1AA0A

Fibritin deletion mutant e (bacteriophage t4)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
VSGLNNAVQNLQVEIGNNSAGIKGQVVALNTLVNGTNPNGSTVEERGLTNSIKANETNIASVTQEVNTAKGNISSLQGDVQALQEAGYIPEAPRDGQAYVRKDGEWVLLSTFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Attachment protein
molecule keywords FIBRITIN
publication title Structure of bacteriophage T4 fibritin: a segmented coiled coil and the role of the C-terminal domain.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 38
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1997-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07921 Fibritin_C Fibritin C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 1aa0A00
2IZ0A 2PGDA 2W90A 1OX3A 2ZYDA 2ZYAA 1AVYA 2IYOA 2W8ZA 2ZYGA 1PGQA 1PGPA 1PGJA 2IYPA 2IZ1A 1NAYA 3FWNA 1PGOA 1AA0A 2JKVA
chains in the Genus database with same CATH superfamily
1Q82Q 1NOHA 2D2CD 1VQMP 3KZIH 1S1CX 2BCCG 1VQ4P 3RK2C 1LTGC 4Y99C 5E79H 1NTMD 3H1IE 3IFMA 1J2JB 4OGQD 4CPGA 1QLED 3BASA 2OYHC 2NZ2A 1GL2D 1MKMA 4U3FE 2E74C 1WMKA 2E76D 2ZYGA 2K9YA 1KC8Q 1PP9D 1QX8A 1SQPK 1KILA 1ZXGA 3W68A 5TISE 1FZGA 1YYCA 1EZVG 1LWUC 2OARA 2M5AA 2AEFA 2V4HA 3QWOC 2IFNA 3D6ZA 4LGDE 5BU5A 5GTHE 3R4YA 2O01H 4PD4D 2Q9IA 2RKLA 4PV1B 3Q5PA 1SQPE 3KDPB 3BCCE 3FXDA 1ZRTD 4H0LC 2IYOA 4NPEA 3L35A 3CCVP 2Z4EA 1RE4A 2ZFCA 1OVUA 5TISH 1R5SA 3RK3B 1VF5D 3H1LE 2ZT9D 2IX7C 4HKZH 1NTZK 3A3YB 1YJ9P 1HWTC 2D2CB 1DD3A 4XA4A 5GTHH 4AYCA 2BEZF 3O6QB 2AEMA 4KJMA 3HD7A 1GD2E 4OGQB 1U7JA 4NPDA 2YIUC 1E79H 1GL2B 3CI9A 4UB6E 1NTZE 2QJPB 5CCGD 1J1DB 1X9VA 2E76B 3GHGC 3L73E 4C7NB 1T2KC 1SQQJ 4WY4D 5AW1B 1RE3A 1KZUB 4AQRD 3AE5C 4GOFA 1KB9I 1SQQG 4XFJA 1LT9B 1NTKJ 3M9BA 2NPSD 1SQXJ 2FYUD 2Y9ZA 1NTKG 1FZCB 1W2EA 1SQXG 2GUSA 1G1JA 4UB6H 2J58A 2WSCH 2P2UA 5AVWB 2NRGA 1VDFA 1SQBD 3V6IA 1S5LE 5AW4B 2HFED 2PFXA 2J5UA 3H1KD 3A5TA 1L4AA 3CL3D 5APTA 2WSFJ 1M8OB 4QMAA 2KS1A 1VF5B 1LTAC 2ZT9B 3G4SP 4L74A 3HTKA 3L74E 1CSBA 1CI6A 2KK7A 3MHVA 2GA1A 1KFNA 2WPSA 5KLVD 3L71J 1N86A 2Q6QA 1NTMK 1S5LH 4DOJA 3L71G 1L0LJ 2FY8A 1Q90D 2N1TA 3RK3E 4HJGH 1L0LG 3CXHI 5KJ7C 3CX5I 2CK3H 3N7NA 2OTKE 1PV3A 1BCCJ 2YKQA 2E75C 1TU3F 1DH3A 1BCCG 1IFIA 3AE4C 4I2LC 3E1RA 1T8ZA 3EQ2A 3VTPC 2Y0CA 4WY4B 1NTME 2RH0A 1L0NJ 2BCCD 2A45H 2V7QJ 1JOCA 1L0NG 2NPSB 5CHXA 1L2PA 2KIKA 2HODB 3PTZA 4RO0A 2YMKA 2FFDC 2XU6A 1PP9E 3NFQA 2O01N 3H32B 3M91A 3FWNA 4HYTB 2WZ7A 3CCRP 2QA4P 3C1LA 1KMIZ 2QVAA 4PD4I 1X0TA 2KYVA 3BVHA 1QVFO 3D70A 3JCUE 2QEXP 5AVTB 3AE6C 3OA7A 3TGUJ 3I55P 2Q3EA 3CCSP 3NXSA 4PD4E 1EQ7A 3TGUG 3BRVB 1ZRTE 3AE7C 2Q5UA 2AXCA 3L70J 2I8DA 1GU4A 4YXDC 3AEEC 3L70G 1BE3J 3CMAP 1NU1D 1BE3G 1X22A 2O3JA 3H6PA 1YJNP 2HPCB 1NWQA 1PL5A 1AFOA 1BGYG 1EDLA 4IFMA 1H0TB 2FYUK 3O6QA 2ZXEB 1K04A 3RL0D 5EFWB 1GL2A 1KTMA 4KHXA 1SQBK 4IL6E 3HUSB 2C9LY 5KLIB 2IDBA 2WVRA 3MUDA 3I56P 3ZDMA 2G8YA 4RJTA 3C9IA 4JYBA 1VQ6P 4C7NA 2FYUE 3VMYA 3Q5RA 1LT9A 1GW3A 2WPQA 3HE5B 1SQXD 3PP5A 3VMZA 2IBZG 1PGJA 2R32A 1FZCA 1SQBE 4XE5B 2Z5HA 3AE2C 1N7SC 3AE8C 3H1KE 2KZJA 1KYOI 3B8EB 1FDIA 5K5GB 1HJBA 1NO4A 3L37A 3SWKA 2FYNB 3PHLA 3P32A 1JEKA 2YNYA 3CCEP 3IN6A 3SFDC 5KLVE 3V5BA 3CD6P 3H1JG 1FS0E 2WWWA 2MKVA 3L71D 4BWNA 2PAJA 3MIWA 1L0LD 1KILC 1QVGO 3RL0B 3Q5SA 2KP8A 3G71P 1M1KQ 1HGVA 3CCQP 2WT7B 4TLFA 1FZAA 2R5DA 3CMEP 2BCCE 2QRXA 5CCGA 4PJ0E 4R4LA 1N8RQ 2LR2A 1JY2P 2E42A 4WY4A 1AQTA 1LT1A 1IO4A 4DT0A 3EWKA 1CZQA 4H13C 4LLHA 2NPSA 3OAKA 4WWIA 1RE4C 3GMAA 3M9HA 2HODA 3AEDC 1CW5A 1J1EC 5AVVB 1HVVA 1S3JA 3P7KA 1N73B 1NVOA 3H32A 3GLMA 3KHUA 1VQNP 1NU1K 2R44A 3AEGC 3HD7C 3V4WA 3L75D 1FZFA 1VQ7P 5AW8B 3NMDA 3ITKA 2YKPA 3LIDA 3JSVC 1EXJA 3TGUD 5CJ4A 1Q86Q 5KKZB 3VYIA 4EDFA 1NU1E 1H8AA 2K9JB 3L70D 5AVZB 3S1KA 5AW9B 1RE3C 5AVXB 1URQD 1BE3D 3CC7P 1JMMA 5AW6B 5KTBA 2XNDH 2WPVB 3U1AA 5B5EE 2XDJA 3A0HE 1K8AQ 2E5TA 4I7ZB 5AW3B 1G2CB 1S9KD 2XKMA 1RY3A 3TDKA 2O1KA 1BGYD 2HPCA 3EFGA 3A0BE 2IZ0A 1EXIA 3CCJP 3WMM0 2WITA 1SFCD 2AEJA 1H0TA 3W67A 3CCLP 4WVZA 2M3BA 1L4AC 2DW3A 3H25A 1FZBA 1DX7A 3B5NB 1K05A 1VL2A 5B5EH 1KORA 3TF5A 3CPWO 3A0HH 1ZLLA 3MD0A 5AW5B 4EOTA 4LC1A 1KD1Q 2YMYA 2QJKB 4H44C 3HUSA 2CPBA 3A0BH 1WT6A 2B88A 2HLOA 1YHQP 1OW7A 1FJPA 2P10A 2N1TC 1FJKA 2IBZD 3HE5A 4BRYB 1Q2NA 3H1IJ 3FX0A 3FWLA 3H1IG 4U3FJ 1ZP0C 2KZIA 2YKOA 5DJTB 1L0LK 1HJ0A 4U3FG 1URQB 1FE6A 3I5CA 1FZEA 2OYIA 3H1JD 1Y8AA 3L71E 3BRTB 3FXEA 1IJDB 2Y0EA 3D6YA 3KXDA 4HB1A 1EDJA 1L0LE 3GF7A 1EDKA 2ZYAA 1SFCB 2ZXXA 3PRJA 3H1HJ 4WB4A 2IFMA 2KSEA 1RQUA 2W6AA 2FBWC 3H1HG 1GW4A 1SQPJ 1GU5A 3M06A 2A06D 1SQPG 2WQYC 4EI2A 2WT7A 3AE3C 1OVVA 1WRGA 1AQ5A 1EDIA 4ZKUA 3V4QA 3RBXA 2Y0DA 2W8ZA 2FKWB 2GM4A 2I1JA 3BATA 2A45I 2LXBA 4PV1C 2KOGA 1YTZI 1LTJB 1YI2P 4W7YA 1SQVD 1LTSC 1VQPP 3L72D 1QL1A 3RK3C 1GK6A 1RF1B 3RL0g 2PP6A 2B87B 1N73A 1NTZJ 2V7QH 2WSCJ 2L91A 2OGUA 3L75E 3M9QA 3L73J 3TGUE 2ZJSE 1VPCA 3L73G 4OGQC 2UWJE 1GL2C 4D6TJ 3L70E 3CCUP 4U7JA 1OW8A 4D6TG 1HUCA 2QM7A 1HTLC 1BE3E 3AE9C 1BDCA 1J1DC 3MUDC 1BSHA 2Q3IA 1Q7YQ 2K9JA 1D7MA 4KT0J 5AVYB 1G1IA 1S9KE 1LT9C 1ZN5A 2WSSH 1BGYE 2QM8A 1A02F 2WPRA 1FZCC 1AVOA 3V2PA 5CBNA 4Y28J 3IAOA 1G2CA 1S4XA 2QJYB 1SVFA 2P7JA 1EZVD 3PH0A 5DJUB 5CCHD 1JTHB 1DIPA 1JY2N 1S72P 3B5NA 1N7LA 1PPJG 2IBZI 5APUA 3C8VA 1VF5C 2ZT9C 1FBMA 2IBZE 1PGOA 1FOSE 4OVNF 2HR3A 2H8PD 3VP9A 1ZV8A 2P67A 2H43A 2BEQD 3AE1C 5AVUB 5APVA 1PIXA 4BRYA 1OZHA 3RK2D 5CCGC 2WSEJ 3CCMP 2B9BA 2K88A 2FXOA 2VRSA 4WY4C 1RH5B 1MFZA 1KV4A 3OJAB 1URQA 2E74D 3CWBJ 3H1JE 2NPSC 3CWBG 4K35A 4JF7A 3B71A 3PLNA 4NPFX 1KQSO 1SQQD 1ZOYC 4GODA 4M3LA 1M1JB 2KSJA 1RF0A 3Q2YA 1NTKD 1Y9BA 3H1HD 1HH0A 2CPSA 3VOPA 2A06E 1SFCA 1QGKB 2JR8A 1YITP 1SQVK 1FC2C 5KLVK 1SQPD 2FXPA 3TNUB 4GKGA 1X8YA 2HYNA 1LTBC 1OXZA 1E5WA 1P84H 2M0BA 2K1AA 4H0LD 5CBOA 5B66E 2WTYA 2HG5D 3G3ZA 4R4MA 4IFFA 3PJSK 1SQVE 2GUVA 2W90A 3L72E 1OX3A 1HBWA 2JEEA 3AECC 1LTJA 3M0DA 5H2FE 3P8CD 3WU2E 1PZQA 4I6MC 4DCKA 3RK2B 3L4FA 4Y99B 2JKVA 1R5LA 1OIPA 1RF1A 2OYHB 2B87A 5B66H 1U7MA 2W27A 4GOEA 2E74B 3V2NA 2N9YB 1BCCD 3L73D 2MJZA 1NYHA 1VQ8P 2FYUJ 2SPZA 5BU8B 5AVSB 1T2KD 3MGNA 5H2FH 1OFCX 2Z5IA 3WU2H 4ZKPA 1L0ND 4D6TD 2QIWA 3CC2P 4W7ZA 1SQBJ 4YXWH 1KB9D 1LP1B 1LWUB 3HUSC 5KLIC 1JY2O 1RHZB 1T3JA 5AW7B 1EZVI 1S2EA 2KLVA 3HE4B 1H89A 1NGMB 2IPPA 1BDDA 3S9OA 1JB0J 2XV5A 2W83C 2YXRB 4H0LB 1EZVE 2OTLP 1M57D 3R2PA 5AVRB 1VQ9P 2O1JA 1VQ5P 3F89A 2FYZA 1GTWA 2Q1KA 2KNCB 5TJHA 1VQKP 1JTHA 4IFDK 2FYNC 2OQQA 1AJYA 1JCCA 1PPJD 4K3AA 2OYIC 3KPEA 3LW5J 4DJGA 2YIUB 2BCCJ 2QG4A 2JWAA 5KJ7D 5BVZA 1LTIC 3Q3DA 4MN4C 2E75D 3CXHD 1RQVA 3CX5D 5GTIE 1X79B 3GHGB 3VMAA 3VN0A 5C39A 2Y9YA 1SQQK 3RL0C 1IFPA 2KB7P 1H88A 1NTKK 3LIEA 1YTZT 5APWA 1SQXK 1IFNA 2XNXA 2ZVOB 3S4RA 3SFEC 1JCDA 4C7RA 1KQLA 4JQ0D 4TT3H 1ZR2A 1U57A 3CWBD 5GTIH 3F5HA 1SQQE 4HH2A 1AVYA 4OWFA 1NTKE 1NAFA 1KQFB 1SQXE 3H1HE 2KUBA 1M1JA 5AW2B 3SSUA 1N73C 1AA0A 2PRRA 5CCHA 1NU1J 5APQA 4I1LA 2L5GB 2JP3A 1NU1G 1VQOP 1T3UA 3TNUA 2JDIH 4AUWA 2O01J 2G3AA 5KKZC 5APXA 1GZLA 1Q81Q 1K73Q 2E75B 4ZMDA 3N4XA 3P8CE 1FU1A 1S5LX 1XTCC 1LNQA 2IZ1A 2QSIA 1FOSF 2H7HA 1L0NK 5CMZA 1JY3N 1W2BO 1P84D 2ZVNB 3VP8A 1FDOA 2WSFH 4I7ZC 1BCCE 1UIXA 2W6BA 3EFFK 1VQLP 2C0WA 2OYHA 3KYQA 2FFDB 1GK4A 3BCCJ 1QEXA 3B4SA 2YO3A 3MTUE 2KI7B 3BCCG 2AXTE 2POHA 1L0NE 4ZNCA 4D6TE 3P8MC 1R8EA 1YIJP 3A2AA 3H1LJ 3SWFA 1MFTA 3B5NC 3SWYA 1KB9E 3H1LG 1NAYA 2C0XA 1YQ4C 3T97B 1IK9A 1LP1A 2QJKC 1LWUA 3U1CA 4L75A 5AVQB 2XZRA 1K9MQ 2AXTH 1N7SD 3HE4A 1KYOD 1KB9H 2D2CC 4EIJA 1NKZB 1NTZG 4RESB 2RMZA 2PGDA 3ABVC 4YTPC 3IF4A 1FAVA 4W80A 5KAIE 1PPJE 3D71A 1LJ2A 2KNCA 2R3CA 1IC2A 1URQC 3II6A 2QJPC 1BSNA 5KAFE 4JPZB 2E76C 4EYYQ 1KILD 3CXHE 3CX5E 1RF0C 4GDOA 1YQ3C 1PGPA 3MP7B 5KAIH 4GIFA 2ZAEB 4N3YB 1SFCC 1AV1A 4UB8E 3MZWB 3GHGA 4N78D 2B89A 3L74J 2K3RA 5KAFH 3V2QA 2RN0A 1HF9A 1ZMEC 3L74G 4H13D 2P1JA 5APYA 2OTJP 1T6AA 1LTTC 3CXHH 3CWBE 3CX5H 3WUVA 3WUTA 3Q1MA 1LGHB 2A45G 1ZR4A 1YBKA 1MUUA 1MV8A 3L75J 3M0AA 1N7SB 4UB8H 5L8RJ 3L75G 1M56D 1LTJC 4N6JA 1DEEG 3M0DC 2WSEH 1QL2A 3NTNA 2H89C 2J59M 1JY3P 3HD7D 1NTMJ 4IL6X 1RF1C 1NTMG 1UIIA 4Z1MH 4OH8B 3TK1A 1PFIA 2LXCB 1JY3O 3H1ID 3JCUH 3GF3A 3RBZA 1PP9J 4U3FD 4O9BA 1SP4A 1KN7A 3FGAD 4JYCA 1KILB 4PD4H 1P84I 1PP9G 1BGYJ 1IK7A 2Q7CA 3AEFC 3AEBC 3GG2A 1PGQA 5KJ7A 2M5AB 2E5YA 2JO1A 1JNMA 3E7KA 2I1KA 1P84E 1IFJA 3WUUA 2QE7H 4IOIH 1OVRA 1GMJA 4YPCA 1OWAA 2M3EA 4B86A 4H13B 2WMMA 1GDTA 4A7PA 1NKNA 3JC22 1IZNB 1Z56A 3IR9A 3OW2O 1L4AD 1OW6A 4BXLA 2QJYC 1J1EB 3BCCD 3VMXA 2FFDA 3L36A 1NJIQ 1N2DC 2C9NY 3USSA 2KXPB 2YXQB 1YJWP 2BASA 4H44D 3H1LD 4DZOA 1SS1A 2P58A 1JMBA 3HD7B 4ASVA 4IL6H 2R3SA 4C46A 2ZYDA 5CJ0A 4L73A 2N1TD 3T97A 3GW6A 3V2RA 3UIAA 3O8ZA 1IFDA 2H88C 2ITAA 1KYOE 1M90Q 1USEA 2YO2A 3QH9A 2OYIB 3H1JJ 1NTZD 2M8RA 2N9BA 3TSIA 1DD4A 1MZ9A 2R5BA 3CC4P 2KLUA 3K5BA 1SLQA 2FYUG 1M7LA 4GT1A 2W6JH 4WBAA 3G6EP 1IFMA 1KYOH 3A7OA 1KILE 2A06G 2K37A 1SQBG 3CLQA 1USDA 3AEAC 4RKUJ 2FXMA 1KFMA 5APSA 1L4AB 3H1KJ 3H1KG 3RGUA 2KS1B 1M1JC 1NH4A 2JJLA 1JM0A 3HTKB 1JUNA 2OYOA 4N78E 1CI6B 1OMIA 5CCHC 1ZW0A 1NHLA 3TYYA 1XTGB 2JWDA 4H44B 1HGZA 2E43A 1SQVJ 3B5ND 3L72J 4ASWA 5M1BA 3LW5H 5KLVJ 3KZIE 3L74D 1EC5A 1FDMA 1SQVG 3L72G 5KLVG 4L76A 3E1IA 1JO5A 4PJ0H 4PV1D 2N1TB 5E79E 1W5CE 5AW0B 1A02J 3KQGA 3U59A 2LKMA 3RK3D 2IYPA 3HRNA 4JBZA 1KQGB 3G9RA 1N7SA 1Y47A 1DEBA
chains in the Genus database with same CATH topology
2IZ0A 2PGDA 2W90A 1OX3A 2ZYDA 2ZYAA 1AVYA 2IYOA 2W8ZA 2ZYGA 1PGQA 1PGPA 1PGJA 2IYPA 2IZ1A 1NAYA 3FWNA 1PGOA 1AA0A 2JKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IZ0 A;  2PGD A;  2W90 A;  1OX3 A;  2ZYD A;  2ZYA A;  1AVY A;  2IYO A;  2W8Z A;  2ZYG A;  1PGQ A;  1PGP A;  1PGJ A;  2IYP A;  2IZ1 A;  1NAY A;  3FWN A;  1PGO A;  1AA0 A;  2JKV A; 
#chains in the Genus database with same CATH topology
 1Q82 Q;  1NOH A;  2D2C D;  1VQM P;  3KZI H;  1S1C X;  2BCC G;  1VQ4 P;  3RK2 C;  1LTG C;  4Y99 C;  5E79 H;  1NTM D;  3H1I E;  3IFM A;  1J2J B;  4OGQ D;  4CPG A;  1QLE D;  3BAS A;  2OYH C;  2NZ2 A;  1GL2 D;  1MKM A;  4U3F E;  2E74 C;  1WMK A;  2E76 D;  2ZYG A;  2K9Y A;  1KC8 Q;  1PP9 D;  1QX8 A;  1SQP K;  1KIL A;  1ZXG A;  3W68 A;  5TIS E;  1FZG A;  1YYC A;  1EZV G;  1LWU C;  2OAR A;  2M5A A;  2AEF A;  2V4H A;  3QWO C;  2IFN A;  3D6Z A;  4LGD E;  5BU5 A;  5GTH E;  3R4Y A;  2O01 H;  4PD4 D;  2Q9I A;  2RKL A;  4PV1 B;  3Q5P A;  1SQP E;  3KDP B;  3BCC E;  3FXD A;  1ZRT D;  4H0L C;  2IYO A;  4NPE A;  3L35 A;  3CCV P;  2Z4E A;  1RE4 A;  2ZFC A;  1OVU A;  5TIS H;  1R5S A;  3RK3 B;  1VF5 D;  3H1L E;  2ZT9 D;  2IX7 C;  4HKZ H;  1NTZ K;  3A3Y B;  1YJ9 P;  1HWT C;  2D2C B;  1DD3 A;  4XA4 A;  5GTH H;  4AYC A;  2BEZ F;  3O6Q B;  2AEM A;  4KJM A;  3HD7 A;  1GD2 E;  4OGQ B;  1U7J A;  4NPD A;  2YIU C;  1E79 H;  1GL2 B;  3CI9 A;  4UB6 E;  1NTZ E;  2QJP B;  5CCG D;  1J1D B;  1X9V A;  2E76 B;  3GHG C;  3L73 E;  4C7N B;  1T2K C;  1SQQ J;  4WY4 D;  5AW1 B;  1RE3 A;  1KZU B;  4AQR D;  3AE5 C;  4GOF A;  1KB9 I;  1SQQ G;  4XFJ A;  1LT9 B;  1NTK J;  3M9B A;  2NPS D;  1SQX J;  2FYU D;  2Y9Z A;  1NTK G;  1FZC B;  1W2E A;  1SQX G;  2GUS A;  1G1J A;  4UB6 H;  2J58 A;  2WSC H;  2P2U A;  5AVW B;  2NRG A;  1VDF A;  1SQB D;  3V6I A;  1S5L E;  5AW4 B;  2HFE D;  2PFX A;  2J5U A;  3H1K D;  3A5T A;  1L4A A;  3CL3 D;  5APT A;  2WSF J;  1M8O B;  4QMA A;  2KS1 A;  1VF5 B;  1LTA C;  2ZT9 B;  3G4S P;  4L74 A;  3HTK A;  3L74 E;  1CSB A;  1CI6 A;  2KK7 A;  3MHV A;  2GA1 A;  1KFN A;  2WPS A;  5KLV D;  3L71 J;  1N86 A;  2Q6Q A;  1NTM K;  1S5L H;  4DOJ A;  3L71 G;  1L0L J;  2FY8 A;  1Q90 D;  2N1T A;  3RK3 E;  4HJG H;  1L0L G;  3CXH I;  5KJ7 C;  3CX5 I;  2CK3 H;  3N7N A;  2OTK E;  1PV3 A;  1BCC J;  2YKQ A;  2E75 C;  1TU3 F;  1DH3 A;  1BCC G;  1IFI A;  3AE4 C;  4I2L C;  3E1R A;  1T8Z A;  3EQ2 A;  3VTP C;  2Y0C A;  4WY4 B;  1NTM E;  2RH0 A;  1L0N J;  2BCC D;  2A45 H;  2V7Q J;  1JOC A;  1L0N G;  2NPS B;  5CHX A;  1L2P A;  2KIK A;  2HOD B;  3PTZ A;  4RO0 A;  2YMK A;  2FFD C;  2XU6 A;  1PP9 E;  3NFQ A;  2O01 N;  3H32 B;  3M91 A;  3FWN A;  4HYT B;  2WZ7 A;  3CCR P;  2QA4 P;  3C1L A;  1KMI Z;  2QVA A;  4PD4 I;  1X0T A;  2KYV A;  3BVH A;  1QVF O;  3D70 A;  3JCU E;  2QEX P;  5AVT B;  3AE6 C;  3OA7 A;  3TGU J;  3I55 P;  2Q3E A;  3CCS P;  3NXS A;  4PD4 E;  1EQ7 A;  3TGU G;  3BRV B;  1ZRT E;  3AE7 C;  2Q5U A;  2AXC A;  3L70 J;  2I8D A;  1GU4 A;  4YXD C;  3AEE C;  3L70 G;  1BE3 J;  3CMA P;  1NU1 D;  1BE3 G;  1X22 A;  2O3J A;  3H6P A;  1YJN P;  2HPC B;  1NWQ A;  1PL5 A;  1AFO A;  1BGY G;  1EDL A;  4IFM A;  1H0T B;  2FYU K;  3O6Q A;  2ZXE B;  1K04 A;  3RL0 D;  5EFW B;  1GL2 A;  1KTM A;  4KHX A;  1SQB K;  4IL6 E;  3HUS B;  2C9L Y;  5KLI B;  2IDB A;  2WVR A;  3MUD A;  3I56 P;  3ZDM A;  2G8Y A;  4RJT A;  3C9I A;  4JYB A;  1VQ6 P;  4C7N A;  2FYU E;  3VMY A;  3Q5R A;  1LT9 A;  1GW3 A;  2WPQ A;  3HE5 B;  1SQX D;  3PP5 A;  3VMZ A;  2IBZ G;  1PGJ A;  2R32 A;  1FZC A;  1SQB E;  4XE5 B;  2Z5H A;  3AE2 C;  1N7S C;  3AE8 C;  3H1K E;  2KZJ A;  1KYO I;  3B8E B;  1FDI A;  5K5G B;  1HJB A;  1NO4 A;  3L37 A;  3SWK A;  2FYN B;  3PHL A;  3P32 A;  1JEK A;  2YNY A;  3CCE P;  3IN6 A;  3SFD C;  5KLV E;  3V5B A;  3CD6 P;  3H1J G;  1FS0 E;  2WWW A;  2MKV A;  3L71 D;  4BWN A;  2PAJ A;  3MIW A;  1L0L D;  1KIL C;  1QVG O;  3RL0 B;  3Q5S A;  2KP8 A;  3G71 P;  1M1K Q;  1HGV A;  3CCQ P;  2WT7 B;  4TLF A;  1FZA A;  2R5D A;  3CME P;  2BCC E;  2QRX A;  5CCG A;  4PJ0 E;  4R4L A;  1N8R Q;  2LR2 A;  1JY2 P;  2E42 A;  4WY4 A;  1AQT A;  1LT1 A;  1IO4 A;  4DT0 A;  3EWK A;  1CZQ A;  4H13 C;  4LLH A;  2NPS A;  3OAK A;  4WWI A;  1RE4 C;  3GMA A;  3M9H A;  2HOD A;  3AED C;  1CW5 A;  1J1E C;  5AVV B;  1HVV A;  1S3J A;  3P7K A;  1N73 B;  1NVO A;  3H32 A;  3GLM A;  3KHU A;  1VQN P;  1NU1 K;  2R44 A;  3AEG C;  3HD7 C;  3V4W A;  3L75 D;  1FZF A;  1VQ7 P;  5AW8 B;  3NMD A;  3ITK A;  2YKP A;  3LID A;  3JSV C;  1EXJ A;  3TGU D;  5CJ4 A;  1Q86 Q;  5KKZ B;  3VYI A;  4EDF A;  1NU1 E;  1H8A A;  2K9J B;  3L70 D;  5AVZ B;  3S1K A;  5AW9 B;  1RE3 C;  5AVX B;  1URQ D;  1BE3 D;  3CC7 P;  1JMM A;  5AW6 B;  5KTB A;  2XND H;  2WPV B;  3U1A A;  5B5E E;  2XDJ A;  3A0H E;  1K8A Q;  2E5T A;  4I7Z B;  5AW3 B;  1G2C B;  1S9K D;  2XKM A;  1RY3 A;  3TDK A;  2O1K A;  1BGY D;  2HPC A;  3EFG A;  3A0B E;  2IZ0 A;  1EXI A;  3CCJ P;  3WMM 0;  2WIT A;  1SFC D;  2AEJ A;  1H0T A;  3W67 A;  3CCL P;  4WVZ A;  2M3B A;  1L4A C;  2DW3 A;  3H25 A;  1FZB A;  1DX7 A;  3B5N B;  1K05 A;  1VL2 A;  5B5E H;  1KOR A;  3TF5 A;  3CPW O;  3A0H H;  1ZLL A;  3MD0 A;  5AW5 B;  4EOT A;  4LC1 A;  1KD1 Q;  2YMY A;  2QJK B;  4H44 C;  3HUS A;  2CPB A;  3A0B H;  1WT6 A;  2B88 A;  2HLO A;  1YHQ P;  1OW7 A;  1FJP A;  2P10 A;  2N1T C;  1FJK A;  2IBZ D;  3HE5 A;  4BRY B;  1Q2N A;  3H1I J;  3FX0 A;  3FWL A;  3H1I G;  4U3F J;  1ZP0 C;  2KZI A;  2YKO A;  5DJT B;  1L0L K;  1HJ0 A;  4U3F G;  1URQ B;  1FE6 A;  3I5C A;  1FZE A;  2OYI A;  3H1J D;  1Y8A A;  3L71 E;  3BRT B;  3FXE A;  1IJD B;  2Y0E A;  3D6Y A;  3KXD A;  4HB1 A;  1EDJ A;  1L0L E;  3GF7 A;  1EDK A;  2ZYA A;  1SFC B;  2ZXX A;  3PRJ A;  3H1H J;  4WB4 A;  2IFM A;  2KSE A;  1RQU A;  2W6A A;  2FBW C;  3H1H G;  1GW4 A;  1SQP J;  1GU5 A;  3M06 A;  2A06 D;  1SQP G;  2WQY C;  4EI2 A;  2WT7 A;  3AE3 C;  1OVV A;  1WRG A;  1AQ5 A;  1EDI A;  4ZKU A;  3V4Q A;  3RBX A;  2Y0D A;  2W8Z A;  2FKW B;  2GM4 A;  2I1J A;  3BAT A;  2A45 I;  2LXB A;  4PV1 C;  2KOG A;  1YTZ I;  1LTJ B;  1YI2 P;  4W7Y A;  1SQV D;  1LTS C;  1VQP P;  3L72 D;  1QL1 A;  3RK3 C;  1GK6 A;  1RF1 B;  3RL0 g;  2PP6 A;  2B87 B;  1N73 A;  1NTZ J;  2V7Q H;  2WSC J;  2L91 A;  2OGU A;  3L75 E;  3M9Q A;  3L73 J;  3TGU E;  2ZJS E;  1VPC A;  3L73 G;  4OGQ C;  2UWJ E;  1GL2 C;  4D6T J;  3L70 E;  3CCU P;  4U7J A;  1OW8 A;  4D6T G;  1HUC A;  2QM7 A;  1HTL C;  1BE3 E;  3AE9 C;  1BDC A;  1J1D C;  3MUD C;  1BSH A;  2Q3I A;  1Q7Y Q;  2K9J A;  1D7M A;  4KT0 J;  5AVY B;  1G1I A;  1S9K E;  1LT9 C;  1ZN5 A;  2WSS H;  1BGY E;  2QM8 A;  1A02 F;  2WPR A;  1FZC C;  1AVO A;  3V2P A;  5CBN A;  4Y28 J;  3IAO A;  1G2C A;  1S4X A;  2QJY B;  1SVF A;  2P7J A;  1EZV D;  3PH0 A;  5DJU B;  5CCH D;  1JTH B;  1DIP A;  1JY2 N;  1S72 P;  3B5N A;  1N7L A;  1PPJ G;  2IBZ I;  5APU A;  3C8V A;  1VF5 C;  2ZT9 C;  1FBM A;  2IBZ E;  1PGO A;  1FOS E;  4OVN F;  2HR3 A;  2H8P D;  3VP9 A;  1ZV8 A;  2P67 A;  2H43 A;  2BEQ D;  3AE1 C;  5AVU B;  5APV A;  1PIX A;  4BRY A;  1OZH A;  3RK2 D;  5CCG C;  2WSE J;  3CCM P;  2B9B A;  2K88 A;  2FXO A;  2VRS A;  4WY4 C;  1RH5 B;  1MFZ A;  1KV4 A;  3OJA B;  1URQ A;  2E74 D;  3CWB J;  3H1J E;  2NPS C;  3CWB G;  4K35 A;  4JF7 A;  3B71 A;  3PLN A;  4NPF X;  1KQS O;  1SQQ D;  1ZOY C;  4GOD A;  4M3L A;  1M1J B;  2KSJ A;  1RF0 A;  3Q2Y A;  1NTK D;  1Y9B A;  3H1H D;  1HH0 A;  2CPS A;  3VOP A;  2A06 E;  1SFC A;  1QGK B;  2JR8 A;  1YIT P;  1SQV K;  1FC2 C;  5KLV K;  1SQP D;  2FXP A;  3TNU B;  4GKG A;  1X8Y A;  2HYN A;  1LTB C;  1OXZ A;  1E5W A;  1P84 H;  2M0B A;  2K1A A;  4H0L D;  5CBO A;  5B66 E;  2WTY A;  2HG5 D;  3G3Z A;  4R4M A;  4IFF A;  3PJS K;  1SQV E;  2GUV A;  2W90 A;  3L72 E;  1OX3 A;  1HBW A;  2JEE A;  3AEC C;  1LTJ A;  3M0D A;  5H2F E;  3P8C D;  3WU2 E;  1PZQ A;  4I6M C;  4DCK A;  3RK2 B;  3L4F A;  4Y99 B;  2JKV A;  1R5L A;  1OIP A;  1RF1 A;  2OYH B;  2B87 A;  5B66 H;  1U7M A;  2W27 A;  4GOE A;  2E74 B;  3V2N A;  2N9Y B;  1BCC D;  3L73 D;  2MJZ A;  1NYH A;  1VQ8 P;  2FYU J;  2SPZ A;  5BU8 B;  5AVS B;  1T2K D;  3MGN A;  5H2F H;  1OFC X;  2Z5I A;  3WU2 H;  4ZKP A;  1L0N D;  4D6T D;  2QIW A;  3CC2 P;  4W7Z A;  1SQB J;  4YXW H;  1KB9 D;  1LP1 B;  1LWU B;  3HUS C;  5KLI C;  1JY2 O;  1RHZ B;  1T3J A;  5AW7 B;  1EZV I;  1S2E A;  2KLV A;  3HE4 B;  1H89 A;  1NGM B;  2IPP A;  1BDD A;  3S9O A;  1JB0 J;  2XV5 A;  2W83 C;  2YXR B;  4H0L B;  1EZV E;  2OTL P;  1M57 D;  3R2P A;  5AVR B;  1VQ9 P;  2O1J A;  1VQ5 P;  3F89 A;  2FYZ A;  1GTW A;  2Q1K A;  2KNC B;  5TJH A;  1VQK P;  1JTH A;  4IFD K;  2FYN C;  2OQQ A;  1AJY A;  1JCC A;  1PPJ D;  4K3A A;  2OYI C;  3KPE A;  3LW5 J;  4DJG A;  2YIU B;  2BCC J;  2QG4 A;  2JWA A;  5KJ7 D;  5BVZ A;  1LTI C;  3Q3D A;  4MN4 C;  2E75 D;  3CXH D;  1RQV A;  3CX5 D;  5GTI E;  1X79 B;  3GHG B;  3VMA A;  3VN0 A;  5C39 A;  2Y9Y A;  1SQQ K;  3RL0 C;  1IFP A;  2KB7 P;  1H88 A;  1NTK K;  3LIE A;  1YTZ T;  5APW A;  1SQX K;  1IFN A;  2XNX A;  2ZVO B;  3S4R A;  3SFE C;  1JCD A;  4C7R A;  1KQL A;  4JQ0 D;  4TT3 H;  1ZR2 A;  1U57 A;  3CWB D;  5GTI H;  3F5H A;  1SQQ E;  4HH2 A;  1AVY A;  4OWF A;  1NTK E;  1NAF A;  1KQF B;  1SQX E;  3H1H E;  2KUB A;  1M1J A;  5AW2 B;  3SSU A;  1N73 C;  1AA0 A;  2PRR A;  5CCH A;  1NU1 J;  5APQ A;  4I1L A;  2L5G B;  2JP3 A;  1NU1 G;  1VQO P;  1T3U A;  3TNU A;  2JDI H;  4AUW A;  2O01 J;  2G3A A;  5KKZ C;  5APX A;  1GZL A;  1Q81 Q;  1K73 Q;  2E75 B;  4ZMD A;  3N4X A;  3P8C E;  1FU1 A;  1S5L X;  1XTC C;  1LNQ A;  2IZ1 A;  2QSI A;  1FOS F;  2H7H A;  1L0N K;  5CMZ A;  1JY3 N;  1W2B O;  1P84 D;  2ZVN B;  3VP8 A;  1FDO A;  2WSF H;  4I7Z C;  1BCC E;  1UIX A;  2W6B A;  3EFF K;  1VQL P;  2C0W A;  2OYH A;  3KYQ A;  2FFD B;  1GK4 A;  3BCC J;  1QEX A;  3B4S A;  2YO3 A;  3MTU E;  2KI7 B;  3BCC G;  2AXT E;  2POH A;  1L0N E;  4ZNC A;  4D6T E;  3P8M C;  1R8E A;  1YIJ P;  3A2A A;  3H1L J;  3SWF A;  1MFT A;  3B5N C;  3SWY A;  1KB9 E;  3H1L G;  1NAY A;  2C0X A;  1YQ4 C;  3T97 B;  1IK9 A;  1LP1 A;  2QJK C;  1LWU A;  3U1C A;  4L75 A;  5AVQ B;  2XZR A;  1K9M Q;  2AXT H;  1N7S D;  3HE4 A;  1KYO D;  1KB9 H;  2D2C C;  4EIJ A;  1NKZ B;  1NTZ G;  4RES B;  2RMZ A;  2PGD A;  3ABV C;  4YTP C;  3IF4 A;  1FAV A;  4W80 A;  5KAI E;  1PPJ E;  3D71 A;  1LJ2 A;  2KNC A;  2R3C A;  1IC2 A;  1URQ C;  3II6 A;  2QJP C;  1BSN A;  5KAF E;  4JPZ B;  2E76 C;  4EYY Q;  1KIL D;  3CXH E;  3CX5 E;  1RF0 C;  4GDO A;  1YQ3 C;  1PGP A;  3MP7 B;  5KAI H;  4GIF A;  2ZAE B;  4N3Y B;  1SFC C;  1AV1 A;  4UB8 E;  3MZW B;  3GHG A;  4N78 D;  2B89 A;  3L74 J;  2K3R A;  5KAF H;  3V2Q A;  2RN0 A;  1HF9 A;  1ZME C;  3L74 G;  4H13 D;  2P1J A;  5APY A;  2OTJ P;  1T6A A;  1LTT C;  3CXH H;  3CWB E;  3CX5 H;  3WUV A;  3WUT A;  3Q1M A;  1LGH B;  2A45 G;  1ZR4 A;  1YBK A;  1MUU A;  1MV8 A;  3L75 J;  3M0A A;  1N7S B;  4UB8 H;  5L8R J;  3L75 G;  1M56 D;  1LTJ C;  4N6J A;  1DEE G;  3M0D C;  2WSE H;  1QL2 A;  3NTN A;  2H89 C;  2J59 M;  1JY3 P;  3HD7 D;  1NTM J;  4IL6 X;  1RF1 C;  1NTM G;  1UII A;  4Z1M H;  4OH8 B;  3TK1 A;  1PFI A;  2LXC B;  1JY3 O;  3H1I D;  3JCU H;  3GF3 A;  3RBZ A;  1PP9 J;  4U3F D;  4O9B A;  1SP4 A;  1KN7 A;  3FGA D;  4JYC A;  1KIL B;  4PD4 H;  1P84 I;  1PP9 G;  1BGY J;  1IK7 A;  2Q7C A;  3AEF C;  3AEB C;  3GG2 A;  1PGQ A;  5KJ7 A;  2M5A B;  2E5Y A;  2JO1 A;  1JNM A;  3E7K A;  2I1K A;  1P84 E;  1IFJ A;  3WUU A;  2QE7 H;  4IOI H;  1OVR A;  1GMJ A;  4YPC A;  1OWA A;  2M3E A;  4B86 A;  4H13 B;  2WMM A;  1GDT A;  4A7P A;  1NKN A;  3JC2 2;  1IZN B;  1Z56 A;  3IR9 A;  3OW2 O;  1L4A D;  1OW6 A;  4BXL A;  2QJY C;  1J1E B;  3BCC D;  3VMX A;  2FFD A;  3L36 A;  1NJI Q;  1N2D C;  2C9N Y;  3USS A;  2KXP B;  2YXQ B;  1YJW P;  2BAS A;  4H44 D;  3H1L D;  4DZO A;  1SS1 A;  2P58 A;  1JMB A;  3HD7 B;  4ASV A;  4IL6 H;  2R3S A;  4C46 A;  2ZYD A;  5CJ0 A;  4L73 A;  2N1T D;  3T97 A;  3GW6 A;  3V2R A;  3UIA A;  3O8Z A;  1IFD A;  2H88 C;  2ITA A;  1KYO E;  1M90 Q;  1USE A;  2YO2 A;  3QH9 A;  2OYI B;  3H1J J;  1NTZ D;  2M8R A;  2N9B A;  3TSI A;  1DD4 A;  1MZ9 A;  2R5B A;  3CC4 P;  2KLU A;  3K5B A;  1SLQ A;  2FYU G;  1M7L A;  4GT1 A;  2W6J H;  4WBA A;  3G6E P;  1IFM A;  1KYO H;  3A7O A;  1KIL E;  2A06 G;  2K37 A;  1SQB G;  3CLQ A;  1USD A;  3AEA C;  4RKU J;  2FXM A;  1KFM A;  5APS A;  1L4A B;  3H1K J;  3H1K G;  3RGU A;  2KS1 B;  1M1J C;  1NH4 A;  2JJL A;  1JM0 A;  3HTK B;  1JUN A;  2OYO A;  4N78 E;  1CI6 B;  1OMI A;  5CCH C;  1ZW0 A;  1NHL A;  3TYY A;  1XTG B;  2JWD A;  4H44 B;  1HGZ A;  2E43 A;  1SQV J;  3B5N D;  3L72 J;  4ASW A;  5M1B A;  3LW5 H;  5KLV J;  3KZI E;  3L74 D;  1EC5 A;  1FDM A;  1SQV G;  3L72 G;  5KLV G;  4L76 A;  3E1I A;  1JO5 A;  4PJ0 H;  4PV1 D;  2N1T B;  5E79 E;  1W5C E;  5AW0 B;  1A02 J;  3KQG A;  3U59 A;  2LKM A;  3RK3 D;  2IYP A;  3HRN A;  4JBZ A;  1KQG B;  3G9R A;  1N7S A;  1Y47 A;  1DEB A; 
#chains in the Genus database with same CATH homology
 2IZ0 A;  2PGD A;  2W90 A;  1OX3 A;  2ZYD A;  2ZYA A;  1AVY A;  2IYO A;  2W8Z A;  2ZYG A;  1PGQ A;  1PGP A;  1PGJ A;  2IYP A;  2IZ1 A;  1NAY A;  3FWN A;  1PGO A;  1AA0 A;  2JKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...