1JMBA

Crystal structure of four-helix bundle model
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQAIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords PROTEIN (FOUR-HELIX BUNDLE MODEL)
publication title Toward the de novo design of a catalytically active helix bundle: a substrate-accessible carboxylate-bridged dinuclear metal center.
pubmed doi rcsb
total genus 18
structure length 48
sequence length 48
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1jmbA00
1EDIA 2LR2A 1ZW0A 1MFTA 3S1KA 4NPDA 4GODA 1BDCA 3RGUA 4KJMA 5C39A 4K3AA 4JBZA 4HKZH 3MZWB 2K3RA 2QRXA 4GOFA 3FXDA 2LXBA 1DEEG 2UWJE 1X0TA 1Y47A 4NPFX 4ZMDA 1JMBA 3ZDMA 3QWOC 2KS1B 4EYYQ 4MN4C 4ASVA 1EDKA 1U7MA 5EFWB 2I8DA 4ZNCA 2JWDA 3PH0A 5K5GB 4IOIH 2Q1KA 2SPZA 5CBOA 2M0BA 2KI7B 4ASWA 2RKLA 1H0TB 1FC2C 2KZJA 2KIKA 2B87B 1LP1B 2P58A 4NPEA 2WMMA 1SS1A 2OTKE 2KUBA 2LXCB 2B89A 1OVVA 4HB1A 1H0TA 1S3JA 2HR3A 4CPGA 1ZXGA 1EC5A 2QVAA 1LP1A 2R44A 1EDLA 1JM0A 1LT1A 1Q2NA 1OVUA 4K35A 2M5AB 2B88A 1U7JA 1BDDA 1NVOA 5DJTB 5DJUB 2KZIA 5CBNA 1OVRA 4HJGH 2ZAEB 3MHVA 4BXLA 2M5AA 1EDJA 2B87A 4GOEA 4WWIA 3FXEA
chains in the Genus database with same CATH superfamily
1NAYA 2LR2A 1R5SA 3G9RA 1KILD 5C39A 3P8CD 3HD7B 1BGYJ 5E79H 3JCUE 2YNYA 2WPRA 2I1JA 3FXDA 1N73B 3MP7B 4OH8B 3BRVB 4ZMDA 3ITKA 3PRJA 2N1TC 4H0LD 1NHLA 1GL2D 2E76C 2E75D 4I7ZC 1OW7A 1PIXA 2O1KA 1CI6B 2NPSC 1L4AA 2FFDA 3JCUH 1LTGC 1N7SD 3AE4C 3TSIA 2JO1A 1IJDB 4CPGA 2WSEH 2FXOA 1RF0A 1TU3F 4ZKPA 3B5NA 1GW4A 1OVUA 2HPCA 2WSEJ 1LGHB 3H1KJ 2BCCJ 1VL2A 5DJTB 2IPPA 2OYHA 3A5TA 4LC1A 2O01H 3Q5PA 1H8AA 4YTPC 3KZIE 4OGQC 2OYOA 1ZW0A 1FU1A 2W90A 1PGOA 4L74A 2WTYA 3AE7C 2XZRA 2IFNA 1LT9A 5KAIE 2OTJP 3BCCE 1PGPA 1P84D 1K73Q 2KOGA 2AXTE 2UWJE 1OWAA 1M56D 3JC22 5CCHC 1H88A 4LGDE 1BGYG 1GU5A 3NFQA 2V4HA 2XKMA 4AUWA 3KZIH 4HYTB 3CC7P 2RN0A 3M91A 3KYQA 3AEDC 2C9NY 1KQFB 2OYIB 4H44D 1SFCD 2WSFJ 2FYNC 1NAFA 3AEAC 5KAIH 4W80A 3CX5D 1WRGA 1SQBE 1RHZB 4JPZB 1QVGO 5CCGD 4PD4I 1RF1C 1UIIA 3L37A 2H43A 3GW6A 3E1IA 3NTNA 1AVOA 3CCJP 2B9BA 3CCEP 2ZVOB 1N7LA 4HJGH 1BSNA 1IFDA 1IO4A 1KILA 1DEBA 3V6IA 2B87A 3OJAB 1S9KE 4Z1MH 1L0LJ 3SFDC 4EDFA 2KNCB 3CCQP 4OVNF 2E42A 3L75J 3RL0B 2QRXA 3H1HJ 5KJ7A 1GL2A 4R4MA 1URQC 1A02J 4I6MC 3ZDMA 3AE2C 3KPEA 2Z4EA 2D2CC 4H13D 2OARA 3EFFK 1YBKA 2JWDA 2R3CA 1G1JA 1N7SA 1J1DB 3JSVC 2HG5D 3PH0A 1VF5B 1JTHA 4U3FJ 1M1JA 5AW9B 3MGNA 4KHXA 2KB7P 3FGAD 1VPCA 3NMDA 2WITA 3HUSA 3KQGA 1ZR4A 3TGUE 5AVWB 2V7QH 3C1LA 3V4QA 3VN0A 4AQRD 3HD7C 1YHQP 4RJTA 1N73C 3AE5C 4DT0A 3M9HA 1K04A 3H1LG 1L0NJ 1CW5A 1RE4C 3D71A 3BCCG 2KZIA 2ZAEB 1SQPJ 1SQQE 1JMMA 1LTJA 1SQXJ 2PFXA 2YMYA 3L72J 1VQ6P 5H2FE 1DX7A 4UB8E 1L4AB 2A45H 2ZXXA 1FBMA 3RGUA 1KFNA 3D6ZA 1UIXA 3BCCD 1L0LG 1NU1E 3G3ZA 5APYA 1EZVI 5GTIH 3A2AA 5KTBA 3L71J 2I1KA 1ZLLA 5KLVD 1NTMG 3B5NB 1U7MA 3H1JJ 3H1IE 2AXCA 1SFCA 5H2FH 2FYUJ 4UB8H 2SPZA 5CBOA 4O9BA 1NTZE 5CCGA 1H0TB 2YKQA 1JY3P 2JKVA 1LP1B 1QEXA 3IAOA 2W6JH 1JY3N 1LJ2A 2KUBA 2LXCB 5AVVB 2J58A 4PD4E 3M0DC 1SQBD 1PL5A 1SQVE 2QE7H 4Y99C 2ZT9B 4U3FG 3GHGA 1EC5A 1JY3O 1S2EA 5AW2B 4B86A 2HFED 1YITP 4IFFA 1HGVA 1SQBK 1NTMK 2HYNA 3E1RA 1YTZI 1BE3E 4DOJA 4YXWH 1Q81Q 1M90Q 1DIPA 2M5AA 4GOEA 4GIFA 2YXQB 5AW5B 2L91A 4PD4H 1S9KD 3S1KA 1VQOP 1ZN5A 3M9BA 2OYIC 2O3JA 3O6QA 1SQXG 3V4WA 3PLNA 1D7MA 2OQQA 4RESB 2NPSD 1PP9E 4NPFX 1AFOA 3RK2B 3Q1MA 1BCCJ 2RH0A 1Q90D 2WZ7A 4IFDK 3HE5A 2NZ2A 1NKZB 4TLFA 2IZ1A 1HVVA 2K9JA 3L71G 1VQ5P 1KILB 3H1JG 1Y8AA 3KDPB 2IDBA 2B87B 2Q3IA 2WMMA 1RE3A 1HJ0A 3W68A 1KQSO 1OVVA 3TGUD 1S3JA 3TF5A 3RL0C 1QL2A 3CWBE 5BU8B 3S4RA 2WPVB 5B5EE 1AA0A 1JM0A 1T2KD 4OGQD 1S5LX 3CPWO 3U1AA 4GDOA 1NVOA 4L76A 3RBZA 2IX7C 4AYCA 1BGYE 3WUVA 4WB4A 2E74C 1NU1G 4IL6E 1SQQD 4KT0J 4WBAA 3T97A 1N7SB 1J1DC 5CCHD 1JNMA 2MJZA 3H1IG 3HTKA 1W2EA 2J59M 4GODA 1SQQK 5BVZA 2Y0EA 2WSCJ 4C7RA 3AEBC 5B5EH 3GG2A 4UB6E 1IFJA 3HUSB 1SLQA 1DEEG 1EZVE 3IN6A 1OW6A 3I55P 4IL6H 5EFWB 1SQVG 1ZRTE 1NU1K 4WY4B 3CI9A 2KI7B 3CC4P 4IFMA 2Y9ZA 1CSBA 1NTZD 2JP3A 3L74J 3N4XA 2AEMA 1BE3G 1PGJA 4UB6H 3H1KE 4PV1D 3O8ZA 2BCCE 2QJPB 5KJ7D 1L4AC 1YYCA 3VMYA 4PD4D 1NTZK 3B8EB 2QVAA 1HUCA 5TJHA 2K1AA 3V2QA 1T3UA 1LT1A 5AVRB 1SQVK 3L35A 1IK9A 1BE3D 4N3YB 2N1TA 1RQUA 1GK6A 1OZHA 1PP9G 1KQLA 4H44B 1SFCB 2WSSH 4BXLA 3R4YA 3Q5SA 2C9LY 4C7NA 2NPSA 1KD1Q 2K9YA 3BASA 3TNUB 1CZQA 2KSJA 2J5UA 4C46A 1M7LA 1N8RQ 2ZT9C 1PP9D 3AE9C 1NJIQ 1OMIA 1KYOI 1T6AA 3H6PA 1EDKA 2K88A 2IBZI 3A7OA 3CMEP 3H1LE 3WMM0 1GD2E 3CWBG 3A0BE 1W5CE 3CC2P 1WT6A 2WPQA 2BEQD 3CLQA 1G2CA 3L73J 3A3YB 3USSA 1FDMA 3V2NA 1QX8A 2WPSA 2P58A 1K8AQ 4NPEA 1FZEA 2OTKE 2PP6A 2P1JA 2ZYAA 3BRTB 4HH2A 3MUDA 3O6QB 2WSFH 3L74G 3SWYA 1H89A 3LIDA 4H13B 1KC8Q 3Q2YA 1IZNB 3CWBD 1VQ4P 1L0LE 2XU6A 3A0BH 3RK3E 3RK2C 2N9YB 5AW7B 1LTSC 3L75E 5CCHA 1FZBA 1NTME 1S72P 1EZVG 5M1BA 1BGYD 1EQ7A 3H1HE 1FZAA 1AQTA 1J2JB 4I2LC 3WU2H 1KMIZ 3SSUA 1E5WA 2QG4A 3H32A 5B66E 2E5YA 2G8YA 3AE1C 1LWUA 4NPDA 1RH5B 4KJMA 3OW2O 1OX3A 1K05A 1EZVD 4U3FE 2POHA 3H1KG 1RF1A 3QH9A 1NTKJ 5KLVJ 2BCCG 1S5LH 4MN4C 3VTPC 1AVYA 1SVFA 1HH0A 1VQLP 1S4XA 2BASA 3RL0g 2FXPA 5B66H 1JB0J 4JQ0D 2M8RA 3WUUA 3SFEC 2M0BA 2ITAA 1GU4A 2KZJA 1L0NE 3H1KD 1YQ3C 2AEFA 2BCCD 4EIJA 3L73G 3HTKB 1SQPE 1SQXE 1FZCB 1NOHA 3HE4A 3L72E 2MKVA 3CD6P 1HTLC 3CCVP 3GLMA 2XDJA 1U7JA 1URQA 2YIUB 1FDOA 5CMZA 2P67A 3MHVA 2YO3A 2KSEA 2XNDH 4WY4C 3L71E 5AW0B 1EXIA 3H1JE 4BWNA 5GTIE 1BSHA 2K3RA 2FYUE 2QJPC 5APTA 2KP8A 1R5LA 1LTTC 3IFMA 2HODA 3V2RA 1KYOE 3IF4A 2Z5HA 3SWKA 3CCRP 2IBZE 2FFDB 1KZUB 1N73A 1YI2P 1KB9I 3V2PA 1FZGA 3EFGA 2QJKB 3H1LD 1ZP0C 1RE4A 2W6BA 3RL0D 3CMAP 3TYYA 4D6TJ 4I1LA 3L75G 1HF9A 1MKMA 5APWA 1MUUA 4N78E 3H1HG 2HPCB 1W2BO 1T8ZA 1NKNA 1CI6A 2E74D 4LLHA 1KYOH 5KKZB 1NYHA 2OYHB 3F5HA 2KS1A 5AW3B 5APVA 2OGUA 1MV8A 3AEEC 1RQVA 2H8PD 2QEXP 5GTHE 2H88C 1L0LD 1PV3A 3RK3D 3L75D 3MTUE 4EI2A 1NTMD 3EQ2A 2CK3H 3H1HD 1L0LK 3G4SP 2CPSA 1EDJA 5AVZB 1IFMA 1LT9B 3CCLP 1G2CB 2XNXA 4BRYA 1BCCE 1MFTA 3L70J 4GKGA 2R5BA 2WVRA 1J1EB 1IK7A 1KN7A 1VQMP 4XE5B 5KAFH 5GTHH 3M0DA 1L0NG 2O1JA 5AVTB 4U3FD 3QWOC 1XTGB 2N1TD 4H13C 2A06E 3OAKA 1SQPG 3UIAA 1JO5A 2E76D 4Y28J 2C0WA 3L72G 2IYPA 4IOIH 2Q1KA 1PPJG 3HRNA 2RKLA 4EOTA 1JEKA 2Q3EA 1AQ5A 2RMZA 2Z5IA 1L0ND 2ZJSE 1LWUB 4HB1A 1ZR2A 2GUVA 2OYIA 4D6TG 2R32A 3P32A 1SQPD 1SQXD 3R2PA 1RE3C 1L0NK 1RY3A 2Q7CA 1GDTA 1KORA 1SQPK 1YQ4C 2FYUG 1SQXK 1AJYA 4YPCA 1R8EA 3AEFC 4H0LB 2ZXEB 3PHLA 4PV1B 3FXEA 3M0AA 4A7PA 2Q6QA 1GL2B 1QVFO 2IBZG 2WT7A 5AVXB 3L71D 1NWQA 2E75B 2R5DA 3VOPA 3CXHI 4K3AA 3H1JD 1FOSE 4HKZH 2H89C 4R4LA 1VQ7P 1JY2P 2FYUD 1X0TA 2KNCA 2KLVA 3L70G 2WSCH 1FZCC 1JTHB 1VF5C 3HE4B 1WMKA 3L74E 4QMAA 1JY2N 2ZVNB 1N2DC 1M1JB 1KB9E 4PJ0E 2FYUK 2IBZD 1JY2O 1JCCA 3TK1A 2YIUC 2QSIA 1LTIC 3AE6C 3II6A 3ABVC 3H25A 1NU1D 3MD0A 4L73A 3NXSA 3VMZA 1Z56A 2WQYC 4N78D 1OIPA 3H1ID 1FJPA 1FS0E 4U7JA 1BCCG 1VDFA 1KB9H 4PJ0H 1LTJB 2HODB 1BDDA 3GMAA 3TDKA 1N86A 3PP5A 2E43A 1FAVA 1YIJP 2FFDC 3WUTA 1PZQA 1SQVD 1GTWA 2QJKC 2A06G 1BCCD 1QL1A 1RF0C 1JCDA 5AVSB 1M8OB 2JR8A 1DH3A 3S9OA 3B5NC 3L73E 1URQD 4RKUJ 5KKZC 1JMBA 2ZFCA 3F89A 2OYHC 2ZYDA 5AW6B 2D2CD 2KS1B 4ASVA 4ZKUA 2A06D 4TT3H 1KQGB 1HGZA 1A02F 4W7ZA 2W6AA 5APUA 1HWTC 2A45I 2FYZA 3AECC 3N7NA 2Q9IA 1HBWA 3AEGC 4ASWA 1IC2A 3A0HE 3GHGB 2IYOA 3FX0A 1LT9C 2GM4A 2QA4P 3C8VA 1SP4A 3P7KA 1IFIA 4BRYB 1QGKB 5APXA 3L4FA 2H7HA 1H0TA 1J1EC 1Q82Q 1M1KQ 1ZOYC 1LP1A 3HD7D 3D70A 1EDLA 4WY4D 1USEA 1T2KC 5CHXA 5KLIB 3B4SA 2M5AB 2O01J 3MUDC 2PGDA 4Y99B 2QM8A 3WU2E 3M06A 4GT1A 2JWAA 1NH4A 3A0HH 5CBNA 4DZOA 2FBWC 1X22A 4W7YA 1YJNP 2G3AA 1K9MQ 2QJYB 1NTKE 5KLVE 1EDIA 2K37A 2BEZF 2L5GB 3LW5H 3CXHE 4XA4A 2OTLP 1PGQA 3SWFA 1FZFA 3FWLA 1S5LE 2NRGA 3HE5B 2CPBA 3LW5J 2LXBA 3I56P 1LWUC 2KK7A 3FWNA 2YXRB 5L8RJ 1T3JA 4N6JA 2K9JB 3L74D 3VMXA 3KXDA 1QLED 2AXTH 1KILC 3H1LJ 1X8YA 1KB9D 3KHUA 3U59A 1S1CX 3BCCJ 2Q5UA 5K5GB 3CXHH 1KFMA 1GK4A 1FC2C 4YXDC 2M3BA 3LIEA 2KYVA 4H0LC 3D6YA 4PV1C 2PAJA 2IFMA 5KJ7C 1GL2C 1SS1A 2KLUA 4JYCA 2WT7B 5AVQB 1Q86Q 2E75C 1ZRTD 3OA7A 3K5BA 1GMJA 3CL3D 1EXJA 2LKMA 1X9VA 2R44A 2YKOA 3T97B 1YJWP 3VMAA 1N7SC 1SQBJ 1G1IA 1NTMJ 1M1JC 1OFCX 1X79B 2JDIH 2JJLA 5AW8B 1VQ9P 3Q3DA 3HUSC 2R3SA 3CCUP 1PPJE 2E74B 3L36A 1BDCA 4JBZA 2GA1A 4GOFA 1P84I 1Y47A 1FJKA 2FKWB 3L73D 4D6TE 3RK3B 5BU5A 3VP8A 1LTJC 2YO2A 1OXZA 2M3EA 3I5CA 1OW8A 2IZ0A 2V7QJ 4IL6X 3HD7A 3CX5I 4WY4A 1GZLA 1ZXGA 1VQPP 2N1TB 1NTKG 5KLVG 2FXMA 4OWFA 2P10A 1DD3A 3VP9A 4H44C 2E76B 1SFCC 4K35A 2B88A 3L70E 4I7ZB 1M57D 4C7NB 1JOCA 2JEEA 3TGUJ 1OVRA 5CCGC 2NPSB 3G6EP 1YTZT 2W8ZA 2FY8A 3B71A 4WWIA 1LTAC 1VF5D 1PFIA 2WWWA 1VQNP 1NTKD 1NGMB 1SQBG 5KAFE 4L75A 1KILE 4JYBA 4RO0A 1Y9BA 3GHGC 3P8CE 4WVZA 3CXHD 1E79H 1Q7YQ 3MZWB 5AW1B 2VRSA 1IFPA 1SQQJ 5AW4B 1AV1A 1NTKK 3M9QA 3BATA 5KLVK 1ZV8A 2QM7A 1NO4A 3TNUA 2N9BA 5TISE 5KLIC 3MIWA 1GW3A 3C9IA 1U57A 4DCKA 5CJ4A 4OGQB 1NU1J 1XTCC 3EWKA 3V5BA 2KIKA 2YMKA 2XV5A 1FOSF 3AE3C 2QJYC 1USDA 3H1IJ 3W67A 1L2PA 1L4AD 5AVYB 3PJSK 2HR3A 1NTZJ 5TISH 1KV4A 4DJGA 1Q2NA 3RBXA 1VQ8P 2Y0CA 5DJUB 3H32B 3GF7A 1IFNA 2P2UA 2Y9YA 4JF7A 3E7KA 2E5TA 2KXPB 3B5ND 1SQVJ 3IR9A 2AEJA 2FYNB 2ZYGA 3VYIA 2HLOA 3L72D 2QIWA 2C0XA 3TGUG 2O01N 1LTBC 1PPJD 1BE3J 3P8MC 1RF1B 2A45G 2Y0DA 3G71P 1P84E 5APSA 1KTMA 2YKPA 1JUNA 2ZT9D 4XFJA 4D6TD 2GUSA 4EYYQ 1YJ9P 1MFZA 1SQQG 2I8DA 5CJ0A 4ZNCA 3GF3A 3PTZA 1DD4A 3U1CA 2P7JA 2W27A 1PP9J 3CCSP 3Q5RA 1P84H 1KYOD 3CX5E 3CCMP 2DW3A 2B89A 1URQB 4M3LA 1LNQA 3BVHA 2D2CB 3AE8C 1MZ9A 5E79E 1ZMEC 2PRRA 1FDIA 1HJBA 3L70D 3RK2D 3RK3C 1FZCA 2W83C 1VQKP 5AVUB 1NTZG 1FE6A 3CWBJ 3CX5H 5APQA
chains in the Genus database with same CATH topology
1EDIA 2LR2A 1ZW0A 1MFTA 3S1KA 4NPDA 4GODA 1BDCA 3RGUA 4KJMA 5C39A 4K3AA 4JBZA 4HKZH 3MZWB 2K3RA 2QRXA 4GOFA 3FXDA 2LXBA 1DEEG 2UWJE 1X0TA 1Y47A 4NPFX 4ZMDA 1JMBA 3ZDMA 3QWOC 2KS1B 4EYYQ 4MN4C 4ASVA 1EDKA 1U7MA 5EFWB 2I8DA 4ZNCA 2JWDA 3PH0A 5K5GB 4IOIH 2Q1KA 2SPZA 5CBOA 2M0BA 2KI7B 4ASWA 2RKLA 1H0TB 1FC2C 2KZJA 2KIKA 2B87B 1LP1B 2P58A 4NPEA 2WMMA 1SS1A 2OTKE 2KUBA 2LXCB 2B89A 1OVVA 4HB1A 1H0TA 1S3JA 2HR3A 4CPGA 1ZXGA 1EC5A 2QVAA 1LP1A 2R44A 1EDLA 1JM0A 1LT1A 1Q2NA 1OVUA 4K35A 2M5AB 2B88A 1U7JA 1BDDA 1NVOA 5DJTB 5DJUB 2KZIA 5CBNA 1OVRA 4HJGH 2ZAEB 3MHVA 4BXLA 2M5AA 1EDJA 2B87A 4GOEA 4WWIA 3FXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EDI A;  2LR2 A;  1ZW0 A;  1MFT A;  3S1K A;  4NPD A;  4GOD A;  1BDC A;  3RGU A;  4KJM A;  5C39 A;  4K3A A;  4JBZ A;  4HKZ H;  3MZW B;  2K3R A;  2QRX A;  4GOF A;  3FXD A;  2LXB A;  1DEE G;  2UWJ E;  1X0T A;  1Y47 A;  4NPF X;  4ZMD A;  1JMB A;  3ZDM A;  3QWO C;  2KS1 B;  4EYY Q;  4MN4 C;  4ASV A;  1EDK A;  1U7M A;  5EFW B;  2I8D A;  4ZNC A;  2JWD A;  3PH0 A;  5K5G B;  4IOI H;  2Q1K A;  2SPZ A;  5CBO A;  2M0B A;  2KI7 B;  4ASW A;  2RKL A;  1H0T B;  1FC2 C;  2KZJ A;  2KIK A;  2B87 B;  1LP1 B;  2P58 A;  4NPE A;  2WMM A;  1SS1 A;  2OTK E;  2KUB A;  2LXC B;  2B89 A;  1OVV A;  4HB1 A;  1H0T A;  1S3J A;  2HR3 A;  4CPG A;  1ZXG A;  1EC5 A;  2QVA A;  1LP1 A;  2R44 A;  1EDL A;  1JM0 A;  1LT1 A;  1Q2N A;  1OVU A;  4K35 A;  2M5A B;  2B88 A;  1U7J A;  1BDD A;  1NVO A;  5DJT B;  5DJU B;  2KZI A;  5CBN A;  1OVR A;  4HJG H;  2ZAE B;  3MHV A;  4BXL A;  2M5A A;  1EDJ A;  2B87 A;  4GOE A;  4WWI A;  3FXE A; 
#chains in the Genus database with same CATH topology
 1NAY A;  2LR2 A;  1R5S A;  3G9R A;  1KIL D;  5C39 A;  3P8C D;  3HD7 B;  1BGY J;  5E79 H;  3JCU E;  2YNY A;  2WPR A;  2I1J A;  3FXD A;  1N73 B;  3MP7 B;  4OH8 B;  3BRV B;  4ZMD A;  3ITK A;  3PRJ A;  2N1T C;  4H0L D;  1NHL A;  1GL2 D;  2E76 C;  2E75 D;  4I7Z C;  1OW7 A;  1PIX A;  2O1K A;  1CI6 B;  2NPS C;  1L4A A;  2FFD A;  3JCU H;  1LTG C;  1N7S D;  3AE4 C;  3TSI A;  2JO1 A;  1IJD B;  4CPG A;  2WSE H;  2FXO A;  1RF0 A;  1TU3 F;  4ZKP A;  3B5N A;  1GW4 A;  1OVU A;  2HPC A;  2WSE J;  1LGH B;  3H1K J;  2BCC J;  1VL2 A;  5DJT B;  2IPP A;  2OYH A;  3A5T A;  4LC1 A;  2O01 H;  3Q5P A;  1H8A A;  4YTP C;  3KZI E;  4OGQ C;  2OYO A;  1ZW0 A;  1FU1 A;  2W90 A;  1PGO A;  4L74 A;  2WTY A;  3AE7 C;  2XZR A;  2IFN A;  1LT9 A;  5KAI E;  2OTJ P;  3BCC E;  1PGP A;  1P84 D;  1K73 Q;  2KOG A;  2AXT E;  2UWJ E;  1OWA A;  1M56 D;  3JC2 2;  5CCH C;  1H88 A;  4LGD E;  1BGY G;  1GU5 A;  3NFQ A;  2V4H A;  2XKM A;  4AUW A;  3KZI H;  4HYT B;  3CC7 P;  2RN0 A;  3M91 A;  3KYQ A;  3AED C;  2C9N Y;  1KQF B;  2OYI B;  4H44 D;  1SFC D;  2WSF J;  2FYN C;  1NAF A;  3AEA C;  5KAI H;  4W80 A;  3CX5 D;  1WRG A;  1SQB E;  1RHZ B;  4JPZ B;  1QVG O;  5CCG D;  4PD4 I;  1RF1 C;  1UII A;  3L37 A;  2H43 A;  3GW6 A;  3E1I A;  3NTN A;  1AVO A;  3CCJ P;  2B9B A;  3CCE P;  2ZVO B;  1N7L A;  4HJG H;  1BSN A;  1IFD A;  1IO4 A;  1KIL A;  1DEB A;  3V6I A;  2B87 A;  3OJA B;  1S9K E;  4Z1M H;  1L0L J;  3SFD C;  4EDF A;  2KNC B;  3CCQ P;  4OVN F;  2E42 A;  3L75 J;  3RL0 B;  2QRX A;  3H1H J;  5KJ7 A;  1GL2 A;  4R4M A;  1URQ C;  1A02 J;  4I6M C;  3ZDM A;  3AE2 C;  3KPE A;  2Z4E A;  2D2C C;  4H13 D;  2OAR A;  3EFF K;  1YBK A;  2JWD A;  2R3C A;  1G1J A;  1N7S A;  1J1D B;  3JSV C;  2HG5 D;  3PH0 A;  1VF5 B;  1JTH A;  4U3F J;  1M1J A;  5AW9 B;  3MGN A;  4KHX A;  2KB7 P;  3FGA D;  1VPC A;  3NMD A;  2WIT A;  3HUS A;  3KQG A;  1ZR4 A;  3TGU E;  5AVW B;  2V7Q H;  3C1L A;  3V4Q A;  3VN0 A;  4AQR D;  3HD7 C;  1YHQ P;  4RJT A;  1N73 C;  3AE5 C;  4DT0 A;  3M9H A;  1K04 A;  3H1L G;  1L0N J;  1CW5 A;  1RE4 C;  3D71 A;  3BCC G;  2KZI A;  2ZAE B;  1SQP J;  1SQQ E;  1JMM A;  1LTJ A;  1SQX J;  2PFX A;  2YMY A;  3L72 J;  1VQ6 P;  5H2F E;  1DX7 A;  4UB8 E;  1L4A B;  2A45 H;  2ZXX A;  1FBM A;  3RGU A;  1KFN A;  3D6Z A;  1UIX A;  3BCC D;  1L0L G;  1NU1 E;  3G3Z A;  5APY A;  1EZV I;  5GTI H;  3A2A A;  5KTB A;  3L71 J;  2I1K A;  1ZLL A;  5KLV D;  1NTM G;  3B5N B;  1U7M A;  3H1J J;  3H1I E;  2AXC A;  1SFC A;  5H2F H;  2FYU J;  4UB8 H;  2SPZ A;  5CBO A;  4O9B A;  1NTZ E;  5CCG A;  1H0T B;  2YKQ A;  1JY3 P;  2JKV A;  1LP1 B;  1QEX A;  3IAO A;  2W6J H;  1JY3 N;  1LJ2 A;  2KUB A;  2LXC B;  5AVV B;  2J58 A;  4PD4 E;  3M0D C;  1SQB D;  1PL5 A;  1SQV E;  2QE7 H;  4Y99 C;  2ZT9 B;  4U3F G;  3GHG A;  1EC5 A;  1JY3 O;  1S2E A;  5AW2 B;  4B86 A;  2HFE D;  1YIT P;  4IFF A;  1HGV A;  1SQB K;  1NTM K;  2HYN A;  3E1R A;  1YTZ I;  1BE3 E;  4DOJ A;  4YXW H;  1Q81 Q;  1M90 Q;  1DIP A;  2M5A A;  4GOE A;  4GIF A;  2YXQ B;  5AW5 B;  2L91 A;  4PD4 H;  1S9K D;  3S1K A;  1VQO P;  1ZN5 A;  3M9B A;  2OYI C;  2O3J A;  3O6Q A;  1SQX G;  3V4W A;  3PLN A;  1D7M A;  2OQQ A;  4RES B;  2NPS D;  1PP9 E;  4NPF X;  1AFO A;  3RK2 B;  3Q1M A;  1BCC J;  2RH0 A;  1Q90 D;  2WZ7 A;  4IFD K;  3HE5 A;  2NZ2 A;  1NKZ B;  4TLF A;  2IZ1 A;  1HVV A;  2K9J A;  3L71 G;  1VQ5 P;  1KIL B;  3H1J G;  1Y8A A;  3KDP B;  2IDB A;  2B87 B;  2Q3I A;  2WMM A;  1RE3 A;  1HJ0 A;  3W68 A;  1KQS O;  1OVV A;  3TGU D;  1S3J A;  3TF5 A;  3RL0 C;  1QL2 A;  3CWB E;  5BU8 B;  3S4R A;  2WPV B;  5B5E E;  1AA0 A;  1JM0 A;  1T2K D;  4OGQ D;  1S5L X;  3CPW O;  3U1A A;  4GDO A;  1NVO A;  4L76 A;  3RBZ A;  2IX7 C;  4AYC A;  1BGY E;  3WUV A;  4WB4 A;  2E74 C;  1NU1 G;  4IL6 E;  1SQQ D;  4KT0 J;  4WBA A;  3T97 A;  1N7S B;  1J1D C;  5CCH D;  1JNM A;  2MJZ A;  3H1I G;  3HTK A;  1W2E A;  2J59 M;  4GOD A;  1SQQ K;  5BVZ A;  2Y0E A;  2WSC J;  4C7R A;  3AEB C;  5B5E H;  3GG2 A;  4UB6 E;  1IFJ A;  3HUS B;  1SLQ A;  1DEE G;  1EZV E;  3IN6 A;  1OW6 A;  3I55 P;  4IL6 H;  5EFW B;  1SQV G;  1ZRT E;  1NU1 K;  4WY4 B;  3CI9 A;  2KI7 B;  3CC4 P;  4IFM A;  2Y9Z A;  1CSB A;  1NTZ D;  2JP3 A;  3L74 J;  3N4X A;  2AEM A;  1BE3 G;  1PGJ A;  4UB6 H;  3H1K E;  4PV1 D;  3O8Z A;  2BCC E;  2QJP B;  5KJ7 D;  1L4A C;  1YYC A;  3VMY A;  4PD4 D;  1NTZ K;  3B8E B;  2QVA A;  1HUC A;  5TJH A;  2K1A A;  3V2Q A;  1T3U A;  1LT1 A;  5AVR B;  1SQV K;  3L35 A;  1IK9 A;  1BE3 D;  4N3Y B;  2N1T A;  1RQU A;  1GK6 A;  1OZH A;  1PP9 G;  1KQL A;  4H44 B;  1SFC B;  2WSS H;  4BXL A;  3R4Y A;  3Q5S A;  2C9L Y;  4C7N A;  2NPS A;  1KD1 Q;  2K9Y A;  3BAS A;  3TNU B;  1CZQ A;  2KSJ A;  2J5U A;  4C46 A;  1M7L A;  1N8R Q;  2ZT9 C;  1PP9 D;  3AE9 C;  1NJI Q;  1OMI A;  1KYO I;  1T6A A;  3H6P A;  1EDK A;  2K88 A;  2IBZ I;  3A7O A;  3CME P;  3H1L E;  3WMM 0;  1GD2 E;  3CWB G;  3A0B E;  1W5C E;  3CC2 P;  1WT6 A;  2WPQ A;  2BEQ D;  3CLQ A;  1G2C A;  3L73 J;  3A3Y B;  3USS A;  1FDM A;  3V2N A;  1QX8 A;  2WPS A;  2P58 A;  1K8A Q;  4NPE A;  1FZE A;  2OTK E;  2PP6 A;  2P1J A;  2ZYA A;  3BRT B;  4HH2 A;  3MUD A;  3O6Q B;  2WSF H;  3L74 G;  3SWY A;  1H89 A;  3LID A;  4H13 B;  1KC8 Q;  3Q2Y A;  1IZN B;  3CWB D;  1VQ4 P;  1L0L E;  2XU6 A;  3A0B H;  3RK3 E;  3RK2 C;  2N9Y B;  5AW7 B;  1LTS C;  3L75 E;  5CCH A;  1FZB A;  1NTM E;  1S72 P;  1EZV G;  5M1B A;  1BGY D;  1EQ7 A;  3H1H E;  1FZA A;  1AQT A;  1J2J B;  4I2L C;  3WU2 H;  1KMI Z;  3SSU A;  1E5W A;  2QG4 A;  3H32 A;  5B66 E;  2E5Y A;  2G8Y A;  3AE1 C;  1LWU A;  4NPD A;  1RH5 B;  4KJM A;  3OW2 O;  1OX3 A;  1K05 A;  1EZV D;  4U3F E;  2POH A;  3H1K G;  1RF1 A;  3QH9 A;  1NTK J;  5KLV J;  2BCC G;  1S5L H;  4MN4 C;  3VTP C;  1AVY A;  1SVF A;  1HH0 A;  1VQL P;  1S4X A;  2BAS A;  3RL0 g;  2FXP A;  5B66 H;  1JB0 J;  4JQ0 D;  2M8R A;  3WUU A;  3SFE C;  2M0B A;  2ITA A;  1GU4 A;  2KZJ A;  1L0N E;  3H1K D;  1YQ3 C;  2AEF A;  2BCC D;  4EIJ A;  3L73 G;  3HTK B;  1SQP E;  1SQX E;  1FZC B;  1NOH A;  3HE4 A;  3L72 E;  2MKV A;  3CD6 P;  1HTL C;  3CCV P;  3GLM A;  2XDJ A;  1U7J A;  1URQ A;  2YIU B;  1FDO A;  5CMZ A;  2P67 A;  3MHV A;  2YO3 A;  2KSE A;  2XND H;  4WY4 C;  3L71 E;  5AW0 B;  1EXI A;  3H1J E;  4BWN A;  5GTI E;  1BSH A;  2K3R A;  2FYU E;  2QJP C;  5APT A;  2KP8 A;  1R5L A;  1LTT C;  3IFM A;  2HOD A;  3V2R A;  1KYO E;  3IF4 A;  2Z5H A;  3SWK A;  3CCR P;  2IBZ E;  2FFD B;  1KZU B;  1N73 A;  1YI2 P;  1KB9 I;  3V2P A;  1FZG A;  3EFG A;  2QJK B;  3H1L D;  1ZP0 C;  1RE4 A;  2W6B A;  3RL0 D;  3CMA P;  3TYY A;  4D6T J;  4I1L A;  3L75 G;  1HF9 A;  1MKM A;  5APW A;  1MUU A;  4N78 E;  3H1H G;  2HPC B;  1W2B O;  1T8Z A;  1NKN A;  1CI6 A;  2E74 D;  4LLH A;  1KYO H;  5KKZ B;  1NYH A;  2OYH B;  3F5H A;  2KS1 A;  5AW3 B;  5APV A;  2OGU A;  1MV8 A;  3AEE C;  1RQV A;  2H8P D;  2QEX P;  5GTH E;  2H88 C;  1L0L D;  1PV3 A;  3RK3 D;  3L75 D;  3MTU E;  4EI2 A;  1NTM D;  3EQ2 A;  2CK3 H;  3H1H D;  1L0L K;  3G4S P;  2CPS A;  1EDJ A;  5AVZ B;  1IFM A;  1LT9 B;  3CCL P;  1G2C B;  2XNX A;  4BRY A;  1BCC E;  1MFT A;  3L70 J;  4GKG A;  2R5B A;  2WVR A;  1J1E B;  1IK7 A;  1KN7 A;  1VQM P;  4XE5 B;  5KAF H;  5GTH H;  3M0D A;  1L0N G;  2O1J A;  5AVT B;  4U3F D;  3QWO C;  1XTG B;  2N1T D;  4H13 C;  2A06 E;  3OAK A;  1SQP G;  3UIA A;  1JO5 A;  2E76 D;  4Y28 J;  2C0W A;  3L72 G;  2IYP A;  4IOI H;  2Q1K A;  1PPJ G;  3HRN A;  2RKL A;  4EOT A;  1JEK A;  2Q3E A;  1AQ5 A;  2RMZ A;  2Z5I A;  1L0N D;  2ZJS E;  1LWU B;  4HB1 A;  1ZR2 A;  2GUV A;  2OYI A;  4D6T G;  2R32 A;  3P32 A;  1SQP D;  1SQX D;  3R2P A;  1RE3 C;  1L0N K;  1RY3 A;  2Q7C A;  1GDT A;  1KOR A;  1SQP K;  1YQ4 C;  2FYU G;  1SQX K;  1AJY A;  4YPC A;  1R8E A;  3AEF C;  4H0L B;  2ZXE B;  3PHL A;  4PV1 B;  3FXE A;  3M0A A;  4A7P A;  2Q6Q A;  1GL2 B;  1QVF O;  2IBZ G;  2WT7 A;  5AVX B;  3L71 D;  1NWQ A;  2E75 B;  2R5D A;  3VOP A;  3CXH I;  4K3A A;  3H1J D;  1FOS E;  4HKZ H;  2H89 C;  4R4L A;  1VQ7 P;  1JY2 P;  2FYU D;  1X0T A;  2KNC A;  2KLV A;  3L70 G;  2WSC H;  1FZC C;  1JTH B;  1VF5 C;  3HE4 B;  1WMK A;  3L74 E;  4QMA A;  1JY2 N;  2ZVN B;  1N2D C;  1M1J B;  1KB9 E;  4PJ0 E;  2FYU K;  2IBZ D;  1JY2 O;  1JCC A;  3TK1 A;  2YIU C;  2QSI A;  1LTI C;  3AE6 C;  3II6 A;  3ABV C;  3H25 A;  1NU1 D;  3MD0 A;  4L73 A;  3NXS A;  3VMZ A;  1Z56 A;  2WQY C;  4N78 D;  1OIP A;  3H1I D;  1FJP A;  1FS0 E;  4U7J A;  1BCC G;  1VDF A;  1KB9 H;  4PJ0 H;  1LTJ B;  2HOD B;  1BDD A;  3GMA A;  3TDK A;  1N86 A;  3PP5 A;  2E43 A;  1FAV A;  1YIJ P;  2FFD C;  3WUT A;  1PZQ A;  1SQV D;  1GTW A;  2QJK C;  2A06 G;  1BCC D;  1QL1 A;  1RF0 C;  1JCD A;  5AVS B;  1M8O B;  2JR8 A;  1DH3 A;  3S9O A;  3B5N C;  3L73 E;  1URQ D;  4RKU J;  5KKZ C;  1JMB A;  2ZFC A;  3F89 A;  2OYH C;  2ZYD A;  5AW6 B;  2D2C D;  2KS1 B;  4ASV A;  4ZKU A;  2A06 D;  4TT3 H;  1KQG B;  1HGZ A;  1A02 F;  4W7Z A;  2W6A A;  5APU A;  1HWT C;  2A45 I;  2FYZ A;  3AEC C;  3N7N A;  2Q9I A;  1HBW A;  3AEG C;  4ASW A;  1IC2 A;  3A0H E;  3GHG B;  2IYO A;  3FX0 A;  1LT9 C;  2GM4 A;  2QA4 P;  3C8V A;  1SP4 A;  3P7K A;  1IFI A;  4BRY B;  1QGK B;  5APX A;  3L4F A;  2H7H A;  1H0T A;  1J1E C;  1Q82 Q;  1M1K Q;  1ZOY C;  1LP1 A;  3HD7 D;  3D70 A;  1EDL A;  4WY4 D;  1USE A;  1T2K C;  5CHX A;  5KLI B;  3B4S A;  2M5A B;  2O01 J;  3MUD C;  2PGD A;  4Y99 B;  2QM8 A;  3WU2 E;  3M06 A;  4GT1 A;  2JWA A;  1NH4 A;  3A0H H;  5CBN A;  4DZO A;  2FBW C;  1X22 A;  4W7Y A;  1YJN P;  2G3A A;  1K9M Q;  2QJY B;  1NTK E;  5KLV E;  1EDI A;  2K37 A;  2BEZ F;  2L5G B;  3LW5 H;  3CXH E;  4XA4 A;  2OTL P;  1PGQ A;  3SWF A;  1FZF A;  3FWL A;  1S5L E;  2NRG A;  3HE5 B;  2CPB A;  3LW5 J;  2LXB A;  3I56 P;  1LWU C;  2KK7 A;  3FWN A;  2YXR B;  5L8R J;  1T3J A;  4N6J A;  2K9J B;  3L74 D;  3VMX A;  3KXD A;  1QLE D;  2AXT H;  1KIL C;  3H1L J;  1X8Y A;  1KB9 D;  3KHU A;  3U59 A;  1S1C X;  3BCC J;  2Q5U A;  5K5G B;  3CXH H;  1KFM A;  1GK4 A;  1FC2 C;  4YXD C;  2M3B A;  3LIE A;  2KYV A;  4H0L C;  3D6Y A;  4PV1 C;  2PAJ A;  2IFM A;  5KJ7 C;  1GL2 C;  1SS1 A;  2KLU A;  4JYC A;  2WT7 B;  5AVQ B;  1Q86 Q;  2E75 C;  1ZRT D;  3OA7 A;  3K5B A;  1GMJ A;  3CL3 D;  1EXJ A;  2LKM A;  1X9V A;  2R44 A;  2YKO A;  3T97 B;  1YJW P;  3VMA A;  1N7S C;  1SQB J;  1G1I A;  1NTM J;  1M1J C;  1OFC X;  1X79 B;  2JDI H;  2JJL A;  5AW8 B;  1VQ9 P;  3Q3D A;  3HUS C;  2R3S A;  3CCU P;  1PPJ E;  2E74 B;  3L36 A;  1BDC A;  4JBZ A;  2GA1 A;  4GOF A;  1P84 I;  1Y47 A;  1FJK A;  2FKW B;  3L73 D;  4D6T E;  3RK3 B;  5BU5 A;  3VP8 A;  1LTJ C;  2YO2 A;  1OXZ A;  2M3E A;  3I5C A;  1OW8 A;  2IZ0 A;  2V7Q J;  4IL6 X;  3HD7 A;  3CX5 I;  4WY4 A;  1GZL A;  1ZXG A;  1VQP P;  2N1T B;  1NTK G;  5KLV G;  2FXM A;  4OWF A;  2P10 A;  1DD3 A;  3VP9 A;  4H44 C;  2E76 B;  1SFC C;  4K35 A;  2B88 A;  3L70 E;  4I7Z B;  1M57 D;  4C7N B;  1JOC A;  2JEE A;  3TGU J;  1OVR A;  5CCG C;  2NPS B;  3G6E P;  1YTZ T;  2W8Z A;  2FY8 A;  3B71 A;  4WWI A;  1LTA C;  1VF5 D;  1PFI A;  2WWW A;  1VQN P;  1NTK D;  1NGM B;  1SQB G;  5KAF E;  4L75 A;  1KIL E;  4JYB A;  4RO0 A;  1Y9B A;  3GHG C;  3P8C E;  4WVZ A;  3CXH D;  1E79 H;  1Q7Y Q;  3MZW B;  5AW1 B;  2VRS A;  1IFP A;  1SQQ J;  5AW4 B;  1AV1 A;  1NTK K;  3M9Q A;  3BAT A;  5KLV K;  1ZV8 A;  2QM7 A;  1NO4 A;  3TNU A;  2N9B A;  5TIS E;  5KLI C;  3MIW A;  1GW3 A;  3C9I A;  1U57 A;  4DCK A;  5CJ4 A;  4OGQ B;  1NU1 J;  1XTC C;  3EWK A;  3V5B A;  2KIK A;  2YMK A;  2XV5 A;  1FOS F;  3AE3 C;  2QJY C;  1USD A;  3H1I J;  3W67 A;  1L2P A;  1L4A D;  5AVY B;  3PJS K;  2HR3 A;  1NTZ J;  5TIS H;  1KV4 A;  4DJG A;  1Q2N A;  3RBX A;  1VQ8 P;  2Y0C A;  5DJU B;  3H32 B;  3GF7 A;  1IFN A;  2P2U A;  2Y9Y A;  4JF7 A;  3E7K A;  2E5T A;  2KXP B;  3B5N D;  1SQV J;  3IR9 A;  2AEJ A;  2FYN B;  2ZYG A;  3VYI A;  2HLO A;  3L72 D;  2QIW A;  2C0X A;  3TGU G;  2O01 N;  1LTB C;  1PPJ D;  1BE3 J;  3P8M C;  1RF1 B;  2A45 G;  2Y0D A;  3G71 P;  1P84 E;  5APS A;  1KTM A;  2YKP A;  1JUN A;  2ZT9 D;  4XFJ A;  4D6T D;  2GUS A;  4EYY Q;  1YJ9 P;  1MFZ A;  1SQQ G;  2I8D A;  5CJ0 A;  4ZNC A;  3GF3 A;  3PTZ A;  1DD4 A;  3U1C A;  2P7J A;  2W27 A;  1PP9 J;  3CCS P;  3Q5R A;  1P84 H;  1KYO D;  3CX5 E;  3CCM P;  2DW3 A;  2B89 A;  1URQ B;  4M3L A;  1LNQ A;  3BVH A;  2D2C B;  3AE8 C;  1MZ9 A;  5E79 E;  1ZME C;  2PRR A;  1FDI A;  1HJB A;  3L70 D;  3RK2 D;  3RK3 C;  1FZC A;  2W83 C;  1VQK P;  5AVU B;  1NTZ G;  1FE6 A;  3CWB J;  3CX5 H;  5APQ A; 
#chains in the Genus database with same CATH homology
 1EDI A;  2LR2 A;  1ZW0 A;  1MFT A;  3S1K A;  4NPD A;  4GOD A;  1BDC A;  3RGU A;  4KJM A;  5C39 A;  4K3A A;  4JBZ A;  4HKZ H;  3MZW B;  2K3R A;  2QRX A;  4GOF A;  3FXD A;  2LXB A;  1DEE G;  2UWJ E;  1X0T A;  1Y47 A;  4NPF X;  4ZMD A;  1JMB A;  3ZDM A;  3QWO C;  2KS1 B;  4EYY Q;  4MN4 C;  4ASV A;  1EDK A;  1U7M A;  5EFW B;  2I8D A;  4ZNC A;  2JWD A;  3PH0 A;  5K5G B;  4IOI H;  2Q1K A;  2SPZ A;  5CBO A;  2M0B A;  2KI7 B;  4ASW A;  2RKL A;  1H0T B;  1FC2 C;  2KZJ A;  2KIK A;  2B87 B;  1LP1 B;  2P58 A;  4NPE A;  2WMM A;  1SS1 A;  2OTK E;  2KUB A;  2LXC B;  2B89 A;  1OVV A;  4HB1 A;  1H0T A;  1S3J A;  2HR3 A;  4CPG A;  1ZXG A;  1EC5 A;  2QVA A;  1LP1 A;  2R44 A;  1EDL A;  1JM0 A;  1LT1 A;  1Q2N A;  1OVU A;  4K35 A;  2M5A B;  2B88 A;  1U7J A;  1BDD A;  1NVO A;  5DJT B;  5DJU B;  2KZI A;  5CBN A;  1OVR A;  4HJG H;  2ZAE B;  3MHV A;  4BXL A;  2M5A A;  1EDJ A;  2B87 A;  4GOE A;  4WWI A;  3FXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...