1JMBA

Crystal structure of four-helix bundle model
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQAIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Toward the de novo design of a catalytically active helix bundle: a substrate-accessible carboxylate-bridged dinuclear metal center.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords PROTEIN (FOUR-HELIX BUNDLE MODEL)
total genus 18
structure length 48
sequence length 48
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1jmbA00
2KS1B 2QVAA 1Y47A 1OVVA 4BXLA 5DJTB 2B87A 1MFTA 3FXDA 1U7JA 2KZJA 1LT1A 2B88A 1X0TA 2UWJE 3PH0A 4CPGA 2KZIA 1LP1A 4ASVA 2K3RA 4ZMDA 1U7MA 2KIKA 5DJUB 1H0TA 3MHVA 4GOEA 2RKLA 4WWIA 2B87B 1SS1A 1ZXGA 2OTKE 4MN4C 3S1KA 2I8DA 1BDCA 2Q1KA 5EFWB 3MZWB 4NPDA 4NPFX 1OVUA 4GOFA 3QWOC 4IOIH 4EYYQ 1JM0A 2QRXA 3FXEA 1EDJA 1EDLA 5CBOA 1LP1B 2KI7B 2JWDA 3RGUA 1ZW0A 1EDKA 2KUBA 2M5AB 2LXBA 4NPEA 2M0BA 1Q2NA 1EDIA 2HR3A 4JBZA 2R44A 1S3JA 4GODA 2WMMA 1OVRA 2SPZA 4ZNCA 4ASWA 4HJGH 4HB1A 4KJMA 1DEEG 4K35A 5CBNA 1BDDA 2M5AA 2ZAEB 2LXCB 2LR2A 5K5GB 1EC5A 1H0TB 1NVOA 5C39A 2B89A 3ZDMA 4K3AA 1JMBA 4HKZH 2P58A 1FC2C
chains in the Genus database with same CATH superfamily
2YXQB 5KAFE 5KAIH 4LLHA 2WT7A 4YPCA 1KILE 2O01N 2G3AA 2P67A 4JYCA 5CJ0A 5AW0B 3BCCE 1S5LX 3TYYA 3VN0A 1GK4A 3V6IA 4WVZA 3L73G 5CMZA 5KLVG 5AVRB 1LWUB 2XV5A 1MFZA 1DEBA 3GF3A 4BXLA 4WY4D 1RY3A 3U59A 1A02F 1HGZA 1IZNB 1OMIA 3CXHD 5KLVK 1QVFO 3FGAD 4Z1MH 3IN6A 2WWWA 1YIJP 1VQ9P 2Z4EA 3D71A 1JY2P 1USEA 1L0NE 1L0NK 1QLED 2B88A 2RH0A 5B5EH 2A45H 3P7KA 4M3LA 2ZXEB 1SQXK 2E76D 3TGUG 1YTZT 1YHQP 1EXIA 4LGDE 1FOSF 2GM4A 2E74D 3H1ID 3I5CA 1RF1B 1MKMA 2GUSA 1SQQK 1SQXG 5KJ7A 1JCCA 1M1JC 2J5UA 2ZT9D 2ZT9B 2OYOA 3PP5A 5AVUB 1SQQE 1LT9B 3VMAA 3P32A 2C9LY 3R4YA 4H0LD 2PGDA 1GL2B 2OYHB 1PIXA 3CX5I 4ZKPA 3IR9A 3BRVB 2IBZE 2C9NY 3HE5B 4EIJA 2ZXXA 1K9MQ 5KLVJ 2KNCB 2IZ1A 3C1LA 4DZOA 2C0WA 1NGMB 3FX0A 3H1HE 1XTCC 4GOEA 2O1KA 3HE4A 1AQ5A 1JTHA 2HPCB 1HWTC 2B87B 3M9HA 1ZMEC 2NZ2A 2WZ7A 2BEZF 1IK7A 3S1KA 3TGUJ 1LTJA 1EZVE 3L37A 1SQQJ 2E43A 2I8DA 1Q86Q 3CWBE 3L75E 3H6PA 3TDKA 3K5BA 3TGUD 1S72P 3CMEP 4Y28J 5BVZA 1OIPA 1FAVA 2Q3EA 1VQ4P 3C8VA 4WY4C 1KILD 2YIUB 2KXPB 2W27A 3GW6A 1N73C 1PP9J 1ZP0C 3HUSB 3LW5H 1HBWA 4D6TD 2Z5HA 3A0BE 4I1LA 1L0LG 4YXWH 3H32A 2N1TB 1OFCX 1PV3A 2K1AA 3ABVC 3PLNA 2JKVA 4EI2A 1Q81Q 2KP8A 2FYUG 2ZVOB 1P84I 2BCCG 3OJAB 1VQ6P 1JB0J 1KORA 2Q7CA 2P1JA 3L74D 4UB6E 2XNDH 1L4AA 1SQQD 2W6AA 2E76C 2JWDA 2IYOA 3W67A 2NRGA 1SQVE 1P84H 2GUVA 1NU1E 1JY3N 1TU3F 2KUBA 2M5AB 1NTZD 2XZRA 4L76A 1EQ7A 3RK3E 3SWYA 2M0BA 4A7PA 1LJ2A 2WSCH 1RE4C 1WT6A 3L72J 3CCEP 5KKZC 1S3JA 1SFCB 1BCCJ 1SQXE 2WPRA 3JCUE 1X8YA 2KLVA 4GKGA 4H44B 5CJ4A 3D70A 4ZNCA 2Q3IA 1SQQG 1IFPA 2FYUE 1JEKA 3O8ZA 3L74G 2E76B 3O6QB 1YQ4C 5KAIE 5KAFH 4Y99B 1VQ5P 4HB1A 4KJMA 1IK9A 2ZYGA 1M90Q 5CBNA 2FY8A 1BDDA 2YMKA 4D6TG 4PD4E 2KS1A 1N7LA 3AEBC 1T3UA 3V4WA 3CX5D 3HUSC 2OYIA 1OW8A 5K5GB 1EC5A 1G2CB 4H0LB 1H0TB 1QL2A 2BCCJ 1LTAC 1ZRTD 3AEGC 1PPJD 5APVA 1NO4A 5C39A 1BE3E 5AW2B 1GW4A 4TT3H 5KJ7C 4JQ0D 1M1KQ 1BCCE 1N2DC 1EXJA 1NTMJ 3AE3C 2N1TA 3CC2P 3CCMP 2NPSA 2P10A 2ZYAA 2FXMA 4JPZB 2P58A 1J1DC 2IX7C 1FC2C 3L72G 2KYVA 3V2PA 1KB9I 2HODA 1OX3A 2O3JA 2IFMA 3H1IJ 3NMDA 5H2FE 1J2JB 1GTWA 3MD0A 1Y47A 4L75A 5L8RJ 1Q7YQ 1N8RQ 2OQQA 1BGYJ 1LTJB 2R32A 3KHUA 3CXHI 5E79H 1OZHA 5CCHD 1K73Q 1BGYD 3G71P 1GD2E 1W2BO 2POHA 1N7SA 3AE4C 3BASA 2W6BA 1JTHB 2HPCA 4C7NB 1BE3J 5AVWB 1L0NJ 2M3BA 1LT1A 1J1DB 2HLOA 2KNCA 2B9BA 1IFJA 1G1IA 1PP9D 2ZT9C 1PGPA 1HJ0A 1X0TA 4IFMA 2MJZA 1K05A 4KHXA 3WUTA 1NU1G 3D6YA 3TNUA 1Y8AA 3W68A 3CPWO 3M9QA 1IJDB 1RQUA 2BEQD 3CMAP 2OYIB 2E5YA 1YI2P 4UB6H 3CC4P 4O9BA 1AFOA 1KN7A 4EOTA 1LP1A 1RQVA 3HD7A 3CLQA 1KQFB 3SFEC 1FS0E 2K3RA 3CWBD 3GF7A 1DD4A 3L75D 1SLQA 2CPBA 1KYOI 2IYPA 4RO0A 5APUA 1XTGB 1VQMP 3IFMA 1IFIA 1FZBA 3II6A 3WU2E 2CK3H 2QA4P 1RH5B 1FZCC 3VOPA 4I6MC 1HF9A 2WTYA 2RKLA 1RF0C 1N7SD 1T3JA 1N7SB 2JJLA 3BCCD 2E5TA 3H1HD 1H88A 2FBWC 4L73A 5CCGC 5CCGA 5CCHA 1HGVA 1S9KD 1VDFA 5KKZB 4MN4C 3L36A 1LWUA 2JP3A 4YTPC 3BATA 1CSBA 1KYOH 4WBAA 1KV4A 1FZAA 2Q1KA 5CCGD 1W2EA 2E75C 1NAFA 1RF0A 1L0LJ 2AEMA 4UB8H 4WB4A 1AV1A 1KILB 4NPDA 2J58A 1NTME 4BRYA 4H44D 2YNYA 1T2KC 2NPSB 4H13C 1M56D 1VQ7P 2PP6A 5CHXA 3FXEA 1EDJA 2CPSA 1EDLA 1SQPJ 2YO2A 3HD7D 1LP1B 5AVSB 2PAJA 1NTKG 2AEFA 4OVNF 5AW8B 3WUVA 4BRYB 2QEXP 1GU5A 2KLUA 1BGYE 1N73A 2K37A 3RGUA 2D2CB 3PRJA 3RK2B 1NTZJ 1JMMA 5GTIE 5AVVB 3GLMA 1SQBD 1LTSC 1L4AB 2IZ0A 2YKOA 3H1LD 3RK3B 3S4RA 1KB9E 2RMZA 2V7QH 5APQA 1VQ8P 2XDJA 5AW1B 2W83C 1LNQA 5APXA 1ZOYC 4H13B 1MUUA 5KLIC 1FDIA 2OTJP 2A06E 3LIEA 4JBZA 5H2FH 1BCCD 3VP8A 1RE3A 1H89A 3E1RA 3M0DC 2O01H 1EZVI 2R44A 4U3FE 3CCJP 2WPSA 4GODA 2WVRA 1KTMA 1PP9G 1JY2N 3IF4A 3RL0g 4ASWA 1LTBC 1BE3D 1ZV8A 2H7HA 2QJPC 3BCCG 3EWKA 3VMYA 1NTKE 1PGQA 1RE4A 4K35A 1N7SC 3I56P 3HD7B 2WSFH 1P84D 2M5AA 3H1KD 1DH3A 1JY3P 4IFDK 1JO5A 1GL2C 2OYHC 3LW5J 1FZCB 2BCCD 2D2CD 1NTKJ 2FYUD 3HE4B 1WRGA 1AA0A 1USDA 4XA4A 3RK2D 2NPSD 2WSSH 1L4AD 1LGHB 2JEEA 3CWBG 1SQPG 3KZIE 1LT9C 1S2EA 2N1TD 3L71D 3M91A 4OH8B 3SFDC 3TK1A 3OW2O 1FZFA 2KB7P 4LC1A 1N86A 3AEEC 2FXPA 3KZIH 3SSUA 3ZDMA 3AE1C 4K3AA 1E79H 3L73E 1M57D 3CD6P 5KLVE 3HUSA 3L70G 2O1JA 3H1IG 1JMBA 2A45I 3HRNA 3V2NA 1L0LK 4C7NA 1K8AQ 1NU1D 1HH0A 2Y9ZA 3L70D 3QH9A 2JR8A 3AE7C 1VQOP 3RK3D 2FYUK 2C0XA 1KQLA 3AE2C 1Z56A 1NHLA 4XE5B 3H1JJ 1PGOA 4IL6X 1OVVA 3E7KA 1SQPK 4PV1C 1VQPP 1NWQA 4R4LA 1A02J 2IDBA 1P84E 1R5LA 1NTMD 1QX8A 2B87A 1QL1A 1SQPE 2WPQA 1X22A 3L74E 3T97A 1HUCA 1PL5A 5AVTB 3RL0C 1U7JA 1UIIA 3JC22 2KZJA 1KD1Q 2JDIH 1LTJC 2VRSA 2QJPB 3AE9C 3V2RA 5M1BA 4D6TE 3A7OA 1YJ9P 3L72D 2UWJE 1FJPA 3B5NC 4U3FD 3M9BA 3SWKA 1AVOA 1EZVD 2HODB 3PH0A 4CPGA 2IBZG 2KZIA 3G9RA 3H1JD 2A06D 3HTKA 1M8OB 5AW4B 1L2PA 2QJYB 3AE5C 1SQBK 2K9JB 3B71A 5KTBA 1NTZG 2WPVB 1FU1A 1BCCG 2FFDB 1S5LE 1WMKA 1SQBE 1IFMA 1L0LE 1L4AC 4H0LC 4DT0A 3OAKA 2FKWB 4PJ0H 1S5LH 3L72E 5AW6B 2D2CC 1U7MA 2KIKA 3RK2C 2G8YA 2W90A 2M8RA 3P8CD 2XNXA 1G2CA 2ZVNB 3L35A 3A3YB 5DJUB 3MHVA 3TSIA 1KB9H 1KILA 2QM7A 3BRTB 1LTIC 4GT1A 1L0NG 3OA7A 4WWIA 4GIFA 1NTKK 3VP9A 2HYNA 5APYA 2M3EA 3V5BA 2IBZD 3H1JG 1SS1A 1YTZI 3U1AA 5B66E 1UIXA 1ZXGA 2Z5IA 1ZLLA 3BCCJ 2OTKE 1X79B 2Y0CA 4PJ0E 4QMAA 4U7JA 5AVZB 1VQLP 1KMIZ 1QGKB 4H13D 1NJIQ 1QVGO 3ITKA 4H44C 1T2KD 1H0TA 1GW3A 1R8EA 1KILC 4C46A 1DIPA 4XFJA 3MZWB 2Q5UA 1SQBJ 4C7RA 3P8CE 3A0HH 3A5TA 4NPFX 1D7MA 1YQ3C 1SFCA 2V7QJ 4GOFA 1NTMG 4AUWA 1EZVG 1SQVK 4TLFA 2KK7A 4IOIH 3KDPB 4B86A 1FZEA 1OW7A 2PFXA 3AE6C 1KFMA 4U3FJ 1JM0A 2N9YB 2QRXA 2FYNC 3L71J 2L91A 3G4SP 5AVXB 3H32B 3V4QA 1YBKA 4I7ZB 3JCUH 3Q5RA 1BSNA 3H1HG 2KI7B 4I2LC 3CXHE 4OGQC 3H1JE 4BWNA 3L71E 5E79E 1KQSO 4AYCA 1YITP 1N73B 2OTLP 1KYOD 2LKMA 3M06A 4RKUJ 1ZW0A 2BCCE 2Q6QA 5KJ7D 1EDKA 1VF5C 3TNUB 4DJGA 2N1TC 4NPEA 3GHGA 5APSA 1VL2A 2HFED 1IO4A 2QIWA 1NTMK 5AW5B 1PPJE 3EFFK 1SVFA 2HR3A 1GMJA 4W80A 2YIUC 2MKVA 4N78E 1SQPD 3USSA 3F5HA 2YKQA 1HVVA 2OARA 2WMMA 1OXZA 1PP9E 2YO3A 4W7YA 2ITAA 3FWNA 1NYHA 2W8ZA 4OGQD 4WY4A 1S1CX 1HTLC 3H1LJ 1FE6A 1RE3C 2WQYC 3M0DA 1DEEG 1NKZB 2ZYDA 1QEXA 3L71G 2ZAEB 2FYNB 2LXCB 3CI9A 2GA1A 2QM8A 4ZKUA 3SWFA 2H88C 3CCLP 5KLVD 2K88A 2Y9YA 3H1LE 3L73D 1FZGA 3Q2YA 2H43A 2R5BA 1CZQA 5GTHE 2Q9IA 3WU2H 1FDMA 2KSEA 4PD4H 3CXHH 1PFIA 2PRRA 1YYCA 3GMAA 3L74J 3MUDC 1Y9BA 3A0BH 3HE5A 4JF7A 5AVQB 5AVYB 3VMXA 1GU4A 3B5ND 5BU8B 1GL2A 1JOCA 2J59M 2R3SA 2WSEJ 1MV8A 2AXTE 5BU5A 2OYHA 5AW7B 1M1JB 1URQB 1OVRA 2L5GB 4D6TJ 3H1KE 3AECC 3H25A 2KS1B 1LT9A 4R4MA 3CCUP 2E42A 3JSVC 1ZR4A 1NTKD 1SQVJ 2FYUJ 2QE7H 3Q5PA 1VQKP 2QVAA 2WSCJ 4JYBA 1RF1A 5B66H 3CCQP 1IFDA 1IFNA 4UB8E 4PD4D 3H1LG 3O6QA 5DJTB 4RJTA 2BASA 4IL6E 2WT7B 2KSJA 1KYOE 3MIWA 2ZJSE 3VMZA 5CCHC 1NKNA 2WSEH 3PTZA 1M1JA 3Q5SA 1MFTA 2H89C 3FXDA 2YMYA 1X9VA 1LWUC 5APWA 3CCSP 1KC8Q 1AJYA 2QJYC 4Y99C 3UIAA 1URQC 2FFDA 3MGNA 1FOSE 2WSFJ 3AEAC 1NOHA 1KB9D 2RN0A 1T8ZA 4U3FG 1JY2O 3B8EB 1JCDA 2P2UA 3KXDA 3NTNA 1SFCC 2FXOA 1SP4A 3M0AA 2K9JA 3WMM0 1JUNA 2Y0EA 2XU6A 1URQA 2AXCA 2AXTH 3RL0B 1NTZE 1FDOA 1KFNA 4L74A 4N6JA 5AW9B 1E5WA 2AEJA 3AEFC 4ASVA 3NFQA 2E75D 3CC7P 1SQVG 4AQRD 4PV1D 4PD4I 4ZMDA 1OW6A 4PV1B 3L4FA 1GZLA 1K04A 2QJKB 1J1EB 2XKMA 3A0HE 4EDFA 2I1KA 1CI6A 3KPEA 3I55P 2JO1A 2FFDC 3IAOA 4HH2A 5B5EE 5TISE 2O01J 4W7ZA 2R5DA 2IBZI 4GDOA 4HYTB 1G1JA 1AQTA 3GHGC 3G3ZA 4N3YB 3FWLA 2E74C 3TF5A 4OWFA 4HKZH 1NU1K 1LTGC 3V2QA 2QSIA 3H1IE 5TISH 3Q1MA 1S9KE 1H8AA 2OYIC 3LIDA 1L0LD 3CWBJ 3L75J 4WY4B 1BDCA 1AVYA 3TGUE 3MTUE 1FBMA 5EFWB 1VF5B 1DD3A 3RBZA 3C9IA 3L75G 1OWAA 1OVUA 4KT0J 2YXRB 3E1IA 4YXDC 3QWOC 4IFFA 4EYYQ 3CCRP 1BGYG 1GL2D 1IC2A 1M7LA 3H1KG 1Q90D 3KQGA 3H1HJ 3L70J 4OGQB 2HG5D 2Y0DA 1U57A 1VQNP 3KYQA 4I7ZC 3HD7C 5CBOA 3R2PA 2N9BA 2IPPA 5AW3B 3CCVP 1BE3G 3B4SA 1URQD 1PZQA 3CL3D 1FZCA 3CX5E 3EFGA 3MUDA 5TJHA 3RL0D 2QG4A 1NU1J 1ZR2A 1YJWP 3D6ZA 2P7JA 1MZ9A 2LXBA 1YJNP 3P8MC 1ZN5A 2K9YA 1Q2NA 2KOGA 1S4XA 3CX5H 1CW5A 1EDIA 1NAYA 1PPJG 2H8PD 5KLIB 2YKPA 3L73J 2I1JA 5GTHH 1SQBG 3F89A 3RBXA 1DX7A 1VF5D 3EQ2A 3L70E 1W5CE 3RK3C 3VYIA 3BVHA 1CI6B 2A45G 1PGJA 2SPZA 5APTA 1RF1C 1BSHA 1SQXD 1RHZB 2FYZA 3A2AA 1R5SA 2DW3A 4IL6H 3NXSA 4DCKA 1L0ND 4HJGH 2JWAA 1VPCA 2E74B 3WUUA 3AEDC 3H1KJ 3GHGB 3Q3DA 1GK6A 3G6EP 3AE8C 5GTIH 1JNMA 1J1EC 3PHLA 2QJKC 1KZUB 1SQVD 1KQGB 2LR2A 1FJKA 2NPSC 2R3CA 3HTKB 3PJSK 1NTZK 4DOJA 1Q82Q 3GG2A 3N4XA 1JY3O 1NVOA 3B5NA 3N7NA 3VTPC 1NH4A 2E75B 1ZRTE 1SQXJ 2B89A 3S9OA 3U1CA 1GDTA 2A06G 2WITA 1HJBA 3B5NB 1T6AA 2W6JH 2ZFCA 2IFNA 4RESB 3MP7B 1SFCD 2OGUA 4N78D 1LTTC 3T97B 2V4HA
chains in the Genus database with same CATH topology
2KS1B 2QVAA 1Y47A 1OVVA 4BXLA 5DJTB 2B87A 1MFTA 3FXDA 1U7JA 2KZJA 1LT1A 2B88A 1X0TA 2UWJE 3PH0A 4CPGA 2KZIA 1LP1A 4ASVA 2K3RA 4ZMDA 1U7MA 2KIKA 5DJUB 1H0TA 3MHVA 4GOEA 2RKLA 4WWIA 2B87B 1SS1A 1ZXGA 2OTKE 4MN4C 3S1KA 2I8DA 1BDCA 2Q1KA 5EFWB 3MZWB 4NPDA 4NPFX 1OVUA 4GOFA 3QWOC 4IOIH 4EYYQ 1JM0A 2QRXA 3FXEA 1EDJA 1EDLA 5CBOA 1LP1B 2KI7B 2JWDA 3RGUA 1ZW0A 1EDKA 2KUBA 2M5AB 2LXBA 4NPEA 2M0BA 1Q2NA 1EDIA 2HR3A 4JBZA 2R44A 1S3JA 4GODA 2WMMA 1OVRA 2SPZA 4ZNCA 4ASWA 4HJGH 4HB1A 4KJMA 1DEEG 4K35A 5CBNA 1BDDA 2M5AA 2ZAEB 2LXCB 2LR2A 5K5GB 1EC5A 1H0TB 1NVOA 5C39A 2B89A 3ZDMA 4K3AA 1JMBA 4HKZH 2P58A 1FC2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KS1 B;  2QVA A;  1Y47 A;  1OVV A;  4BXL A;  5DJT B;  2B87 A;  1MFT A;  3FXD A;  1U7J A;  2KZJ A;  1LT1 A;  2B88 A;  1X0T A;  2UWJ E;  3PH0 A;  4CPG A;  2KZI A;  1LP1 A;  4ASV A;  2K3R A;  4ZMD A;  1U7M A;  2KIK A;  5DJU B;  1H0T A;  3MHV A;  4GOE A;  2RKL A;  4WWI A;  2B87 B;  1SS1 A;  1ZXG A;  2OTK E;  4MN4 C;  3S1K A;  2I8D A;  1BDC A;  2Q1K A;  5EFW B;  3MZW B;  4NPD A;  4NPF X;  1OVU A;  4GOF A;  3QWO C;  4IOI H;  4EYY Q;  1JM0 A;  2QRX A;  3FXE A;  1EDJ A;  1EDL A;  5CBO A;  1LP1 B;  2KI7 B;  2JWD A;  3RGU A;  1ZW0 A;  1EDK A;  2KUB A;  2M5A B;  2LXB A;  4NPE A;  2M0B A;  1Q2N A;  1EDI A;  2HR3 A;  4JBZ A;  2R44 A;  1S3J A;  4GOD A;  2WMM A;  1OVR A;  2SPZ A;  4ZNC A;  4ASW A;  4HJG H;  4HB1 A;  4KJM A;  1DEE G;  4K35 A;  5CBN A;  1BDD A;  2M5A A;  2ZAE B;  2LXC B;  2LR2 A;  5K5G B;  1EC5 A;  1H0T B;  1NVO A;  5C39 A;  2B89 A;  3ZDM A;  4K3A A;  1JMB A;  4HKZ H;  2P58 A;  1FC2 C; 
#chains in the Genus database with same CATH topology
 2YXQ B;  5KAF E;  5KAI H;  4LLH A;  2WT7 A;  4YPC A;  1KIL E;  2O01 N;  2G3A A;  2P67 A;  4JYC A;  5CJ0 A;  5AW0 B;  3BCC E;  1S5L X;  3TYY A;  3VN0 A;  1GK4 A;  3V6I A;  4WVZ A;  3L73 G;  5CMZ A;  5KLV G;  5AVR B;  1LWU B;  2XV5 A;  1MFZ A;  1DEB A;  3GF3 A;  4BXL A;  4WY4 D;  1RY3 A;  3U59 A;  1A02 F;  1HGZ A;  1IZN B;  1OMI A;  3CXH D;  5KLV K;  1QVF O;  3FGA D;  4Z1M H;  3IN6 A;  2WWW A;  1YIJ P;  1VQ9 P;  2Z4E A;  3D71 A;  1JY2 P;  1USE A;  1L0N E;  1L0N K;  1QLE D;  2B88 A;  2RH0 A;  5B5E H;  2A45 H;  3P7K A;  4M3L A;  2ZXE B;  1SQX K;  2E76 D;  3TGU G;  1YTZ T;  1YHQ P;  1EXI A;  4LGD E;  1FOS F;  2GM4 A;  2E74 D;  3H1I D;  3I5C A;  1RF1 B;  1MKM A;  2GUS A;  1SQQ K;  1SQX G;  5KJ7 A;  1JCC A;  1M1J C;  2J5U A;  2ZT9 D;  2ZT9 B;  2OYO A;  3PP5 A;  5AVU B;  1SQQ E;  1LT9 B;  3VMA A;  3P32 A;  2C9L Y;  3R4Y A;  4H0L D;  2PGD A;  1GL2 B;  2OYH B;  1PIX A;  3CX5 I;  4ZKP A;  3IR9 A;  3BRV B;  2IBZ E;  2C9N Y;  3HE5 B;  4EIJ A;  2ZXX A;  1K9M Q;  5KLV J;  2KNC B;  2IZ1 A;  3C1L A;  4DZO A;  2C0W A;  1NGM B;  3FX0 A;  3H1H E;  1XTC C;  4GOE A;  2O1K A;  3HE4 A;  1AQ5 A;  1JTH A;  2HPC B;  1HWT C;  2B87 B;  3M9H A;  1ZME C;  2NZ2 A;  2WZ7 A;  2BEZ F;  1IK7 A;  3S1K A;  3TGU J;  1LTJ A;  1EZV E;  3L37 A;  1SQQ J;  2E43 A;  2I8D A;  1Q86 Q;  3CWB E;  3L75 E;  3H6P A;  3TDK A;  3K5B A;  3TGU D;  1S72 P;  3CME P;  4Y28 J;  5BVZ A;  1OIP A;  1FAV A;  2Q3E A;  1VQ4 P;  3C8V A;  4WY4 C;  1KIL D;  2YIU B;  2KXP B;  2W27 A;  3GW6 A;  1N73 C;  1PP9 J;  1ZP0 C;  3HUS B;  3LW5 H;  1HBW A;  4D6T D;  2Z5H A;  3A0B E;  4I1L A;  1L0L G;  4YXW H;  3H32 A;  2N1T B;  1OFC X;  1PV3 A;  2K1A A;  3ABV C;  3PLN A;  2JKV A;  4EI2 A;  1Q81 Q;  2KP8 A;  2FYU G;  2ZVO B;  1P84 I;  2BCC G;  3OJA B;  1VQ6 P;  1JB0 J;  1KOR A;  2Q7C A;  2P1J A;  3L74 D;  4UB6 E;  2XND H;  1L4A A;  1SQQ D;  2W6A A;  2E76 C;  2JWD A;  2IYO A;  3W67 A;  2NRG A;  1SQV E;  1P84 H;  2GUV A;  1NU1 E;  1JY3 N;  1TU3 F;  2KUB A;  2M5A B;  1NTZ D;  2XZR A;  4L76 A;  1EQ7 A;  3RK3 E;  3SWY A;  2M0B A;  4A7P A;  1LJ2 A;  2WSC H;  1RE4 C;  1WT6 A;  3L72 J;  3CCE P;  5KKZ C;  1S3J A;  1SFC B;  1BCC J;  1SQX E;  2WPR A;  3JCU E;  1X8Y A;  2KLV A;  4GKG A;  4H44 B;  5CJ4 A;  3D70 A;  4ZNC A;  2Q3I A;  1SQQ G;  1IFP A;  2FYU E;  1JEK A;  3O8Z A;  3L74 G;  2E76 B;  3O6Q B;  1YQ4 C;  5KAI E;  5KAF H;  4Y99 B;  1VQ5 P;  4HB1 A;  4KJM A;  1IK9 A;  2ZYG A;  1M90 Q;  5CBN A;  2FY8 A;  1BDD A;  2YMK A;  4D6T G;  4PD4 E;  2KS1 A;  1N7L A;  3AEB C;  1T3U A;  3V4W A;  3CX5 D;  3HUS C;  2OYI A;  1OW8 A;  5K5G B;  1EC5 A;  1G2C B;  4H0L B;  1H0T B;  1QL2 A;  2BCC J;  1LTA C;  1ZRT D;  3AEG C;  1PPJ D;  5APV A;  1NO4 A;  5C39 A;  1BE3 E;  5AW2 B;  1GW4 A;  4TT3 H;  5KJ7 C;  4JQ0 D;  1M1K Q;  1BCC E;  1N2D C;  1EXJ A;  1NTM J;  3AE3 C;  2N1T A;  3CC2 P;  3CCM P;  2NPS A;  2P10 A;  2ZYA A;  2FXM A;  4JPZ B;  2P58 A;  1J1D C;  2IX7 C;  1FC2 C;  3L72 G;  2KYV A;  3V2P A;  1KB9 I;  2HOD A;  1OX3 A;  2O3J A;  2IFM A;  3H1I J;  3NMD A;  5H2F E;  1J2J B;  1GTW A;  3MD0 A;  1Y47 A;  4L75 A;  5L8R J;  1Q7Y Q;  1N8R Q;  2OQQ A;  1BGY J;  1LTJ B;  2R32 A;  3KHU A;  3CXH I;  5E79 H;  1OZH A;  5CCH D;  1K73 Q;  1BGY D;  3G71 P;  1GD2 E;  1W2B O;  2POH A;  1N7S A;  3AE4 C;  3BAS A;  2W6B A;  1JTH B;  2HPC A;  4C7N B;  1BE3 J;  5AVW B;  1L0N J;  2M3B A;  1LT1 A;  1J1D B;  2HLO A;  2KNC A;  2B9B A;  1IFJ A;  1G1I A;  1PP9 D;  2ZT9 C;  1PGP A;  1HJ0 A;  1X0T A;  4IFM A;  2MJZ A;  1K05 A;  4KHX A;  3WUT A;  1NU1 G;  3D6Y A;  3TNU A;  1Y8A A;  3W68 A;  3CPW O;  3M9Q A;  1IJD B;  1RQU A;  2BEQ D;  3CMA P;  2OYI B;  2E5Y A;  1YI2 P;  4UB6 H;  3CC4 P;  4O9B A;  1AFO A;  1KN7 A;  4EOT A;  1LP1 A;  1RQV A;  3HD7 A;  3CLQ A;  1KQF B;  3SFE C;  1FS0 E;  2K3R A;  3CWB D;  3GF7 A;  1DD4 A;  3L75 D;  1SLQ A;  2CPB A;  1KYO I;  2IYP A;  4RO0 A;  5APU A;  1XTG B;  1VQM P;  3IFM A;  1IFI A;  1FZB A;  3II6 A;  3WU2 E;  2CK3 H;  2QA4 P;  1RH5 B;  1FZC C;  3VOP A;  4I6M C;  1HF9 A;  2WTY A;  2RKL A;  1RF0 C;  1N7S D;  1T3J A;  1N7S B;  2JJL A;  3BCC D;  2E5T A;  3H1H D;  1H88 A;  2FBW C;  4L73 A;  5CCG C;  5CCG A;  5CCH A;  1HGV A;  1S9K D;  1VDF A;  5KKZ B;  4MN4 C;  3L36 A;  1LWU A;  2JP3 A;  4YTP C;  3BAT A;  1CSB A;  1KYO H;  4WBA A;  1KV4 A;  1FZA A;  2Q1K A;  5CCG D;  1W2E A;  2E75 C;  1NAF A;  1RF0 A;  1L0L J;  2AEM A;  4UB8 H;  4WB4 A;  1AV1 A;  1KIL B;  4NPD A;  2J58 A;  1NTM E;  4BRY A;  4H44 D;  2YNY A;  1T2K C;  2NPS B;  4H13 C;  1M56 D;  1VQ7 P;  2PP6 A;  5CHX A;  3FXE A;  1EDJ A;  2CPS A;  1EDL A;  1SQP J;  2YO2 A;  3HD7 D;  1LP1 B;  5AVS B;  2PAJ A;  1NTK G;  2AEF A;  4OVN F;  5AW8 B;  3WUV A;  4BRY B;  2QEX P;  1GU5 A;  2KLU A;  1BGY E;  1N73 A;  2K37 A;  3RGU A;  2D2C B;  3PRJ A;  3RK2 B;  1NTZ J;  1JMM A;  5GTI E;  5AVV B;  3GLM A;  1SQB D;  1LTS C;  1L4A B;  2IZ0 A;  2YKO A;  3H1L D;  3RK3 B;  3S4R A;  1KB9 E;  2RMZ A;  2V7Q H;  5APQ A;  1VQ8 P;  2XDJ A;  5AW1 B;  2W83 C;  1LNQ A;  5APX A;  1ZOY C;  4H13 B;  1MUU A;  5KLI C;  1FDI A;  2OTJ P;  2A06 E;  3LIE A;  4JBZ A;  5H2F H;  1BCC D;  3VP8 A;  1RE3 A;  1H89 A;  3E1R A;  3M0D C;  2O01 H;  1EZV I;  2R44 A;  4U3F E;  3CCJ P;  2WPS A;  4GOD A;  2WVR A;  1KTM A;  1PP9 G;  1JY2 N;  3IF4 A;  3RL0 g;  4ASW A;  1LTB C;  1BE3 D;  1ZV8 A;  2H7H A;  2QJP C;  3BCC G;  3EWK A;  3VMY A;  1NTK E;  1PGQ A;  1RE4 A;  4K35 A;  1N7S C;  3I56 P;  3HD7 B;  2WSF H;  1P84 D;  2M5A A;  3H1K D;  1DH3 A;  1JY3 P;  4IFD K;  1JO5 A;  1GL2 C;  2OYH C;  3LW5 J;  1FZC B;  2BCC D;  2D2C D;  1NTK J;  2FYU D;  3HE4 B;  1WRG A;  1AA0 A;  1USD A;  4XA4 A;  3RK2 D;  2NPS D;  2WSS H;  1L4A D;  1LGH B;  2JEE A;  3CWB G;  1SQP G;  3KZI E;  1LT9 C;  1S2E A;  2N1T D;  3L71 D;  3M91 A;  4OH8 B;  3SFD C;  3TK1 A;  3OW2 O;  1FZF A;  2KB7 P;  4LC1 A;  1N86 A;  3AEE C;  2FXP A;  3KZI H;  3SSU A;  3ZDM A;  3AE1 C;  4K3A A;  1E79 H;  3L73 E;  1M57 D;  3CD6 P;  5KLV E;  3HUS A;  3L70 G;  2O1J A;  3H1I G;  1JMB A;  2A45 I;  3HRN A;  3V2N A;  1L0L K;  4C7N A;  1K8A Q;  1NU1 D;  1HH0 A;  2Y9Z A;  3L70 D;  3QH9 A;  2JR8 A;  3AE7 C;  1VQO P;  3RK3 D;  2FYU K;  2C0X A;  1KQL A;  3AE2 C;  1Z56 A;  1NHL A;  4XE5 B;  3H1J J;  1PGO A;  4IL6 X;  1OVV A;  3E7K A;  1SQP K;  4PV1 C;  1VQP P;  1NWQ A;  4R4L A;  1A02 J;  2IDB A;  1P84 E;  1R5L A;  1NTM D;  1QX8 A;  2B87 A;  1QL1 A;  1SQP E;  2WPQ A;  1X22 A;  3L74 E;  3T97 A;  1HUC A;  1PL5 A;  5AVT B;  3RL0 C;  1U7J A;  1UII A;  3JC2 2;  2KZJ A;  1KD1 Q;  2JDI H;  1LTJ C;  2VRS A;  2QJP B;  3AE9 C;  3V2R A;  5M1B A;  4D6T E;  3A7O A;  1YJ9 P;  3L72 D;  2UWJ E;  1FJP A;  3B5N C;  4U3F D;  3M9B A;  3SWK A;  1AVO A;  1EZV D;  2HOD B;  3PH0 A;  4CPG A;  2IBZ G;  2KZI A;  3G9R A;  3H1J D;  2A06 D;  3HTK A;  1M8O B;  5AW4 B;  1L2P A;  2QJY B;  3AE5 C;  1SQB K;  2K9J B;  3B71 A;  5KTB A;  1NTZ G;  2WPV B;  1FU1 A;  1BCC G;  2FFD B;  1S5L E;  1WMK A;  1SQB E;  1IFM A;  1L0L E;  1L4A C;  4H0L C;  4DT0 A;  3OAK A;  2FKW B;  4PJ0 H;  1S5L H;  3L72 E;  5AW6 B;  2D2C C;  1U7M A;  2KIK A;  3RK2 C;  2G8Y A;  2W90 A;  2M8R A;  3P8C D;  2XNX A;  1G2C A;  2ZVN B;  3L35 A;  3A3Y B;  5DJU B;  3MHV A;  3TSI A;  1KB9 H;  1KIL A;  2QM7 A;  3BRT B;  1LTI C;  4GT1 A;  1L0N G;  3OA7 A;  4WWI A;  4GIF A;  1NTK K;  3VP9 A;  2HYN A;  5APY A;  2M3E A;  3V5B A;  2IBZ D;  3H1J G;  1SS1 A;  1YTZ I;  3U1A A;  5B66 E;  1UIX A;  1ZXG A;  2Z5I A;  1ZLL A;  3BCC J;  2OTK E;  1X79 B;  2Y0C A;  4PJ0 E;  4QMA A;  4U7J A;  5AVZ B;  1VQL P;  1KMI Z;  1QGK B;  4H13 D;  1NJI Q;  1QVG O;  3ITK A;  4H44 C;  1T2K D;  1H0T A;  1GW3 A;  1R8E A;  1KIL C;  4C46 A;  1DIP A;  4XFJ A;  3MZW B;  2Q5U A;  1SQB J;  4C7R A;  3P8C E;  3A0H H;  3A5T A;  4NPF X;  1D7M A;  1YQ3 C;  1SFC A;  2V7Q J;  4GOF A;  1NTM G;  4AUW A;  1EZV G;  1SQV K;  4TLF A;  2KK7 A;  4IOI H;  3KDP B;  4B86 A;  1FZE A;  1OW7 A;  2PFX A;  3AE6 C;  1KFM A;  4U3F J;  1JM0 A;  2N9Y B;  2QRX A;  2FYN C;  3L71 J;  2L91 A;  3G4S P;  5AVX B;  3H32 B;  3V4Q A;  1YBK A;  4I7Z B;  3JCU H;  3Q5R A;  1BSN A;  3H1H G;  2KI7 B;  4I2L C;  3CXH E;  4OGQ C;  3H1J E;  4BWN A;  3L71 E;  5E79 E;  1KQS O;  4AYC A;  1YIT P;  1N73 B;  2OTL P;  1KYO D;  2LKM A;  3M06 A;  4RKU J;  1ZW0 A;  2BCC E;  2Q6Q A;  5KJ7 D;  1EDK A;  1VF5 C;  3TNU B;  4DJG A;  2N1T C;  4NPE A;  3GHG A;  5APS A;  1VL2 A;  2HFE D;  1IO4 A;  2QIW A;  1NTM K;  5AW5 B;  1PPJ E;  3EFF K;  1SVF A;  2HR3 A;  1GMJ A;  4W80 A;  2YIU C;  2MKV A;  4N78 E;  1SQP D;  3USS A;  3F5H A;  2YKQ A;  1HVV A;  2OAR A;  2WMM A;  1OXZ A;  1PP9 E;  2YO3 A;  4W7Y A;  2ITA A;  3FWN A;  1NYH A;  2W8Z A;  4OGQ D;  4WY4 A;  1S1C X;  1HTL C;  3H1L J;  1FE6 A;  1RE3 C;  2WQY C;  3M0D A;  1DEE G;  1NKZ B;  2ZYD A;  1QEX A;  3L71 G;  2ZAE B;  2FYN B;  2LXC B;  3CI9 A;  2GA1 A;  2QM8 A;  4ZKU A;  3SWF A;  2H88 C;  3CCL P;  5KLV D;  2K88 A;  2Y9Y A;  3H1L E;  3L73 D;  1FZG A;  3Q2Y A;  2H43 A;  2R5B A;  1CZQ A;  5GTH E;  2Q9I A;  3WU2 H;  1FDM A;  2KSE A;  4PD4 H;  3CXH H;  1PFI A;  2PRR A;  1YYC A;  3GMA A;  3L74 J;  3MUD C;  1Y9B A;  3A0B H;  3HE5 A;  4JF7 A;  5AVQ B;  5AVY B;  3VMX A;  1GU4 A;  3B5N D;  5BU8 B;  1GL2 A;  1JOC A;  2J59 M;  2R3S A;  2WSE J;  1MV8 A;  2AXT E;  5BU5 A;  2OYH A;  5AW7 B;  1M1J B;  1URQ B;  1OVR A;  2L5G B;  4D6T J;  3H1K E;  3AEC C;  3H25 A;  2KS1 B;  1LT9 A;  4R4M A;  3CCU P;  2E42 A;  3JSV C;  1ZR4 A;  1NTK D;  1SQV J;  2FYU J;  2QE7 H;  3Q5P A;  1VQK P;  2QVA A;  2WSC J;  4JYB A;  1RF1 A;  5B66 H;  3CCQ P;  1IFD A;  1IFN A;  4UB8 E;  4PD4 D;  3H1L G;  3O6Q A;  5DJT B;  4RJT A;  2BAS A;  4IL6 E;  2WT7 B;  2KSJ A;  1KYO E;  3MIW A;  2ZJS E;  3VMZ A;  5CCH C;  1NKN A;  2WSE H;  3PTZ A;  1M1J A;  3Q5S A;  1MFT A;  2H89 C;  3FXD A;  2YMY A;  1X9V A;  1LWU C;  5APW A;  3CCS P;  1KC8 Q;  1AJY A;  2QJY C;  4Y99 C;  3UIA A;  1URQ C;  2FFD A;  3MGN A;  1FOS E;  2WSF J;  3AEA C;  1NOH A;  1KB9 D;  2RN0 A;  1T8Z A;  4U3F G;  1JY2 O;  3B8E B;  1JCD A;  2P2U A;  3KXD A;  3NTN A;  1SFC C;  2FXO A;  1SP4 A;  3M0A A;  2K9J A;  3WMM 0;  1JUN A;  2Y0E A;  2XU6 A;  1URQ A;  2AXC A;  2AXT H;  3RL0 B;  1NTZ E;  1FDO A;  1KFN A;  4L74 A;  4N6J A;  5AW9 B;  1E5W A;  2AEJ A;  3AEF C;  4ASV A;  3NFQ A;  2E75 D;  3CC7 P;  1SQV G;  4AQR D;  4PV1 D;  4PD4 I;  4ZMD A;  1OW6 A;  4PV1 B;  3L4F A;  1GZL A;  1K04 A;  2QJK B;  1J1E B;  2XKM A;  3A0H E;  4EDF A;  2I1K A;  1CI6 A;  3KPE A;  3I55 P;  2JO1 A;  2FFD C;  3IAO A;  4HH2 A;  5B5E E;  5TIS E;  2O01 J;  4W7Z A;  2R5D A;  2IBZ I;  4GDO A;  4HYT B;  1G1J A;  1AQT A;  3GHG C;  3G3Z A;  4N3Y B;  3FWL A;  2E74 C;  3TF5 A;  4OWF A;  4HKZ H;  1NU1 K;  1LTG C;  3V2Q A;  2QSI A;  3H1I E;  5TIS H;  3Q1M A;  1S9K E;  1H8A A;  2OYI C;  3LID A;  1L0L D;  3CWB J;  3L75 J;  4WY4 B;  1BDC A;  1AVY A;  3TGU E;  3MTU E;  1FBM A;  5EFW B;  1VF5 B;  1DD3 A;  3RBZ A;  3C9I A;  3L75 G;  1OWA A;  1OVU A;  4KT0 J;  2YXR B;  3E1I A;  4YXD C;  3QWO C;  4IFF A;  4EYY Q;  3CCR P;  1BGY G;  1GL2 D;  1IC2 A;  1M7L A;  3H1K G;  1Q90 D;  3KQG A;  3H1H J;  3L70 J;  4OGQ B;  2HG5 D;  2Y0D A;  1U57 A;  1VQN P;  3KYQ A;  4I7Z C;  3HD7 C;  5CBO A;  3R2P A;  2N9B A;  2IPP A;  5AW3 B;  3CCV P;  1BE3 G;  3B4S A;  1URQ D;  1PZQ A;  3CL3 D;  1FZC A;  3CX5 E;  3EFG A;  3MUD A;  5TJH A;  3RL0 D;  2QG4 A;  1NU1 J;  1ZR2 A;  1YJW P;  3D6Z A;  2P7J A;  1MZ9 A;  2LXB A;  1YJN P;  3P8M C;  1ZN5 A;  2K9Y A;  1Q2N A;  2KOG A;  1S4X A;  3CX5 H;  1CW5 A;  1EDI A;  1NAY A;  1PPJ G;  2H8P D;  5KLI B;  2YKP A;  3L73 J;  2I1J A;  5GTH H;  1SQB G;  3F89 A;  3RBX A;  1DX7 A;  1VF5 D;  3EQ2 A;  3L70 E;  1W5C E;  3RK3 C;  3VYI A;  3BVH A;  1CI6 B;  2A45 G;  1PGJ A;  2SPZ A;  5APT A;  1RF1 C;  1BSH A;  1SQX D;  1RHZ B;  2FYZ A;  3A2A A;  1R5S A;  2DW3 A;  4IL6 H;  3NXS A;  4DCK A;  1L0N D;  4HJG H;  2JWA A;  1VPC A;  2E74 B;  3WUU A;  3AED C;  3H1K J;  3GHG B;  3Q3D A;  1GK6 A;  3G6E P;  3AE8 C;  5GTI H;  1JNM A;  1J1E C;  3PHL A;  2QJK C;  1KZU B;  1SQV D;  1KQG B;  2LR2 A;  1FJK A;  2NPS C;  2R3C A;  3HTK B;  3PJS K;  1NTZ K;  4DOJ A;  1Q82 Q;  3GG2 A;  3N4X A;  1JY3 O;  1NVO A;  3B5N A;  3N7N A;  3VTP C;  1NH4 A;  2E75 B;  1ZRT E;  1SQX J;  2B89 A;  3S9O A;  3U1C A;  1GDT A;  2A06 G;  2WIT A;  1HJB A;  3B5N B;  1T6A A;  2W6J H;  2ZFC A;  2IFN A;  4RES B;  3MP7 B;  1SFC D;  2OGU A;  4N78 D;  1LTT C;  3T97 B;  2V4H A; 
#chains in the Genus database with same CATH homology
 2KS1 B;  2QVA A;  1Y47 A;  1OVV A;  4BXL A;  5DJT B;  2B87 A;  1MFT A;  3FXD A;  1U7J A;  2KZJ A;  1LT1 A;  2B88 A;  1X0T A;  2UWJ E;  3PH0 A;  4CPG A;  2KZI A;  1LP1 A;  4ASV A;  2K3R A;  4ZMD A;  1U7M A;  2KIK A;  5DJU B;  1H0T A;  3MHV A;  4GOE A;  2RKL A;  4WWI A;  2B87 B;  1SS1 A;  1ZXG A;  2OTK E;  4MN4 C;  3S1K A;  2I8D A;  1BDC A;  2Q1K A;  5EFW B;  3MZW B;  4NPD A;  4NPF X;  1OVU A;  4GOF A;  3QWO C;  4IOI H;  4EYY Q;  1JM0 A;  2QRX A;  3FXE A;  1EDJ A;  1EDL A;  5CBO A;  1LP1 B;  2KI7 B;  2JWD A;  3RGU A;  1ZW0 A;  1EDK A;  2KUB A;  2M5A B;  2LXB A;  4NPE A;  2M0B A;  1Q2N A;  1EDI A;  2HR3 A;  4JBZ A;  2R44 A;  1S3J A;  4GOD A;  2WMM A;  1OVR A;  2SPZ A;  4ZNC A;  4ASW A;  4HJG H;  4HB1 A;  4KJM A;  1DEE G;  4K35 A;  5CBN A;  1BDD A;  2M5A A;  2ZAE B;  2LXC B;  2LR2 A;  5K5G B;  1EC5 A;  1H0T B;  1NVO A;  5C39 A;  2B89 A;  3ZDM A;  4K3A A;  1JMB A;  4HKZ H;  2P58 A;  1FC2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...