1JMBA

Crystal structure of four-helix bundle model
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
48
structure length
48
Chain Sequence
b'DYLRELLKLELQAIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FOUR-HELIX BUNDLE MODEL)
publication title Toward the de novo design of a catalytically active helix bundle: a substrate-accessible carboxylate-bridged dinuclear metal center.
pubmed doi rcsb
molecule tags De novo protein
total genus 18
structure length 48
sequence length 48
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1jmbA00
1Q2NA 1H0TB 3RGUA 1LP1B 1U7JA 4MN4C 1X0TA 2HR3A 2LXCB 1OVUA 2M0BA 2B87A 5C39A 2K3RA 4CPGA 5CBOA 1LT1A 1H0TA 4GOEA 2LXBA 1U7MA 2B88A 4KJMA 4WWIA 2B87B 2JWDA 1JM0A 2QVAA 2WMMA 4IOIH 5CBNA 2M5AA 1OVRA 2QRXA 2KZJA 1EDKA 1ZXGA 4ZMDA 3PH0A 3S1KA 5EFWB 1JMBA 3ZDMA 1S3JA 3MZWB 5DJTB 4HJGH 4ASVA 2M5AB 1EDIA 2P58A 2UWJE 1Y47A 1ZW0A 2SPZA 2KZIA 2KUBA 4K3AA 4GODA 2B89A 2KS1B 4EYYQ 4GOFA 4HB1A 5K5GB 2OTKE 4NPDA 3FXDA 2KIKA 4NPFX 2R44A 1BDCA 1FC2C 2I8DA 3QWOC 4ZNCA 4JBZA 1EDJA 1BDDA 4ASWA 4NPEA 4K35A 4HKZH 1NVOA 1LP1A 2KI7B 2LR2A 1EDLA 1DEEG 2ZAEB 2Q1KA 1EC5A 4BXLA 1OVVA 2RKLA 3MHVA 3FXEA 1MFTA 5DJUB 1SS1A
chains in the Genus database with same CATH superfamily
4RJTA 1U7JA 4MN4C 2W6JH 3TK1A 1X9VA 1JNMA 2M3EA 4OWFA 3MGNA 3I56P 3CWBG 1K9MQ 3CL3D 1LT1A 1GL2C 3VP8A 2P1JA 1Q82Q 4I7ZC 2R5BA 1MV8A 3B5NA 3KPEA 3CD6P 3G3ZA 1VQOP 2GM4A 2I1KA 3E7KA 1KYOD 1PFIA 5EFWB 1KORA 5BVZA 2C0WA 3RL0g 1TU3F 1RE4A 1S72P 2WQYC 2N1TC 4L75A 2OYHA 3L73E 1ZN5A 1HF9A 3CWBD 2FYUJ 3W67A 1PPJG 1L4AD 3FX0A 1LNQA 3BCCE 2P2UA 3TSIA 1JY3O 4ZKUA 3HE4A 5KAIE 2OYIA 2OTLP 2WPSA 3H1JD 1R5SA 1N7SC 1M1JC 1KZUB 1S5LH 2O01H 4L76A 2Y9ZA 1VQ8P 1KILE 2E43A 2FYUK 1LTJC 1RF1B 2C0XA 1JY2P 1RQVA 3S4RA 2ZXXA 2W6BA 4L74A 4DOJA 4H13B 1OW7A 3TNUA 1EZVE 2NPSD 1QVGO 2WSFH 3CXHE 3L4FA 2IFMA 2KSJA 1M7LA 1DX7A 1CZQA 2ZYGA 5KLVJ 5AVXB 3H1HJ 2QE7H 3WUUA 5AW6B 1RE3A 3KXDA 1SQBJ 1PV3A 2KP8A 5CCGA 2A06G 3H6PA 1IFNA 1SFCD 4R4LA 3SSUA 4LGDE 2K1AA 5KLVK 5B5EH 3AE7C 1CSBA 5APSA 1PP9J 2W6AA 3VN0A 5CCHD 1ZRTD 3CCRP 2P7JA 1SQBK 1SQVG 2BCCG 2WZ7A 2I8DA 1KYOE 4ZNCA 3HUSC 4GKGA 1UIXA 1RF1A 5KJ7A 1VQ7P 1NKNA 1R8EA 2E76C 3QH9A 2XV5A 2JO1A 2C9NY 1LWUB 3MHVA 1SQPG 3L75J 1PGJA 3AE4C 1EZVI 2YXRB 2P10A 1FZGA 3LW5J 2LXCB 4U7JA 1UIIA 2PFXA 3CXHI 2M0BA 3PTZA 2KLVA 1SQVD 2BCCD 2Y0EA 1K04A 3H1JE 3UIAA 2RN0A 1S9KE 2WPQA 2B87B 3F89A 1JM0A 1M90Q 1PGQA 1AQTA 1NTMD 3WUVA 3FWNA 3S1KA 3WUTA 1AVOA 2NZ2A 3CI9A 3P32A 3VMXA 5GTHH 1VF5D 4D6TG 3C9IA 1ZP0C 2KZIA 3BATA 1SQQG 1GZLA 3D71A 5AVVB 3H1KG 3SFDC 3G9RA 1QL1A 1KFMA 5AW2B 1RHZB 2IZ1A 1KYOI 1RY3A 2Y9YA 4XFJA 1HUCA 1T3UA 5AW8B 2OYIC 1L0NG 1EDJA 2J5UA 5BU5A 2Z5IA 1KFNA 3RK2D 1W5CE 3L74G 1LWUA 3II6A 3O6QB 5KLIB 4OH8B 3AEDC 4D6TD 4H44B 1YJ9P 2YMYA 1SQQD 2H88C 3M0DA 3AE3C 3H1KD 1SS1A 3T97B 1LP1B 2MJZA 2OQQA 1ZRTE 1Z56A 2B87A 4U3FG 3AE9C 1BCCG 1IC2A 1KN7A 4TLFA 3JCUH 1IK9A 3L74D 3CLQA 3WU2H 3S9OA 2PRRA 1NOHA 2KZJA 1WRGA 3L70J 1MFZA 1A02J 3VMZA 5AW9B 1NKZB 5E79H 1M1JB 1QGKB 2P67A 1OZHA 2A45H 2AEFA 1QLED 1NTZE 2QM7A 1SQVE 2BCCE 1H89A 1LTJB 4U3FD 2M8RA 4Y99B 5APWA 2R5DA 3KHUA 4HB1A 5K5GB 1PIXA 1BE3G 2XKMA 5AVRB 1FZCB 3CCVP 1T2KC 2KIKA 3O6QA 1VQKP 1NTME 3D6YA 4IFDK 1BDCA 2IYOA 1SQPJ 1KTMA 3V2NA 3PRJA 3AEAC 1FOSF 5B5EE 2WT7B 2VRSA 4B86A 5AW7B 3IN6A 1L4AB 4RKUJ 1W2BO 1LP1A 4IFFA 1ZR2A 2ZAEB 1EC5A 3H1ID 3LIEA 1SLQA 2E74D 3KDPB 2FFDA 1SVFA 1M56D 3A5TA 1T3JA 2JJLA 1SQPK 1JY3P 3BRTB 2ZVNB 3U59A 1KMIZ 4D6TJ 2IBZG 2B88A 1KQLA 1SQQJ 1GU4A 1HJBA 1BSNA 3H1KJ 3L71E 1EDKA 2NPSB 3H1LJ 4PV1C 1DEBA 3HUSB 1N2DC 4N78D 3USSA 2O01N 3Q3DA 5KKZC 2JDIH 3P8CD 3VMYA 2R3SA 4WY4A 1SQXJ 3RL0B 3Q2YA 4C7RA 3D70A 2SPZA 3AE1C 2FYUD 3VP9A 1FZCA 1L0NJ 1NU1G 1CI6A 3L74J 2O1JA 2ZT9C 1URQC 2IBZD 1SQQK 1VQLP 2PGDA 3EQ2A 2H43A 2IYPA 2WT7A 5GTHE 5KLVG 1L4AA 1SFCB 1GL2D 3KYQA 2YMKA 2HFED 2IX7C 1GW3A 4UB6E 2KXPB 1LTIC 3GHGC 1OW6A 1SQBG 3PP5A 1S5LX 1BCCJ 4LLHA 3B4SA 1L0NK 3KZIH 5B66H 4U3FE 1VQMP 1NU1D 5DJUB 3OW2O 2N1TD 4UB8H 4I1LA 2BEQD 3OJAB 1FDMA 1PP9G 1VDFA 5KLVD 2ZXEB 3V4WA 1GW4A 1G2CB 2NPSA 3H1HD 3LW5H 1IFDA 3L72G 1SQBD 1JMMA 1OXZA 3H1IE 1BE3J 2QJYC 1CW5A 1NO4A 3AE5C 1N7SD 1NGMB 3SWYA 4AUWA 3FWLA 2UWJE 3NXSA 3L75G 3WU2E 3A0HH 2B89A 3VYIA 2ZVOB 1E79H 1Q90D 1PP9D 5APXA 4DZOA 1SFCA 2JP3A 3M06A 1JCDA 2CPBA 1RQUA 5AVUB 1KILC 5E79E 2H7HA 1YJWP 2Q3IA 3CC2P 2ZYAA 1VF5B 3V5BA 3QWOC 4W7YA 5AVWB 4JBZA 5CCHA 4WB4A 3R2PA 1J1EB 1JO5A 5APUA 4WBAA 2FYUE 4DT0A 1HJ0A 1EDLA 3L75D 2Y0DA 1FBMA 2YO3A 2IBZE 5APTA 1X0TA 4C7NA 1DIPA 3RK2B 2K3RA 3RBZA 3L36A 1PL5A 1YQ4C 1N73C 4N3YB 4IL6H 1PPJD 1VQ5P 1NU1J 4W80A 2KLUA 1ZXGA 3V4QA 4ZMDA 2K37A 1KQGB 1YI2P 2QSIA 1DD4A 2Q7CA 3H32B 1DD3A 1HTLC 1L0LG 2QJPB 3SWKA 2J58A 3RL0D 2E76D 4WY4C 5AW3B 4EI2A 5KLVE 5KAFH 3H1HE 1YYCA 3NTNA 2W90A 4EYYQ 2BEZF 2OTKE 3HD7C 1W2EA 2FBWC 1SQBE 1NU1K 2A45I 4O9BA 4RO0A 3BVHA 2D2CC 5TISH 3L37A 1LT9B 2CPSA 2WWWA 3V2QA 4EIJA 2FYNC 2XNXA 3L70G 1G1JA 2Q6QA 4LC1A 4NPEA 1VQ4P 4HKZH 5BU8B 1AQ5A 1KV4A 1VPCA 1S1CX 3IAOA 1PP9E 4BXLA 2QJKC 3L72J 2IBZI 2WVRA 1H0TB 2A06D 4BWNA 4YXDC 2E5TA 3F5HA 3MUDC 3D6ZA 2PAJA 4H0LC 3KZIE 1J1DC 3RBXA 1K73Q 3CWBE 2ZT9B 1U7MA 1T6AA 3H32A 4XA4A 3C1LA 2E74B 3L70D 3RK3C 4UB8E 3CPWO 3TGUG 2WPVB 3L75E 1JMBA 4TT3H 3GLMA 2IZ0A 1VQPP 2L5GB 3BASA 1QL2A 1Y47A 5M1BA 2KUBA 2QG4A 3I55P 3B5NC 3CX5H 2KS1B 1GU5A 4KT0J 1JEKA 1LT9A 1P84H 1PPJE 1BSHA 1FZBA 4NPFX 1SQPD 1RE4C 1GDTA 2OYHC 1MKMA 2FY8A 4BRYB 3H1LG 1GTWA 1N8RQ 1D7MA 3MIWA 5AVQB 2WPRA 3E1IA 3A7OA 3R4YA 4PD4H 3VMAA 1AFOA 4IFMA 1GL2B 1RF0A 1SQXG 4JQ0D 4I7ZB 3SFEC 1JY2N 2XNDH 3B8EB 1L0LJ 2WSEJ 2YIUC 3H1LD 2N1TB 1EXIA 5AW4B 1S5LE 5H2FH 2OARA 3CX5D 2MKVA 3MZWB 4JYCA 1Y9BA 2KS1A 1SQXD 4ASVA 2M5AB 2A06E 4IL6E 2POHA 1L0ND 1P84D 2E75C 2DW3A 2OGUA 1ZR4A 1FZAA 4GT1A 1L0LK 1RE3C 2JKVA 5CCGC 4NPDA 2Z4EA 1N7SB 1OW8A 2GUVA 1EQ7A 4BRYA 1ZLLA 4OGQC 4OVNF 1YIJP 4PD4D 3M91A 3MD0A 5KAFE 2IFNA 1M57D 1GL2A 1BCCD 1NTKG 2RMZA 4PV1D 3E1RA 2K9YA 3FXEA 1YQ3C 5CHXA 3MP7B 3TGUJ 1BGYJ 2HR3A 1SQPE 2HG5D 3CMEP 1RF1C 5KJ7C 4ZKPA 3T97A 1KD1Q 2N1TA 4H13C 4YTPC 3U1AA 2ZT9D 3CCEP 1URQD 4KJMA 5KAIH 5CBNA 2M5AA 1FAVA 1OVRA 4Y28J 2QA4P 1BE3D 5AVSB 4WVZA 5CJ0A 2FXMA 3L73G 3W68A 2P58A 1FJKA 1N7SA 1M1JA 4GODA 1S4XA 4D6TE 2XZRA 3V6IA 2KB7P 1U57A 1SQQE 1Q86Q 3Q5RA 2YKOA 1PGPA 1Q7YQ 3H1KE 1LTJA 3H1LE 1E5WA 2E76B 3GG2A 1USDA 2ZYDA 1OWAA 1FDIA 2KOGA 4QMAA 3L73D 5L8RJ 1LTSC 1S2EA 1YHQP 3GW6A 1L0NE 3A0BH 1P84E 3RK3B 3L74E 2AEMA 1EZVG 2GA1A 5AVZB 1HGZA 2WSCH 1T8ZA 5GTIH 5APVA 1LWUC 1SQXK 1WT6A 1IFJA 2ITAA 3GF7A 1KILD 1VQNP 1BCCE 1NWQA 3M0DC 1GD2E 3AEFC 4IL6X 3MTUE 1KB9H 2XDJA 4HH2A 2OYHB 1X79B 3AE8C 3HUSA 1HVVA 3GMAA 2JWAA 1LTTC 2K88A 1JTHB 1NTKJ 2XU6A 2AXCA 2OYIB 3HE5B 5TJHA 2Z5HA 4JYBA 1GK4A 5APYA 1BE3E 3JCUE 2C9LY 3CX5I 1LJ2A 1RH5B 1BDDA 1JB0J 2YIUB 1P84I 3HRNA 2I1JA 2RH0A 3TNUB 1FDOA 2AXTH 4EOTA 3L72D 2B9BA 3U1CA 5CJ4A 1MFTA 3PLNA 1NTKK 3JC22 5KLIC 5AVTB 4N78E 3RGUA 4H44C 3A2AA 3H1JG 3P8CE 1H88A 1OVUA 2E75B 4WY4D 5C39A 3L73J 2J59M 2YKQA 1KB9D 3PJSK 2V7QJ 4PD4I 3TDKA 3WMM0 3ITKA 3HD7D 4Z1MH 4PJ0H 1JY3N 2W8ZA 4W7ZA 3BCCJ 4YPCA 1EXJA 1G2CA 1OMIA 4OGQB 2WSEH 2FFDC 2D2CD 1MUUA 3ZDMA 1Q81Q 3A3YB 3LIDA 3L35A 4HJGH 1AV1A 1JTHA 3CMAP 2WITA 3HE5A 4M3LA 2E42A 4A7PA 1S9KD 2ZJSE 4KHXA 1IFIA 1NU1E 2HODB 1HH0A 4Y99C 2OTJP 1LGHB 1FS0E 2M3BA 4H0LD 2WSSH 2PP6A 1OX3A 1FZCC 4I6MC 3AE2C 5AW0B 1FE6A 1SP4A 1JCCA 2G8YA 1QEXA 1KQFB 1YITP 1JOCA 2L91A 1NVOA 1N7LA 1X8YA 3RK3D 2LR2A 1L4AC 3SWFA 2V4HA 1Q2NA 3CCQP 3N4XA 5AW1B 3BRVB 2HYNA 2ZFCA 1FZFA 3B5ND 3A0BE 1L0LD 2WSCJ 2FYZA 4PV1B 4GOEA 2R3CA 3AEBC 5KKZB 2WMMA 4IOIH 3P8MC 2QRXA 3N7NA 3L72E 5GTIE 1NH4A 1NTZG 2FKWB 5B66E 2NPSC 1URQB 1XTGB 1VQ9P 2HODA 1AA0A 1KB9E 3TYYA 3CWBJ 1BGYG 1H8AA 1NTMG 1VL2A 3RL0C 1NAFA 1GMJA 3GHGB 4DCKA 3EWKA 1FC2C 1J2JB 3C8VA 3M0AA 3KQGA 3GF3A 1YTZT 1XTCC 3OAKA 3PHLA 3H1JJ 5KTBA 1YJNP 2N9BA 4AQRD 1NTZD 2JEEA 1SFCC 4K35A 2Q1KA 1OVVA 2RKLA 1LTBC 3V2RA 3G6EP 1IJDB 3TGUD 1BGYD 3A0HE 4YXWH 3ABVC 4N6JA 5CCHC 2LKMA 2IDBA 2O1KA 1ZV8A 2E75D 2W83C 1KQSO 3CC4P 1H0TA 1AVYA 2AXTE 1IFPA 1R5LA 2FXPA 3M9BA 1HBWA 3L71G 5CCGD 2QJYB 4WWIA 2JR8A 5APQA 2JWDA 1QX8A 2YKPA 3CCMP 3RK3E 4UB6H 4OGQD 4R4MA 1URQA 3JSVC 2W27A 1HGVA 1VQ6P 2IPPA 3HTKB 3CC7P 3IR9A 4PJ0E 2KK7A 1KILB 3M9QA 1IFMA 1KB9I 1L0LE 1LTAC 3GHGA 1T2KD 1JY2O 1OFCX 1FU1A 3NFQA 1IO4A 2QM8A 3TF5A 3L71D 2K9JB 3Q1MA 2KSEA 5KJ7D 2O01J 2NRGA 4H13D 4JF7A 2H89C 3NMDA 4ASWA 1HWTC 1VF5C 3H25A 3G4SP 3IF4A 2KI7B 1A02F 2FFDB 2FXOA 2O3JA 4HYTB 3L70E 3CCSP 1J1EC 1OIPA 2WSFJ 3AECC 3OA7A 4GIFA 1K05A 1YBKA 1N73B 2YXQB 4CPGA 5CBOA 1NTZJ 1SQVJ 2BCCJ 2QEXP 3RK2C 1GK6A 1M8OB 3H1IG 1G1IA 2V7QH 5TISE 3HTKA 2QVAA 3AE6C 3G71P 2CK3H 3VTPC 2OYOA 3PH0A 3P7KA 1NTMJ 4WY4B 1KILA 2BASA 1S3JA 2Q5UA 5AVYB 3CCJP 3TGUE 1CI6B 1BGYE 1NAYA 1KC8Q 3O8ZA 3HD7B 2K9JA 3EFGA 4K3AA 1NYHA 1WMKA 2Q9IA 1NTZK 1NTKD 3I5CA 2QIWA 1SQVK 2KNCB 2QJPC 1FZEA 1AJYA 2D2CB 1FOSE 2HPCB 2A45G 1L2PA 3M9HA 2FYNB 3IFMA 1Y8AA 2Q3EA 1NTMK 4XE5B 1M1KQ 3BCCG 1YTZI 2FYUG 2QJKB 1QVFO 3CXHH 3K5BA 3V2PA 2GUSA 2R32A 1N73A 1DEEG 1LT9C 4C46A 3L71J 3CCUP 2YO2A 3AEEC 4H0LB 2E5YA 1J1DB 3CX5E 2HLOA 1SQXE 2H8PD 1IK7A 1MZ9A 1X22A 2LXBA 3BCCD 1ZMEC 1JUNA 1RF0C 3FGAD 3HD7A 4JPZB 1ZOYC 3Q5PA 3B5NB 5DJTB 2E74C 1PGOA 1K8AQ 1IZNB 4PD4E 4AYCA 1EDIA 2KNCA 4GDOA 2Y0CA 2HPCA 3H1HG 1ZW0A 1KYOH 1NJIQ 1FJPA 4RESB 4U3FJ 4GOFA 3B71A 1DH3A 2YNYA 4I2LC 4H44D 5CMZA 1PZQA 1EZVD 4L73A 1NHLA 3FXDA 2AEJA 2R44A 2WTYA 3CXHD 1USEA 5AW5B 4EDFA 3VOPA 2KYVA 2G3AA 5H2FE 2N9YB 3MUDA 1N86A 3HE4B 1LTGC 4C7NB 3CCLP 3Q5SA 1NTKE 4DJGA 3EFFK 3H1IJ 3AEGC
chains in the Genus database with same CATH topology
1Q2NA 1H0TB 3RGUA 1LP1B 1U7JA 4MN4C 1X0TA 2HR3A 2LXCB 1OVUA 2M0BA 2B87A 5C39A 2K3RA 4CPGA 5CBOA 1LT1A 1H0TA 4GOEA 2LXBA 1U7MA 2B88A 4KJMA 4WWIA 2B87B 2JWDA 1JM0A 2QVAA 2WMMA 4IOIH 5CBNA 2M5AA 1OVRA 2QRXA 2KZJA 1EDKA 1ZXGA 4ZMDA 3PH0A 3S1KA 5EFWB 1JMBA 3ZDMA 1S3JA 3MZWB 5DJTB 4HJGH 4ASVA 2M5AB 1EDIA 2P58A 2UWJE 1Y47A 1ZW0A 2SPZA 2KZIA 2KUBA 4K3AA 4GODA 2B89A 2KS1B 4EYYQ 4GOFA 4HB1A 5K5GB 2OTKE 4NPDA 3FXDA 2KIKA 4NPFX 2R44A 1BDCA 1FC2C 2I8DA 3QWOC 4ZNCA 4JBZA 1EDJA 1BDDA 4ASWA 4NPEA 4K35A 4HKZH 1NVOA 1LP1A 2KI7B 2LR2A 1EDLA 1DEEG 2ZAEB 2Q1KA 1EC5A 4BXLA 1OVVA 2RKLA 3MHVA 3FXEA 1MFTA 5DJUB 1SS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q2N A;  1H0T B;  3RGU A;  1LP1 B;  1U7J A;  4MN4 C;  1X0T A;  2HR3 A;  2LXC B;  1OVU A;  2M0B A;  2B87 A;  5C39 A;  2K3R A;  4CPG A;  5CBO A;  1LT1 A;  1H0T A;  4GOE A;  2LXB A;  1U7M A;  2B88 A;  4KJM A;  4WWI A;  2B87 B;  2JWD A;  1JM0 A;  2QVA A;  2WMM A;  4IOI H;  5CBN A;  2M5A A;  1OVR A;  2QRX A;  2KZJ A;  1EDK A;  1ZXG A;  4ZMD A;  3PH0 A;  3S1K A;  5EFW B;  1JMB A;  3ZDM A;  1S3J A;  3MZW B;  5DJT B;  4HJG H;  4ASV A;  2M5A B;  1EDI A;  2P58 A;  2UWJ E;  1Y47 A;  1ZW0 A;  2SPZ A;  2KZI A;  2KUB A;  4K3A A;  4GOD A;  2B89 A;  2KS1 B;  4EYY Q;  4GOF A;  4HB1 A;  5K5G B;  2OTK E;  4NPD A;  3FXD A;  2KIK A;  4NPF X;  2R44 A;  1BDC A;  1FC2 C;  2I8D A;  3QWO C;  4ZNC A;  4JBZ A;  1EDJ A;  1BDD A;  4ASW A;  4NPE A;  4K35 A;  4HKZ H;  1NVO A;  1LP1 A;  2KI7 B;  2LR2 A;  1EDL A;  1DEE G;  2ZAE B;  2Q1K A;  1EC5 A;  4BXL A;  1OVV A;  2RKL A;  3MHV A;  3FXE A;  1MFT A;  5DJU B;  1SS1 A; 
#chains in the Genus database with same CATH topology
 4RJT A;  1U7J A;  4MN4 C;  2W6J H;  3TK1 A;  1X9V A;  1JNM A;  2M3E A;  4OWF A;  3MGN A;  3I56 P;  3CWB G;  1K9M Q;  3CL3 D;  1LT1 A;  1GL2 C;  3VP8 A;  2P1J A;  1Q82 Q;  4I7Z C;  2R5B A;  1MV8 A;  3B5N A;  3KPE A;  3CD6 P;  3G3Z A;  1VQO P;  2GM4 A;  2I1K A;  3E7K A;  1KYO D;  1PFI A;  5EFW B;  1KOR A;  5BVZ A;  2C0W A;  3RL0 g;  1TU3 F;  1RE4 A;  1S72 P;  2WQY C;  2N1T C;  4L75 A;  2OYH A;  3L73 E;  1ZN5 A;  1HF9 A;  3CWB D;  2FYU J;  3W67 A;  1PPJ G;  1L4A D;  3FX0 A;  1LNQ A;  3BCC E;  2P2U A;  3TSI A;  1JY3 O;  4ZKU A;  3HE4 A;  5KAI E;  2OYI A;  2OTL P;  2WPS A;  3H1J D;  1R5S A;  1N7S C;  1M1J C;  1KZU B;  1S5L H;  2O01 H;  4L76 A;  2Y9Z A;  1VQ8 P;  1KIL E;  2E43 A;  2FYU K;  1LTJ C;  1RF1 B;  2C0X A;  1JY2 P;  1RQV A;  3S4R A;  2ZXX A;  2W6B A;  4L74 A;  4DOJ A;  4H13 B;  1OW7 A;  3TNU A;  1EZV E;  2NPS D;  1QVG O;  2WSF H;  3CXH E;  3L4F A;  2IFM A;  2KSJ A;  1M7L A;  1DX7 A;  1CZQ A;  2ZYG A;  5KLV J;  5AVX B;  3H1H J;  2QE7 H;  3WUU A;  5AW6 B;  1RE3 A;  3KXD A;  1SQB J;  1PV3 A;  2KP8 A;  5CCG A;  2A06 G;  3H6P A;  1IFN A;  1SFC D;  4R4L A;  3SSU A;  4LGD E;  2K1A A;  5KLV K;  5B5E H;  3AE7 C;  1CSB A;  5APS A;  1PP9 J;  2W6A A;  3VN0 A;  5CCH D;  1ZRT D;  3CCR P;  2P7J A;  1SQB K;  1SQV G;  2BCC G;  2WZ7 A;  2I8D A;  1KYO E;  4ZNC A;  3HUS C;  4GKG A;  1UIX A;  1RF1 A;  5KJ7 A;  1VQ7 P;  1NKN A;  1R8E A;  2E76 C;  3QH9 A;  2XV5 A;  2JO1 A;  2C9N Y;  1LWU B;  3MHV A;  1SQP G;  3L75 J;  1PGJ A;  3AE4 C;  1EZV I;  2YXR B;  2P10 A;  1FZG A;  3LW5 J;  2LXC B;  4U7J A;  1UII A;  2PFX A;  3CXH I;  2M0B A;  3PTZ A;  2KLV A;  1SQV D;  2BCC D;  2Y0E A;  1K04 A;  3H1J E;  3UIA A;  2RN0 A;  1S9K E;  2WPQ A;  2B87 B;  3F89 A;  1JM0 A;  1M90 Q;  1PGQ A;  1AQT A;  1NTM D;  3WUV A;  3FWN A;  3S1K A;  3WUT A;  1AVO A;  2NZ2 A;  3CI9 A;  3P32 A;  3VMX A;  5GTH H;  1VF5 D;  4D6T G;  3C9I A;  1ZP0 C;  2KZI A;  3BAT A;  1SQQ G;  1GZL A;  3D71 A;  5AVV B;  3H1K G;  3SFD C;  3G9R A;  1QL1 A;  1KFM A;  5AW2 B;  1RHZ B;  2IZ1 A;  1KYO I;  1RY3 A;  2Y9Y A;  4XFJ A;  1HUC A;  1T3U A;  5AW8 B;  2OYI C;  1L0N G;  1EDJ A;  2J5U A;  5BU5 A;  2Z5I A;  1KFN A;  3RK2 D;  1W5C E;  3L74 G;  1LWU A;  3II6 A;  3O6Q B;  5KLI B;  4OH8 B;  3AED C;  4D6T D;  4H44 B;  1YJ9 P;  2YMY A;  1SQQ D;  2H88 C;  3M0D A;  3AE3 C;  3H1K D;  1SS1 A;  3T97 B;  1LP1 B;  2MJZ A;  2OQQ A;  1ZRT E;  1Z56 A;  2B87 A;  4U3F G;  3AE9 C;  1BCC G;  1IC2 A;  1KN7 A;  4TLF A;  3JCU H;  1IK9 A;  3L74 D;  3CLQ A;  3WU2 H;  3S9O A;  2PRR A;  1NOH A;  2KZJ A;  1WRG A;  3L70 J;  1MFZ A;  1A02 J;  3VMZ A;  5AW9 B;  1NKZ B;  5E79 H;  1M1J B;  1QGK B;  2P67 A;  1OZH A;  2A45 H;  2AEF A;  1QLE D;  1NTZ E;  2QM7 A;  1SQV E;  2BCC E;  1H89 A;  1LTJ B;  4U3F D;  2M8R A;  4Y99 B;  5APW A;  2R5D A;  3KHU A;  4HB1 A;  5K5G B;  1PIX A;  1BE3 G;  2XKM A;  5AVR B;  1FZC B;  3CCV P;  1T2K C;  2KIK A;  3O6Q A;  1VQK P;  1NTM E;  3D6Y A;  4IFD K;  1BDC A;  2IYO A;  1SQP J;  1KTM A;  3V2N A;  3PRJ A;  3AEA C;  1FOS F;  5B5E E;  2WT7 B;  2VRS A;  4B86 A;  5AW7 B;  3IN6 A;  1L4A B;  4RKU J;  1W2B O;  1LP1 A;  4IFF A;  1ZR2 A;  2ZAE B;  1EC5 A;  3H1I D;  3LIE A;  1SLQ A;  2E74 D;  3KDP B;  2FFD A;  1SVF A;  1M56 D;  3A5T A;  1T3J A;  2JJL A;  1SQP K;  1JY3 P;  3BRT B;  2ZVN B;  3U59 A;  1KMI Z;  4D6T J;  2IBZ G;  2B88 A;  1KQL A;  1SQQ J;  1GU4 A;  1HJB A;  1BSN A;  3H1K J;  3L71 E;  1EDK A;  2NPS B;  3H1L J;  4PV1 C;  1DEB A;  3HUS B;  1N2D C;  4N78 D;  3USS A;  2O01 N;  3Q3D A;  5KKZ C;  2JDI H;  3P8C D;  3VMY A;  2R3S A;  4WY4 A;  1SQX J;  3RL0 B;  3Q2Y A;  4C7R A;  3D70 A;  2SPZ A;  3AE1 C;  2FYU D;  3VP9 A;  1FZC A;  1L0N J;  1NU1 G;  1CI6 A;  3L74 J;  2O1J A;  2ZT9 C;  1URQ C;  2IBZ D;  1SQQ K;  1VQL P;  2PGD A;  3EQ2 A;  2H43 A;  2IYP A;  2WT7 A;  5GTH E;  5KLV G;  1L4A A;  1SFC B;  1GL2 D;  3KYQ A;  2YMK A;  2HFE D;  2IX7 C;  1GW3 A;  4UB6 E;  2KXP B;  1LTI C;  3GHG C;  1OW6 A;  1SQB G;  3PP5 A;  1S5L X;  1BCC J;  4LLH A;  3B4S A;  1L0N K;  3KZI H;  5B66 H;  4U3F E;  1VQM P;  1NU1 D;  5DJU B;  3OW2 O;  2N1T D;  4UB8 H;  4I1L A;  2BEQ D;  3OJA B;  1FDM A;  1PP9 G;  1VDF A;  5KLV D;  2ZXE B;  3V4W A;  1GW4 A;  1G2C B;  2NPS A;  3H1H D;  3LW5 H;  1IFD A;  3L72 G;  1SQB D;  1JMM A;  1OXZ A;  3H1I E;  1BE3 J;  2QJY C;  1CW5 A;  1NO4 A;  3AE5 C;  1N7S D;  1NGM B;  3SWY A;  4AUW A;  3FWL A;  2UWJ E;  3NXS A;  3L75 G;  3WU2 E;  3A0H H;  2B89 A;  3VYI A;  2ZVO B;  1E79 H;  1Q90 D;  1PP9 D;  5APX A;  4DZO A;  1SFC A;  2JP3 A;  3M06 A;  1JCD A;  2CPB A;  1RQU A;  5AVU B;  1KIL C;  5E79 E;  2H7H A;  1YJW P;  2Q3I A;  3CC2 P;  2ZYA A;  1VF5 B;  3V5B A;  3QWO C;  4W7Y A;  5AVW B;  4JBZ A;  5CCH A;  4WB4 A;  3R2P A;  1J1E B;  1JO5 A;  5APU A;  4WBA A;  2FYU E;  4DT0 A;  1HJ0 A;  1EDL A;  3L75 D;  2Y0D A;  1FBM A;  2YO3 A;  2IBZ E;  5APT A;  1X0T A;  4C7N A;  1DIP A;  3RK2 B;  2K3R A;  3RBZ A;  3L36 A;  1PL5 A;  1YQ4 C;  1N73 C;  4N3Y B;  4IL6 H;  1PPJ D;  1VQ5 P;  1NU1 J;  4W80 A;  2KLU A;  1ZXG A;  3V4Q A;  4ZMD A;  2K37 A;  1KQG B;  1YI2 P;  2QSI A;  1DD4 A;  2Q7C A;  3H32 B;  1DD3 A;  1HTL C;  1L0L G;  2QJP B;  3SWK A;  2J58 A;  3RL0 D;  2E76 D;  4WY4 C;  5AW3 B;  4EI2 A;  5KLV E;  5KAF H;  3H1H E;  1YYC A;  3NTN A;  2W90 A;  4EYY Q;  2BEZ F;  2OTK E;  3HD7 C;  1W2E A;  2FBW C;  1SQB E;  1NU1 K;  2A45 I;  4O9B A;  4RO0 A;  3BVH A;  2D2C C;  5TIS H;  3L37 A;  1LT9 B;  2CPS A;  2WWW A;  3V2Q A;  4EIJ A;  2FYN C;  2XNX A;  3L70 G;  1G1J A;  2Q6Q A;  4LC1 A;  4NPE A;  1VQ4 P;  4HKZ H;  5BU8 B;  1AQ5 A;  1KV4 A;  1VPC A;  1S1C X;  3IAO A;  1PP9 E;  4BXL A;  2QJK C;  3L72 J;  2IBZ I;  2WVR A;  1H0T B;  2A06 D;  4BWN A;  4YXD C;  2E5T A;  3F5H A;  3MUD C;  3D6Z A;  2PAJ A;  4H0L C;  3KZI E;  1J1D C;  3RBX A;  1K73 Q;  3CWB E;  2ZT9 B;  1U7M A;  1T6A A;  3H32 A;  4XA4 A;  3C1L A;  2E74 B;  3L70 D;  3RK3 C;  4UB8 E;  3CPW O;  3TGU G;  2WPV B;  3L75 E;  1JMB A;  4TT3 H;  3GLM A;  2IZ0 A;  1VQP P;  2L5G B;  3BAS A;  1QL2 A;  1Y47 A;  5M1B A;  2KUB A;  2QG4 A;  3I55 P;  3B5N C;  3CX5 H;  2KS1 B;  1GU5 A;  4KT0 J;  1JEK A;  1LT9 A;  1P84 H;  1PPJ E;  1BSH A;  1FZB A;  4NPF X;  1SQP D;  1RE4 C;  1GDT A;  2OYH C;  1MKM A;  2FY8 A;  4BRY B;  3H1L G;  1GTW A;  1N8R Q;  1D7M A;  3MIW A;  5AVQ B;  2WPR A;  3E1I A;  3A7O A;  3R4Y A;  4PD4 H;  3VMA A;  1AFO A;  4IFM A;  1GL2 B;  1RF0 A;  1SQX G;  4JQ0 D;  4I7Z B;  3SFE C;  1JY2 N;  2XND H;  3B8E B;  1L0L J;  2WSE J;  2YIU C;  3H1L D;  2N1T B;  1EXI A;  5AW4 B;  1S5L E;  5H2F H;  2OAR A;  3CX5 D;  2MKV A;  3MZW B;  4JYC A;  1Y9B A;  2KS1 A;  1SQX D;  4ASV A;  2M5A B;  2A06 E;  4IL6 E;  2POH A;  1L0N D;  1P84 D;  2E75 C;  2DW3 A;  2OGU A;  1ZR4 A;  1FZA A;  4GT1 A;  1L0L K;  1RE3 C;  2JKV A;  5CCG C;  4NPD A;  2Z4E A;  1N7S B;  1OW8 A;  2GUV A;  1EQ7 A;  4BRY A;  1ZLL A;  4OGQ C;  4OVN F;  1YIJ P;  4PD4 D;  3M91 A;  3MD0 A;  5KAF E;  2IFN A;  1M57 D;  1GL2 A;  1BCC D;  1NTK G;  2RMZ A;  4PV1 D;  3E1R A;  2K9Y A;  3FXE A;  1YQ3 C;  5CHX A;  3MP7 B;  3TGU J;  1BGY J;  2HR3 A;  1SQP E;  2HG5 D;  3CME P;  1RF1 C;  5KJ7 C;  4ZKP A;  3T97 A;  1KD1 Q;  2N1T A;  4H13 C;  4YTP C;  3U1A A;  2ZT9 D;  3CCE P;  1URQ D;  4KJM A;  5KAI H;  5CBN A;  2M5A A;  1FAV A;  1OVR A;  4Y28 J;  2QA4 P;  1BE3 D;  5AVS B;  4WVZ A;  5CJ0 A;  2FXM A;  3L73 G;  3W68 A;  2P58 A;  1FJK A;  1N7S A;  1M1J A;  4GOD A;  1S4X A;  4D6T E;  2XZR A;  3V6I A;  2KB7 P;  1U57 A;  1SQQ E;  1Q86 Q;  3Q5R A;  2YKO A;  1PGP A;  1Q7Y Q;  3H1K E;  1LTJ A;  3H1L E;  1E5W A;  2E76 B;  3GG2 A;  1USD A;  2ZYD A;  1OWA A;  1FDI A;  2KOG A;  4QMA A;  3L73 D;  5L8R J;  1LTS C;  1S2E A;  1YHQ P;  3GW6 A;  1L0N E;  3A0B H;  1P84 E;  3RK3 B;  3L74 E;  2AEM A;  1EZV G;  2GA1 A;  5AVZ B;  1HGZ A;  2WSC H;  1T8Z A;  5GTI H;  5APV A;  1LWU C;  1SQX K;  1WT6 A;  1IFJ A;  2ITA A;  3GF7 A;  1KIL D;  1VQN P;  1BCC E;  1NWQ A;  3M0D C;  1GD2 E;  3AEF C;  4IL6 X;  3MTU E;  1KB9 H;  2XDJ A;  4HH2 A;  2OYH B;  1X79 B;  3AE8 C;  3HUS A;  1HVV A;  3GMA A;  2JWA A;  1LTT C;  2K88 A;  1JTH B;  1NTK J;  2XU6 A;  2AXC A;  2OYI B;  3HE5 B;  5TJH A;  2Z5H A;  4JYB A;  1GK4 A;  5APY A;  1BE3 E;  3JCU E;  2C9L Y;  3CX5 I;  1LJ2 A;  1RH5 B;  1BDD A;  1JB0 J;  2YIU B;  1P84 I;  3HRN A;  2I1J A;  2RH0 A;  3TNU B;  1FDO A;  2AXT H;  4EOT A;  3L72 D;  2B9B A;  3U1C A;  5CJ4 A;  1MFT A;  3PLN A;  1NTK K;  3JC2 2;  5KLI C;  5AVT B;  4N78 E;  3RGU A;  4H44 C;  3A2A A;  3H1J G;  3P8C E;  1H88 A;  1OVU A;  2E75 B;  4WY4 D;  5C39 A;  3L73 J;  2J59 M;  2YKQ A;  1KB9 D;  3PJS K;  2V7Q J;  4PD4 I;  3TDK A;  3WMM 0;  3ITK A;  3HD7 D;  4Z1M H;  4PJ0 H;  1JY3 N;  2W8Z A;  4W7Z A;  3BCC J;  4YPC A;  1EXJ A;  1G2C A;  1OMI A;  4OGQ B;  2WSE H;  2FFD C;  2D2C D;  1MUU A;  3ZDM A;  1Q81 Q;  3A3Y B;  3LID A;  3L35 A;  4HJG H;  1AV1 A;  1JTH A;  3CMA P;  2WIT A;  3HE5 A;  4M3L A;  2E42 A;  4A7P A;  1S9K D;  2ZJS E;  4KHX A;  1IFI A;  1NU1 E;  2HOD B;  1HH0 A;  4Y99 C;  2OTJ P;  1LGH B;  1FS0 E;  2M3B A;  4H0L D;  2WSS H;  2PP6 A;  1OX3 A;  1FZC C;  4I6M C;  3AE2 C;  5AW0 B;  1FE6 A;  1SP4 A;  1JCC A;  2G8Y A;  1QEX A;  1KQF B;  1YIT P;  1JOC A;  2L91 A;  1NVO A;  1N7L A;  1X8Y A;  3RK3 D;  2LR2 A;  1L4A C;  3SWF A;  2V4H A;  1Q2N A;  3CCQ P;  3N4X A;  5AW1 B;  3BRV B;  2HYN A;  2ZFC A;  1FZF A;  3B5N D;  3A0B E;  1L0L D;  2WSC J;  2FYZ A;  4PV1 B;  4GOE A;  2R3C A;  3AEB C;  5KKZ B;  2WMM A;  4IOI H;  3P8M C;  2QRX A;  3N7N A;  3L72 E;  5GTI E;  1NH4 A;  1NTZ G;  2FKW B;  5B66 E;  2NPS C;  1URQ B;  1XTG B;  1VQ9 P;  2HOD A;  1AA0 A;  1KB9 E;  3TYY A;  3CWB J;  1BGY G;  1H8A A;  1NTM G;  1VL2 A;  3RL0 C;  1NAF A;  1GMJ A;  3GHG B;  4DCK A;  3EWK A;  1FC2 C;  1J2J B;  3C8V A;  3M0A A;  3KQG A;  3GF3 A;  1YTZ T;  1XTC C;  3OAK A;  3PHL A;  3H1J J;  5KTB A;  1YJN P;  2N9B A;  4AQR D;  1NTZ D;  2JEE A;  1SFC C;  4K35 A;  2Q1K A;  1OVV A;  2RKL A;  1LTB C;  3V2R A;  3G6E P;  1IJD B;  3TGU D;  1BGY D;  3A0H E;  4YXW H;  3ABV C;  4N6J A;  5CCH C;  2LKM A;  2IDB A;  2O1K A;  1ZV8 A;  2E75 D;  2W83 C;  1KQS O;  3CC4 P;  1H0T A;  1AVY A;  2AXT E;  1IFP A;  1R5L A;  2FXP A;  3M9B A;  1HBW A;  3L71 G;  5CCG D;  2QJY B;  4WWI A;  2JR8 A;  5APQ A;  2JWD A;  1QX8 A;  2YKP A;  3CCM P;  3RK3 E;  4UB6 H;  4OGQ D;  4R4M A;  1URQ A;  3JSV C;  2W27 A;  1HGV A;  1VQ6 P;  2IPP A;  3HTK B;  3CC7 P;  3IR9 A;  4PJ0 E;  2KK7 A;  1KIL B;  3M9Q A;  1IFM A;  1KB9 I;  1L0L E;  1LTA C;  3GHG A;  1T2K D;  1JY2 O;  1OFC X;  1FU1 A;  3NFQ A;  1IO4 A;  2QM8 A;  3TF5 A;  3L71 D;  2K9J B;  3Q1M A;  2KSE A;  5KJ7 D;  2O01 J;  2NRG A;  4H13 D;  4JF7 A;  2H89 C;  3NMD A;  4ASW A;  1HWT C;  1VF5 C;  3H25 A;  3G4S P;  3IF4 A;  2KI7 B;  1A02 F;  2FFD B;  2FXO A;  2O3J A;  4HYT B;  3L70 E;  3CCS P;  1J1E C;  1OIP A;  2WSF J;  3AEC C;  3OA7 A;  4GIF A;  1K05 A;  1YBK A;  1N73 B;  2YXQ B;  4CPG A;  5CBO A;  1NTZ J;  1SQV J;  2BCC J;  2QEX P;  3RK2 C;  1GK6 A;  1M8O B;  3H1I G;  1G1I A;  2V7Q H;  5TIS E;  3HTK A;  2QVA A;  3AE6 C;  3G71 P;  2CK3 H;  3VTP C;  2OYO A;  3PH0 A;  3P7K A;  1NTM J;  4WY4 B;  1KIL A;  2BAS A;  1S3J A;  2Q5U A;  5AVY B;  3CCJ P;  3TGU E;  1CI6 B;  1BGY E;  1NAY A;  1KC8 Q;  3O8Z A;  3HD7 B;  2K9J A;  3EFG A;  4K3A A;  1NYH A;  1WMK A;  2Q9I A;  1NTZ K;  1NTK D;  3I5C A;  2QIW A;  1SQV K;  2KNC B;  2QJP C;  1FZE A;  1AJY A;  2D2C B;  1FOS E;  2HPC B;  2A45 G;  1L2P A;  3M9H A;  2FYN B;  3IFM A;  1Y8A A;  2Q3E A;  1NTM K;  4XE5 B;  1M1K Q;  3BCC G;  1YTZ I;  2FYU G;  2QJK B;  1QVF O;  3CXH H;  3K5B A;  3V2P A;  2GUS A;  2R32 A;  1N73 A;  1DEE G;  1LT9 C;  4C46 A;  3L71 J;  3CCU P;  2YO2 A;  3AEE C;  4H0L B;  2E5Y A;  1J1D B;  3CX5 E;  2HLO A;  1SQX E;  2H8P D;  1IK7 A;  1MZ9 A;  1X22 A;  2LXB A;  3BCC D;  1ZME C;  1JUN A;  1RF0 C;  3FGA D;  3HD7 A;  4JPZ B;  1ZOY C;  3Q5P A;  3B5N B;  5DJT B;  2E74 C;  1PGO A;  1K8A Q;  1IZN B;  4PD4 E;  4AYC A;  1EDI A;  2KNC A;  4GDO A;  2Y0C A;  2HPC A;  3H1H G;  1ZW0 A;  1KYO H;  1NJI Q;  1FJP A;  4RES B;  4U3F J;  4GOF A;  3B71 A;  1DH3 A;  2YNY A;  4I2L C;  4H44 D;  5CMZ A;  1PZQ A;  1EZV D;  4L73 A;  1NHL A;  3FXD A;  2AEJ A;  2R44 A;  2WTY A;  3CXH D;  1USE A;  5AW5 B;  4EDF A;  3VOP A;  2KYV A;  2G3A A;  5H2F E;  2N9Y B;  3MUD A;  1N86 A;  3HE4 B;  1LTG C;  4C7N B;  3CCL P;  3Q5S A;  1NTK E;  4DJG A;  3EFF K;  3H1I J;  3AEG C; 
#chains in the Genus database with same CATH homology
 1Q2N A;  1H0T B;  3RGU A;  1LP1 B;  1U7J A;  4MN4 C;  1X0T A;  2HR3 A;  2LXC B;  1OVU A;  2M0B A;  2B87 A;  5C39 A;  2K3R A;  4CPG A;  5CBO A;  1LT1 A;  1H0T A;  4GOE A;  2LXB A;  1U7M A;  2B88 A;  4KJM A;  4WWI A;  2B87 B;  2JWD A;  1JM0 A;  2QVA A;  2WMM A;  4IOI H;  5CBN A;  2M5A A;  1OVR A;  2QRX A;  2KZJ A;  1EDK A;  1ZXG A;  4ZMD A;  3PH0 A;  3S1K A;  5EFW B;  1JMB A;  3ZDM A;  1S3J A;  3MZW B;  5DJT B;  4HJG H;  4ASV A;  2M5A B;  1EDI A;  2P58 A;  2UWJ E;  1Y47 A;  1ZW0 A;  2SPZ A;  2KZI A;  2KUB A;  4K3A A;  4GOD A;  2B89 A;  2KS1 B;  4EYY Q;  4GOF A;  4HB1 A;  5K5G B;  2OTK E;  4NPD A;  3FXD A;  2KIK A;  4NPF X;  2R44 A;  1BDC A;  1FC2 C;  2I8D A;  3QWO C;  4ZNC A;  4JBZ A;  1EDJ A;  1BDD A;  4ASW A;  4NPE A;  4K35 A;  4HKZ H;  1NVO A;  1LP1 A;  2KI7 B;  2LR2 A;  1EDL A;  1DEE G;  2ZAE B;  2Q1K A;  1EC5 A;  4BXL A;  1OVV A;  2RKL A;  3MHV A;  3FXE A;  1MFT A;  5DJU B;  1SS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...