1JMBA

Crystal structure of four-helix bundle model
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQAIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Toward the de novo design of a catalytically active helix bundle: a substrate-accessible carboxylate-bridged dinuclear metal center.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords PROTEIN (FOUR-HELIX BUNDLE MODEL)
total genus 18
structure length 48
sequence length 48
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1jmbA00
1SS1A 1OVRA 3QWOC 5EFWB 2JWDA 1ZXGA 4HJGH 4JBZA 1EDKA 2P58A 4GOFA 4HB1A 4CPGA 1ZW0A 1LP1B 4NPFX 2RKLA 3MHVA 2M5AA 4NPEA 1EDLA 2LR2A 2LXBA 2K3RA 2B88A 4KJMA 4ZMDA 4K3AA 4ASVA 2SPZA 1OVVA 4MN4C 1EC5A 1H0TB 5DJUB 4HKZH 2UWJE 2QRXA 1Y47A 1BDCA 2I8DA 2B89A 2KUBA 4GODA 2WMMA 1LT1A 4WWIA 4EYYQ 2HR3A 1JM0A 1X0TA 1BDDA 5K5GB 3S1KA 3FXEA 4GOEA 1U7MA 4BXLA 2KZIA 1S3JA 5DJTB 2M0BA 2R44A 5C39A 2KZJA 1Q2NA 1EDIA 3FXDA 3PH0A 2KIKA 1OVUA 4IOIH 2KI7B 4K35A 4ASWA 4NPDA 2QVAA 2B87B 2LXCB 3RGUA 2B87A 1H0TA 5CBOA 2KS1B 1DEEG 1NVOA 2ZAEB 2M5AB 1MFTA 2Q1KA 3ZDMA 5CBNA 2OTKE 1U7JA 1FC2C 4ZNCA 1JMBA 3MZWB 1LP1A 1EDJA
chains in the Genus database with same CATH superfamily
1L0NJ 4H13D 4HH2A 1D7MA 5CMZA 3H1KE 3QWOC 1S1CX 5CJ4A 2FYUD 1Y8AA 2N1TA 1SQPD 1ZXGA 2OGUA 1R5LA 3LW5J 2IYPA 3AE2C 5KKZB 3H1LJ 2K9YA 2C0WA 1VQ7P 3RK2C 3OA7A 4KT0J 1SQPE 3II6A 3BCCJ 1A02J 4W80A 1KB9H 2P58A 4WY4D 2E76D 4XA4A 3C1LA 3TK1A 3GW6A 1RF1A 1FZCB 1CW5A 1M57D 4CPGA 3L72G 4W7ZA 1PL5A 1ZW0A 1N86A 2PGDA 1JTHB 1P84D 2WVRA 2XNXA 4QMAA 1VQ4P 3UIAA 1KB9E 2ZFCA 1YHQP 3CCSP 1KYOH 1NTZK 2K88A 4NPEA 1PPJG 3GMAA 4JF7A 3LW5H 1JB0J 3AE5C 2E76C 5APWA 3V2NA 1SQBD 1BE3J 2XNDH 3TGUG 1HJBA 2GUVA 2HODB 3L70E 2YKOA 4RESB 2QM7A 4ZMDA 1WT6A 1H8AA 1YJ9P 1FJPA 2QSIA 2KLVA 2FY8A 1IC2A 1LJ2A 2WQYC 4XFJA 2WZ7A 1LTJA 1S5LX 2A06D 2LKMA 3H6PA 3L71D 3M9HA 3R4YA 1X9VA 4MN4C 1FOSF 2ZVOB 5APSA 3P32A 1IK9A 2UWJE 4HKZH 3USSA 1NTMK 1JY3P 1L0LD 1N7SB 3A7OA 5CCGA 1K73Q 1NWQA 2CPBA 1N73B 2KUBA 1JY2P 3T97A 1LT1A 2YO2A 4PV1C 4WWIA 1LTIC 3WUTA 2HR3A 1FE6A 1VQKP 4XE5B 1KD1Q 1G1JA 3CX5E 2FKWB 3O8ZA 3FXEA 1GL2A 1WRGA 1NTZE 1U7MA 4N3YB 5B5EH 2L91A 4JQ0D 5BVZA 3O6QA 2RMZA 3HUSA 2N9YB 2O01N 1JOCA 4Y28J 1VQPP 5L8RJ 3L74G 1MFZA 1QL1A 2M0BA 2R44A 1QGKB 3B5NA 3B8EB 3HUSB 3NXSA 5AW2B 5C39A 3SFDC 2OYIA 1FU1A 5AW7B 3VP9A 1J1EC 2L5GB 3KZIE 2K9JA 3KXDA 1EDIA 2YKPA 1FZGA 4OGQB 2KYVA 3TSIA 1AQ5A 1QEXA 2D2CD 2HODA 3G71P 2E76B 3HRNA 3VYIA 3M0DA 2R5BA 3B4SA 2AEJA 2QEXP 1T2KD 3Q5PA 2KIKA 1KFNA 4N6JA 1H89A 1CSBA 4L75A 2KI7B 3V4QA 3L75J 1OMIA 3WMM0 1JCCA 5AW9B 4DT0A 1NU1K 2IDBA 3A5TA 3CWBJ 4LGDE 3HE4A 2WSFH 2AXTE 3EQ2A 3H1KD 2W6JH 1N73A 2YMKA 5KAFE 1YI2P 1NTZJ 1MKMA 1ZMEC 3CI9A 1RQUA 1ZN5A 3TF5A 2YO3A 2W6AA 1K8AQ 1JEKA 4ZKUA 4BWNA 1J1DB 1M1JA 3H25A 3VMZA 2AXCA 3M9QA 1KQSO 2W6BA 1NYHA 2A45I 3LIDA 1JCDA 4IL6E 1KTMA 1L0LE 2JO1A 1S9KE 2IYOA 1IO4A 1FDIA 1PP9J 3GG2A 5AVRB 2E74B 2HFED 1EZVD 1K04A 3V2QA 3ZDMA 3EWKA 3BASA 1A02F 4PJ0H 3IF4A 3MD0A 1BE3D 1KV4A 1T6AA 2OYIB 1OW8A 1RH5B 3RL0D 1BCCE 2PAJA 2K9JB 1BGYE 1G2CA 4OGQD 5AVUB 1NAFA 1NTKD 1SFCD 3JSVC 3CX5D 1G2CB 4U3FG 2BCCD 4D6TD 4DCKA 3AE7C 1AJYA 4YTPC 2C0XA 4OWFA 1SS1A 4Y99C 2IFNA 3CLQA 1BGYJ 1RE3A 1JY2O 1GD2E 2KSEA 3AE1C 2JWDA 4W7YA 1RF1C 3RK3B 5KLIB 2YMYA 1K9MQ 3FWLA 1SQQE 1IFMA 3HD7D 4U7JA 1LT9B 1FAVA 4C7RA 3HD7B 3CL3D 1KMIZ 4JBZA 5AVZB 5KJ7A 1S2EA 1L2PA 2N1TC 3TNUA 1OZHA 1PGOA 3NTNA 4I7ZB 1OFCX 1SQBE 5CCHC 1VQLP 1NTKK 3PP5A 3TNUB 1SLQA 4R4MA 1LP1B 3RK2D 2PFXA 2ZJSE 2YIUB 3L70G 4GIFA 4NPFX 1SQBJ 2Q5UA 2Q9IA 1GDTA 1HVVA 1NU1D 1L0NE 1SQQJ 1GZLA 1OW6A 1SFCB 2LR2A 2LXBA 1VQ8P 1BDCA 4IFMA 2V7QH 2QM8A 1DH3A 2O1KA 2E75D 2PRRA 3CCJP 1JNMA 2P10A 1R5SA 2N9BA 2P2UA 1NOHA 2QJYB 3CWBE 1N7LA 1VF5C 3H1IG 4IFFA 4K3AA 5E79H 4EI2A 3OW2O 3CCLP 1KILC 2SPZA 1EZVE 1KN7A 1L4AD 2QA4P 1JY2N 1LTSC 2FXMA 1P84I 1KYOE 1OX3A 2BASA 4WB4A 3VMXA 1NHLA 2FYUE 2G8YA 3CWBD 3RBZA 1RY3A 2JR8A 4EIJA 1H0TB 2FFDA 3L74E 1YTZT 1AFOA 1PGPA 2O3JA 2FYUJ 1LTGC 2B89A 2IZ1A 3H1HD 3CMEP 3HE5B 2ZT9D 4EYYQ 2E5TA 1L0ND 1X0TA 1BDDA 5AW0B 3HE5A 3I5CA 1PP9E 1OXZA 2K1AA 1SQXG 1S4XA 4DJGA 5DJUB 2Z4EA 1YITP 4GOEA 5BU8B 2K37A 1Y9BA 1T2KC 5AVXB 5H2FE 2KZIA 3AECC 1PP9G 2IBZD 4OVNF 2QJKC 1HF9A 1PFIA 2ZT9B 5DJTB 1DX7A 1GU5A 3ITKA 1TU3F 1VQ5P 2ZYAA 1SQPG 1IFDA 1AV1A 3H1HJ 3M0AA 2H8PD 5AW4B 2IX7C 3FXDA 2ZYDA 2KNCA 1GTWA 3V2RA 5KLVJ 2CK3H 4UB8H 3PH0A 3W67A 2Q3IA 2Z5HA 3MUDC 3VN0A 2WPQA 4ASVA 3D6ZA 3L72D 4IOIH 1LT9C 2NPSA 4ZKPA 1GL2B 4BRYA 1HBWA 1NTZD 2CPSA 3B71A 5AW5B 4NPDA 3F5HA 1FZCA 2OTJP 5CHXA 1KC8Q 4I7ZC 3P7KA 1RE4C 3IFMA 1BE3E 1IFJA 1AVYA 1CI6B 1FDOA 1SQQK 1VL2A 3L72E 3RGUA 2P7JA 1BCCG 2JKVA 3BATA 5TISE 2H43A 1QVFO 1HGZA 3CPWO 3A0BH 1S5LH 1IFIA 3L4FA 1KQFB 4LC1A 1NTMG 2QJPC 5B66H 1URQD 3L73E 2WSCH 3A3YB 1DEEG 5CCGC 4PJ0E 3SFEC 1VPCA 2C9NY 1XTCC 2AXTH 2QJYC 3BRTB 2R3SA 4EDFA 3AE4C 4WBAA 1MFTA 1LWUC 2ITAA 2OTKE 2WSEJ 1LTJB 3JCUH 1PV3A 2I1KA 2KB7P 3CX5H 3M06A 1L0NK 4N78E 5KKZC 1HTLC 1N7SA 1J2JB 2KNCB 2WPVB 2Y0EA 3AEBC 3G3ZA 1LTJC 3CXHD 4YXDC 1QVGO 3HUSC 1FOSE 1EDJA 2V7QJ 1M1JB 2FYNB 1NAYA 3IN6A 3L35A 2OYOA 1YQ3C 1KYOI 1YQ4C 4C7NA 1PGJA 1BGYD 2NPSB 4H0LB 1YIJP 3CCEP 3CXHE 1EZVI 3BCCD 1AVOA 3IAOA 3L71J 3RK2B 3L74D 2HPCA 1Z56A 2OYHC 1PPJE 1KZUB 5BU5A 1SQVD 2FYZA 2YKQA 5KTBA 3G4SP 4I1LA 4D6TJ 2BEQD 2FYUK 1Q82Q 3V2PA 1SVFA 1RE4A 2R32A 3H32A 3RBXA 1CI6A 2WTYA 1P84H 4L74A 4HJGH 3B5NB 1EDKA 2A45H 3AE8C 1NU1J 1E5WA 1PIXA 1SQQD 4HB1A 3E1RA 4LLHA 3CXHH 5B66E 3CCMP 4UB8E 1DEBA 1OWAA 1X22A 3F89A 1IJDB 2Y0DA 1BCCJ 1GK4A 1URQB 1JY3O 2KXPB 3QH9A 4HYTB 1DD3A 3H1JD 3VMAA 1SQVJ 5APYA 3FX0A 4L73A 1EDLA 2WSSH 3H1KG 5AVVB 1YJWP 2M8RA 2K3RA 2PP6A 3IR9A 3TDKA 3H1JE 2B88A 3KZIH 1NTKE 4KJMA 1FDMA 3U1CA 1Q7YQ 2QG4A 2GM4A 1LWUB 3P8CE 3H1LE 4H13B 2KOGA 3HE4B 4KHXA 2YXRB 1NTKJ 3RL0B 3WUVA 1YYCA 1S72P 2JP3A 2QIWA 1URQC 1W2EA 3HD7A 5KLVG 2W83C 1E79H 5KLVK 1JUNA 3AEEC 3K5BA 4I2LC 4H13C 2E74D 1EC5A 4DZOA 3CC7P 5APTA 3SSUA 3H1LD 2E75C 3H1IJ 1L0LK 1EZVG 1FZEA 1NKZB 1WMKA 3B5ND 3AE3C 3L73D 3L75D 4EOTA 1Y47A 1RQVA 4GKGA 4RKUJ 3U59A 2WMMA 1GU4A 3M91A 3W68A 3GHGC 1JM0A 3JCUE 4WVZA 4D6TE 1QX8A 3H32B 1H88A 3KPEA 1M90Q 2C9LY 1VQ6P 1SQPK 2R3CA 5CCHD 3L70J 4PV1D 3V6IA 4RO0A 2YNYA 1PGQA 2BCCG 2KK7A 5AVYB 2Q6QA 4B86A 1N7SC 3B5NC 4D6TG 1N2DC 2QE7H 2WPRA 2XU6A 3KDPB 4PD4E 3Q5SA 1S3JA 3AE6C 3E7KA 1ZOYC 5M1BA 3G6EP 1JO5A 1URQA 3HD7C 2IZ0A 3WUUA 5CCGD 3CCQP 1ZLLA 2J5UA 2O01H 2FYUG 2RH0A 1RF0A 1U57A 2KZJA 4H44D 4PD4H 1NGMB 2M3EA 1L0LJ 1P84E 5APVA 1JTHA 3H1HE 3AEAC 3BCCE 2KS1A 2MKVA 1FZAA 2V4HA 5B5EE 3H1KJ 1SQVK 5APUA 1LNQA 1SQBK 4IFDK 1OVUA 3E1IA 1L4AA 1SFCC 1VQOP 3TGUE 3M0DC 3H1JJ 4OGQC 3EFFK 1RHZB 1L4AB 4ASWA 3L70D 5KAFH 1J1EB 1T3JA 1EXJA 1LTAC 1MZ9A 2VRSA 4H44C 1J1DC 1NU1G 4H0LD 1SQVE 2Z5IA 3JC22 1PPJD 5AW8B 2QVAA 3GLMA 1W2BO 5GTHH 2E75B 1SQBG 3ABVC 1OIPA 1MV8A 5AW3B 4AQRD 3RK3E 5CCHA 3TGUD 1KB9D 1VQNP 2OYHA 1KILE 5KJ7C 3PJSK 4R4LA 2WITA 1NU1E 2OTLP 3L37A 5CBOA 1NJIQ 1M7LA 1RF0C 1L4AC 1SFCA 4O9BA 4TLFA 5AVSB 4OH8B 1GL2D 1X8YA 3Q3DA 2WPSA 2H7HA 2A06G 3L71G 1W5CE 4H44B 2IFMA 3EFGA 5H2FH 2W27A 3T97B 4UB6H 3I55P 5KJ7D 3AEFC 2ZAEB 2M5AB 3G9RA 3RL0C 1T8ZA 3S4RA 2P67A 1M56D 2A45G 3D6YA 1L0LG 4BRYB 3OAKA 3FGAD 1KILA 1MUUA 2A06E 3L71E 1ZV8A 1FC2C 1Q86Q 5APQA 5KAIE 4Z1MH 1KFMA 3U1AA 2IBZE 2WT7B 1RF1B 4YPCA 3P8CD 5KLIC 3RK3C 2MJZA 1JMBA 3I56P 5CJ0A 2WT7A 3N4XA 1FZBA 1GW4A 3GHGB 3S9OA 1SQPJ 4JYCA 3VP8A 3D70A 1PP9D 2IBZG 2JJLA 2H89C 4N78D 2NZ2A 2W90A 3SWYA 1UIXA 3OJAB 1OVRA 4GDOA 1IFPA 2KP8A 3MTUE 5EFWB 1FBMA 1ZRTD 4Y99B 1FS0E 1LTTC 1KQGB 2KSJA 3GF7A 3KQGA 3L74J 3SWFA 1NH4A 1GW3A 4I6MC 2D2CB 3RL0g 3PTZA 4GOFA 5GTIH 3VTPC 4U3FE 3PRJA 3VOPA 2HYNA 1M1KQ 3A0HE 1ZR4A 1NTZG 2RKLA 2E43A 1HUCA 3MHVA 2M5AA 4JPZB 2OARA 5TJHA 3CC4P 1KILD 2FFDC 1HJ0A 2N1TD 1GK6A 1KILB 2XDJA 2Q7CA 2HPCB 1R8EA 1BCCD 1LTBC 1YBKA 3M9BA 2BCCJ 3CXHI 2W8ZA 1SQXE 2J59M 2E5YA 2DW3A 3LIEA 1HGVA 4YXWH 1AQTA 4AUWA 2Y9YA 1S5LE 3A0BE 1KYOD 3MUDA 1NTMD 2O01J 2YIUC 2ZYGA 1KB9I 2Q3EA 3GF3A 5APXA 1UIIA 2GUSA 3O6QB 1IK7A 3GHGA 1OVVA 3A2AA 4IL6H 2JWAA 3CCUP 4UB6E 3NMDA 4A7PA 1DIPA 1Q81Q 2Y0CA 3N7NA 2Y9ZA 4C46A 2M3BA 2QRXA 2XV5A 2NPSD 2I1JA 1LGHB 2XZRA 2I8DA 2ZXEB 3BRVB 1QL2A 1BSNA 1BE3G 1SQXJ 3MIWA 4GODA 4PD4I 1Q90D 5AVQB 2QJPB 3RK3D 5K5GB 3Q5RA 2E74C 4M3LA 5KAIH 1FZFA 1ZR2A 2YXQB 3S1KA 1N8RQ 1NTKG 1NTME 2ZT9C 1LWUA 2H88C 2XKMA 3CMAP 4U3FD 3D71A 3HTKA 2OYIC 3L72J 3CCVP 1QLED 3C9IA 4GT1A 4BXLA 5AW6B 3HTKB 2D2CC 1BGYG 3TYYA 2AEFA 3PLNA 3BCCG 1HWTC 3SWKA 2JEEA 1ZRTE 1SQVG 3Q2YA 2RN0A 1BSHA 1GL2C 3P8MC 3PHLA 4U3FJ 1EQ7A 1Q2NA 3AE9C 3WU2E 1AA0A 1HH0A 1KQLA 2ZVNB 4C7NB 5KLVE 2IBZI 1USDA 2IPPA 1VDFA 2R5DA 5GTHE 3H1IE 3KYQA 1N7SD 1M8OB 3CD6P 2QJKB 3CC2P 1SQQG 3CCRP 2O1JA 1VQMP 2E42A 1XTGB 3V4WA 1YJNP 2AEMA 2FXPA 1IZNB 1IFNA 3KHUA 4K35A 4L76A 2NRGA 1KORA 1FJKA 1USEA 2FBWC 3H1JG 3TGUJ 1YTZI 2BEZF 2FXOA 4IL6X 2N1TB 4RJTA 1DD4A 4AYCA 1NKNA 1NO4A 2B87B 2J58A 3V5BA 2LXCB 1GMJA 1JY3N 1FZCC 3C8VA 2B87A 1RE3C 3Q1MA 5AVWB 2BCCE 1H0TA 3H1ID 2GA1A 3L73J 4JYBA 1S9KD 5E79E 1ZP0C 2FFDB 3L75E 2ZXXA 5KLVD 5GTIE 2KS1B 3CX5I 1OW7A 3BVHA 2KLUA 4PV1B 1SP4A 2HLOA 2WWWA 3AEGC 1G1IA 3MGNA 1NVOA 2WSCJ 3CWBG 4WY4A 1PZQA 1VF5B 3A0HH 3H1LG 3L36A 3L73G 1M1JC 2FYNC 2JDIH 2B9BA 3L75G 4TT3H 2Q1KA 4WY4B 5CBNA 2HG5D 3H1HG 1LT9A 2NPSC 4H0LC 3R2PA 3WU2H 1U7JA 2POHA 4DOJA 2WSEH 1L0NG 1X79B 5AW1B 4ZNCA 1EXIA 1JMMA 1SQXK 4PD4D 2G3AA 3VMYA 1SQXD 3AEDC 1T3UA 1NTMJ 3MP7B 1VQ9P 1K05A 3MZWB 3NFQA 2WSFJ 2OYHB 1LP1A 1CZQA 2P1JA 3FWNA 1VF5D 4WY4C 5AVTB 5TISH 2OQQA 1N73C
chains in the Genus database with same CATH topology
1SS1A 1OVRA 3QWOC 5EFWB 2JWDA 1ZXGA 4HJGH 4JBZA 1EDKA 2P58A 4GOFA 4HB1A 4CPGA 1ZW0A 1LP1B 4NPFX 2RKLA 3MHVA 2M5AA 4NPEA 1EDLA 2LR2A 2LXBA 2K3RA 2B88A 4KJMA 4ZMDA 4K3AA 4ASVA 2SPZA 1OVVA 4MN4C 1EC5A 1H0TB 5DJUB 4HKZH 2UWJE 2QRXA 1Y47A 1BDCA 2I8DA 2B89A 2KUBA 4GODA 2WMMA 1LT1A 4WWIA 4EYYQ 2HR3A 1JM0A 1X0TA 1BDDA 5K5GB 3S1KA 3FXEA 4GOEA 1U7MA 4BXLA 2KZIA 1S3JA 5DJTB 2M0BA 2R44A 5C39A 2KZJA 1Q2NA 1EDIA 3FXDA 3PH0A 2KIKA 1OVUA 4IOIH 2KI7B 4K35A 4ASWA 4NPDA 2QVAA 2B87B 2LXCB 3RGUA 2B87A 1H0TA 5CBOA 2KS1B 1DEEG 1NVOA 2ZAEB 2M5AB 1MFTA 2Q1KA 3ZDMA 5CBNA 2OTKE 1U7JA 1FC2C 4ZNCA 1JMBA 3MZWB 1LP1A 1EDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SS1 A;  1OVR A;  3QWO C;  5EFW B;  2JWD A;  1ZXG A;  4HJG H;  4JBZ A;  1EDK A;  2P58 A;  4GOF A;  4HB1 A;  4CPG A;  1ZW0 A;  1LP1 B;  4NPF X;  2RKL A;  3MHV A;  2M5A A;  4NPE A;  1EDL A;  2LR2 A;  2LXB A;  2K3R A;  2B88 A;  4KJM A;  4ZMD A;  4K3A A;  4ASV A;  2SPZ A;  1OVV A;  4MN4 C;  1EC5 A;  1H0T B;  5DJU B;  4HKZ H;  2UWJ E;  2QRX A;  1Y47 A;  1BDC A;  2I8D A;  2B89 A;  2KUB A;  4GOD A;  2WMM A;  1LT1 A;  4WWI A;  4EYY Q;  2HR3 A;  1JM0 A;  1X0T A;  1BDD A;  5K5G B;  3S1K A;  3FXE A;  4GOE A;  1U7M A;  4BXL A;  2KZI A;  1S3J A;  5DJT B;  2M0B A;  2R44 A;  5C39 A;  2KZJ A;  1Q2N A;  1EDI A;  3FXD A;  3PH0 A;  2KIK A;  1OVU A;  4IOI H;  2KI7 B;  4K35 A;  4ASW A;  4NPD A;  2QVA A;  2B87 B;  2LXC B;  3RGU A;  2B87 A;  1H0T A;  5CBO A;  2KS1 B;  1DEE G;  1NVO A;  2ZAE B;  2M5A B;  1MFT A;  2Q1K A;  3ZDM A;  5CBN A;  2OTK E;  1U7J A;  1FC2 C;  4ZNC A;  1JMB A;  3MZW B;  1LP1 A;  1EDJ A; 
#chains in the Genus database with same CATH topology
 1L0N J;  4H13 D;  4HH2 A;  1D7M A;  5CMZ A;  3H1K E;  3QWO C;  1S1C X;  5CJ4 A;  2FYU D;  1Y8A A;  2N1T A;  1SQP D;  1ZXG A;  2OGU A;  1R5L A;  3LW5 J;  2IYP A;  3AE2 C;  5KKZ B;  3H1L J;  2K9Y A;  2C0W A;  1VQ7 P;  3RK2 C;  3OA7 A;  4KT0 J;  1SQP E;  3II6 A;  3BCC J;  1A02 J;  4W80 A;  1KB9 H;  2P58 A;  4WY4 D;  2E76 D;  4XA4 A;  3C1L A;  3TK1 A;  3GW6 A;  1RF1 A;  1FZC B;  1CW5 A;  1M57 D;  4CPG A;  3L72 G;  4W7Z A;  1PL5 A;  1ZW0 A;  1N86 A;  2PGD A;  1JTH B;  1P84 D;  2WVR A;  2XNX A;  4QMA A;  1VQ4 P;  3UIA A;  1KB9 E;  2ZFC A;  1YHQ P;  3CCS P;  1KYO H;  1NTZ K;  2K88 A;  4NPE A;  1PPJ G;  3GMA A;  4JF7 A;  3LW5 H;  1JB0 J;  3AE5 C;  2E76 C;  5APW A;  3V2N A;  1SQB D;  1BE3 J;  2XND H;  3TGU G;  1HJB A;  2GUV A;  2HOD B;  3L70 E;  2YKO A;  4RES B;  2QM7 A;  4ZMD A;  1WT6 A;  1H8A A;  1YJ9 P;  1FJP A;  2QSI A;  2KLV A;  2FY8 A;  1IC2 A;  1LJ2 A;  2WQY C;  4XFJ A;  2WZ7 A;  1LTJ A;  1S5L X;  2A06 D;  2LKM A;  3H6P A;  3L71 D;  3M9H A;  3R4Y A;  1X9V A;  4MN4 C;  1FOS F;  2ZVO B;  5APS A;  3P32 A;  1IK9 A;  2UWJ E;  4HKZ H;  3USS A;  1NTM K;  1JY3 P;  1L0L D;  1N7S B;  3A7O A;  5CCG A;  1K73 Q;  1NWQ A;  2CPB A;  1N73 B;  2KUB A;  1JY2 P;  3T97 A;  1LT1 A;  2YO2 A;  4PV1 C;  4WWI A;  1LTI C;  3WUT A;  2HR3 A;  1FE6 A;  1VQK P;  4XE5 B;  1KD1 Q;  1G1J A;  3CX5 E;  2FKW B;  3O8Z A;  3FXE A;  1GL2 A;  1WRG A;  1NTZ E;  1U7M A;  4N3Y B;  5B5E H;  2L91 A;  4JQ0 D;  5BVZ A;  3O6Q A;  2RMZ A;  3HUS A;  2N9Y B;  2O01 N;  1JOC A;  4Y28 J;  1VQP P;  5L8R J;  3L74 G;  1MFZ A;  1QL1 A;  2M0B A;  2R44 A;  1QGK B;  3B5N A;  3B8E B;  3HUS B;  3NXS A;  5AW2 B;  5C39 A;  3SFD C;  2OYI A;  1FU1 A;  5AW7 B;  3VP9 A;  1J1E C;  2L5G B;  3KZI E;  2K9J A;  3KXD A;  1EDI A;  2YKP A;  1FZG A;  4OGQ B;  2KYV A;  3TSI A;  1AQ5 A;  1QEX A;  2D2C D;  2HOD A;  3G71 P;  2E76 B;  3HRN A;  3VYI A;  3M0D A;  2R5B A;  3B4S A;  2AEJ A;  2QEX P;  1T2K D;  3Q5P A;  2KIK A;  1KFN A;  4N6J A;  1H89 A;  1CSB A;  4L75 A;  2KI7 B;  3V4Q A;  3L75 J;  1OMI A;  3WMM 0;  1JCC A;  5AW9 B;  4DT0 A;  1NU1 K;  2IDB A;  3A5T A;  3CWB J;  4LGD E;  3HE4 A;  2WSF H;  2AXT E;  3EQ2 A;  3H1K D;  2W6J H;  1N73 A;  2YMK A;  5KAF E;  1YI2 P;  1NTZ J;  1MKM A;  1ZME C;  3CI9 A;  1RQU A;  1ZN5 A;  3TF5 A;  2YO3 A;  2W6A A;  1K8A Q;  1JEK A;  4ZKU A;  4BWN A;  1J1D B;  1M1J A;  3H25 A;  3VMZ A;  2AXC A;  3M9Q A;  1KQS O;  2W6B A;  1NYH A;  2A45 I;  3LID A;  1JCD A;  4IL6 E;  1KTM A;  1L0L E;  2JO1 A;  1S9K E;  2IYO A;  1IO4 A;  1FDI A;  1PP9 J;  3GG2 A;  5AVR B;  2E74 B;  2HFE D;  1EZV D;  1K04 A;  3V2Q A;  3ZDM A;  3EWK A;  3BAS A;  1A02 F;  4PJ0 H;  3IF4 A;  3MD0 A;  1BE3 D;  1KV4 A;  1T6A A;  2OYI B;  1OW8 A;  1RH5 B;  3RL0 D;  1BCC E;  2PAJ A;  2K9J B;  1BGY E;  1G2C A;  4OGQ D;  5AVU B;  1NAF A;  1NTK D;  1SFC D;  3JSV C;  3CX5 D;  1G2C B;  4U3F G;  2BCC D;  4D6T D;  4DCK A;  3AE7 C;  1AJY A;  4YTP C;  2C0X A;  4OWF A;  1SS1 A;  4Y99 C;  2IFN A;  3CLQ A;  1BGY J;  1RE3 A;  1JY2 O;  1GD2 E;  2KSE A;  3AE1 C;  2JWD A;  4W7Y A;  1RF1 C;  3RK3 B;  5KLI B;  2YMY A;  1K9M Q;  3FWL A;  1SQQ E;  1IFM A;  3HD7 D;  4U7J A;  1LT9 B;  1FAV A;  4C7R A;  3HD7 B;  3CL3 D;  1KMI Z;  4JBZ A;  5AVZ B;  5KJ7 A;  1S2E A;  1L2P A;  2N1T C;  3TNU A;  1OZH A;  1PGO A;  3NTN A;  4I7Z B;  1OFC X;  1SQB E;  5CCH C;  1VQL P;  1NTK K;  3PP5 A;  3TNU B;  1SLQ A;  4R4M A;  1LP1 B;  3RK2 D;  2PFX A;  2ZJS E;  2YIU B;  3L70 G;  4GIF A;  4NPF X;  1SQB J;  2Q5U A;  2Q9I A;  1GDT A;  1HVV A;  1NU1 D;  1L0N E;  1SQQ J;  1GZL A;  1OW6 A;  1SFC B;  2LR2 A;  2LXB A;  1VQ8 P;  1BDC A;  4IFM A;  2V7Q H;  2QM8 A;  1DH3 A;  2O1K A;  2E75 D;  2PRR A;  3CCJ P;  1JNM A;  2P10 A;  1R5S A;  2N9B A;  2P2U A;  1NOH A;  2QJY B;  3CWB E;  1N7L A;  1VF5 C;  3H1I G;  4IFF A;  4K3A A;  5E79 H;  4EI2 A;  3OW2 O;  3CCL P;  1KIL C;  2SPZ A;  1EZV E;  1KN7 A;  1L4A D;  2QA4 P;  1JY2 N;  1LTS C;  2FXM A;  1P84 I;  1KYO E;  1OX3 A;  2BAS A;  4WB4 A;  3VMX A;  1NHL A;  2FYU E;  2G8Y A;  3CWB D;  3RBZ A;  1RY3 A;  2JR8 A;  4EIJ A;  1H0T B;  2FFD A;  3L74 E;  1YTZ T;  1AFO A;  1PGP A;  2O3J A;  2FYU J;  1LTG C;  2B89 A;  2IZ1 A;  3H1H D;  3CME P;  3HE5 B;  2ZT9 D;  4EYY Q;  2E5T A;  1L0N D;  1X0T A;  1BDD A;  5AW0 B;  3HE5 A;  3I5C A;  1PP9 E;  1OXZ A;  2K1A A;  1SQX G;  1S4X A;  4DJG A;  5DJU B;  2Z4E A;  1YIT P;  4GOE A;  5BU8 B;  2K37 A;  1Y9B A;  1T2K C;  5AVX B;  5H2F E;  2KZI A;  3AEC C;  1PP9 G;  2IBZ D;  4OVN F;  2QJK C;  1HF9 A;  1PFI A;  2ZT9 B;  5DJT B;  1DX7 A;  1GU5 A;  3ITK A;  1TU3 F;  1VQ5 P;  2ZYA A;  1SQP G;  1IFD A;  1AV1 A;  3H1H J;  3M0A A;  2H8P D;  5AW4 B;  2IX7 C;  3FXD A;  2ZYD A;  2KNC A;  1GTW A;  3V2R A;  5KLV J;  2CK3 H;  4UB8 H;  3PH0 A;  3W67 A;  2Q3I A;  2Z5H A;  3MUD C;  3VN0 A;  2WPQ A;  4ASV A;  3D6Z A;  3L72 D;  4IOI H;  1LT9 C;  2NPS A;  4ZKP A;  1GL2 B;  4BRY A;  1HBW A;  1NTZ D;  2CPS A;  3B71 A;  5AW5 B;  4NPD A;  3F5H A;  1FZC A;  2OTJ P;  5CHX A;  1KC8 Q;  4I7Z C;  3P7K A;  1RE4 C;  3IFM A;  1BE3 E;  1IFJ A;  1AVY A;  1CI6 B;  1FDO A;  1SQQ K;  1VL2 A;  3L72 E;  3RGU A;  2P7J A;  1BCC G;  2JKV A;  3BAT A;  5TIS E;  2H43 A;  1QVF O;  1HGZ A;  3CPW O;  3A0B H;  1S5L H;  1IFI A;  3L4F A;  1KQF B;  4LC1 A;  1NTM G;  2QJP C;  5B66 H;  1URQ D;  3L73 E;  2WSC H;  3A3Y B;  1DEE G;  5CCG C;  4PJ0 E;  3SFE C;  1VPC A;  2C9N Y;  1XTC C;  2AXT H;  2QJY C;  3BRT B;  2R3S A;  4EDF A;  3AE4 C;  4WBA A;  1MFT A;  1LWU C;  2ITA A;  2OTK E;  2WSE J;  1LTJ B;  3JCU H;  1PV3 A;  2I1K A;  2KB7 P;  3CX5 H;  3M06 A;  1L0N K;  4N78 E;  5KKZ C;  1HTL C;  1N7S A;  1J2J B;  2KNC B;  2WPV B;  2Y0E A;  3AEB C;  3G3Z A;  1LTJ C;  3CXH D;  4YXD C;  1QVG O;  3HUS C;  1FOS E;  1EDJ A;  2V7Q J;  1M1J B;  2FYN B;  1NAY A;  3IN6 A;  3L35 A;  2OYO A;  1YQ3 C;  1KYO I;  1YQ4 C;  4C7N A;  1PGJ A;  1BGY D;  2NPS B;  4H0L B;  1YIJ P;  3CCE P;  3CXH E;  1EZV I;  3BCC D;  1AVO A;  3IAO A;  3L71 J;  3RK2 B;  3L74 D;  2HPC A;  1Z56 A;  2OYH C;  1PPJ E;  1KZU B;  5BU5 A;  1SQV D;  2FYZ A;  2YKQ A;  5KTB A;  3G4S P;  4I1L A;  4D6T J;  2BEQ D;  2FYU K;  1Q82 Q;  3V2P A;  1SVF A;  1RE4 A;  2R32 A;  3H32 A;  3RBX A;  1CI6 A;  2WTY A;  1P84 H;  4L74 A;  4HJG H;  3B5N B;  1EDK A;  2A45 H;  3AE8 C;  1NU1 J;  1E5W A;  1PIX A;  1SQQ D;  4HB1 A;  3E1R A;  4LLH A;  3CXH H;  5B66 E;  3CCM P;  4UB8 E;  1DEB A;  1OWA A;  1X22 A;  3F89 A;  1IJD B;  2Y0D A;  1BCC J;  1GK4 A;  1URQ B;  1JY3 O;  2KXP B;  3QH9 A;  4HYT B;  1DD3 A;  3H1J D;  3VMA A;  1SQV J;  5APY A;  3FX0 A;  4L73 A;  1EDL A;  2WSS H;  3H1K G;  5AVV B;  1YJW P;  2M8R A;  2K3R A;  2PP6 A;  3IR9 A;  3TDK A;  3H1J E;  2B88 A;  3KZI H;  1NTK E;  4KJM A;  1FDM A;  3U1C A;  1Q7Y Q;  2QG4 A;  2GM4 A;  1LWU B;  3P8C E;  3H1L E;  4H13 B;  2KOG A;  3HE4 B;  4KHX A;  2YXR B;  1NTK J;  3RL0 B;  3WUV A;  1YYC A;  1S72 P;  2JP3 A;  2QIW A;  1URQ C;  1W2E A;  3HD7 A;  5KLV G;  2W83 C;  1E79 H;  5KLV K;  1JUN A;  3AEE C;  3K5B A;  4I2L C;  4H13 C;  2E74 D;  1EC5 A;  4DZO A;  3CC7 P;  5APT A;  3SSU A;  3H1L D;  2E75 C;  3H1I J;  1L0L K;  1EZV G;  1FZE A;  1NKZ B;  1WMK A;  3B5N D;  3AE3 C;  3L73 D;  3L75 D;  4EOT A;  1Y47 A;  1RQV A;  4GKG A;  4RKU J;  3U59 A;  2WMM A;  1GU4 A;  3M91 A;  3W68 A;  3GHG C;  1JM0 A;  3JCU E;  4WVZ A;  4D6T E;  1QX8 A;  3H32 B;  1H88 A;  3KPE A;  1M90 Q;  2C9L Y;  1VQ6 P;  1SQP K;  2R3C A;  5CCH D;  3L70 J;  4PV1 D;  3V6I A;  4RO0 A;  2YNY A;  1PGQ A;  2BCC G;  2KK7 A;  5AVY B;  2Q6Q A;  4B86 A;  1N7S C;  3B5N C;  4D6T G;  1N2D C;  2QE7 H;  2WPR A;  2XU6 A;  3KDP B;  4PD4 E;  3Q5S A;  1S3J A;  3AE6 C;  3E7K A;  1ZOY C;  5M1B A;  3G6E P;  1JO5 A;  1URQ A;  3HD7 C;  2IZ0 A;  3WUU A;  5CCG D;  3CCQ P;  1ZLL A;  2J5U A;  2O01 H;  2FYU G;  2RH0 A;  1RF0 A;  1U57 A;  2KZJ A;  4H44 D;  4PD4 H;  1NGM B;  2M3E A;  1L0L J;  1P84 E;  5APV A;  1JTH A;  3H1H E;  3AEA C;  3BCC E;  2KS1 A;  2MKV A;  1FZA A;  2V4H A;  5B5E E;  3H1K J;  1SQV K;  5APU A;  1LNQ A;  1SQB K;  4IFD K;  1OVU A;  3E1I A;  1L4A A;  1SFC C;  1VQO P;  3TGU E;  3M0D C;  3H1J J;  4OGQ C;  3EFF K;  1RHZ B;  1L4A B;  4ASW A;  3L70 D;  5KAF H;  1J1E B;  1T3J A;  1EXJ A;  1LTA C;  1MZ9 A;  2VRS A;  4H44 C;  1J1D C;  1NU1 G;  4H0L D;  1SQV E;  2Z5I A;  3JC2 2;  1PPJ D;  5AW8 B;  2QVA A;  3GLM A;  1W2B O;  5GTH H;  2E75 B;  1SQB G;  3ABV C;  1OIP A;  1MV8 A;  5AW3 B;  4AQR D;  3RK3 E;  5CCH A;  3TGU D;  1KB9 D;  1VQN P;  2OYH A;  1KIL E;  5KJ7 C;  3PJS K;  4R4L A;  2WIT A;  1NU1 E;  2OTL P;  3L37 A;  5CBO A;  1NJI Q;  1M7L A;  1RF0 C;  1L4A C;  1SFC A;  4O9B A;  4TLF A;  5AVS B;  4OH8 B;  1GL2 D;  1X8Y A;  3Q3D A;  2WPS A;  2H7H A;  2A06 G;  3L71 G;  1W5C E;  4H44 B;  2IFM A;  3EFG A;  5H2F H;  2W27 A;  3T97 B;  4UB6 H;  3I55 P;  5KJ7 D;  3AEF C;  2ZAE B;  2M5A B;  3G9R A;  3RL0 C;  1T8Z A;  3S4R A;  2P67 A;  1M56 D;  2A45 G;  3D6Y A;  1L0L G;  4BRY B;  3OAK A;  3FGA D;  1KIL A;  1MUU A;  2A06 E;  3L71 E;  1ZV8 A;  1FC2 C;  1Q86 Q;  5APQ A;  5KAI E;  4Z1M H;  1KFM A;  3U1A A;  2IBZ E;  2WT7 B;  1RF1 B;  4YPC A;  3P8C D;  5KLI C;  3RK3 C;  2MJZ A;  1JMB A;  3I56 P;  5CJ0 A;  2WT7 A;  3N4X A;  1FZB A;  1GW4 A;  3GHG B;  3S9O A;  1SQP J;  4JYC A;  3VP8 A;  3D70 A;  1PP9 D;  2IBZ G;  2JJL A;  2H89 C;  4N78 D;  2NZ2 A;  2W90 A;  3SWY A;  1UIX A;  3OJA B;  1OVR A;  4GDO A;  1IFP A;  2KP8 A;  3MTU E;  5EFW B;  1FBM A;  1ZRT D;  4Y99 B;  1FS0 E;  1LTT C;  1KQG B;  2KSJ A;  3GF7 A;  3KQG A;  3L74 J;  3SWF A;  1NH4 A;  1GW3 A;  4I6M C;  2D2C B;  3RL0 g;  3PTZ A;  4GOF A;  5GTI H;  3VTP C;  4U3F E;  3PRJ A;  3VOP A;  2HYN A;  1M1K Q;  3A0H E;  1ZR4 A;  1NTZ G;  2RKL A;  2E43 A;  1HUC A;  3MHV A;  2M5A A;  4JPZ B;  2OAR A;  5TJH A;  3CC4 P;  1KIL D;  2FFD C;  1HJ0 A;  2N1T D;  1GK6 A;  1KIL B;  2XDJ A;  2Q7C A;  2HPC B;  1R8E A;  1BCC D;  1LTB C;  1YBK A;  3M9B A;  2BCC J;  3CXH I;  2W8Z A;  1SQX E;  2J59 M;  2E5Y A;  2DW3 A;  3LIE A;  1HGV A;  4YXW H;  1AQT A;  4AUW A;  2Y9Y A;  1S5L E;  3A0B E;  1KYO D;  3MUD A;  1NTM D;  2O01 J;  2YIU C;  2ZYG A;  1KB9 I;  2Q3E A;  3GF3 A;  5APX A;  1UII A;  2GUS A;  3O6Q B;  1IK7 A;  3GHG A;  1OVV A;  3A2A A;  4IL6 H;  2JWA A;  3CCU P;  4UB6 E;  3NMD A;  4A7P A;  1DIP A;  1Q81 Q;  2Y0C A;  3N7N A;  2Y9Z A;  4C46 A;  2M3B A;  2QRX A;  2XV5 A;  2NPS D;  2I1J A;  1LGH B;  2XZR A;  2I8D A;  2ZXE B;  3BRV B;  1QL2 A;  1BSN A;  1BE3 G;  1SQX J;  3MIW A;  4GOD A;  4PD4 I;  1Q90 D;  5AVQ B;  2QJP B;  3RK3 D;  5K5G B;  3Q5R A;  2E74 C;  4M3L A;  5KAI H;  1FZF A;  1ZR2 A;  2YXQ B;  3S1K A;  1N8R Q;  1NTK G;  1NTM E;  2ZT9 C;  1LWU A;  2H88 C;  2XKM A;  3CMA P;  4U3F D;  3D71 A;  3HTK A;  2OYI C;  3L72 J;  3CCV P;  1QLE D;  3C9I A;  4GT1 A;  4BXL A;  5AW6 B;  3HTK B;  2D2C C;  1BGY G;  3TYY A;  2AEF A;  3PLN A;  3BCC G;  1HWT C;  3SWK A;  2JEE A;  1ZRT E;  1SQV G;  3Q2Y A;  2RN0 A;  1BSH A;  1GL2 C;  3P8M C;  3PHL A;  4U3F J;  1EQ7 A;  1Q2N A;  3AE9 C;  3WU2 E;  1AA0 A;  1HH0 A;  1KQL A;  2ZVN B;  4C7N B;  5KLV E;  2IBZ I;  1USD A;  2IPP A;  1VDF A;  2R5D A;  5GTH E;  3H1I E;  3KYQ A;  1N7S D;  1M8O B;  3CD6 P;  2QJK B;  3CC2 P;  1SQQ G;  3CCR P;  2O1J A;  1VQM P;  2E42 A;  1XTG B;  3V4W A;  1YJN P;  2AEM A;  2FXP A;  1IZN B;  1IFN A;  3KHU A;  4K35 A;  4L76 A;  2NRG A;  1KOR A;  1FJK A;  1USE A;  2FBW C;  3H1J G;  3TGU J;  1YTZ I;  2BEZ F;  2FXO A;  4IL6 X;  2N1T B;  4RJT A;  1DD4 A;  4AYC A;  1NKN A;  1NO4 A;  2B87 B;  2J58 A;  3V5B A;  2LXC B;  1GMJ A;  1JY3 N;  1FZC C;  3C8V A;  2B87 A;  1RE3 C;  3Q1M A;  5AVW B;  2BCC E;  1H0T A;  3H1I D;  2GA1 A;  3L73 J;  4JYB A;  1S9K D;  5E79 E;  1ZP0 C;  2FFD B;  3L75 E;  2ZXX A;  5KLV D;  5GTI E;  2KS1 B;  3CX5 I;  1OW7 A;  3BVH A;  2KLU A;  4PV1 B;  1SP4 A;  2HLO A;  2WWW A;  3AEG C;  1G1I A;  3MGN A;  1NVO A;  2WSC J;  3CWB G;  4WY4 A;  1PZQ A;  1VF5 B;  3A0H H;  3H1L G;  3L36 A;  3L73 G;  1M1J C;  2FYN C;  2JDI H;  2B9B A;  3L75 G;  4TT3 H;  2Q1K A;  4WY4 B;  5CBN A;  2HG5 D;  3H1H G;  1LT9 A;  2NPS C;  4H0L C;  3R2P A;  3WU2 H;  1U7J A;  2POH A;  4DOJ A;  2WSE H;  1L0N G;  1X79 B;  5AW1 B;  4ZNC A;  1EXI A;  1JMM A;  1SQX K;  4PD4 D;  2G3A A;  3VMY A;  1SQX D;  3AED C;  1T3U A;  1NTM J;  3MP7 B;  1VQ9 P;  1K05 A;  3MZW B;  3NFQ A;  2WSF J;  2OYH B;  1LP1 A;  1CZQ A;  2P1J A;  3FWN A;  1VF5 D;  4WY4 C;  5AVT B;  5TIS H;  2OQQ A;  1N73 C; 
#chains in the Genus database with same CATH homology
 1SS1 A;  1OVR A;  3QWO C;  5EFW B;  2JWD A;  1ZXG A;  4HJG H;  4JBZ A;  1EDK A;  2P58 A;  4GOF A;  4HB1 A;  4CPG A;  1ZW0 A;  1LP1 B;  4NPF X;  2RKL A;  3MHV A;  2M5A A;  4NPE A;  1EDL A;  2LR2 A;  2LXB A;  2K3R A;  2B88 A;  4KJM A;  4ZMD A;  4K3A A;  4ASV A;  2SPZ A;  1OVV A;  4MN4 C;  1EC5 A;  1H0T B;  5DJU B;  4HKZ H;  2UWJ E;  2QRX A;  1Y47 A;  1BDC A;  2I8D A;  2B89 A;  2KUB A;  4GOD A;  2WMM A;  1LT1 A;  4WWI A;  4EYY Q;  2HR3 A;  1JM0 A;  1X0T A;  1BDD A;  5K5G B;  3S1K A;  3FXE A;  4GOE A;  1U7M A;  4BXL A;  2KZI A;  1S3J A;  5DJT B;  2M0B A;  2R44 A;  5C39 A;  2KZJ A;  1Q2N A;  1EDI A;  3FXD A;  3PH0 A;  2KIK A;  1OVU A;  4IOI H;  2KI7 B;  4K35 A;  4ASW A;  4NPD A;  2QVA A;  2B87 B;  2LXC B;  3RGU A;  2B87 A;  1H0T A;  5CBO A;  2KS1 B;  1DEE G;  1NVO A;  2ZAE B;  2M5A B;  1MFT A;  2Q1K A;  3ZDM A;  5CBN A;  2OTK E;  1U7J A;  1FC2 C;  4ZNC A;  1JMB A;  3MZW B;  1LP1 A;  1EDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...