3B0K A;  2NTG A;  3CSQ A;  4DDC A;  4HTN A;  2BLX A;  1YQV Y;  5C6I A;  1VDT A;  2OEA X;  2OE9 X;  2BPU A;  1L28 A;  1GF6 A;  4UWV A;  4WLT A;  2RB0 X;  3W6C A;  2EKS C;  1P3N A;  3JR6 A;  1JTT L;  4NHI A;  4AXT A;  216L A;  2W1L A;  2GV0 A;  4FDY A;  4H8Y A;  5D5F A;  4D9Z A;  1B5X A;  1P5C A;  3LYT A;  5KY1 A;  1L12 A;  1TCY A;  2MEB A;  1UIB A;  4B4J A;  5K7O A;  1AT5 A;  4LFX A;  1I6S A;  1ALC A;  1HEO A;  3AZ4 A;  1IOS A;  1QUO A;  3DN0 A;  4PK0 A;  4TSC A;  114L A;  1LJE A;  2PC2 A;  1UC0 A;  1HFZ A;  243L A;  3ZEK A;  211L A;  1UID A;  4C5F A;  2YBL A;  3VWO A;  1WQR A;  1JTM A;  2ZYP A;  1D3M A;  1L22 A;  3SB5 A;  4DYG A;  3WUL A;  1L77 A;  5I54 A;  1LMA A;  4N0J A;  1L75 A;  4OWE A;  1QDR A;  3HH4 A;  3ATO A;  1CX6 A;  1P6Y A;  1HEM A;  3C7W A;  1C6K A;  1C6P A;  190L A;  1G0J A;  2MEA A;  4UWU A;  4N8Z A;  1OVK A;  3IJU A;  1HER A;  215L A;  135L A;  1D6P A;  1NHE A;  4ARL A;  2LZT A;  1QTE A;  4WM5 A;  1JWR A;  2A7D A;  1TDY A;  3DN1 A;  3A93 A;  253L A;  1IC5 Y;  1I1Z A;  3A6B Y;  1L42 A;  2C8P A;  3GUK A;  5DLA A;  2Z39 A;  107L A;  4KT3 A;  227L A;  1FKQ A;  1LZ1 A;  5F9X A;  2ZNX Y;  213L A;  2YSS C;  1GWD A;  4PJZ A;  5D5C A;  1G7M C;  1LJG A;  131L A;  3A3R X;  1LHI A;  1L27 A;  4KXI A;  205L A;  1GF5 A;  1GB3 A;  1LSY A;  2HUL A;  183L A;  5KXS A;  2EQL A;  1LSD A;  5FDJ A;  4QY9 A;  1OUG A;  1SLY A;  4PPO A;  4NWH A;  4LGK A;  2RB2 X;  1G7L C;  1L48 A;  176L A;  4LDL A;  3K3T A;  4HTK A;  1T8A A;  5F16 A;  3DMZ A;  4MCK A;  1PS5 A;  3HUQ A;  1DQJ C;  1L43 A;  1LW9 A;  3SP3 A;  164L A;  232L A;  3B0O A;  1NMM A;  1SSY A;  3NY9 A;  4ZIX A;  1L0J A;  1L98 A;  3FAD A;  4WMG A;  4OW1 A;  142L A;  1VDP A;  4H9A A;  2Q0M X;  1L88 A;  4H9C A;  5DN4 A;  1D0M A;  260L A;  1L69 A;  4M4O A;  1QSA A;  2Y8P A;  4ET8 A;  4ZFP A;  2RBN A;  1CV1 A;  1C69 A;  4W58 A;  4NSG A;  3GUI A;  3WU7 A;  4I7J A;  4HSF A;  1UBZ A;  109L A;  4KL7 A;  3DN4 A;  3HH3 A;  3DN3 A;  5FST A;  1L60 A;  1BB5 A;  1XGR C;  1B7R A;  2F4G A;  1C43 A;  4NHT A;  4LYM A;  3HUA A;  1CX7 A;  1DYB A;  4EKR A;  3LN2 A;  4WLX A;  3WPL A;  3TXE A;  197L A;  3DKE X;  1LMC A;  1REY A;  2LYZ A;  1IP5 A;  4XAD A;  3UON A;  4QGZ A;  4L41 A;  170L A;  166L A;  4W59 A;  1L08 A;  3HDE A;  1E8L A;  3IWR A;  153L A;  1L64 A;  3P4Z A;  2WAR A;  1LZT A;  1CKC A;  1MEL L;  2H9K A;  1HNL A;  212L A;  1C6B A;  2HUM A;  4I7P A; 
#chains in the Genus database with same CATH homology
 1L07 A;  2OU9 A;  1CVK A;  1UIH A;  1LMP A;  4RW2 A;  4J7V A;  1RCM A;  4TTD A;  2AUB A;  2DQG Y;  4LZM A;  1XJU A;  1HFX A;  3LHM A;  1LHK A;  3SB7 A;  1L99 A;  4WLY A;  1LZ5 A;  1H87 A;  4NGW A;  1D9W A;  1JSE A;  2RSC A;  1DYD A;  1IC7 Y;  2BQG A;  1FKV A;  3HT9 A;  1WQM A;  1B7Q A;  4ARQ A;  1L09 A;  1GB5 A;  3DN8 A;  1GBZ A;  1L17 A;  2F32 A;  1LHJ A;  1LZ9 A;  4H9I A;  255L A;  3B0I A;  4EXM A;  2B6T A;  1SQ2 L;  1GBO A;  1L18 A;  1GB6 A;  1JUG A;  3HT7 A;  3ZVQ B;  1C6D A;  3W3E A;  4B4I A;  2RH1 A;  2CDS A;  3HH5 A;  1UA6 Y;  4W56 A;  1QUS A;  1GEV A;  4GCC A;  1L20 A;  1QTZ A;  1L29 A;  1WVV A;  1L47 A;  5LA8 A;  240L A;  2RBR A;  2Z2F A;  1G06 A;  4XN6 A;  1LJF A;  1GFR A;  1L45 A;  3TXJ A;  113L A;  2B6Y A;  2DQC Y;  3AZ7 A;  4BAF A;  4NHP A;  3TMU A;  1VDQ A;  1C6T A;  1DKJ A;  3CDO A;  248L A;  4W94 A;  4NEB A;  1B5U A;  1BHZ A;  2HEB A;  3SBA A;  1D6Q A;  1HMK A;  214L A;  3OK0 A;  5LZM A;  2RBO A;  1YIK A;  1LPI A;  4I7N A;  1L79 A;  4LT1 A;  1QS5 A;  2OU8 A;  231L A;  2ZNW Y;  4GCF A;  2HEC A;  1IWX A;  245L A;  1L89 A;  1GE1 A;  3DNA A;  3RU5 A;  1LOZ A;  6LYZ A;  1L13 A;  3M3U A;  2XTH A;  1DI5 A;  4GCE A;  3J6K A;  3C81 A;  2DQH Y;  3ULR A;  1G0G A;  5HLL A;  1LYZ A;  138L A;  1L66 A;  1FLQ A;  1GF0 A;  219L A;  2OTZ X;  2MEH A;  4W52 A;  1P46 A;  4NGL A;  4N1C C;  1F6S A;  4EMN A;  4CFP A;  1W6Z A;  3HTF A;  3NY8 A;  3MGW A;  4PRU A;  3WUN A;  3EXD A;  4E97 A;  3G3X A;  3GUN A;  1H6M A;  4G9S A;  1L34 A;  4H93 A;  1TEW A;  238L A;  1LJI A;  4PJ2 C;  1IP1 A;  1PZY A;  5E9R A;  5F14 A;  224L A;  3CT5 A;  2FBB A;  1L02 A;  1AT6 A;  5KXO A;  1L16 A;  1LSF A;  198L A;  5C6J A;  1KXX A;  1TBY A;  257L A;  1UIE A;  4DD9 A;  165L A;  157L A;  172L A;  1LJN A;  3GUO A;  4LT0 A;  3A92 A;  4HJY A;  5LYT A;  4RW1 A;  1L0K A;  4W51 A;  3CT0 A;  1L94 A;  4HV1 A;  2BQF A;  1T6H A;  1LYH A;  2HU1 A;  4EKS A;  2MED A;  4LYB A;  4WM6 A;  5L3I A;  5F81 A;  141L A;  3WMK A;  2Q9D A;  1GXX A;  1L05 A;  3G3W A;  4LYT A;  1F0W A;  182L A;  2LCB A;  2CUU A;  1OUI A;  173L A;  191L A;  3RZ4 A;  1PQK A;  1LWG A;  1QT8 A;  2HTX A;  1FLW A;  1IOQ A;  4H1P A;  1LHH A;  1L57 A;  3C82 A;  1IC4 Y;  4LFP A;  225L A;  1INU A;  1XGP C;  7LYZ A;  1L06 A;  1LYJ A;  1LSG A;  1L58 A;  3HFM Y;  1CJ9 A;  2ZQ4 A;  3FI5 A;  1KXY A;  187L A;  4NWE A;  1CJ7 A;  1L33 A;  1ZUR A;  217L A;  2BQC A;  5LA5 A;  2O79 A;  1LSN A;  1KW5 A;  1C6M A;  2CGI A;  4DQJ A;  1LMN A;  1OWY A;  4XEN A;  4A7D A;  2D4K A;  2XQO A;  4H8X A;  2QB0 B;  1IOR A;  1L21 A;  2HEF A;  1L44 A;  207L A;  3A3Q A;  2YBH A;  3ODU A;  2Z2E A;  1DI3 A;  3TMV A;  2LYM A;  1C63 A;  254L A;  3G3V A;  4I7R A;  221L A;  1CU0 A;  1B5V A;  4NGO A;  1KXW A;  4Z98 A;  3F6Z A;  2ANV A;  3GUP A;  1LYG A;  4DQ5 A;  1L49 A;  3RUN A;  5KXT A;  1CJ8 A;  3C80 A;  1SX2 A;  5LVG A;  1YKZ X;  4K5Y A;  1B2K A;  2BQA A;  1NF5 A;  233L A;  3P66 A;  4XJF A;  1GDX A;  1D2Y A;  1JHL A;  133L A;  1REX A;  261L A;  4BS7 A;  1QT4 A;  1L38 A;  1LGX A;  2ZIJ A;  1GPQ C;  1QDT A;  1DYG A;  1IP2 A;  1SSW A;  1CNS A;  3AGG G;  1C6G A;  230L A;  1C66 A;  1LKR A;  119L A;  1UIG A;  1L85 A;  4RDS A;  1LTM A;  251L A;  3D4S A;  5EBH A;  1QS9 A;  1L95 A;  222L A;  1LZ4 A;  228L A;  1CUQ A;  1DYA A;  1L25 A;  3C7Z A;  252L A;  4W57 A;  1LMT A;  1XEJ A;  1A4V A;  237L A;  4WO9 A;  4DWX A;  4GN5 C;  1FN5 A;  2OE7 X;  4OWB A;  6LZM A;  2G4N A;  5FEK A;  2F2N A;  1L41 A;  4CJ2 A;  5KXM A;  4I7L A;  1CV6 A;  3A34 A;  1HEQ A;  4NGI A;  1EQ5 A;  3EML A;  1LHM A;  4FJR A;  3IJV A;  3AW6 A;  3P64 A;  3E3D A;  223L A;  1IIZ A;  1B0D A;  3A96 A;  1LCN A;  2MEF A;  3AW7 A;  1CV4 A;  111L A;  4NFV A;  4N5R A;  4DD2 A;  4LDE A;  4R0F A;  5B59 A;  1LJ4 A;  4H90 A;  1QTK A;  4I8S A;  5KKI A;  1NBY C;  3WU9 A;  4WL7 A;  1LYY A;  1LJH A;  4LYC A;  4J1B A;  2RB1 X;  3TXH A;  1WTH A;  1B7S A;  4NSI A;  1AM7 A;  1W08 A;  4ET9 A;  1B7N A;  2MEI A;  1WQO A;  128L A;  4DC4 A;  4AQN A;  1C6L A;  3A94 A;  104L A;  2F4A A;  1LGW A;  188L A;  4YM8 A;  2ANX A;  3GUL A;  1L55 A;  1KY1 A;  4ZEE A;  5B07 A;  1LHL A;  2F2Q A;  2OTY X;  1NHB A;  2BQI A;  1LJ3 A;  1XGQ C;  148L E;  3D3D A;  5KXL A;  5KXW A;  155L A;  1BQL Y;  1C6H A;  5ILF A;  4HJZ A;  1L80 A;  4XJH A;  2OE4 X;  1J1P Y;  184L A;  1BVX A;  5I4W A;  1D3J A;  4WM2 A;  3CDR A;  1KS3 A;  3WXT A;  126L A;  1GF3 A;  1L71 A;  4UWN A;  4WG1 A;  1L19 A;  1LZE A;  1GFG A;  3WUM A;  1B5Y A;  1KIR C;  2N5Z A;  1HHL A;  3GUJ A;  4LZT A;  5KXP A;  3L64 A;  4TX7 A;  4DD3 A;  4QEQ A;  4EPF A;  5E4P A;  145L A;  209L A;  1C6A A;  1LI2 A;  1IR9 A;  5I4Y A;  1BB6 A;  4Z41 A;  1I20 A;  5L3H A;  1PQM A;  1IO5 A;  1CV0 A;  4DJH A;  1L72 A;  1YAN A;  1MLC E;  2MEG A;  4OO9 A;  1CU2 A;  5DM9 A;  3A8Z A;  3F8V A;  2F47 A;  3HU9 A;  1L37 A;  1XEI A;  3SB9 A;  4XJB A;  1KW7 A;  149L A;  1QT3 A;  1IEE A;  2I25 L;  3C8S A;  1GE0 A;  5I5Q A;  5HMV A;  1VAT A;  1GE2 A;  1FLY A;  1HEW A;  1LAA A;  3WW6 A;  2BLY A;  2DQF C;  1P56 A;  1L97 A;  5C6L A;  1IR7 A;  1OVH A;  4H92 A;  2DQE Y;  1HEN A;  1QQY A;  1OUH A;  3A91 A;  1L26 A;  160L A;  2BQO A;  151L A;  1FLU A;  1HSW A;  1HEP A;  1OV7 A;  3BKH A;  1L24 A;  3CDV A;  3TXF A;  5KKJ A;  1IVM A;  2B7X A;  4N9R A;  3TMW A;  3HBE X;  2YDG A;  2B73 A;  1ZWN A;  4MST A;  4DKL A;  4BAP A;  3DMV A;  3BKV A;  4NHS A;  1BGI A;  2O4W A;  2NTH A;  4M6D A;  4CHX A;  1L92 A;  1QUH A;  2BQH A;  1LPY A;  3L2X A;  1L52 A;  177L A;  1KNI A;  3WXU A;  4GRV A;  1JTP L;  1LSC A;  1F10 A;  2B72 A;  4NG8 A;  4YXA C;  3EBA B;  1JJ0 A;  1DPX A;  2B6X A;  1L59 A;  1IR8 A;  3AGI A;  1YAO A;  1T6V L;  2I26 L;  4G4C A;  1QTV A;  2FYD A;  1GFU A;  4HTQ A;  2DQI Y;  1P2L A;  192L A;  2Z37 A;  226L A;  1WTN A;  3W6A A;  1LSA A;  3C83 A;  4KPM A;  1WQQ A;  4LT3 A;  3OE0 A;  241L A;  1L54 A;  256L A;  3WYH A;  3T36 A;  2YBI A;  2ZIL A;  3FE0 A;  5LAF A;  4EOF A;  2MEC A;  3AZ5 A;  3SBB C;  1GEZ A;  194L A;  1IWZ A;  2ZYC A;  4TWS A;  1NBZ C;  3TMX A;  1KY0 A;  3HTD A;  4LYZ A;  5J7C A;  5LYZ A;  1GFH A;  1L40 A;  5HNL A;  3G3A B;  4J1A A;  4XJD A;  2I6Z A;  1UIF A;  1C68 A;  1CJ6 A;  3C7Y A;  1SWY A;  4YEN A;  1L50 A;  1L56 A;  1UAC Y;  5LIN A;  1YAM A;  4NG1 A;  1I56 A;  3K2R A;  1JEF A;  3P68 A;  1NDG C;  4S0W A;  2HU3 A;  1L74 A;  143L A;  1YKY X;  1LSZ A;  4I7T A;  3HU8 A;  4OWA A;  1JSF A;  4ARQ B;  4YEM A;  3W6D A;  4CFO A;  1L84 A;  3OE9 A;  5B1F A;  5HNC A;  123L A;  1DKK A;  1JKD A;  185L A;  5KXZ A;  3PDS A;  4OWC A;  4WO6 A;  1P2R A;  3AGH A;  3B72 A;  5APD A;  1V7T A;  4W53 A;  2F30 A;  1UIC A;  206L A;  247L A;  1L30 A;  1IOC A;  3SB8 A;  1KIQ C;  1T97 A;  3FI7 A;  1RFP A;  242L A;  3B6L A;  1B9O A;  4IAP A;  4E3U A;  1LZR A;  1GBS A;  3WL2 A;  180L A;  2LC9 A;  5IEL A;  5B1G A;  4O34 A;  171L A;  1GFK A;  4DDB A;  2CWI A;  5LVJ A;  1HFY A;  134L A;  1D0K A;  1QSQ A;  2IHL A;  5AMY A;  147L A;  2LHM A;  4YF2 A;  1LYF A;  2G4Q A;  1IY3 A;  1L53 A;  4Z3M A;  2BQN A;  4DDA A;  2FBD A;  3WU8 A;  1QUD A;  1C65 A;  2D4J A;  1GFT A;  4ETA A;  1YAP A;  4N1E I;  2MEE A;  4EJ4 A;  1IWV A;  1RJC B;  103L A;  4H9E A;  4W55 A;  4WM3 A;  112L A;  4YOP A;  1CV5 A;  1L73 A;  2RAZ X;  5HMJ A;  2BQM A;  4ETD A;  3QAK A;  3N9A A;  3QE8 A;  5KXY A;  2H5Z A;  259L A;  3HTG A;  144L A;  1YRO A;  1L82 A;  1C6I A;  1BVK C;  1HSX A;  1LKS A;  3TXB A;  4C3W A;  169L A;  220L A;  3W6E A;  4HP0 A;  1L65 A;  235L A;  158L A;  1GFA A;  1HC0 A;  4G4H A;  4B1A A;  137L A;  4NGK A;  1L83 A;  1REZ A;  3OE8 A;  3LYO A;  168L A;  4HV2 A;  1CU3 A;  1GBW A;  4ETB A;  1ZV5 L;  1P2C C;  2BQE A;  4XJG A;  1CTW A;  1IP3 A;  3ATN A;  3CQL A;  1LZ6 A;  3A95 A;  1N4F A;  4NHQ A;  3A6C Y;  2RBS A;  3PBL A;  1CKD A;  1QUG A;  1XEK A;  1XFP L;  2YBM A;  1QTD A;  1L81 A;  1GF7 A;  1ZYT A;  1B6I A;  5T3F A;  1GB7 A;  4CGE A;  2EIZ C;  3GXK A;  178L A;  262L A;  4YX7 C;  4TSB A;  1HEL A;  2Z18 A;  5L9J A;  1DI4 A;  4DD1 A;  3HBD A;  1LI3 A;  163L A;  4GN4 A;  3KAM A;  2B70 A;  1IP4 A;  1C61 A;  258L A;  3EO5 A;  1T8G A;  1ZMY L;  3N9C A;  1LGU A;  1T3P A;  162L A;  1GHL A;  1P7S A;  3NYA A;  3WUA A;  3P65 A;  4PGJ B;  1L32 A;  3A67 Y;  3HTB A;  125L A;  1JIY A;  3CSZ A;  4ARM B;  1D9U A;  5F9U A;  3HWL A;  4ML7 A;  1JIS A;  132L A;  2ZWB A;  2VB1 A;  1QSB A;  3CDQ A;  1YL1 X;  1LI6 A;  130L A;  2A4T A;  1WVU A;  4NGV A;  1QT7 A;  4NGZ A;  1LSB A;  1OUD A;  1LJK A;  146L A;  1F6R A;  4WG7 A;  1QTH A;  1JTO L;  1G7J C;  5KJ9 A;  3CB7 A;  4J0L A;  3D9A C;  1L00 A;  1J1X Y;  4XYY A;  127L A;  4LDO A;  5DL9 A;  150L A;  1LMQ A;  4H9H A;  1OUB A;  4DD0 A;  3GXR A;  3DN2 A;  1V7S A;  3WH1 A;  1UCO A;  1PQD A;  3G3B B;  3OJP A;  4H9B A;  4Z46 A;  3RZE A;  3LYZ A;  1L51 A;  1IWY A;  4YXC A;  1L14 A;  4G4B A;  140L A;  1GF4 A;  2W1Y A;  1D0L A;  1BWJ A;  1Z55 A;  1C62 A;  1YL0 X;  3A90 A;  1LZ8 A;  156L A;  250L A;  1AKI A;  1DPW A;  1P64 A;  4WOA A;  1HML A;  5LVK A;  1G0L A;  1YAQ A;  3RW8 A;  1C64 A;  4MR1 A;  2RBQ A;  1XEP A;  1BB4 A;  139L A;  1LSP A;  1C46 A;  1PQI A;  1L96 A;  3AJN A;  1OV5 A;  5HQ1 A;  2Q9E A;  1GDW A;  1GBY A;  2L78 A;  1KIP C;  3LZT A;  1RI8 B;  1GFE A;  4B0D A;  5A3Z A;  1YIL A;  2DKV A;  239L A;  2W1X A;  1OQM A;  2W1M A;  5APF A;  1L76 A;  9LYZ A;  1A2Y C;  1C60 A;  1CU6 A;  1RE2 A;  1DYE A;  1IX0 A;  3GUM A;  4HPE A;  5LAG A;  1P36 A;  1VFB C;  1OUE A;  1OUA A;  1K28 A;  2B74 A;  218L A;  1L46 A;  3WW5 A;  2Z38 A;  2D91 A;  1EL1 A;  1QT5 A;  1QSW A;  2HEA A;  2DBT A;  1GAZ A;  1D3N A;  2G4P A;  2O7A A;  1C6F A;  5ILC A;  1IWT A;  4HJV A;  2HUK A;  3TXK A;  4IAS A;  1LJJ A;  4DQ7 A;  2DQD Y;  2YBN A;  2A7F A;  2QAR C;  3SB6 A;  152L A;  8LYZ A;  5LYM A;  1L39 A;  4ZPU A;  1B7P A;  4B4E A;  3FA0 A;  1L15 A;  4GLA A;  1LZD A;  1GE3 A;  229L A;  2DQJ Y;  1NKH A;  5A3E A;  1JJ1 A;  2IGC A;  2X0A A;  4OOT A;  4GBR B;  1J1O Y;  1OWZ A;  1IWW A;  181L A;  1C6C A;  1JKC A;  2Z12 A;  2BQB A;  4WL6 A;  5I53 A;  3CT1 A;  1DYC A;  4IJ4 A;  1GE4 A;  244L A;  4P2E A;  1QTB A;  3HDF A;  1IOT A;  4TUN A;  4GN3 A;  2LZM A;  1JQU A;  4DT3 A;  2DQA A;  1LZG A;  4R6C A;  4EKQ A;  1G7H C;  1OUF A;  3RT5 X;  1WQN A;  1LSM A;  5JEN B;  5LVI A;  5IHG A;  2BAA A;  4NGY A;  161L A;  1L03 A;  208L A;  1DXJ A;  4LT2 A;  1QIO A;  2EPE A;  1L70 A;  3AB6 A;  4I7Q A;  5M1Y A;  4B49 A;  200L A;  2FYC A;  2HED A;  3ZVQ A;  1CU5 A;  3WPJ A;  1OVJ A;  4I7M A;  5DN5 A;  4EPI A;  1TAY A;  1G0Q A;  5KXK A;  4II8 A;  1C67 A;  1XGU C;  3CSR A;  4PHI A;  4XJI A;  1XGT C;  1L23 A;  3T6U A;  3LYM A;  1OYU A;  1VED A;  1G07 A;  2XBS A;  4ARP A;  2ZQ3 A;  1ZVH L;  120L A;  4I0C A;  4GCB A;  1IP7 A;  1UIA A;  159L A;  3DMX A;  110L A;  249L A;  1CKF A;  1GB2 A;  5LVH A;  246L A;  3J4G A;  4WM4 A;  1IY4 A;  5FCP A;  2IFF Y;  1LZS A;  1NQI A;  3HT8 A;  5KXN A;  4H9F A;  4RLN A;  3F9L A;  1LWK A;  3CDT A;  174L A;  1B5Z A;  4ARJ A;  1UUZ C;  3OE6 A;  2D4I A;  1B7M A;  1L01 A;  4LYO A;  2NWD X;  3SN6 R;  2B5Z A;  2YVB A;  1QTC A;  1YKX X;  2C8O A;  3LZ2 A;  1C6Q A;  1G1W A;  234L A;  2CJL A;  3TXG A;  1WTM A;  1CKG A;  3RNX A;  1IWU A;  1GFJ A;  1G0K A;  1XSF A;  3N9E A;  5KXX A;  167L A;  1QUT A;  115L A;  195L A;  3C8R A;  3V2W A;  4YEO A;  210L A;  1GF9 A;  5I14 A;  6LYT A;  2BQD A;  2YBJ A;  1C10 A;  4PRQ A;  2HUB A;  1LZB A;  1L67 A;  1L62 A;  1L36 A;  3WPK A;  3EMS A;  3W6B A;  201L A;  5FHW A;  1L86 A;  1JKA A;  1L04 A;  3WVY A;  1PQJ A;  1B7O A;  1B7L A;  1CUP A;  4HPI A;  1GAY A;  1PQO A;  5LXW A;  1FBI X;  1ZVY B;  108L A;  1CV3 A;  1OUC A;  1L68 A;  175L A;  1LMO A;  1LYD A;  1C08 C;  2HEE A;  4IAT A;  1LLH A;  1GF8 A;  4OOO A;  1SX7 A;  1G0M A;  2RBP A;  5II3 A;  1BWI A;  2B6W A;  1L11 A;  1NWG A;  3C8Q A;  1P37 A;  129L A;  1LYS A;  1EQ4 A;  3TXD A;  3HBH A;  4W54 A;  3LZM A;  3HUK A;  5APC A;  3AZ6 A;  1WQP A;  4OWH A;  1LZN A;  4WM1 A;  1AZF A;  1GFV A;  1XJT A;  4X3B A;  1L87 A;  1IP6 A;  1LZA A;  1GD6 A;  3VW7 A;  1L91 A;  1BB7 A;  2BQJ A;  4NSJ A;  1JJ3 A;  1JTN A;  199L A;  1T8F A;  5KXR A;  1C6N A;  4ETC A;  1L61 A;  1JPO A;  3M18 B;  2LZ2 A;  2B75 A;  1C6E A;  4I7K A;  4G49 A;  1G7I C;  3TXI A;  4NY5 A;  1L93 A;  2BQL A;  4U3X B;  1REM A;  1LZC A;  3QY4 A;  4DAJ A;  2XJW A;  4QDN A;  1QT6 A;  4RLM A;  7LZM A;  3HH6 A;  4NSH A;  1C6J A;  4AGA A;  3WVX A;  4I7S A;  1OUJ A;  3V2Y A;  1B5W A;  1SWZ A;  196L A;  1LYE A;  1EPY A;  118L A;  1LZY A;  1OP9 B;  1VAU A;  2XBR A;  122L A;  1JIT A;  4BAD A;  1GB9 A;  1D2W A;  1L90 A;  1BB3 A;  1GBX A;  3DN6 A;  2Z6B A;  1EQE A;  189L A;  1C45 A;  1L31 A;  1BWH A;  1L10 A;  5B05 A;  4I7O A;  4H91 A;  193L A;  2LYO A;  1NDM C;  4H8Z A;  3W6F A;  2OU0 X;  2B6Z A;  5B06 A;  1JKB A;  1GB8 A;  1O23 A;  1FDL Y;  3HT6 A;  3AYQ A;  154L A;  1HF4 A;  1L63 A;  4WLD A;  2D6B A;  1DZB X;  102L A;  1DYF A;  1VDS A;  5FEL A;  5I4X A;  4H94 A;  1TLA A;  1LYO A;  2RAY X;  1CKH A;  236L A;  3QNG A;  186L A;  1GXV 2;  4ANR A;  1G0P A;  1D3F A;  2BQK A;  4EKP A;  4GCD A;  5IDD A;  4DD7 A;  1G1V A;  2ZIK A;  4GLV A;  5LIO A;  4NIJ A;  2H9J A;  1L35 A;  1LYI A;  5APE A;  4ARM A;  1LSE A;  2Z19 A;  1C7P A;  4NGJ A;  4ETE A;  4W96 A;  1GB0 A;  3B0K A;  2NTG A;  3CSQ A;  4DDC A;  4HTN A;  2BLX A;  1YQV Y;  5C6I A;  1VDT A;  2OEA X;  2OE9 X;  2BPU A;  1L28 A;  1GF6 A;  4UWV A;  4WLT A;  2RB0 X;  3W6C A;  2EKS C;  1P3N A;  3JR6 A;  1JTT L;  4NHI A;  4AXT A;  216L A;  2W1L A;  2GV0 A;  4FDY A;  4H8Y A;  5D5F A;  4D9Z A;  1B5X A;  1P5C A;  3LYT A;  5KY1 A;  1L12 A;  1TCY A;  2MEB A;  1UIB A;  4B4J A;  5K7O A;  1AT5 A;  4LFX A;  1I6S A;  1ALC A;  1HEO A;  3AZ4 A;  1IOS A;  1QUO A;  3DN0 A;  4PK0 A;  4TSC A;  114L A;  1LJE A;  2PC2 A;  1UC0 A;  1HFZ A;  243L A;  3ZEK A;  211L A;  1UID A;  4C5F A;  2YBL A;  3VWO A;  1WQR A;  1JTM A;  2ZYP A;  1D3M A;  1L22 A;  3SB5 A;  4DYG A;  3WUL A;  1L77 A;  5I54 A;  1LMA A;  4N0J A;  1L75 A;  4OWE A;  1QDR A;  3HH4 A;  3ATO A;  1CX6 A;  1P6Y A;  1HEM A;  3C7W A;  1C6K A;  1C6P A;  190L A;  1G0J A;  2MEA A;  4UWU A;  4N8Z A;  1OVK A;  3IJU A;  1HER A;  215L A;  135L A;  1D6P A;  1NHE A;  4ARL A;  2LZT A;  1QTE A;  4WM5 A;  1JWR A;  2A7D A;  1TDY A;  3DN1 A;  3A93 A;  253L A;  1IC5 Y;  1I1Z A;  3A6B Y;  1L42 A;  2C8P A;  3GUK A;  5DLA A;  2Z39 A;  107L A;  4KT3 A;  227L A;  1FKQ A;  1LZ1 A;  5F9X A;  2ZNX Y;  213L A;  2YSS C;  1GWD A;  4PJZ A;  5D5C A;  1G7M C;  1LJG A;  131L A;  3A3R X;  1LHI A;  1L27 A;  4KXI A;  205L A;  1GF5 A;  1GB3 A;  1LSY A;  2HUL A;  183L A;  5KXS A;  2EQL A;  1LSD A;  5FDJ A;  4QY9 A;  1OUG A;  1SLY A;  4PPO A;  4NWH A;  4LGK A;  2RB2 X;  1G7L C;  1L48 A;  176L A;  4LDL A;  3K3T A;  4HTK A;  1T8A A;  5F16 A;  3DMZ A;  4MCK A;  1PS5 A;  3HUQ A;  1DQJ C;  1L43 A;  1LW9 A;  3SP3 A;  164L A;  232L A;  3B0O A;  1NMM A;  1SSY A;  3NY9 A;  4ZIX A;  1L0J A;  1L98 A;  3FAD A;  4WMG A;  4OW1 A;  142L A;  1VDP A;  4H9A A;  2Q0M X;  1L88 A;  4H9C A;  5DN4 A;  1D0M A;  260L A;  1L69 A;  4M4O A;  1QSA A;  2Y8P A;  4ET8 A;  4ZFP A;  2RBN A;  1CV1 A;  1C69 A;  4W58 A;  4NSG A;  3GUI A;  3WU7 A;  4I7J A;  4HSF A;  1UBZ A;  109L A;  4KL7 A;  3DN4 A;  3HH3 A;  3DN3 A;  5FST A;  1L60 A;  1BB5 A;  1XGR C;  1B7R A;  2F4G A;  1C43 A;  4NHT A;  4LYM A;  3HUA A;  1CX7 A;  1DYB A;  4EKR A;  3LN2 A;  4WLX A;  3WPL A;  3TXE A;  197L A;  3DKE X;  1LMC A;  1REY A;  2LYZ A;  1IP5 A;  4XAD A;  3UON A;  4QGZ A;  4L41 A;  170L A;  166L A;  4W59 A;  1L08 A;  3HDE A;  1E8L A;  3IWR A;  153L A;  1L64 A;  3P4Z A;  2WAR A;  1LZT A;  1CKC A;  1MEL L;  2H9K A;  1HNL A;  212L A;  1C6B A;  2HUM A;  4I7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...