1AA0A

Fibritin deletion mutant e (bacteriophage t4)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
b'VSGLNNAVQNLQVEIGNNSAGIKGQVVALNTLVNGTNPNGSTVEERGLTNSIKANETNIASVTQEVNTAKGNISSLQGDVQALQEAGYIPEAPRDGQAYVRKDGEWVLLSTFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBRITIN
publication title Structure of bacteriophage T4 fibritin: a segmented coiled coil and the role of the C-terminal domain.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Attachment protein
total genus 38
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1997-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07921 Fibritin_C Fibritin C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 1aa0A00
2IZ1A 2JKVA 2IYOA 2IZ0A 1PGQA 2PGDA 3FWNA 2W8ZA 1OX3A 1AVYA 2ZYGA 1PGJA 1AA0A 1PGPA 2ZYAA 2IYPA 1NAYA 2W90A 2ZYDA 1PGOA
chains in the Genus database with same CATH superfamily
4W80A 2WPSA 1X8YA 2R5DA 2QA4P 3H1IG 4IOIH 5L8RJ 3TK1A 3F89A 1EXIA 2IFNA 2K9JB 2E76C 1USDA 5KLVD 3CC4P 3CD6P 1P84I 1PPJE 5B66H 4KJMA 2HODB 3D6ZA 5TJHA 2WSFJ 1IFNA 3VTPC 1HTLC 3AE3C 4JYBA 2WPRA 1JM0A 4DCKA 1SQPD 2RKLA 4D6TD 2B87A 1EDIA 1IFJA 1FAVA 1L0LJ 2J58A 3Q2YA 1FZFA 5B66E 1SQQJ 4H44D 3V2QA 1PGJA 2YXRB 3H1KD 1JY3N 4W7YA 3AE1C 2BEZF 1KD1Q 1N7LA 4U3FD 1GU5A 1VDFA 1S4XA 1ZOYC 2Q1KA 1PIXA 1SQVD 1YJ9P 1SFCB 1E5WA 3M9HA 1CZQA 1LP1A 1IK7A 4PV1C 3RBXA 1W2BO 2FXMA 2LXBA 3T97B 3H1IE 1BGYJ 1VPCA 2Q5UA 2HPCB 2ZJSE 2H8PD 5AVXB 4A7PA 3SWKA 3E1RA 2YKOA 2ZVNB 1GL2D 3M0DA 4I1LA 3A2AA 3H1LG 3V5BA 3CCJP 4ZKPA 3WUUA 3L71G 4CPGA 3Q3DA 5H2FH 1RE4A 2KP8A 2KS1A 1RE4C 3H1HJ 2KSEA 5AW1B 3USSA 1HUCA 2LR2A 2WSFH 4XFJA 5KLIC 3IF4A 1KB9H 3AE9C 3QWOC 3G71P 2QVAA 4L75A 2BCCE 1UIIA 5KJ7A 1JB0J 5KJ7C 2FBWC 1NTZK 3BCCD 2PAJA 1HWTC 1FZCA 1FZCC 1U7MA 1ZRTE 1URQB 4WVZA 2I1JA 1L0ND 1MFTA 1NO4A 2Z4EA 5APSA 2QEXP 1IFPA 3A0BH 2A45I 4DJGA 1YI2P 2J5UA 2OYHC 2OYHB 4HKZH 1LTIC 1XTGB 1NTZE 3P8CD 1H88A 1CI6A 3I56P 5AW0B 2MJZA 3CWBJ 1EXJA 2E74B 5AVVB 1N8RQ 1N86A 3IN6A 3VP8A 3CCSP 1YIJP 1W2EA 1PP9J 4ASWA 1BDCA 2O01H 1QX8A 1WRGA 2KIKA 3AE4C 4GOFA 1IC2A 2G8YA 1J1EB 5CJ0A 3MHVA 2E75B 2OYIA 3H32B 2OYIC 1KQLA 4WB4A 3Q5SA 3FXEA 3RL0B 3A5TA 1CW5A 2O3JA 1W5CE 2IFMA 4UB8E 1VQPP 3AE2C 3H1JG 3F5HA 3A3YB 4H44C 2IBZI 4PD4I 1JTHA 3CLQA 4TLFA 2ZT9D 5KLVE 1LTGC 1PPJD 2D2CD 3VMYA 3L70G 2XV5A 3G6EP 4NPFX 1OMIA 1GW4A 1YJWP 3BVHA 3A0HH 4NPDA 4UB6H 3RK3B 3SFDC 3PRJA 1SQPE 1QGKB 4Y99C 1NTMG 1JEKA 3CMEP 1NJIQ 5AW3B 3KXDA 2WT7B 1GL2C 4C7NA 2M3BA 3PH0A 2W27A 2QJKC 2XDJA 1DD3A 1GL2B 3H1KE 2QJKB 4K3AA 4LGDE 3A0HE 4UB6E 2ZYAA 1KFMA 3PHLA 1Q7YQ 5TISH 2OTLP 3LW5H 3L35A 1R8EA 1NAFA 3AEBC 3BCCG 4L73A 3RK3E 2JEEA 1BE3J 2HLOA 3H1JE 1L0NG 2WSEH 2KNCA 3H1ID 3S9OA 1S1CX 3AEAC 1NTMK 2IZ1A 3CI9A 2B88A 5B5EE 1KZUB 1OVUA 3L70E 3CC7P 2R32A 4HYTB 2QM7A 3V4WA 3MP7B 1KYOI 1SFCD 5AW5B 5AVYB 3JCUH 1HH0A 1NH4A 1YQ4C 3K5BA 1NTKJ 1NTME 4IL6E 4KT0J 4DOJA 1M1JA 3EFFK 1L0NK 4BRYB 1M1JC 3AECC 1VQ6P 3AE7C 4N6JA 5AVRB 2FFDA 3V2NA 1IJDB 3E1IA 1GTWA 1TU3F 5CMZA 1LWUA 2OARA 1LWUC 2P58A 1DX7A 2AXTH 1ZN5A 2FYZA 3BCCE 2LKMA 1ZRTD 1L4AB 4C7RA 5DJUB 1M8OB 3L73G 1VQNP 2WSCH 1L0NE 3WU2H 4DT0A 1DEEG 5AW4B 1KB9D 3QH9A 3IR9A 2JJLA 1RQUA 1AVOA 3E7KA 2M5AA 3TNUA 1DEBA 1BCCG 3W67A 1JY3O 1EQ7A 3MGNA 2AXTE 2WITA 3H1LD 3P8CE 3B5NB 1YHQP 3FXDA 1OVRA 3L71D 3WU2E 4ZNCA 1VL2A 1URQD 2ZT9C 1LJ2A 1MV8A 2D2CC 3V4QA 4KHXA 3GHGA 1UIXA 1LTJC 3GHGC 2P7JA 1EDLA 2FY8A 1LTJB 1JNMA 2YO2A 1ZP0C 5CBOA 1AV1A 2QRXA 3C8VA 1AJYA 2H43A 5AW8B 2GUSA 3L75G 1PV3A 1RHZB 2IYOA 3CX5E 1SQBG 1VQ8P 2E74D 2K9JA 2JWDA 1OW6A 3RGUA 3L73E 2E75D 2HODA 4L76A 1X22A 1YYCA 3N7NA 3L72J 1N7SC 4PJ0H 3RL0D 3CXHH 1NYHA 4WY4B 1N7SB 1NU1G 2B9BA 2Z5IA 1HF9A 2YKPA 2BCCJ 1IZNB 4EDFA 3LIEA 1T3JA 2Y0CA 4R4LA 1KQFB 3L74J 3N4XA 1H0TB 2JR8A 1ZMEC 1QL2A 3TGUG 2ZYGA 2P10A 3CXHE 3EQ2A 4U7JA 4Y28J 1EZVG 2A45G 5KKZC 1GK4A 5KKZB 3U1AA 3D70A 1SFCA 1NTZJ 1L2PA 1SFCC 5CBNA 1RQVA 3MUDA 3GMAA 3CCUP 1T2KC 3MUDC 3RK3D 1NU1K 3L75E 3T97A 2YMYA 3GF7A 1K8AQ 3H1JD 2AEFA 2Q3IA 2HPCA 3H6PA 3AE6C 1YTZI 2BEQD 3M9QA 2KUBA 4I6MC 5KAIH 2POHA 2A06G 3SWFA 4HH2A 4R4MA 1L0LG 4YXDC 3L70D 1PL5A 2P1JA 5CCGC 2E43A 2A45H 1NU1E 2FYUJ 2ZVOB 2M3EA 3BRTB 3FWNA 1S2EA 2QIWA 5AVQB 3G9RA 3Q5PA 1Q86Q 2GUVA 1H8AA 2IBZG 1QL1A 1NTMD 2V7QJ 3CCVP 5KLVJ 1M7LA 5GTIH 2LXCB 1EDJA 2DW3A 4AYCA 3TGUE 2ZFCA 2Q9IA 4AUWA 2JDIH 3OA7A 1EZVE 3Q5RA 2HR3A 1KN7A 5E79H 2AEJA 5AW7B 1BGYG 5CCHD 1EC5A 1VQKP 5AVSB 1FOSF 5H2FE 3W68A 1GU4A 2WQYC 3CCQP 1G2CB 1FS0E 1L0LK 3O6QB 1SQPJ 1URQA 4D6TJ 1M90Q 1URQC 3WUVA 2C9NY 5GTIE 1IO4A 3B8EB 1NHLA 3HE5B 5GTHH 3CPWO 2NPSB 1FJPA 1E79H 1KB9E 2O01N 3H1KJ 2RMZA 5E79E 1Y8AA 4U3FJ 2OYHA 4PD4H 4L74A 1N73B 3I55P 2MKVA 3H1HG 2A06E 4I7ZB 1SQVJ 4IFMA 2WZ7A 1L0LE 2Y9ZA 4TT3H 1DD4A 3H1LE 2YMKA 2E74C 2C0WA 3G4SP 2RN0A 5GTHE 3L71E 1FZAA 1J1DB 2AEMA 1J1EC 3H32A 1L4AD 2JP3A 2E75C 1KV4A 2M0BA 1JY2P 3A0BE 4PD4E 1BDDA 4ZKUA 2OTKE 2ZXXA 3HUSB 3RL0C 2ZAEB 1NOHA 2OQQA 3CCLP 2J59M 1ZW0A 1BGYE 1VF5C 3D71A 2WTYA 3B5ND 5APUA 3CX5D 3SSUA 3SFEC 2I1KA 1VF5B 1K9MQ 1MUUA 2YIUB 4OGQB 5APXA 5CJ4A 3SWYA 2C9LY 1T6AA 4H0LD 2XKMA 3AEGC 2N9YB 3L73D 1YJNP 1PZQA 1IFMA 3KPEA 1FDMA 2GA1A 3B71A 3S4RA 4NPEA 5M1BA 1PP9G 1BCCD 1KC8Q 3H1HE 2H7HA 1Y47A 3RK3C 4JYCA 2QE7H 1Q81Q 1DH3A 3CL3D 3VP9A 3BCCJ 3HE4B 2W8ZA 2Y9YA 3IFMA 1OIPA 1L0NJ 2WT7A 1KYOH 2NZ2A 1GL2A 3KQGA 3CXHD 2IZ0A 1D7MA 3CMAP 2SPZA 1ZR4A 4WY4D 2NRGA 1N7SD 1LTBC 1SQXD 5KTBA 1NVOA 3JSVC 4O9BA 1U57A 5KAFH 3L75D 4BWNA 1FBMA 2QJPB 1HJBA 2R44A 2KXPB 1SQBD 2Y0DA 1J2JB 1OX3A 4XA4A 1KILB 1YTZT 1VQOP 2N1TB 1ZXGA 5AW2B 3CC2P 1GW3A 3HD7B 1OW8A 3BATA 3FWLA 1WMKA 4JQ0D 5TISE 5CCHA 4HJGH 5CCHC 2YNYA 3M0AA 4EYYQ 1PP9E 5KAFE 1RF1B 3VOPA 1NU1D 1Q90D 3AEDC 1LNQA 4GODA 1T2KD 1X79B 4BRYA 1RE3A 3L36A 1RE3C 1AQTA 2FYNB 3TGUD 4MN4C 1EZVD 1BE3G 4YTPC 2JO1A 4C46A 3I5CA 2XNXA 3PLNA 3JCUE 1A02J 2BASA 4BXLA 1GZLA 2XZRA 5CCGD 1LTAC 1L4AA 5C39A 4GDOA 1HGZA 1L4AC 2QJYB 2OTJP 3NMDA 3WUTA 1S9KE 2KLVA 1CSBA 2W90A 1NTKG 2A06D 3HRNA 1FDIA 1P84H 3VMXA 1L0LD 3B5NA 3B5NC 1MFZA 1SQQD 1RF0C 3U1CA 1LTTC 1IK9A 2C0XA 1AA0A 1FDOA 4H0LC 3H1IJ 1IFDA 1AFOA 1GD2E 4H0LB 1Q82Q 1VQ9P 3TYYA 1G1IA 2IBZD 4PD4D 4WBAA 2NPSD 2K88A 1LTJA 1Z56A 1T8ZA 1P84E 3OW2O 1QEXA 2VRSA 5K5GB 1S5LX 2QG4A 3BRVB 2M8RA 1SQXG 1LT9B 2R3SA 3EWKA 4IFDK 3RK2B 1S3JA 4I2LC 1BGYD 1FOSE 3PJSK 1NTKK 3GG2A 5APYA 1EDKA 2K9YA 3AEEC 1NKNA 2K3RA 3OJAB 5AVTB 3VMZA 2WPQA 4WY4A 4WY4C 1N7SA 2W6JH 4IFFA 1AQ5A 3JC22 2L91A 1BCCE 1M56D 3VN0A 3H1HD 1NTKE 1NWQA 3TSIA 3R4YA 3G3ZA 3KHUA 2E76B 1SQXK 2PP6A 1H0TA 1SS1A 3TDKA 1VF5D 2QM8A 4OGQD 2E5TA 1LGHB 1JOCA 3MD0A 1SQBK 1OWAA 1KQGB 1GDTA 1KFNA 1OFCX 4PJ0E 3CX5I 4JF7A 4OWFA 3CCMP 4AQRD 4LC1A 3H1LJ 2RH0A 1SQXE 2B87B 1FZGA 2KZJA 1PGPA 1U7JA 1KYOD 3L72G 3L71J 3V2PA 3FX0A 1SQBE 3P32A 2FKWB 2BCCG 2Q6QA 4Z1MH 3VYIA 4EOTA 3CWBD 3L74G 3U59A 4PV1B 1LP1B 5AVUB 2CPSA 2WPVB 2R3CA 4OVNF 1R5LA 1PP9D 5CCGA 1SQQG 3CXHI 2PGDA 1NKZB 2O01J 3M9BA 1WT6A 4JPZB 2IX7C 2L5GB 3KYQA 3M0DC 1JY2N 1NAYA 1K04A 3LIDA 3KDPB 1NTZG 2KB7P 3NXSA 1YITP 5KAIE 2CPBA 2YKQA 1KILD 1JO5A 2W6BA 2N1TD 4B86A 3GW6A 3HD7D 5AW9B 4IL6X 2KS1B 1G2CA 3AE8C 3O6QA 2OYOA 1PGOA 2O1KA 2XU6A 1VQLP 4W7ZA 4N78D 3O8ZA 1VQMP 4RO0A 3V6IA 3PTZA 1SQQK 3L72E 1JY3P 1RH5B 5KLIB 3HE5A 5AVZB 2NPSA 1HJ0A 2H89C 2NPSC 4RESB 1T3UA 2FYUG 3P7KA 1S9KD 3L37A 1GK6A 1N73A 1N73C 1K73Q 3UIAA 2OGUA 1FU1A 1H89A 4I7ZC 1FZBA 3L74E 5BVZA 1FZCB 5KLVG 1JCCA 3AE5C 1SQQE 3MIWA 1EZVI 1YQ3C 1S5LH 3H1JJ 1J1DC 5CHXA 3L4FA 2W83C 1MKMA 1VQ5P 2WSSH 2QSIA 3HUSA 5APVA 3HUSC 1BSNA 2IBZE 3H25A 1A02F 1FJKA 1SQPG 4D6TG 1P84D 3P8MC 1CI6B 3LW5J 4WWIA 1ZV8A 3L70J 2FYUK 4UB8H 3MZWB 1BE3D 5APTA 2H88C 1KB9I 1X9VA 1S5LE 3H1KG 2WSEJ 4YXWH 2JWAA 2W6AA 4H13D 4U3FG 2YIUC 1ZLLA 4OGQC 2OYIB 5KLVK 2V7QH 1R5SA 1MZ9A 1SLQA 1NTMJ 1SQVG 1G1JA 1N2DC 1NGMB 3RL0g 5EFWB 4GOEA 1KORA 3FGAD 3CWBG 2FYUE 3MTUE 1QVGO 1Q2NA 1KMIZ 2KSJA 1S72P 2CK3H 1NTKD 1SQPK 4H44B 3RK2D 1PFIA 3HE4A 1X0TA 3WMM0 1JTHB 4RKUJ 2GM4A 2AXCA 1M57D 2WMMA 3Q1MA 2IPPA 4QMAA 1GMJA 1M1KQ 1LT1A 3S1KA 1K05A 1SQVK 1HGVA 3RBZA 4D6TE 3EFGA 3GLMA 4LLHA 3B4SA 4Y99B 4RJTA 2YO3A 2Q7CA 3HTKA 5DJTB 2QJPC 1VQ4P 2WSCJ 2E76D 2YXQB 1KYOE 4C7NB 3HTKB 4U3FE 1SVFA 1FE6A 1KILA 1KILC 2N1TA 2N1TC 4ASVA 1SQVE 3M91A 5B5EH 3HD7A 1Y9BA 1QVFO 3HD7C 4YPCA 1VQ7P 3CWBE 3C9IA 1RF1A 2Z5HA 1RF1C 3NFQA 3CCRP 4OH8B 2R5BA 2IDBA 1JCDA 2HYNA 2KNCB 3II6A 2WWWA 3TF5A 4EI2A 4IL6H 3A7OA 1SP4A 3IAOA 4GKGA 5AW6B 3AEFC 4M3LA 1RY3A 1QLED 1BSHA 3L73J 2FYNC 2KI7B 1AVYA 2HG5D 2FXOA 4GT1A 2I8DA 1KILE 2B89A 1YBKA 4XE5B 1JMBA 1OXZA 1BCCJ 4PV1D 2KLUA 3GF3A 2E42A 1DIPA 2FXPA 3KZIH 4DZOA 3D6YA 1JUNA 2QJYC 4N78E 1M1JB 2FFDC 3L72D 5BU5A 2FFDB 4EIJA 2BCCD 1LWUB 2E5YA 3VMAA 2PRRA 3BASA 2P67A 4N3YB 3M06A 2N9BA 2IYPA 3ITKA 1IFIA 3C1LA 3L74D 1OW7A 2PFXA 3KZIE 1SQXJ 1KQSO 3ZDMA 4H13C 2XNDH 1PGQA 1OZHA 4GIFA 1RF0A 4K35A 1PPJG 2K1AA 2WVRA 1OVVA 2KOGA 3L75J 4H13B 5APWA 1FC2C 5APQA 2G3AA 1SQBJ 2KZIA 1JMMA 2M5AB 3TNUB 1USEA 2O1JA 1NTZD 2Q3EA 3PP5A 2KYVA 1HVVA 1FZEA 1LT9A 1LT9C 1HBWA 5KJ7D 1KTMA 3OAKA 3RK2C 2HFED 2V4HA 1BE3E 3CX5H 2KK7A 2P2UA 3ABVC 1NU1J 2K37A 4HB1A 2ZYDA 1LTSC 2ZT9B 2JKVA 2D2CB 5BU8B 1ZR2A 2ZXEB 3CCEP 3GHGB 5AVWB 3R2PA 2ITAA 3NTNA 3V2RA 4JBZA 1XTCC 1JY2O 4ZMDA 3TGUJ 2Y0EA 2UWJE 2FYUD
chains in the Genus database with same CATH topology
2IZ1A 2JKVA 2IYOA 2IZ0A 1PGQA 2PGDA 3FWNA 2W8ZA 1OX3A 1AVYA 2ZYGA 1PGJA 1AA0A 1PGPA 2ZYAA 2IYPA 1NAYA 2W90A 2ZYDA 1PGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IZ1 A;  2JKV A;  2IYO A;  2IZ0 A;  1PGQ A;  2PGD A;  3FWN A;  2W8Z A;  1OX3 A;  1AVY A;  2ZYG A;  1PGJ A;  1AA0 A;  1PGP A;  2ZYA A;  2IYP A;  1NAY A;  2W90 A;  2ZYD A;  1PGO A; 
#chains in the Genus database with same CATH topology
 4W80 A;  2WPS A;  1X8Y A;  2R5D A;  2QA4 P;  3H1I G;  4IOI H;  5L8R J;  3TK1 A;  3F89 A;  1EXI A;  2IFN A;  2K9J B;  2E76 C;  1USD A;  5KLV D;  3CC4 P;  3CD6 P;  1P84 I;  1PPJ E;  5B66 H;  4KJM A;  2HOD B;  3D6Z A;  5TJH A;  2WSF J;  1IFN A;  3VTP C;  1HTL C;  3AE3 C;  4JYB A;  2WPR A;  1JM0 A;  4DCK A;  1SQP D;  2RKL A;  4D6T D;  2B87 A;  1EDI A;  1IFJ A;  1FAV A;  1L0L J;  2J58 A;  3Q2Y A;  1FZF A;  5B66 E;  1SQQ J;  4H44 D;  3V2Q A;  1PGJ A;  2YXR B;  3H1K D;  1JY3 N;  4W7Y A;  3AE1 C;  2BEZ F;  1KD1 Q;  1N7L A;  4U3F D;  1GU5 A;  1VDF A;  1S4X A;  1ZOY C;  2Q1K A;  1PIX A;  1SQV D;  1YJ9 P;  1SFC B;  1E5W A;  3M9H A;  1CZQ A;  1LP1 A;  1IK7 A;  4PV1 C;  3RBX A;  1W2B O;  2FXM A;  2LXB A;  3T97 B;  3H1I E;  1BGY J;  1VPC A;  2Q5U A;  2HPC B;  2ZJS E;  2H8P D;  5AVX B;  4A7P A;  3SWK A;  3E1R A;  2YKO A;  2ZVN B;  1GL2 D;  3M0D A;  4I1L A;  3A2A A;  3H1L G;  3V5B A;  3CCJ P;  4ZKP A;  3WUU A;  3L71 G;  4CPG A;  3Q3D A;  5H2F H;  1RE4 A;  2KP8 A;  2KS1 A;  1RE4 C;  3H1H J;  2KSE A;  5AW1 B;  3USS A;  1HUC A;  2LR2 A;  2WSF H;  4XFJ A;  5KLI C;  3IF4 A;  1KB9 H;  3AE9 C;  3QWO C;  3G71 P;  2QVA A;  4L75 A;  2BCC E;  1UII A;  5KJ7 A;  1JB0 J;  5KJ7 C;  2FBW C;  1NTZ K;  3BCC D;  2PAJ A;  1HWT C;  1FZC A;  1FZC C;  1U7M A;  1ZRT E;  1URQ B;  4WVZ A;  2I1J A;  1L0N D;  1MFT A;  1NO4 A;  2Z4E A;  5APS A;  2QEX P;  1IFP A;  3A0B H;  2A45 I;  4DJG A;  1YI2 P;  2J5U A;  2OYH C;  2OYH B;  4HKZ H;  1LTI C;  1XTG B;  1NTZ E;  3P8C D;  1H88 A;  1CI6 A;  3I56 P;  5AW0 B;  2MJZ A;  3CWB J;  1EXJ A;  2E74 B;  5AVV B;  1N8R Q;  1N86 A;  3IN6 A;  3VP8 A;  3CCS P;  1YIJ P;  1W2E A;  1PP9 J;  4ASW A;  1BDC A;  2O01 H;  1QX8 A;  1WRG A;  2KIK A;  3AE4 C;  4GOF A;  1IC2 A;  2G8Y A;  1J1E B;  5CJ0 A;  3MHV A;  2E75 B;  2OYI A;  3H32 B;  2OYI C;  1KQL A;  4WB4 A;  3Q5S A;  3FXE A;  3RL0 B;  3A5T A;  1CW5 A;  2O3J A;  1W5C E;  2IFM A;  4UB8 E;  1VQP P;  3AE2 C;  3H1J G;  3F5H A;  3A3Y B;  4H44 C;  2IBZ I;  4PD4 I;  1JTH A;  3CLQ A;  4TLF A;  2ZT9 D;  5KLV E;  1LTG C;  1PPJ D;  2D2C D;  3VMY A;  3L70 G;  2XV5 A;  3G6E P;  4NPF X;  1OMI A;  1GW4 A;  1YJW P;  3BVH A;  3A0H H;  4NPD A;  4UB6 H;  3RK3 B;  3SFD C;  3PRJ A;  1SQP E;  1QGK B;  4Y99 C;  1NTM G;  1JEK A;  3CME P;  1NJI Q;  5AW3 B;  3KXD A;  2WT7 B;  1GL2 C;  4C7N A;  2M3B A;  3PH0 A;  2W27 A;  2QJK C;  2XDJ A;  1DD3 A;  1GL2 B;  3H1K E;  2QJK B;  4K3A A;  4LGD E;  3A0H E;  4UB6 E;  2ZYA A;  1KFM A;  3PHL A;  1Q7Y Q;  5TIS H;  2OTL P;  3LW5 H;  3L35 A;  1R8E A;  1NAF A;  3AEB C;  3BCC G;  4L73 A;  3RK3 E;  2JEE A;  1BE3 J;  2HLO A;  3H1J E;  1L0N G;  2WSE H;  2KNC A;  3H1I D;  3S9O A;  1S1C X;  3AEA C;  1NTM K;  2IZ1 A;  3CI9 A;  2B88 A;  5B5E E;  1KZU B;  1OVU A;  3L70 E;  3CC7 P;  2R32 A;  4HYT B;  2QM7 A;  3V4W A;  3MP7 B;  1KYO I;  1SFC D;  5AW5 B;  5AVY B;  3JCU H;  1HH0 A;  1NH4 A;  1YQ4 C;  3K5B A;  1NTK J;  1NTM E;  4IL6 E;  4KT0 J;  4DOJ A;  1M1J A;  3EFF K;  1L0N K;  4BRY B;  1M1J C;  3AEC C;  1VQ6 P;  3AE7 C;  4N6J A;  5AVR B;  2FFD A;  3V2N A;  1IJD B;  3E1I A;  1GTW A;  1TU3 F;  5CMZ A;  1LWU A;  2OAR A;  1LWU C;  2P58 A;  1DX7 A;  2AXT H;  1ZN5 A;  2FYZ A;  3BCC E;  2LKM A;  1ZRT D;  1L4A B;  4C7R A;  5DJU B;  1M8O B;  3L73 G;  1VQN P;  2WSC H;  1L0N E;  3WU2 H;  4DT0 A;  1DEE G;  5AW4 B;  1KB9 D;  3QH9 A;  3IR9 A;  2JJL A;  1RQU A;  1AVO A;  3E7K A;  2M5A A;  3TNU A;  1DEB A;  1BCC G;  3W67 A;  1JY3 O;  1EQ7 A;  3MGN A;  2AXT E;  2WIT A;  3H1L D;  3P8C E;  3B5N B;  1YHQ P;  3FXD A;  1OVR A;  3L71 D;  3WU2 E;  4ZNC A;  1VL2 A;  1URQ D;  2ZT9 C;  1LJ2 A;  1MV8 A;  2D2C C;  3V4Q A;  4KHX A;  3GHG A;  1UIX A;  1LTJ C;  3GHG C;  2P7J A;  1EDL A;  2FY8 A;  1LTJ B;  1JNM A;  2YO2 A;  1ZP0 C;  5CBO A;  1AV1 A;  2QRX A;  3C8V A;  1AJY A;  2H43 A;  5AW8 B;  2GUS A;  3L75 G;  1PV3 A;  1RHZ B;  2IYO A;  3CX5 E;  1SQB G;  1VQ8 P;  2E74 D;  2K9J A;  2JWD A;  1OW6 A;  3RGU A;  3L73 E;  2E75 D;  2HOD A;  4L76 A;  1X22 A;  1YYC A;  3N7N A;  3L72 J;  1N7S C;  4PJ0 H;  3RL0 D;  3CXH H;  1NYH A;  4WY4 B;  1N7S B;  1NU1 G;  2B9B A;  2Z5I A;  1HF9 A;  2YKP A;  2BCC J;  1IZN B;  4EDF A;  3LIE A;  1T3J A;  2Y0C A;  4R4L A;  1KQF B;  3L74 J;  3N4X A;  1H0T B;  2JR8 A;  1ZME C;  1QL2 A;  3TGU G;  2ZYG A;  2P10 A;  3CXH E;  3EQ2 A;  4U7J A;  4Y28 J;  1EZV G;  2A45 G;  5KKZ C;  1GK4 A;  5KKZ B;  3U1A A;  3D70 A;  1SFC A;  1NTZ J;  1L2P A;  1SFC C;  5CBN A;  1RQV A;  3MUD A;  3GMA A;  3CCU P;  1T2K C;  3MUD C;  3RK3 D;  1NU1 K;  3L75 E;  3T97 A;  2YMY A;  3GF7 A;  1K8A Q;  3H1J D;  2AEF A;  2Q3I A;  2HPC A;  3H6P A;  3AE6 C;  1YTZ I;  2BEQ D;  3M9Q A;  2KUB A;  4I6M C;  5KAI H;  2POH A;  2A06 G;  3SWF A;  4HH2 A;  4R4M A;  1L0L G;  4YXD C;  3L70 D;  1PL5 A;  2P1J A;  5CCG C;  2E43 A;  2A45 H;  1NU1 E;  2FYU J;  2ZVO B;  2M3E A;  3BRT B;  3FWN A;  1S2E A;  2QIW A;  5AVQ B;  3G9R A;  3Q5P A;  1Q86 Q;  2GUV A;  1H8A A;  2IBZ G;  1QL1 A;  1NTM D;  2V7Q J;  3CCV P;  5KLV J;  1M7L A;  5GTI H;  2LXC B;  1EDJ A;  2DW3 A;  4AYC A;  3TGU E;  2ZFC A;  2Q9I A;  4AUW A;  2JDI H;  3OA7 A;  1EZV E;  3Q5R A;  2HR3 A;  1KN7 A;  5E79 H;  2AEJ A;  5AW7 B;  1BGY G;  5CCH D;  1EC5 A;  1VQK P;  5AVS B;  1FOS F;  5H2F E;  3W68 A;  1GU4 A;  2WQY C;  3CCQ P;  1G2C B;  1FS0 E;  1L0L K;  3O6Q B;  1SQP J;  1URQ A;  4D6T J;  1M90 Q;  1URQ C;  3WUV A;  2C9N Y;  5GTI E;  1IO4 A;  3B8E B;  1NHL A;  3HE5 B;  5GTH H;  3CPW O;  2NPS B;  1FJP A;  1E79 H;  1KB9 E;  2O01 N;  3H1K J;  2RMZ A;  5E79 E;  1Y8A A;  4U3F J;  2OYH A;  4PD4 H;  4L74 A;  1N73 B;  3I55 P;  2MKV A;  3H1H G;  2A06 E;  4I7Z B;  1SQV J;  4IFM A;  2WZ7 A;  1L0L E;  2Y9Z A;  4TT3 H;  1DD4 A;  3H1L E;  2YMK A;  2E74 C;  2C0W A;  3G4S P;  2RN0 A;  5GTH E;  3L71 E;  1FZA A;  1J1D B;  2AEM A;  1J1E C;  3H32 A;  1L4A D;  2JP3 A;  2E75 C;  1KV4 A;  2M0B A;  1JY2 P;  3A0B E;  4PD4 E;  1BDD A;  4ZKU A;  2OTK E;  2ZXX A;  3HUS B;  3RL0 C;  2ZAE B;  1NOH A;  2OQQ A;  3CCL P;  2J59 M;  1ZW0 A;  1BGY E;  1VF5 C;  3D71 A;  2WTY A;  3B5N D;  5APU A;  3CX5 D;  3SSU A;  3SFE C;  2I1K A;  1VF5 B;  1K9M Q;  1MUU A;  2YIU B;  4OGQ B;  5APX A;  5CJ4 A;  3SWY A;  2C9L Y;  1T6A A;  4H0L D;  2XKM A;  3AEG C;  2N9Y B;  3L73 D;  1YJN P;  1PZQ A;  1IFM A;  3KPE A;  1FDM A;  2GA1 A;  3B71 A;  3S4R A;  4NPE A;  5M1B A;  1PP9 G;  1BCC D;  1KC8 Q;  3H1H E;  2H7H A;  1Y47 A;  3RK3 C;  4JYC A;  2QE7 H;  1Q81 Q;  1DH3 A;  3CL3 D;  3VP9 A;  3BCC J;  3HE4 B;  2W8Z A;  2Y9Y A;  3IFM A;  1OIP A;  1L0N J;  2WT7 A;  1KYO H;  2NZ2 A;  1GL2 A;  3KQG A;  3CXH D;  2IZ0 A;  1D7M A;  3CMA P;  2SPZ A;  1ZR4 A;  4WY4 D;  2NRG A;  1N7S D;  1LTB C;  1SQX D;  5KTB A;  1NVO A;  3JSV C;  4O9B A;  1U57 A;  5KAF H;  3L75 D;  4BWN A;  1FBM A;  2QJP B;  1HJB A;  2R44 A;  2KXP B;  1SQB D;  2Y0D A;  1J2J B;  1OX3 A;  4XA4 A;  1KIL B;  1YTZ T;  1VQO P;  2N1T B;  1ZXG A;  5AW2 B;  3CC2 P;  1GW3 A;  3HD7 B;  1OW8 A;  3BAT A;  3FWL A;  1WMK A;  4JQ0 D;  5TIS E;  5CCH A;  4HJG H;  5CCH C;  2YNY A;  3M0A A;  4EYY Q;  1PP9 E;  5KAF E;  1RF1 B;  3VOP A;  1NU1 D;  1Q90 D;  3AED C;  1LNQ A;  4GOD A;  1T2K D;  1X79 B;  4BRY A;  1RE3 A;  3L36 A;  1RE3 C;  1AQT A;  2FYN B;  3TGU D;  4MN4 C;  1EZV D;  1BE3 G;  4YTP C;  2JO1 A;  4C46 A;  3I5C A;  2XNX A;  3PLN A;  3JCU E;  1A02 J;  2BAS A;  4BXL A;  1GZL A;  2XZR A;  5CCG D;  1LTA C;  1L4A A;  5C39 A;  4GDO A;  1HGZ A;  1L4A C;  2QJY B;  2OTJ P;  3NMD A;  3WUT A;  1S9K E;  2KLV A;  1CSB A;  2W90 A;  1NTK G;  2A06 D;  3HRN A;  1FDI A;  1P84 H;  3VMX A;  1L0L D;  3B5N A;  3B5N C;  1MFZ A;  1SQQ D;  1RF0 C;  3U1C A;  1LTT C;  1IK9 A;  2C0X A;  1AA0 A;  1FDO A;  4H0L C;  3H1I J;  1IFD A;  1AFO A;  1GD2 E;  4H0L B;  1Q82 Q;  1VQ9 P;  3TYY A;  1G1I A;  2IBZ D;  4PD4 D;  4WBA A;  2NPS D;  2K88 A;  1LTJ A;  1Z56 A;  1T8Z A;  1P84 E;  3OW2 O;  1QEX A;  2VRS A;  5K5G B;  1S5L X;  2QG4 A;  3BRV B;  2M8R A;  1SQX G;  1LT9 B;  2R3S A;  3EWK A;  4IFD K;  3RK2 B;  1S3J A;  4I2L C;  1BGY D;  1FOS E;  3PJS K;  1NTK K;  3GG2 A;  5APY A;  1EDK A;  2K9Y A;  3AEE C;  1NKN A;  2K3R A;  3OJA B;  5AVT B;  3VMZ A;  2WPQ A;  4WY4 A;  4WY4 C;  1N7S A;  2W6J H;  4IFF A;  1AQ5 A;  3JC2 2;  2L91 A;  1BCC E;  1M56 D;  3VN0 A;  3H1H D;  1NTK E;  1NWQ A;  3TSI A;  3R4Y A;  3G3Z A;  3KHU A;  2E76 B;  1SQX K;  2PP6 A;  1H0T A;  1SS1 A;  3TDK A;  1VF5 D;  2QM8 A;  4OGQ D;  2E5T A;  1LGH B;  1JOC A;  3MD0 A;  1SQB K;  1OWA A;  1KQG B;  1GDT A;  1KFN A;  1OFC X;  4PJ0 E;  3CX5 I;  4JF7 A;  4OWF A;  3CCM P;  4AQR D;  4LC1 A;  3H1L J;  2RH0 A;  1SQX E;  2B87 B;  1FZG A;  2KZJ A;  1PGP A;  1U7J A;  1KYO D;  3L72 G;  3L71 J;  3V2P A;  3FX0 A;  1SQB E;  3P32 A;  2FKW B;  2BCC G;  2Q6Q A;  4Z1M H;  3VYI A;  4EOT A;  3CWB D;  3L74 G;  3U59 A;  4PV1 B;  1LP1 B;  5AVU B;  2CPS A;  2WPV B;  2R3C A;  4OVN F;  1R5L A;  1PP9 D;  5CCG A;  1SQQ G;  3CXH I;  2PGD A;  1NKZ B;  2O01 J;  3M9B A;  1WT6 A;  4JPZ B;  2IX7 C;  2L5G B;  3KYQ A;  3M0D C;  1JY2 N;  1NAY A;  1K04 A;  3LID A;  3KDP B;  1NTZ G;  2KB7 P;  3NXS A;  1YIT P;  5KAI E;  2CPB A;  2YKQ A;  1KIL D;  1JO5 A;  2W6B A;  2N1T D;  4B86 A;  3GW6 A;  3HD7 D;  5AW9 B;  4IL6 X;  2KS1 B;  1G2C A;  3AE8 C;  3O6Q A;  2OYO A;  1PGO A;  2O1K A;  2XU6 A;  1VQL P;  4W7Z A;  4N78 D;  3O8Z A;  1VQM P;  4RO0 A;  3V6I A;  3PTZ A;  1SQQ K;  3L72 E;  1JY3 P;  1RH5 B;  5KLI B;  3HE5 A;  5AVZ B;  2NPS A;  1HJ0 A;  2H89 C;  2NPS C;  4RES B;  1T3U A;  2FYU G;  3P7K A;  1S9K D;  3L37 A;  1GK6 A;  1N73 A;  1N73 C;  1K73 Q;  3UIA A;  2OGU A;  1FU1 A;  1H89 A;  4I7Z C;  1FZB A;  3L74 E;  5BVZ A;  1FZC B;  5KLV G;  1JCC A;  3AE5 C;  1SQQ E;  3MIW A;  1EZV I;  1YQ3 C;  1S5L H;  3H1J J;  1J1D C;  5CHX A;  3L4F A;  2W83 C;  1MKM A;  1VQ5 P;  2WSS H;  2QSI A;  3HUS A;  5APV A;  3HUS C;  1BSN A;  2IBZ E;  3H25 A;  1A02 F;  1FJK A;  1SQP G;  4D6T G;  1P84 D;  3P8M C;  1CI6 B;  3LW5 J;  4WWI A;  1ZV8 A;  3L70 J;  2FYU K;  4UB8 H;  3MZW B;  1BE3 D;  5APT A;  2H88 C;  1KB9 I;  1X9V A;  1S5L E;  3H1K G;  2WSE J;  4YXW H;  2JWA A;  2W6A A;  4H13 D;  4U3F G;  2YIU C;  1ZLL A;  4OGQ C;  2OYI B;  5KLV K;  2V7Q H;  1R5S A;  1MZ9 A;  1SLQ A;  1NTM J;  1SQV G;  1G1J A;  1N2D C;  1NGM B;  3RL0 g;  5EFW B;  4GOE A;  1KOR A;  3FGA D;  3CWB G;  2FYU E;  3MTU E;  1QVG O;  1Q2N A;  1KMI Z;  2KSJ A;  1S72 P;  2CK3 H;  1NTK D;  1SQP K;  4H44 B;  3RK2 D;  1PFI A;  3HE4 A;  1X0T A;  3WMM 0;  1JTH B;  4RKU J;  2GM4 A;  2AXC A;  1M57 D;  2WMM A;  3Q1M A;  2IPP A;  4QMA A;  1GMJ A;  1M1K Q;  1LT1 A;  3S1K A;  1K05 A;  1SQV K;  1HGV A;  3RBZ A;  4D6T E;  3EFG A;  3GLM A;  4LLH A;  3B4S A;  4Y99 B;  4RJT A;  2YO3 A;  2Q7C A;  3HTK A;  5DJT B;  2QJP C;  1VQ4 P;  2WSC J;  2E76 D;  2YXQ B;  1KYO E;  4C7N B;  3HTK B;  4U3F E;  1SVF A;  1FE6 A;  1KIL A;  1KIL C;  2N1T A;  2N1T C;  4ASV A;  1SQV E;  3M91 A;  5B5E H;  3HD7 A;  1Y9B A;  1QVF O;  3HD7 C;  4YPC A;  1VQ7 P;  3CWB E;  3C9I A;  1RF1 A;  2Z5H A;  1RF1 C;  3NFQ A;  3CCR P;  4OH8 B;  2R5B A;  2IDB A;  1JCD A;  2HYN A;  2KNC B;  3II6 A;  2WWW A;  3TF5 A;  4EI2 A;  4IL6 H;  3A7O A;  1SP4 A;  3IAO A;  4GKG A;  5AW6 B;  3AEF C;  4M3L A;  1RY3 A;  1QLE D;  1BSH A;  3L73 J;  2FYN C;  2KI7 B;  1AVY A;  2HG5 D;  2FXO A;  4GT1 A;  2I8D A;  1KIL E;  2B89 A;  1YBK A;  4XE5 B;  1JMB A;  1OXZ A;  1BCC J;  4PV1 D;  2KLU A;  3GF3 A;  2E42 A;  1DIP A;  2FXP A;  3KZI H;  4DZO A;  3D6Y A;  1JUN A;  2QJY C;  4N78 E;  1M1J B;  2FFD C;  3L72 D;  5BU5 A;  2FFD B;  4EIJ A;  2BCC D;  1LWU B;  2E5Y A;  3VMA A;  2PRR A;  3BAS A;  2P67 A;  4N3Y B;  3M06 A;  2N9B A;  2IYP A;  3ITK A;  1IFI A;  3C1L A;  3L74 D;  1OW7 A;  2PFX A;  3KZI E;  1SQX J;  1KQS O;  3ZDM A;  4H13 C;  2XND H;  1PGQ A;  1OZH A;  4GIF A;  1RF0 A;  4K35 A;  1PPJ G;  2K1A A;  2WVR A;  1OVV A;  2KOG A;  3L75 J;  4H13 B;  5APW A;  1FC2 C;  5APQ A;  2G3A A;  1SQB J;  2KZI A;  1JMM A;  2M5A B;  3TNU B;  1USE A;  2O1J A;  1NTZ D;  2Q3E A;  3PP5 A;  2KYV A;  1HVV A;  1FZE A;  1LT9 A;  1LT9 C;  1HBW A;  5KJ7 D;  1KTM A;  3OAK A;  3RK2 C;  2HFE D;  2V4H A;  1BE3 E;  3CX5 H;  2KK7 A;  2P2U A;  3ABV C;  1NU1 J;  2K37 A;  4HB1 A;  2ZYD A;  1LTS C;  2ZT9 B;  2JKV A;  2D2C B;  5BU8 B;  1ZR2 A;  2ZXE B;  3CCE P;  3GHG B;  5AVW B;  3R2P A;  2ITA A;  3NTN A;  3V2R A;  4JBZ A;  1XTC C;  1JY2 O;  4ZMD A;  3TGU J;  2Y0E A;  2UWJ E;  2FYU D; 
#chains in the Genus database with same CATH homology
 2IZ1 A;  2JKV A;  2IYO A;  2IZ0 A;  1PGQ A;  2PGD A;  3FWN A;  2W8Z A;  1OX3 A;  1AVY A;  2ZYG A;  1PGJ A;  1AA0 A;  1PGP A;  2ZYA A;  2IYP A;  1NAY A;  2W90 A;  2ZYD A;  1PGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...