1AA0A

Fibritin deletion mutant e (bacteriophage t4)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
VSGLNNAVQNLQVEIGNNSAGIKGQVVALNTLVNGTNPNGSTVEERGLTNSIKANETNIASVTQEVNTAKGNISSLQGDVQALQEAGYIPEAPRDGQAYVRKDGEWVLLSTFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBRITIN
publication title Structure of bacteriophage T4 fibritin: a segmented coiled coil and the role of the C-terminal domain.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Attachment protein
total genus 38
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1997-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07921 Fibritin_C Fibritin C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 1aa0A00
2IYOA 2JKVA 1AVYA 2ZYAA 2W90A 2IZ1A 2IYPA 3FWNA 1PGJA 2IZ0A 2ZYGA 2PGDA 1PGPA 1PGOA 1NAYA 2ZYDA 1OX3A 2W8ZA 1AA0A 1PGQA
chains in the Genus database with same CATH superfamily
3HD7B 2FXMA 3AE4C 3U59A 1YJNP 3GG2A 2HG5D 3L74D 3HUSC 1CW5A 1ZMEC 2FY8A 4I2LC 1P84H 1BGYE 1LT1A 3KZIE 3L75G 2XDJA 3HE5A 1NTKG 3VOPA 2WSCH 3P8MC 1H89A 2R44A 2I1JA 4PD4I 1D7MA 1MKMA 2IZ1A 2H88C 2IYPA 1NAFA 1HGZA 1FZCB 2WSEH 4LGDE 1P84E 3GHGC 1M57D 4PV1B 1GL2B 1ZW0A 2XV5A 2GUVA 3EWKA 4CPGA 4DZOA 1FDOA 3FWNA 3RK3B 2NRGA 5CBOA 1BDDA 1DEBA 1L0ND 3VN0A 3CCVP 1SVFA 4MN4C 3L75J 2YMKA 1RQVA 1ZXGA 1JTHA 4BWNA 3F5HA 1JO5A 1LTJB 1FC2C 3V6IA 1Q86Q 3LW5H 1BE3E 1S2EA 3H1HE 1YTZI 2BEZF 2O1JA 3OA7A 1URQB 3TGUD 2QE7H 2OTJP 3AE9C 3D71A 5AVXB 3L36A 1KILA 1NGMB 2E75C 2KXPB 3VYIA 2M3BA 3CWBG 1XTGB 1Y8AA 1SQPD 2YIUC 1P84I 1PP9E 3AEBC 3RBXA 2KNCB 1J1DB 5APVA 3CCLP 2WITA 4H0LB 3M0DA 1FU1A 1JCCA 2JWDA 1VF5B 2V4HA 2OTLP 1E5WA 2W8ZA 4C7NB 1RE4A 4PD4D 3Q3DA 4U7JA 2E76B 1SQXE 1X9VA 3CCJP 4H44C 4HKZH 3L71E 3W67A 4BRYA 2WT7B 3VP8A 2P7JA 3C1LA 3PLNA 2E74D 3NXSA 2KIKA 4DJGA 1KILD 3H1KD 5APSA 2A06D 2AEJA 2HODA 3AEEC 5AW3B 1K73Q 1KORA 1HF9A 3T97B 3JCUE 1DH3A 3H32B 2HLOA 3S9OA 3VP9A 1IFDA 1KFMA 2L91A 2KSEA 2ZT9B 5CCGA 1M1JA 3CCRP 2R3CA 1SQXK 1LT9C 1SQQG 3G6EP 2QJPC 2BCCJ 3CCMP 1OWAA 2OGUA 1KYOE 3N7NA 1HTLC 1BGYD 3BCCE 3MIWA 2PFXA 3R4YA 1Q81Q 2E5YA 3G3ZA 2XKMA 1KFNA 1LTBC 2E5TA 2NZ2A 1E79H 2Q3IA 4Y99B 1T6AA 2WPQA 3B5NC 1G2CA 4AQRD 1KD1Q 1P84D 5C39A 3Q5SA 5APTA 5APYA 1NAYA 3IF4A 2CPBA 4HJGH 1RY3A 3L73E 2FYUE 1SQQJ 3FXEA 2OYHC 4ZNCA 3LIEA 5B5EH 5APQA 3HD7C 1H0TB 4EOTA 5CCGD 2W83C 3M91A 1SFCC 4R4LA 1Q2NA 2P10A 2WPSA 1ZP0C 1BE3D 1KYOI 4UB6E 3A0BH 3H1HD 2ZJSE 4LLHA 5B5EE 3V5BA 1GW4A 1AJYA 1T8ZA 1WT6A 4I6MC 1SQPJ 1BSNA 1PIXA 2Q9IA 1FZCC 3PP5A 3TYYA 2YMYA 4EYYQ 1JY3O 1NTMG 4YXWH 3GHGB 2NPSA 2DW3A 2V7QJ 5L8RJ 3A0BE 3A2AA 1PP9D 1KZUB 3H1LE 2Y9ZA 5DJUB 3MD0A 3RK3C 3U1AA 2WWWA 1KB9E 2N1TA 1AA0A 2I8DA 1IFIA 1WRGA 1T2KC 1IJDB 2RKLA 3HRNA 1HJ0A 4WY4A 3LIDA 3BATA 1S1CX 1J1EB 5AW8B 3HTKB 2B9BA 2UWJE 2JP3A 3JSVC 1LTJC 1IO4A 1GW3A 2H89C 4GOFA 1LTTC 2WSFH 5GTHH 1LWUB 1SQXD 3G71P 3L71D 1NTMJ 4EIJA 1URQC 1VQPP 1GU5A 2QG4A 2KLUA 1GZLA 3E1IA 1FZAA 5BVZA 1JY2N 1QX8A 1EDKA 1KC8Q 4JPZB 2K9JB 2R5DA 3QWOC 2GUSA 3H1JG 3KQGA 5GTHE 1IFMA 1DIPA 1EZVE 3O6QB 2NPSD 1N73A 1VQLP 5H2FH 3Q2YA 1U57A 4W7ZA 1L4AA 2RN0A 1J1DC 2JWAA 2OYIA 3V2PA 4C7RA 1L0NE 1SLQA 1KB9I 4YTPC 1KQSO 4EI2A 1VF5C 2KP8A 1GK6A 4WY4D 2JKVA 1KYOD 2QRXA 1OW6A 3A3YB 5H2FE 1NHLA 3HE5B 2JEEA 3VMYA 1FOSF 2E76C 2Q3EA 3C8VA 1FJKA 3H1JJ 3G4SP 3AE1C 2WSCJ 5BU5A 3TGUE 1FZFA 1QLED 4LC1A 2HPCA 1FDIA 2D2CD 3EFFK 3IN6A 4GOEA 1RF1A 2AXTH 5KKZC 2WSEJ 1NKZB 3N4XA 2ZYDA 3L73D 4GDOA 4D6TD 1HUCA 1EZVI 2M8RA 2YO3A 2ZVNB 1L4AD 2ZT9C 1BCCE 1KV4A 2C9NY 1JTHB 3SWYA 2FXPA 4C46A 1VDFA 1IZNB 2J59M 3GF7A 4WB4A 2FFDC 1LTAC 3SFDC 2HR3A 1SQBE 1FZGA 3IFMA 4TT3H 1NU1G 2AEMA 5EFWB 4I1LA 1GK4A 2J5UA 3LW5J 4OWFA 4Y99C 1KILB 1PP9J 1IK7A 1PPJG 3B5NB 4DT0A 2R5BA 2K1AA 2W90A 3H1KE 2A06E 3WUTA 4L76A 5CMZA 2IZ0A 3H1LD 2LR2A 3D6YA 2W6JH 1S3JA 5KJ7A 2Q7CA 2A45I 1KB9D 3KZIH 1SQBK 4XE5B 1S5LH 1EDLA 1IFNA 3RL0D 4NPFX 3V4WA 3PH0A 3E7KA 1RF0C 3L72E 1HWTC 1MFZA 2G3AA 3EFGA 1NU1J 3L71J 1ZN5A 1SFCB 3BCCG 1AV1A 4UB8E 1M7LA 1YQ3C 5AVZB 3RK2D 2QM7A 3GLMA 4YPCA 4BRYB 1S5LE 3Q5PA 3RGUA 1YHQP 2WQYC 3VMAA 4IFFA 1VQ6P 3CC2P 3M9BA 1G1JA 1R8EA 2KZJA 2HODB 2OARA 5CCHA 1EZVD 2QJKB 2FBWC 3P7KA 1KTMA 2FYUG 2Y9YA 1W2BO 1L0LG 2R3SA 5KJ7D 3CD6P 1M1JB 3BCCJ 5TISE 1USEA 2HYNA 2QM8A 5KAIH 1J1EC 4U3FE 1PGQA 1GU4A 1W5CE 4WBAA 3FXDA 2ZFCA 2IX7C 1LWUC 5B66H 3MUDC 3S1KA 4HB1A 3AEGC 5KAIE 1HBWA 1G2CB 3AE8C 2FYUJ 5CHXA 1L0LJ 4RKUJ 5B66E 1YJ9P 5CCHD 4GT1A 4WWIA 1SQVE 3CPWO 3MZWB 5KLVE 3M06A 2AXCA 1BCCD 1PFIA 1QL1A 4L74A 4NPEA 3AECC 1LGHB 4I7ZB 3H1IE 1PL5A 3L74G 2K9YA 4DCKA 1NWQA 1SQBD 3TNUB 2KSJA 1NTZD 4IFDK 1FZBA 1BDCA 2QA4P 1U7JA 3QH9A 2BCCG 4KT0J 2IFMA 1Q7YQ 1XTCC 3G9RA 3D6ZA 1SQVK 2ITAA 3JCUH 1QGKB 5KLVK 1CI6A 1RE3A 2H43A 5KKZB 2G8YA 1YTZT 3CXHD 1KYOH 3BRTB 2ZYGA 2N1TB 1N7LA 3L74J 3TK1A 3L4FA 2MJZA 3M9HA 1VL2A 2KS1A 4WY4B 1L0NG 1OVRA 3L72D 3V2RA 1GL2A 4YXDC 1VQ9P 1N7SA 2CK3H 1T3UA 1SP4A 3WUVA 4Y28J 2FFDB 2E43A 1FZEA 2E74C 3PTZA 2WSFJ 2D2CB 1K8AQ 2O1KA 3TGUG 1KILC 4JBZA 3CX5E 3L70D 3L75E 4W80A 2QEXP 1N73B 1NTKE 1SQPG 2WMMA 4JYCA 1L0NJ 5APWA 1QVGO 3U1CA 3O8ZA 4D6TE 1Z56A 2OYIB 3SWKA 3BVHA 3M0DC 4UB6H 4IOIH 2J58A 1VQNP 4U3FD 4WVZA 1H8AA 2O01N 4PV1D 1GL2D 1RE4C 1N7SD 3TGUJ 2CPSA 4K3AA 3CL3D 3GF3A 2KNCA 3UIAA 5AVTB 1M90Q 1NTKK 1YIJP 1VQ4P 1RE3C 2B87A 2HPCB 1X79B 2OTKE 2KB7P 5AVRB 1KB9H 4Z1MH 1RF1B 2IYOA 2WVRA 1S72P 2ZYAA 1DX7A 2QJYB 2I1KA 2O01H 2YXQB 3CX5I 4C7NA 2QJKC 1BCCJ 2A06G 1SQVD 5KLVD 2YKPA 1IK9A 2WT7A 5CCGC 1M1JC 3AEDC 5K5GB 3CWBE 2POHA 3H1ID 1VQ5P 3HE4B 4L73A 4JF7A 3AE5C 5AW4B 2JJLA 4N78E 2YXRB 1BGYG 1R5SA 2IBZD 3H32A 2WZ7A 1DEEG 3AEAC 5APUA 3H1KJ 3W68A 3S4RA 3WUUA 4H0LD 2QVAA 2W27A 5AVWB 1Q82Q 1FDMA 2PRRA 5TJHA 1JMBA 1T3JA 2Z4EA 5AVUB 1HH0A 2FKWB 5E79H 3OJAB 1OVUA 5AW1B 2PGDA 5KAFH 1RH5B 1G1IA 2M0BA 3Q5RA 1BGYJ 4GIFA 3IR9A 1JY3N 4I7ZC 1IFPA 5E79E 4H13D 3WMM0 1FS0E 3NMDA 2KZIA 1PGJA 4AYCA 1LTGC 4B86A 1JEKA 3AE6C 5KAFE 4PJ0E 5KTBA 5AW6B 1BE3G 1JB0J 3PHLA 3H1HG 4O9BA 1PV3A 2A45H 1CZQA 1JM0A 1NKNA 2Q1KA 1SQQE 2FYZA 4W7YA 3CX5D 2RH0A 4RESB 2NPSC 1MZ9A 3HUSA 3L75D 1NTKD 2K3RA 4HH2A 4HYTB 2VRSA 1LP1A 1AQTA 1PP9G 3CMAP 4QMAA 1EDJA 2N1TC 5AVYB 4U3FJ 2Z5IA 1GTWA 1AVYA 3IAOA 4WY4C 3CC4P 1ZV8A 1K04A 3FGAD 4OH8B 1BE3J 3GHGA 5DJTB 3H1HJ 1UIXA 1SQQK 1ZOYC 1OX3A 3RL0g 3JC22 3FX0A 3SWFA 1NTZE 1JMMA 4OGQD 2HFED 1SQXG 2C9LY 3R2PA 2H8PD 2E74B 3L71G 2D2CC 3CXHH 2MKVA 1DD4A 5M1BA 1ZR4A 4IL6X 2Y0EA 4XFJA 1OW7A 5KLVJ 3CMEP 1N73C 1OW8A 1L4AC 1L2PA 2FYNB 3CXHE 2OYIC 3H1IJ 4UB8H 2P1JA 3V4QA 1VQMP 1JY2P 3D70A 1NTZK 3CLQA 1NTME 3CWBD 5AW9B 4R4MA 3M9QA 3SFEC 3CCUP 1FJPA 2KK7A 1SQXJ 5CJ0A 4N78D 5GTIE 1KQFB 1S4XA 3B71A 4KHXA 3WU2H 3A5TA 2W6AA 1N86A 2XU6A 2RMZA 4GODA 1JY3P 1Y9BA 1CI6B 2BASA 3A7OA 1NJIQ 3AE7C 1RF1C 1EQ7A 2R32A 1OVVA 5TISH 2QJYC 3KHUA 3L70E 2BCCD 1NTMK 1M1KQ 3WU2E 3BASA 4TLFA 2XNDH 3L73G 4D6TG 2JR8A 3RL0C 2KS1B 1JUNA 3A0HH 1AQ5A 2Z5HA 1VQ8P 3CXHI 1PGPA 2KYVA 2YNYA 3H1JE 1N7SB 3P8CE 4ASVA 3RK2C 2E75D 3C9IA 2ZAEB 1EXJA 3CCQP 1RQUA 1KQLA 3A0HE 5KLIB 1OFCX 2K88A 1SQQD 4OVNF 1NTKJ 3RK3E 4DOJA 3TSIA 2IDBA 3I55P 1LT9A 3L73J 2LXBA 4D6TJ 3ITKA 2KUBA 2XNXA 4BXLA 1J2JB 1LNQA 4ZMDA 5KJ7C 1AVOA 3H1LG 4L75A 3B8EB 1OMIA 1R5LA 4H44D 4KJMA 2IFNA 2OYOA 3ZDMA 2WTYA 1JOCA 3B5NA 2YO2A 3RBZA 1EXIA 2OQQA 1LJ2A 4ZKPA 2L5GB 2O3JA 2M5AA 2LXCB 1EDIA 4XA4A 2QSIA 1Q90D 2IBZE 2OYHA 2B87B 5AVQB 2QIWA 3CCEP 1H88A 3HD7A 1HJBA 4EDFA 3H1LJ 1U7MA 1NYHA 5CCHC 2WPRA 3VMZA 1SFCA 5AW2B 2NPSB 3MTUE 1K05A 1S9KE 1QVFO 1EZVG 3Q1MA 1NU1E 1YI2P 1X8YA 2YKQA 3CWBJ 1NO4A 2O01J 2AEFA 4M3LA 2YKOA 1PPJE 3GW6A 1A02J 4H13B 1NTMD 3VTPC 1FZCA 1CSBA 1S5LX 3MGNA 3B5ND 5CJ4A 2K37A 1NVOA 3CX5H 1IFJA 1NH4A 1BSHA 1FE6A 1HGVA 2JDIH 2Q6QA 4ASWA 2P67A 1NU1K 2IBZI 1JCDA 1TU3F 3HD7D 1N8RQ 1ZRTE 1X22A 1LTSC 1W2EA 3H6PA 1SFCD 1LTJA 2SPZA 2A45G 3OAKA 2FYNC 1L4AB 3OW2O 1URQA 3ABVC 1VQOP 3I56P 1BCCG 2ZXXA 3USSA 1MUUA 1PGOA 3H1JD 3V2NA 3P8CD 1YYCA 1NOHA 4OGQB 1L0LE 1SQBG 3TF5A 1NTZG 1YITP 4JYBA 1JNMA 3L35A 3RK3D 1MV8A 3KDPB 1JY2O 1T2KD 3HUSB 2XZRA 2PAJA 3TDKA 3TNUA 2Q5UA 3H1KG 1LP1B 2KOGA 5APXA 4IL6H 3CC7P 1GDTA 2FYUK 2P58A 3RL0B 1M8OB 1L0LK 2GM4A 1KN7A 1URQD 3PRJA 4PV1C 1GL2C 1SQBJ 1VQKP 1N7SC 1NTZJ 3L72G 1UIIA 4IL6E 3RK2B 3KYQA 5KLIC 3T97A 5BU8B 3FWLA 4N6JA 5AW7B 3M0AA 1A02F 1OIPA 4JQ0D 1IC2A 1EC5A 1FBMA 4ZKUA 3H25A 3L74E 5AVVB 1X0TA 1WMKA 4K35A 1VF5D 1S9KD 2N9BA 2P2UA 1KQGB 2FFDA 3L70G 1NU1D 1QEXA 5AVSB 2BCCE 3L72J 2E76D 1AFOA 1DD3A 4NPDA 2Y0CA 1PPJD 4PJ0H 3PJSK 4N3YB 3AEFC 2PP6A 2E75B 2WPVB 3GMAA 4RO0A 1USDA 2W6BA 4RJTA 4U3FG 2C0XA 2YIUB 2C0WA 1MFTA 1HVVA 3EQ2A 1PZQA 2KLVA 1OXZA 4H0LC 2GA1A 2N1TD 1VQ7P 3MHVA 1KMIZ 3L70J 3KPEA 1H0TA 4A7PA 2ZT9D 5AW0B 1RF0A 1ZRTD 3AE2C 1FOSE 3BCCD 3B4SA 2E42A 1K9MQ 1VPCA 1ZLLA 1Y47A 3CCSP 3AE3C 4H44B 1SQVG 1M56D 2FXOA 5KLVG 1OZHA 2B88A 2H7HA 2V7QH 3VMXA 4H13C 1YBKA 1FAVA 1L0NK 2BEQD 1SQPE 3H1IG 2FYUD 3NFQA 1L0LD 1LTIC 3SSUA 2JO1A 4GKGA 2WSSH 3NTNA 4PD4H 1GD2E 1RHZB 2IBZG 1YQ4C 2AXTE 2IPPA 1LT9B 1YJWP 2QJPB 2Y0DA 1SQVJ 3HE4A 2ZXEB 3P32A 3HTKA 4PD4E 2ZVOB 1LWUA 3L37A 2B89A 1QL2A 4IFMA 1SQPK 3MUDA 2KI7B 5GTIH 1ZR2A 3II6A 5CBNA 1KILE 2K9JA 2M5AB 3F89A 3I5CA 2M3EA 4AUWA 4OGQC 3E1RA 3O6QA 2N9YB 3BRVB 2LKMA 3K5BA 3V2QA 1SS1A 1GMJA 2OYHB 3MP7B 3KXDA 3CI9A 1N2DC 5AW5B
chains in the Genus database with same CATH topology
2IYOA 2JKVA 1AVYA 2ZYAA 2W90A 2IZ1A 2IYPA 3FWNA 1PGJA 2IZ0A 2ZYGA 2PGDA 1PGPA 1PGOA 1NAYA 2ZYDA 1OX3A 2W8ZA 1AA0A 1PGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IYO A;  2JKV A;  1AVY A;  2ZYA A;  2W90 A;  2IZ1 A;  2IYP A;  3FWN A;  1PGJ A;  2IZ0 A;  2ZYG A;  2PGD A;  1PGP A;  1PGO A;  1NAY A;  2ZYD A;  1OX3 A;  2W8Z A;  1AA0 A;  1PGQ A; 
#chains in the Genus database with same CATH topology
 3HD7 B;  2FXM A;  3AE4 C;  3U59 A;  1YJN P;  3GG2 A;  2HG5 D;  3L74 D;  3HUS C;  1CW5 A;  1ZME C;  2FY8 A;  4I2L C;  1P84 H;  1BGY E;  1LT1 A;  3KZI E;  3L75 G;  2XDJ A;  3HE5 A;  1NTK G;  3VOP A;  2WSC H;  3P8M C;  1H89 A;  2R44 A;  2I1J A;  4PD4 I;  1D7M A;  1MKM A;  2IZ1 A;  2H88 C;  2IYP A;  1NAF A;  1HGZ A;  1FZC B;  2WSE H;  4LGD E;  1P84 E;  3GHG C;  1M57 D;  4PV1 B;  1GL2 B;  1ZW0 A;  2XV5 A;  2GUV A;  3EWK A;  4CPG A;  4DZO A;  1FDO A;  3FWN A;  3RK3 B;  2NRG A;  5CBO A;  1BDD A;  1DEB A;  1L0N D;  3VN0 A;  3CCV P;  1SVF A;  4MN4 C;  3L75 J;  2YMK A;  1RQV A;  1ZXG A;  1JTH A;  4BWN A;  3F5H A;  1JO5 A;  1LTJ B;  1FC2 C;  3V6I A;  1Q86 Q;  3LW5 H;  1BE3 E;  1S2E A;  3H1H E;  1YTZ I;  2BEZ F;  2O1J A;  3OA7 A;  1URQ B;  3TGU D;  2QE7 H;  2OTJ P;  3AE9 C;  3D71 A;  5AVX B;  3L36 A;  1KIL A;  1NGM B;  2E75 C;  2KXP B;  3VYI A;  2M3B A;  3CWB G;  1XTG B;  1Y8A A;  1SQP D;  2YIU C;  1P84 I;  1PP9 E;  3AEB C;  3RBX A;  2KNC B;  1J1D B;  5APV A;  3CCL P;  2WIT A;  4H0L B;  3M0D A;  1FU1 A;  1JCC A;  2JWD A;  1VF5 B;  2V4H A;  2OTL P;  1E5W A;  2W8Z A;  4C7N B;  1RE4 A;  4PD4 D;  3Q3D A;  4U7J A;  2E76 B;  1SQX E;  1X9V A;  3CCJ P;  4H44 C;  4HKZ H;  3L71 E;  3W67 A;  4BRY A;  2WT7 B;  3VP8 A;  2P7J A;  3C1L A;  3PLN A;  2E74 D;  3NXS A;  2KIK A;  4DJG A;  1KIL D;  3H1K D;  5APS A;  2A06 D;  2AEJ A;  2HOD A;  3AEE C;  5AW3 B;  1K73 Q;  1KOR A;  1HF9 A;  3T97 B;  3JCU E;  1DH3 A;  3H32 B;  2HLO A;  3S9O A;  3VP9 A;  1IFD A;  1KFM A;  2L91 A;  2KSE A;  2ZT9 B;  5CCG A;  1M1J A;  3CCR P;  2R3C A;  1SQX K;  1LT9 C;  1SQQ G;  3G6E P;  2QJP C;  2BCC J;  3CCM P;  1OWA A;  2OGU A;  1KYO E;  3N7N A;  1HTL C;  1BGY D;  3BCC E;  3MIW A;  2PFX A;  3R4Y A;  1Q81 Q;  2E5Y A;  3G3Z A;  2XKM A;  1KFN A;  1LTB C;  2E5T A;  2NZ2 A;  1E79 H;  2Q3I A;  4Y99 B;  1T6A A;  2WPQ A;  3B5N C;  1G2C A;  4AQR D;  1KD1 Q;  1P84 D;  5C39 A;  3Q5S A;  5APT A;  5APY A;  1NAY A;  3IF4 A;  2CPB A;  4HJG H;  1RY3 A;  3L73 E;  2FYU E;  1SQQ J;  3FXE A;  2OYH C;  4ZNC A;  3LIE A;  5B5E H;  5APQ A;  3HD7 C;  1H0T B;  4EOT A;  5CCG D;  2W83 C;  3M91 A;  1SFC C;  4R4L A;  1Q2N A;  2P10 A;  2WPS A;  1ZP0 C;  1BE3 D;  1KYO I;  4UB6 E;  3A0B H;  3H1H D;  2ZJS E;  4LLH A;  5B5E E;  3V5B A;  1GW4 A;  1AJY A;  1T8Z A;  1WT6 A;  4I6M C;  1SQP J;  1BSN A;  1PIX A;  2Q9I A;  1FZC C;  3PP5 A;  3TYY A;  2YMY A;  4EYY Q;  1JY3 O;  1NTM G;  4YXW H;  3GHG B;  2NPS A;  2DW3 A;  2V7Q J;  5L8R J;  3A0B E;  3A2A A;  1PP9 D;  1KZU B;  3H1L E;  2Y9Z A;  5DJU B;  3MD0 A;  3RK3 C;  3U1A A;  2WWW A;  1KB9 E;  2N1T A;  1AA0 A;  2I8D A;  1IFI A;  1WRG A;  1T2K C;  1IJD B;  2RKL A;  3HRN A;  1HJ0 A;  4WY4 A;  3LID A;  3BAT A;  1S1C X;  1J1E B;  5AW8 B;  3HTK B;  2B9B A;  2UWJ E;  2JP3 A;  3JSV C;  1LTJ C;  1IO4 A;  1GW3 A;  2H89 C;  4GOF A;  1LTT C;  2WSF H;  5GTH H;  1LWU B;  1SQX D;  3G71 P;  3L71 D;  1NTM J;  4EIJ A;  1URQ C;  1VQP P;  1GU5 A;  2QG4 A;  2KLU A;  1GZL A;  3E1I A;  1FZA A;  5BVZ A;  1JY2 N;  1QX8 A;  1EDK A;  1KC8 Q;  4JPZ B;  2K9J B;  2R5D A;  3QWO C;  2GUS A;  3H1J G;  3KQG A;  5GTH E;  1IFM A;  1DIP A;  1EZV E;  3O6Q B;  2NPS D;  1N73 A;  1VQL P;  5H2F H;  3Q2Y A;  1U57 A;  4W7Z A;  1L4A A;  2RN0 A;  1J1D C;  2JWA A;  2OYI A;  3V2P A;  4C7R A;  1L0N E;  1SLQ A;  1KB9 I;  4YTP C;  1KQS O;  4EI2 A;  1VF5 C;  2KP8 A;  1GK6 A;  4WY4 D;  2JKV A;  1KYO D;  2QRX A;  1OW6 A;  3A3Y B;  5H2F E;  1NHL A;  3HE5 B;  2JEE A;  3VMY A;  1FOS F;  2E76 C;  2Q3E A;  3C8V A;  1FJK A;  3H1J J;  3G4S P;  3AE1 C;  2WSC J;  5BU5 A;  3TGU E;  1FZF A;  1QLE D;  4LC1 A;  2HPC A;  1FDI A;  2D2C D;  3EFF K;  3IN6 A;  4GOE A;  1RF1 A;  2AXT H;  5KKZ C;  2WSE J;  1NKZ B;  3N4X A;  2ZYD A;  3L73 D;  4GDO A;  4D6T D;  1HUC A;  1EZV I;  2M8R A;  2YO3 A;  2ZVN B;  1L4A D;  2ZT9 C;  1BCC E;  1KV4 A;  2C9N Y;  1JTH B;  3SWY A;  2FXP A;  4C46 A;  1VDF A;  1IZN B;  2J59 M;  3GF7 A;  4WB4 A;  2FFD C;  1LTA C;  3SFD C;  2HR3 A;  1SQB E;  1FZG A;  3IFM A;  4TT3 H;  1NU1 G;  2AEM A;  5EFW B;  4I1L A;  1GK4 A;  2J5U A;  3LW5 J;  4OWF A;  4Y99 C;  1KIL B;  1PP9 J;  1IK7 A;  1PPJ G;  3B5N B;  4DT0 A;  2R5B A;  2K1A A;  2W90 A;  3H1K E;  2A06 E;  3WUT A;  4L76 A;  5CMZ A;  2IZ0 A;  3H1L D;  2LR2 A;  3D6Y A;  2W6J H;  1S3J A;  5KJ7 A;  2Q7C A;  2A45 I;  1KB9 D;  3KZI H;  1SQB K;  4XE5 B;  1S5L H;  1EDL A;  1IFN A;  3RL0 D;  4NPF X;  3V4W A;  3PH0 A;  3E7K A;  1RF0 C;  3L72 E;  1HWT C;  1MFZ A;  2G3A A;  3EFG A;  1NU1 J;  3L71 J;  1ZN5 A;  1SFC B;  3BCC G;  1AV1 A;  4UB8 E;  1M7L A;  1YQ3 C;  5AVZ B;  3RK2 D;  2QM7 A;  3GLM A;  4YPC A;  4BRY B;  1S5L E;  3Q5P A;  3RGU A;  1YHQ P;  2WQY C;  3VMA A;  4IFF A;  1VQ6 P;  3CC2 P;  3M9B A;  1G1J A;  1R8E A;  2KZJ A;  2HOD B;  2OAR A;  5CCH A;  1EZV D;  2QJK B;  2FBW C;  3P7K A;  1KTM A;  2FYU G;  2Y9Y A;  1W2B O;  1L0L G;  2R3S A;  5KJ7 D;  3CD6 P;  1M1J B;  3BCC J;  5TIS E;  1USE A;  2HYN A;  2QM8 A;  5KAI H;  1J1E C;  4U3F E;  1PGQ A;  1GU4 A;  1W5C E;  4WBA A;  3FXD A;  2ZFC A;  2IX7 C;  1LWU C;  5B66 H;  3MUD C;  3S1K A;  4HB1 A;  3AEG C;  5KAI E;  1HBW A;  1G2C B;  3AE8 C;  2FYU J;  5CHX A;  1L0L J;  4RKU J;  5B66 E;  1YJ9 P;  5CCH D;  4GT1 A;  4WWI A;  1SQV E;  3CPW O;  3MZW B;  5KLV E;  3M06 A;  2AXC A;  1BCC D;  1PFI A;  1QL1 A;  4L74 A;  4NPE A;  3AEC C;  1LGH B;  4I7Z B;  3H1I E;  1PL5 A;  3L74 G;  2K9Y A;  4DCK A;  1NWQ A;  1SQB D;  3TNU B;  2KSJ A;  1NTZ D;  4IFD K;  1FZB A;  1BDC A;  2QA4 P;  1U7J A;  3QH9 A;  2BCC G;  4KT0 J;  2IFM A;  1Q7Y Q;  1XTC C;  3G9R A;  3D6Z A;  1SQV K;  2ITA A;  3JCU H;  1QGK B;  5KLV K;  1CI6 A;  1RE3 A;  2H43 A;  5KKZ B;  2G8Y A;  1YTZ T;  3CXH D;  1KYO H;  3BRT B;  2ZYG A;  2N1T B;  1N7L A;  3L74 J;  3TK1 A;  3L4F A;  2MJZ A;  3M9H A;  1VL2 A;  2KS1 A;  4WY4 B;  1L0N G;  1OVR A;  3L72 D;  3V2R A;  1GL2 A;  4YXD C;  1VQ9 P;  1N7S A;  2CK3 H;  1T3U A;  1SP4 A;  3WUV A;  4Y28 J;  2FFD B;  2E43 A;  1FZE A;  2E74 C;  3PTZ A;  2WSF J;  2D2C B;  1K8A Q;  2O1K A;  3TGU G;  1KIL C;  4JBZ A;  3CX5 E;  3L70 D;  3L75 E;  4W80 A;  2QEX P;  1N73 B;  1NTK E;  1SQP G;  2WMM A;  4JYC A;  1L0N J;  5APW A;  1QVG O;  3U1C A;  3O8Z A;  4D6T E;  1Z56 A;  2OYI B;  3SWK A;  3BVH A;  3M0D C;  4UB6 H;  4IOI H;  2J58 A;  1VQN P;  4U3F D;  4WVZ A;  1H8A A;  2O01 N;  4PV1 D;  1GL2 D;  1RE4 C;  1N7S D;  3TGU J;  2CPS A;  4K3A A;  3CL3 D;  3GF3 A;  2KNC A;  3UIA A;  5AVT B;  1M90 Q;  1NTK K;  1YIJ P;  1VQ4 P;  1RE3 C;  2B87 A;  2HPC B;  1X79 B;  2OTK E;  2KB7 P;  5AVR B;  1KB9 H;  4Z1M H;  1RF1 B;  2IYO A;  2WVR A;  1S72 P;  2ZYA A;  1DX7 A;  2QJY B;  2I1K A;  2O01 H;  2YXQ B;  3CX5 I;  4C7N A;  2QJK C;  1BCC J;  2A06 G;  1SQV D;  5KLV D;  2YKP A;  1IK9 A;  2WT7 A;  5CCG C;  1M1J C;  3AED C;  5K5G B;  3CWB E;  2POH A;  3H1I D;  1VQ5 P;  3HE4 B;  4L73 A;  4JF7 A;  3AE5 C;  5AW4 B;  2JJL A;  4N78 E;  2YXR B;  1BGY G;  1R5S A;  2IBZ D;  3H32 A;  2WZ7 A;  1DEE G;  3AEA C;  5APU A;  3H1K J;  3W68 A;  3S4R A;  3WUU A;  4H0L D;  2QVA A;  2W27 A;  5AVW B;  1Q82 Q;  1FDM A;  2PRR A;  5TJH A;  1JMB A;  1T3J A;  2Z4E A;  5AVU B;  1HH0 A;  2FKW B;  5E79 H;  3OJA B;  1OVU A;  5AW1 B;  2PGD A;  5KAF H;  1RH5 B;  1G1I A;  2M0B A;  3Q5R A;  1BGY J;  4GIF A;  3IR9 A;  1JY3 N;  4I7Z C;  1IFP A;  5E79 E;  4H13 D;  3WMM 0;  1FS0 E;  3NMD A;  2KZI A;  1PGJ A;  4AYC A;  1LTG C;  4B86 A;  1JEK A;  3AE6 C;  5KAF E;  4PJ0 E;  5KTB A;  5AW6 B;  1BE3 G;  1JB0 J;  3PHL A;  3H1H G;  4O9B A;  1PV3 A;  2A45 H;  1CZQ A;  1JM0 A;  1NKN A;  2Q1K A;  1SQQ E;  2FYZ A;  4W7Y A;  3CX5 D;  2RH0 A;  4RES B;  2NPS C;  1MZ9 A;  3HUS A;  3L75 D;  1NTK D;  2K3R A;  4HH2 A;  4HYT B;  2VRS A;  1LP1 A;  1AQT A;  1PP9 G;  3CMA P;  4QMA A;  1EDJ A;  2N1T C;  5AVY B;  4U3F J;  2Z5I A;  1GTW A;  1AVY A;  3IAO A;  4WY4 C;  3CC4 P;  1ZV8 A;  1K04 A;  3FGA D;  4OH8 B;  1BE3 J;  3GHG A;  5DJT B;  3H1H J;  1UIX A;  1SQQ K;  1ZOY C;  1OX3 A;  3RL0 g;  3JC2 2;  3FX0 A;  3SWF A;  1NTZ E;  1JMM A;  4OGQ D;  2HFE D;  1SQX G;  2C9L Y;  3R2P A;  2H8P D;  2E74 B;  3L71 G;  2D2C C;  3CXH H;  2MKV A;  1DD4 A;  5M1B A;  1ZR4 A;  4IL6 X;  2Y0E A;  4XFJ A;  1OW7 A;  5KLV J;  3CME P;  1N73 C;  1OW8 A;  1L4A C;  1L2P A;  2FYN B;  3CXH E;  2OYI C;  3H1I J;  4UB8 H;  2P1J A;  3V4Q A;  1VQM P;  1JY2 P;  3D70 A;  1NTZ K;  3CLQ A;  1NTM E;  3CWB D;  5AW9 B;  4R4M A;  3M9Q A;  3SFE C;  3CCU P;  1FJP A;  2KK7 A;  1SQX J;  5CJ0 A;  4N78 D;  5GTI E;  1KQF B;  1S4X A;  3B71 A;  4KHX A;  3WU2 H;  3A5T A;  2W6A A;  1N86 A;  2XU6 A;  2RMZ A;  4GOD A;  1JY3 P;  1Y9B A;  1CI6 B;  2BAS A;  3A7O A;  1NJI Q;  3AE7 C;  1RF1 C;  1EQ7 A;  2R32 A;  1OVV A;  5TIS H;  2QJY C;  3KHU A;  3L70 E;  2BCC D;  1NTM K;  1M1K Q;  3WU2 E;  3BAS A;  4TLF A;  2XND H;  3L73 G;  4D6T G;  2JR8 A;  3RL0 C;  2KS1 B;  1JUN A;  3A0H H;  1AQ5 A;  2Z5H A;  1VQ8 P;  3CXH I;  1PGP A;  2KYV A;  2YNY A;  3H1J E;  1N7S B;  3P8C E;  4ASV A;  3RK2 C;  2E75 D;  3C9I A;  2ZAE B;  1EXJ A;  3CCQ P;  1RQU A;  1KQL A;  3A0H E;  5KLI B;  1OFC X;  2K88 A;  1SQQ D;  4OVN F;  1NTK J;  3RK3 E;  4DOJ A;  3TSI A;  2IDB A;  3I55 P;  1LT9 A;  3L73 J;  2LXB A;  4D6T J;  3ITK A;  2KUB A;  2XNX A;  4BXL A;  1J2J B;  1LNQ A;  4ZMD A;  5KJ7 C;  1AVO A;  3H1L G;  4L75 A;  3B8E B;  1OMI A;  1R5L A;  4H44 D;  4KJM A;  2IFN A;  2OYO A;  3ZDM A;  2WTY A;  1JOC A;  3B5N A;  2YO2 A;  3RBZ A;  1EXI A;  2OQQ A;  1LJ2 A;  4ZKP A;  2L5G B;  2O3J A;  2M5A A;  2LXC B;  1EDI A;  4XA4 A;  2QSI A;  1Q90 D;  2IBZ E;  2OYH A;  2B87 B;  5AVQ B;  2QIW A;  3CCE P;  1H88 A;  3HD7 A;  1HJB A;  4EDF A;  3H1L J;  1U7M A;  1NYH A;  5CCH C;  2WPR A;  3VMZ A;  1SFC A;  5AW2 B;  2NPS B;  3MTU E;  1K05 A;  1S9K E;  1QVF O;  1EZV G;  3Q1M A;  1NU1 E;  1YI2 P;  1X8Y A;  2YKQ A;  3CWB J;  1NO4 A;  2O01 J;  2AEF A;  4M3L A;  2YKO A;  1PPJ E;  3GW6 A;  1A02 J;  4H13 B;  1NTM D;  3VTP C;  1FZC A;  1CSB A;  1S5L X;  3MGN A;  3B5N D;  5CJ4 A;  2K37 A;  1NVO A;  3CX5 H;  1IFJ A;  1NH4 A;  1BSH A;  1FE6 A;  1HGV A;  2JDI H;  2Q6Q A;  4ASW A;  2P67 A;  1NU1 K;  2IBZ I;  1JCD A;  1TU3 F;  3HD7 D;  1N8R Q;  1ZRT E;  1X22 A;  1LTS C;  1W2E A;  3H6P A;  1SFC D;  1LTJ A;  2SPZ A;  2A45 G;  3OAK A;  2FYN C;  1L4A B;  3OW2 O;  1URQ A;  3ABV C;  1VQO P;  3I56 P;  1BCC G;  2ZXX A;  3USS A;  1MUU A;  1PGO A;  3H1J D;  3V2N A;  3P8C D;  1YYC A;  1NOH A;  4OGQ B;  1L0L E;  1SQB G;  3TF5 A;  1NTZ G;  1YIT P;  4JYB A;  1JNM A;  3L35 A;  3RK3 D;  1MV8 A;  3KDP B;  1JY2 O;  1T2K D;  3HUS B;  2XZR A;  2PAJ A;  3TDK A;  3TNU A;  2Q5U A;  3H1K G;  1LP1 B;  2KOG A;  5APX A;  4IL6 H;  3CC7 P;  1GDT A;  2FYU K;  2P58 A;  3RL0 B;  1M8O B;  1L0L K;  2GM4 A;  1KN7 A;  1URQ D;  3PRJ A;  4PV1 C;  1GL2 C;  1SQB J;  1VQK P;  1N7S C;  1NTZ J;  3L72 G;  1UII A;  4IL6 E;  3RK2 B;  3KYQ A;  5KLI C;  3T97 A;  5BU8 B;  3FWL A;  4N6J A;  5AW7 B;  3M0A A;  1A02 F;  1OIP A;  4JQ0 D;  1IC2 A;  1EC5 A;  1FBM A;  4ZKU A;  3H25 A;  3L74 E;  5AVV B;  1X0T A;  1WMK A;  4K35 A;  1VF5 D;  1S9K D;  2N9B A;  2P2U A;  1KQG B;  2FFD A;  3L70 G;  1NU1 D;  1QEX A;  5AVS B;  2BCC E;  3L72 J;  2E76 D;  1AFO A;  1DD3 A;  4NPD A;  2Y0C A;  1PPJ D;  4PJ0 H;  3PJS K;  4N3Y B;  3AEF C;  2PP6 A;  2E75 B;  2WPV B;  3GMA A;  4RO0 A;  1USD A;  2W6B A;  4RJT A;  4U3F G;  2C0X A;  2YIU B;  2C0W A;  1MFT A;  1HVV A;  3EQ2 A;  1PZQ A;  2KLV A;  1OXZ A;  4H0L C;  2GA1 A;  2N1T D;  1VQ7 P;  3MHV A;  1KMI Z;  3L70 J;  3KPE A;  1H0T A;  4A7P A;  2ZT9 D;  5AW0 B;  1RF0 A;  1ZRT D;  3AE2 C;  1FOS E;  3BCC D;  3B4S A;  2E42 A;  1K9M Q;  1VPC A;  1ZLL A;  1Y47 A;  3CCS P;  3AE3 C;  4H44 B;  1SQV G;  1M56 D;  2FXO A;  5KLV G;  1OZH A;  2B88 A;  2H7H A;  2V7Q H;  3VMX A;  4H13 C;  1YBK A;  1FAV A;  1L0N K;  2BEQ D;  1SQP E;  3H1I G;  2FYU D;  3NFQ A;  1L0L D;  1LTI C;  3SSU A;  2JO1 A;  4GKG A;  2WSS H;  3NTN A;  4PD4 H;  1GD2 E;  1RHZ B;  2IBZ G;  1YQ4 C;  2AXT E;  2IPP A;  1LT9 B;  1YJW P;  2QJP B;  2Y0D A;  1SQV J;  3HE4 A;  2ZXE B;  3P32 A;  3HTK A;  4PD4 E;  2ZVO B;  1LWU A;  3L37 A;  2B89 A;  1QL2 A;  4IFM A;  1SQP K;  3MUD A;  2KI7 B;  5GTI H;  1ZR2 A;  3II6 A;  5CBN A;  1KIL E;  2K9J A;  2M5A B;  3F89 A;  3I5C A;  2M3E A;  4AUW A;  4OGQ C;  3E1R A;  3O6Q A;  2N9Y B;  3BRV B;  2LKM A;  3K5B A;  3V2Q A;  1SS1 A;  1GMJ A;  2OYH B;  3MP7 B;  3KXD A;  3CI9 A;  1N2D C;  5AW5 B; 
#chains in the Genus database with same CATH homology
 2IYO A;  2JKV A;  1AVY A;  2ZYA A;  2W90 A;  2IZ1 A;  2IYP A;  3FWN A;  1PGJ A;  2IZ0 A;  2ZYG A;  2PGD A;  1PGP A;  1PGO A;  1NAY A;  2ZYD A;  1OX3 A;  2W8Z A;  1AA0 A;  1PGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...