1OVVA

Crystal structure of four-helix bundle model di-co(ii)-df1-l13a (form ii)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQAIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FOUR-HELIX BUNDLE MODEL di-Co(II)-DF1-L13A (form II)
publication title Response of a designed metalloprotein to changes in metal ion coordination, exogenous ligands, and active site volume determined by X-ray crystallography.
pubmed doi rcsb
molecule tags De novo protein
total genus 22
structure length 48
sequence length 48
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1ovvA00
4K35A 4ASVA 5CBOA 4NPDA 5CBNA 2B88A 1JM0A 2R44A 1OVUA 1U7MA 2K3RA 3S1KA 1LP1B 1ZXGA 2KS1B 1BDCA 2Q1KA 2M5AA 4IOIH 4GOEA 4HB1A 2UWJE 2KUBA 2HR3A 2B89A 2P58A 2RKLA 1JMBA 4ZMDA 2LXBA 1SS1A 3MZWB 2B87B 1X0TA 3ZDMA 1H0TB 5DJUB 1MFTA 1NVOA 5DJTB 1DEEG 4MN4C 5K5GB 4CPGA 4HJGH 1EDIA 4EYYQ 1EDKA 2ZAEB 2SPZA 2I8DA 2LR2A 2LXCB 3FXEA 4ASWA 1LT1A 2M0BA 1LP1A 4NPFX 1OVVA 3RGUA 1S3JA 4ZNCA 2QVAA 1ZW0A 2OTKE 1OVRA 3FXDA 2M5AB 2KZJA 3QWOC 1Q2NA 4NPEA 1BDDA 5C39A 1EDJA 2KI7B 4GOFA 2B87A 4GODA 1EDLA 1H0TA 1U7JA 4HKZH 4WWIA 2KIKA 1EC5A 4JBZA 4KJMA 2WMMA 2JWDA 1Y47A 4BXLA 3MHVA 2KZIA 1FC2C 3PH0A 2QRXA 5EFWB 4K3AA
chains in the Genus database with same CATH superfamily
1X22A 2ZXXA 4KT0J 5TISE 3C8VA 1GK6A 1P84E 1NOHA 1OVUA 3RBXA 1EZVG 4RKUJ 3BCCJ 1M90Q 1HWTC 3L73J 2Q9IA 1SQQJ 3AE3C 3RBZA 1N7SC 1NGMB 2C0XA 4UB6E 2Q3IA 2KS1A 4PJ0H 1A02J 5E79E 2JJLA 4MN4C 2YKPA 3H6PA 2JEEA 5K5GB 1H88A 1SQBK 4EIJA 1VQOP 3CCQP 1T3JA 2QG4A 2W27A 4ASWA 2WITA 1VQ5P 1EZVE 3CWBJ 3AE1C 1OW6A 3H1HD 2KYVA 5AVYB 1KQLA 3H1LG 4ZNCA 2QVAA 4U3FD 2KP8A 1KB9H 3AEGC 3LIEA 1LT9B 1SVFA 1LTSC 1S5LE 2FFDB 1BSHA 4R4LA 2K9JB 3LW5H 2FY8A 1FU1A 3L71D 2IBZI 2R3CA 2PFXA 2O01N 3WUTA 2XNDH 3JC22 3KPEA 3A2AA 1NU1G 3H1KE 3TDKA 5KJ7D 1FZCA 1GDTA 2QM8A 1LWUB 3H1LE 1YJWP 1XTCC 3CCEP 3KDPB 5CJ0A 5H2FH 1K73Q 2JKVA 4DOJA 3N4XA 3T97B 2E76C 1S5LX 1ZMEC 1MV8A 1HBWA 1M56D 2A45H 1IFIA 1MFTA 2QA4P 1UIIA 3M06A 1NU1E 1KD1Q 2K1AA 2FYUG 3GHGC 1JCDA 2FYUK 4ZKUA 1CZQA 3CC4P 4U7JA 4A7PA 1H8AA 1HF9A 2Z5HA 1H89A 4PD4E 1LP1A 3AECC 1LWUC 5AVTB 2P7JA 2BCCG 4OGQB 1YHQP 2M5AB 4OWFA 4GKGA 1NKNA 3V2NA 4WY4B 2WWWA 2QIWA 2B87A 4ZKPA 2DW3A 1L4AD 3H1LJ 2C9NY 1NH4A 3L74D 1N8RQ 2O01H 3IAOA 2QRXA 2FYUE 1KYOI 4L75A 1LT9A 5CBOA 2AEMA 1KQFB 2FFDA 1S1CX 2K9JA 1KV4A 2IBZD 1FZFA 1NTKG 1SQBD 1G2CB 1NTKK 4EOTA 1AQ5A 2BCCE 2QJKB 4UB8H 1M7LA 1NU1J 3LIDA 3I5CA 1GL2C 4WY4C 2LXBA 2N1TA 4L74A 3M9HA 3PTZA 3AEFC 5AW6B 5DJUB 3CXHE 1TU3F 1RE4C 1IZNB 3O6QA 3L35A 3W67A 3CMAP 4CPGA 4HJGH 2ZT9D 2IFMA 2LXCB 3VMAA 1NTKE 1SQXG 5KLVG 3F89A 3JCUE 5KLVK 2R5DA 1YBKA 3AE5C 3G71P 2HG5D 3L75D 1OVRA 2QJKC 1GU4A 3D71A 2FYUJ 4H13B 1USDA 1K9MQ 2CPBA 3WMM0 5KKZB 4NPEA 1ZOYC 2KNCA 1FAVA 1L2PA 3MUDC 2IX7C 4C7NA 2BCCJ 2HODB 2AXTE 2WMMA 4GIFA 3CLQA 3HUSC 1R5LA 4ASVA 1LTJB 3FWLA 5AW9B 1S4XA 3KZIE 3RL0g 5KLVE 4PJ0E 1JNMA 1NAYA 3B71A 2OGUA 3AEDC 3V2QA 3A0BH 1LTTC 4PV1D 3L36A 4H13C 2KUBA 2GUSA 3H32A 4XFJA 1OW8A 4ZMDA 1NTKJ 4C46A 3A5TA 1X0TA 4H0LC 2N1TD 3VP9A 2OYHC 5AW8B 1NWQA 2K88A 3USSA 1IFNA 2R3SA 1LTJC 3P32A 4XA4A 4LLHA 2O1KA 3C1LA 1YYCA 3FXEA 2VRSA 2AEFA 2QJYB 4EI2A 2XU6A 1FJKA 2L5GB 2HPCA 1SFCC 2PAJA 2K9YA 3FXDA 3OA7A 4YXDC 1JTHA 5CCHC 1YQ4C 1YITP 1SQVJ 2YXRB 3CPWO 1FOSF 2BEQD 3G9RA 5L8RJ 1SQXJ 1KTMA 5KLVJ 4GOFA 1K04A 4W7ZA 1HVVA 3H1IG 3HE4B 3R4YA 1U7JA 1M1KQ 2E75D 2I1JA 2W90A 4DCKA 1BCCG 1RF1B 1Y47A 4AUWA 2ZVOB 4Z1MH 2QJPC 1PFIA 2OTLP 1GK4A 1GW4A 2R44A 2KLVA 1X9VA 3S1KA 3Q5RA 5CCGC 2FYZA 2YMYA 3WU2E 2OYIB 1VQ9P 1SQQK 4IOIH 4I7ZB 3G3ZA 1JB0J 1GMJA 2NPSB 2GUVA 1SS1A 2ZXEB 3BASA 3LW5J 3H1IE 3SWYA 1BCCE 3ZDMA 1AA0A 2ZYAA 2WSCH 1CSBA 1W5CE 1S9KE 1JY3N 3RL0D 4WVZA 2Z5IA 3D70A 3RK2D 2A06D 2OQQA 3RK3E 1PP9G 3CWBG 3IN6A 1RQUA 1ZW0A 3AE9C 3P8MC 3SSUA 1SQQE 2OTKE 3AE2C 2OYIC 3WUUA 5KJ7C 1BDDA 3II6A 3TGUG 5AVSB 5AW3B 1BGYD 1KYOH 5AVUB 2YKOA 1RHZB 2Y9ZA 3F5HA 4UB8E 5GTIH 3CX5H 1K05A 3MIWA 5EFWB 1JCCA 3A0HH 4K3AA 3SWKA 1NTZG 1AVYA 1URQB 1NTZK 3GMAA 3AE7C 5APWA 3HE4A 1QX8A 3H1IJ 3P8CE 2K37A 1RF1A 2E5TA 1PP9E 3CWBE 1BCCJ 2YNYA 1N7LA 4I2LC 1MZ9A 1DIPA 1NKZB 1BSNA 2MKVA 1Y8AA 1M1JA 2JO1A 3A7OA 1OW7A 1L0NG 1P84I 2KSEA 3TGUE 3CCRP 1L0NK 1QVFO 2M8RA 1RE3A 1Q90D 3L70D 5APQA 1J1DC 1M57D 3CCLP 3B5NA 5DJTB 1NTZE 1YTZI 5B66E 1URQC 4I6MC 2NPSA 3EFGA 1RQVA 1JOCA 2QM7A 3VTPC 1L4AC 3MTUE 4JQ0D 3Q5PA 3M0DC 5KLIC 1L0LG 4HYTB 1L0LK 1L0NE 3RK3D 2KZJA 3BATA 2E5YA 2W6BA 3BCCD 2FXPA 4H44D 3L73D 1EZVI 3I55P 1SQQD 2KSJA 4D6TG 1PP9J 3HD7D 4DZOA 1ZRTD 2IBZG 5AW5B 2C9LY 1USEA 3L71J 4C7RA 3FGAD 3TGUJ 2AXCA 4AQRD 2B88A 1SQPG 5APSA 3PRJA 1YI2P 2POHA 2Y0CA 2E76B 2WPRA 3D6YA 2YO2A 1OWAA 2H8PD 1L0LE 1N7SA 1ZLLA 1NTZJ 3HTKA 3CC2P 1NU1K 3GHGB 1NO4A 1PGPA 5KAFH 3L4FA 4D6TE 5AVXB 2KOGA 1JY2N 3V2PA 1NHLA 1P84D 1L0NJ 2CPSA 3NTNA 3CCVP 1EDKA 1Y9BA 1E5WA 3BVHA 1AFOA 3GF7A 5AW7B 1FJPA 3E1IA 3N7NA 5KAIH 5CHXA 1PPJG 1OXZA 3NMDA 2O3JA 2CK3H 2YMKA 3R2PA 2W6JH 4PD4I 1EXIA 2D2CB 3TNUB 1JY3P 3V4QA 1HGVA 1Q7YQ 1L0LJ 4PV1C 2O1JA 3PH0A 3CI9A 3M0AA 4BRYB 1JMMA 5B5EH 3EWKA 3A3YB 1EZVD 2FBWC 3L37A 3E1RA 4IL6E 2Q3EA 1GL2B 2WSEH 1VQPP 4GT1A 3U1AA 4D6TJ 1KC8Q 1PPJE 1KQSO 3AEEC 2E74D 2G8YA 1N7SD 1LGHB 1EQ7A 2J5UA 1SQPJ 3CCSP 2D2CC 2RN0A 3H1JG 3PHLA 3H1KD 4N78E 1NYHA 2FYNC 1X8YA 3GHGA 1BE3G 2HYNA 3H1LD 1OMIA 1OZHA 4EYYQ 1KILB 4IL6X 2B9BA 1LWUA 1IFMA 3CXHI 1VQ6P 2WT7B 1CW5A 3PP5A 2ZVNB 3V4WA 1NTMG 3HUSB 1NTMK 4RJTA 3L75J 1SQVG 3T97A 2WSFH 3H1JE 1SQVK 2R5BA 3RK2B 1NU1D 1SQXK 3FX0A 3KHUA 2V4HA 4PD4D 3GW6A 1KILC 2IZ1A 3S4RA 5TISH 3M91A 1QEXA 1P84H 3CMEP 3IF4A 4H0LB 1BDCA 1IFJA 2M5AA 2OYHB 1NTME 1N73C 1W2BO 3RL0C 4HB1A 1GL2A 4JYCA 4WY4A 1FOSE 1SQVE 2YO3A 2V7QJ 3OW2O 2P10A 5APTA 5BU8B 1SQXE 3CCUP 3RK2C 2IYOA 2FYUD 3L72G 4UB6H 3TK1A 1H0TB 1LTIC 2M3EA 1RE4A 1FZAA 1IO4A 2N9YB 1SFCB 5E79H 1WT6A 4AYCA 2XV5A 1RF0C 2BCCD 3H1JJ 4B86A 1G2CA 1RY3A 2FKWB 2JR8A 1KILE 1WMKA 4WBAA 4IFFA 3NXSA 1BE3J 1KB9E 2QJPB 2ZYGA 4YPCA 3MUDA 3CCMP 1DH3A 2KI7B 3CXHD 2NRGA 1JY2P 3KYQA 3L72E 1LJ2A 2WT7A 2A45G 4OVNF 3AE6C 2N9BA 3HUSA 1VQ7P 1NTMJ 2H89C 5AVRB 1NTKD 1JO5A 1AV1A 1IK7A 1ZR4A 4KHXA 1QVGO 2KLUA 2IPPA 1JM0A 1PGJA 3V5BA 3HD7B 4TT3H 3W68A 2JDIH 2Q1KA 1HUCA 4OGQD 2KK7A 3AE8C 5H2FE 2UWJE 2GA1A 1YJNP 3MD0A 4WY4D 1VQLP 3WUVA 2YIUC 3AEBC 2HODA 1LNQA 1J2JB 3IR9A 2OYHA 1S2EA 2R32A 1YIJP 1SQXD 1LTJA 5KLVD 3CD6P 3IFMA 1EDIA 3M9BA 4H44C 2PP6A 3L72J 3HD7C 4PD4H 1SFCA 5AW1B 5CCHA 2WSSH 3H1HG 1SLQA 1HJBA 1FDMA 2Y9YA 1VPCA 4U3FG 2FXOA 1G1JA 1MUUA 2KIKA 3VMYA 1EC5A 2BEZF 3MHVA 1DX7A 1T6AA 3CL3D 1GZLA 3P7KA 1MKMA 3KQGA 3L71G 4NPDA 1DD3A 2KB7P 5CCGA 1J1DB 2H7HA 4M3LA 3Q3DA 1KFMA 3H1HE 4H13D 1IK9A 1T8ZA 2P58A 2RKLA 2J58A 3U59A 1KZUB 1L4AB 3SWFA 5APUA 1Q81Q 1VF5D 1NVOA 3L70J 1T2KD 5KLIB 3VN0A 2HFED 2WSEJ 3L71E 1Q82Q 1HGZA 1VQMP 2OARA 2LR2A 3MGNA 4L76A 1ZP0C 2Y0EA 3E7KA 1M8OB 2O01J 2ZYDA 3JCUH 4O9BA 2OYIA 2WPQA 4WB4A 5CCHD 4YTPC 5KJ7A 4XE5B 3GG2A 3H1ID 1OIPA 3QWOC 1Q2NA 1BCCD 2ZFCA 2IYPA 1S9KD 1J1EC 1ZR2A 1SP4A 3K5BA 1GW3A 1G1IA 3SFDC 3VP8A 2AXTH 2E74C 3V2RA 3H1HJ 2I1KA 1K8AQ 3L74G 3EQ2A 2ZT9B 5CBNA 4U3FJ 1JUNA 2QSIA 1PIXA 1FZCC 2W6AA 3KZIH 1U7MA 2K3RA 1LP1B 3D6ZA 3A0BE 2E43A 5CCGD 1A02F 1IC2A 2AEJA 1SQBG 4GOEA 2QEXP 3H1KG 2WSFJ 2H43A 1W2EA 3B4SA 3MP7B 2WTYA 2XKMA 1SQPK 3OAKA 1XTGB 2B87B 1HTLC 2L91A 3G6EP 3CC7P 2GM4A 1URQA 1YTZT 3P8CD 3U1CA 3VMXA 3Q1MA 3L74E 1PP9D 3CWBD 2ZT9C 1U57A 2SPZA 1L4AA 3PLNA 3RGUA 3M0DA 2IFNA 3TGUD 4QMAA 4W80A 2JP3A 2IBZE 4PV1B 1SQBE 5APXA 4LC1A 3B5ND 3CCJP 3UIAA 2FXMA 3B8EB 1SQPE 5C39A 2NPSD 3L75G 5APVA 1NTZD 3GLMA 1FE6A 2N1TB 1R5SA 1IJDB 3NFQA 1YJ9P 1HJ0A 3O6QB 2NZ2A 1LT9C 1QLED 2FFDC 4HH2A 2Q7CA 1R8EA 1L0ND 5AVVB 2IDBA 1FZGA 2P2UA 1YQ3C 2FYNB 3FWNA 3WU2H 3L74J 1T3UA 2HR3A 3L75E 2KNCB 1PZQA 4I1LA 1PL5A 1FS0E 2E75B 2N1TC 4C7NB 5BU5A 3HRNA 1QGKB 2P1JA 2MJZA 1DEEG 1SQBJ 3H1KJ 1URQD 4W7YA 3H25A 1DEBA 4Y99B 1KMIZ 1L0LD 1LT1A 3PJSK 1S3JA 3VMZA 4TLFA 2G3AA 3VYIA 1NAFA 1OFCX 4D6TD 5AW0B 1KYOE 3I56P 1LTBC 3BRVB 4R4MA 5TJHA 3CX5I 1EDJA 3H32B 5GTIE 3CX5E 3OJAB 2YKQA 2E75C 4JBZA 1JY3O 4BXLA 4OGQC 1SQPD 3A0HE 1N73B 3RL0B 2M3BA 5GTHH 2WPSA 1JEKA 4Y99C 2LKMA 1VQ8P 2BASA 4GDOA 4RO0A 2WSCJ 1ZXGA 2Q6QA 1FZEA 3SFEC 2HPCB 2W8ZA 1BE3E 3JSVC 1JTHB 4JYBA 2RMZA 2H88C 2YXQB 1AJYA 3TNUA 1VDFA 5KTBA 2IZ0A 3ITKA 5CMZA 2PGDA 2ZJSE 3M9QA 4BRYA 1GTWA 2XDJA 2HLOA 1OX3A 5B66H 1HH0A 1PPJD 2I8DA 4Y28J 2E76D 3G4SP 5AVWB 1VF5B 1FDOA 1WRGA 2A06G 3O8ZA 1ZN5A 1MFZA 5CJ4A 4N78D 2ITAA 3Q2YA 4GODA 1CI6B 5APYA 1LTAC 2J59M 1KYOD 2RH0A 3Q5SA 1KB9I 1BGYG 2PRRA 1UIXA 1VL2A 4K35A 2P67A 1KILA 4LGDE 1KQGB 4EDFA 5KKZC 3CX5D 3KXDA 2YIUB 1S72P 1E79H 1S5LH 3QH9A 1VF5C 2WQYC 2E42A 1N73A 1T2KC 1VQ4P 3TSIA 2OYOA 3H1JD 1LTGC 2A06E 2WZ7A 3AEAC 5AW4B 3TF5A 3RK3B 4OH8B 5KAFE 1Z56A 2D2CD 3HE5B 4H44B 4JF7A 1D7MA 1BE3D 3MZWB 1VQKP 3AE4C 1BGYE 4JPZB 4DT0A 2W83C 3L70G 3TYYA 4IFDK 1RF0A 2WVRA 1AQTA 4BWNA 1N2DC 2ZAEB 1GL2D 2A45I 1NJIQ 1PV3A 3ABVC 1NTMD 5KAIE 1OVVA 2JWAA 2XZRA 3GF3A 4RESB 1SQVD 1M1JB 3RK3C 3VOPA 3S9OA 2QJYC 1Q86Q 1H0TA 1JY2O 1KN7A 4KJMA 2JWDA 2KZIA 3BCCG 1FC2C 3L73G 5B5EE 1SQQG 2Z4EA 3L70E 3B5NB 1KFNA 1KILD 1IFPA 4YXWH 1CI6A 1AVOA 4IL6H 2OTJP 3BRTB 1QL1A 2C0WA 3V6IA 1KB9D 1N86A 1RF1C 1DD4A 1BGYJ 2KS1B 3C9IA 4DJGA 1M1JC 5BVZA 4N6JA 3L72D 2B89A 1JMBA 1VQNP 5AVZB 2XNXA 4IFMA 1RE3C 1X79B 2Y0DA 3BCCE 3L73E 2WPVB 3B5NC 1KORA 4I7ZC 1FBMA 3HE5A 1FDIA 2NPSC 4U3FE 1ZRTE 5AW2B 3HD7A 2M0BA 2V7QH 4L73A 4NPFX 1J1EB 2KXPB 4N3YB 1PGQA 2QE7H 4H0LD 5M1BA 1ZV8A 1FZBA 3EFFK 1PGOA 1IFDA 5GTHE 1RH5B 2E74B 1N7SB 1GU5A 3CXHH 3HTKB 1QL2A 1EXJA 1FZCB 1EDLA 4HKZH 4WWIA 1GD2E 5AVQB 2Q5UA 1SFCD
chains in the Genus database with same CATH topology
4K35A 4ASVA 5CBOA 4NPDA 5CBNA 2B88A 1JM0A 2R44A 1OVUA 1U7MA 2K3RA 3S1KA 1LP1B 1ZXGA 2KS1B 1BDCA 2Q1KA 2M5AA 4IOIH 4GOEA 4HB1A 2UWJE 2KUBA 2HR3A 2B89A 2P58A 2RKLA 1JMBA 4ZMDA 2LXBA 1SS1A 3MZWB 2B87B 1X0TA 3ZDMA 1H0TB 5DJUB 1MFTA 1NVOA 5DJTB 1DEEG 4MN4C 5K5GB 4CPGA 4HJGH 1EDIA 4EYYQ 1EDKA 2ZAEB 2SPZA 2I8DA 2LR2A 2LXCB 3FXEA 4ASWA 1LT1A 2M0BA 1LP1A 4NPFX 1OVVA 3RGUA 1S3JA 4ZNCA 2QVAA 1ZW0A 2OTKE 1OVRA 3FXDA 2M5AB 2KZJA 3QWOC 1Q2NA 4NPEA 1BDDA 5C39A 1EDJA 2KI7B 4GOFA 2B87A 4GODA 1EDLA 1H0TA 1U7JA 4HKZH 4WWIA 2KIKA 1EC5A 4JBZA 4KJMA 2WMMA 2JWDA 1Y47A 4BXLA 3MHVA 2KZIA 1FC2C 3PH0A 2QRXA 5EFWB 4K3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K35 A;  4ASV A;  5CBO A;  4NPD A;  5CBN A;  2B88 A;  1JM0 A;  2R44 A;  1OVU A;  1U7M A;  2K3R A;  3S1K A;  1LP1 B;  1ZXG A;  2KS1 B;  1BDC A;  2Q1K A;  2M5A A;  4IOI H;  4GOE A;  4HB1 A;  2UWJ E;  2KUB A;  2HR3 A;  2B89 A;  2P58 A;  2RKL A;  1JMB A;  4ZMD A;  2LXB A;  1SS1 A;  3MZW B;  2B87 B;  1X0T A;  3ZDM A;  1H0T B;  5DJU B;  1MFT A;  1NVO A;  5DJT B;  1DEE G;  4MN4 C;  5K5G B;  4CPG A;  4HJG H;  1EDI A;  4EYY Q;  1EDK A;  2ZAE B;  2SPZ A;  2I8D A;  2LR2 A;  2LXC B;  3FXE A;  4ASW A;  1LT1 A;  2M0B A;  1LP1 A;  4NPF X;  1OVV A;  3RGU A;  1S3J A;  4ZNC A;  2QVA A;  1ZW0 A;  2OTK E;  1OVR A;  3FXD A;  2M5A B;  2KZJ A;  3QWO C;  1Q2N A;  4NPE A;  1BDD A;  5C39 A;  1EDJ A;  2KI7 B;  4GOF A;  2B87 A;  4GOD A;  1EDL A;  1H0T A;  1U7J A;  4HKZ H;  4WWI A;  2KIK A;  1EC5 A;  4JBZ A;  4KJM A;  2WMM A;  2JWD A;  1Y47 A;  4BXL A;  3MHV A;  2KZI A;  1FC2 C;  3PH0 A;  2QRX A;  5EFW B;  4K3A A; 
#chains in the Genus database with same CATH topology
 1X22 A;  2ZXX A;  4KT0 J;  5TIS E;  3C8V A;  1GK6 A;  1P84 E;  1NOH A;  1OVU A;  3RBX A;  1EZV G;  4RKU J;  3BCC J;  1M90 Q;  1HWT C;  3L73 J;  2Q9I A;  1SQQ J;  3AE3 C;  3RBZ A;  1N7S C;  1NGM B;  2C0X A;  4UB6 E;  2Q3I A;  2KS1 A;  4PJ0 H;  1A02 J;  5E79 E;  2JJL A;  4MN4 C;  2YKP A;  3H6P A;  2JEE A;  5K5G B;  1H88 A;  1SQB K;  4EIJ A;  1VQO P;  3CCQ P;  1T3J A;  2QG4 A;  2W27 A;  4ASW A;  2WIT A;  1VQ5 P;  1EZV E;  3CWB J;  3AE1 C;  1OW6 A;  3H1H D;  2KYV A;  5AVY B;  1KQL A;  3H1L G;  4ZNC A;  2QVA A;  4U3F D;  2KP8 A;  1KB9 H;  3AEG C;  3LIE A;  1LT9 B;  1SVF A;  1LTS C;  1S5L E;  2FFD B;  1BSH A;  4R4L A;  2K9J B;  3LW5 H;  2FY8 A;  1FU1 A;  3L71 D;  2IBZ I;  2R3C A;  2PFX A;  2O01 N;  3WUT A;  2XND H;  3JC2 2;  3KPE A;  3A2A A;  1NU1 G;  3H1K E;  3TDK A;  5KJ7 D;  1FZC A;  1GDT A;  2QM8 A;  1LWU B;  3H1L E;  1YJW P;  1XTC C;  3CCE P;  3KDP B;  5CJ0 A;  5H2F H;  1K73 Q;  2JKV A;  4DOJ A;  3N4X A;  3T97 B;  2E76 C;  1S5L X;  1ZME C;  1MV8 A;  1HBW A;  1M56 D;  2A45 H;  1IFI A;  1MFT A;  2QA4 P;  1UII A;  3M06 A;  1NU1 E;  1KD1 Q;  2K1A A;  2FYU G;  3GHG C;  1JCD A;  2FYU K;  4ZKU A;  1CZQ A;  3CC4 P;  4U7J A;  4A7P A;  1H8A A;  1HF9 A;  2Z5H A;  1H89 A;  4PD4 E;  1LP1 A;  3AEC C;  1LWU C;  5AVT B;  2P7J A;  2BCC G;  4OGQ B;  1YHQ P;  2M5A B;  4OWF A;  4GKG A;  1NKN A;  3V2N A;  4WY4 B;  2WWW A;  2QIW A;  2B87 A;  4ZKP A;  2DW3 A;  1L4A D;  3H1L J;  2C9N Y;  1NH4 A;  3L74 D;  1N8R Q;  2O01 H;  3IAO A;  2QRX A;  2FYU E;  1KYO I;  4L75 A;  1LT9 A;  5CBO A;  2AEM A;  1KQF B;  2FFD A;  1S1C X;  2K9J A;  1KV4 A;  2IBZ D;  1FZF A;  1NTK G;  1SQB D;  1G2C B;  1NTK K;  4EOT A;  1AQ5 A;  2BCC E;  2QJK B;  4UB8 H;  1M7L A;  1NU1 J;  3LID A;  3I5C A;  1GL2 C;  4WY4 C;  2LXB A;  2N1T A;  4L74 A;  3M9H A;  3PTZ A;  3AEF C;  5AW6 B;  5DJU B;  3CXH E;  1TU3 F;  1RE4 C;  1IZN B;  3O6Q A;  3L35 A;  3W67 A;  3CMA P;  4CPG A;  4HJG H;  2ZT9 D;  2IFM A;  2LXC B;  3VMA A;  1NTK E;  1SQX G;  5KLV G;  3F89 A;  3JCU E;  5KLV K;  2R5D A;  1YBK A;  3AE5 C;  3G71 P;  2HG5 D;  3L75 D;  1OVR A;  2QJK C;  1GU4 A;  3D71 A;  2FYU J;  4H13 B;  1USD A;  1K9M Q;  2CPB A;  3WMM 0;  5KKZ B;  4NPE A;  1ZOY C;  2KNC A;  1FAV A;  1L2P A;  3MUD C;  2IX7 C;  4C7N A;  2BCC J;  2HOD B;  2AXT E;  2WMM A;  4GIF A;  3CLQ A;  3HUS C;  1R5L A;  4ASV A;  1LTJ B;  3FWL A;  5AW9 B;  1S4X A;  3KZI E;  3RL0 g;  5KLV E;  4PJ0 E;  1JNM A;  1NAY A;  3B71 A;  2OGU A;  3AED C;  3V2Q A;  3A0B H;  1LTT C;  4PV1 D;  3L36 A;  4H13 C;  2KUB A;  2GUS A;  3H32 A;  4XFJ A;  1OW8 A;  4ZMD A;  1NTK J;  4C46 A;  3A5T A;  1X0T A;  4H0L C;  2N1T D;  3VP9 A;  2OYH C;  5AW8 B;  1NWQ A;  2K88 A;  3USS A;  1IFN A;  2R3S A;  1LTJ C;  3P32 A;  4XA4 A;  4LLH A;  2O1K A;  3C1L A;  1YYC A;  3FXE A;  2VRS A;  2AEF A;  2QJY B;  4EI2 A;  2XU6 A;  1FJK A;  2L5G B;  2HPC A;  1SFC C;  2PAJ A;  2K9Y A;  3FXD A;  3OA7 A;  4YXD C;  1JTH A;  5CCH C;  1YQ4 C;  1YIT P;  1SQV J;  2YXR B;  3CPW O;  1FOS F;  2BEQ D;  3G9R A;  5L8R J;  1SQX J;  1KTM A;  5KLV J;  4GOF A;  1K04 A;  4W7Z A;  1HVV A;  3H1I G;  3HE4 B;  3R4Y A;  1U7J A;  1M1K Q;  2E75 D;  2I1J A;  2W90 A;  4DCK A;  1BCC G;  1RF1 B;  1Y47 A;  4AUW A;  2ZVO B;  4Z1M H;  2QJP C;  1PFI A;  2OTL P;  1GK4 A;  1GW4 A;  2R44 A;  2KLV A;  1X9V A;  3S1K A;  3Q5R A;  5CCG C;  2FYZ A;  2YMY A;  3WU2 E;  2OYI B;  1VQ9 P;  1SQQ K;  4IOI H;  4I7Z B;  3G3Z A;  1JB0 J;  1GMJ A;  2NPS B;  2GUV A;  1SS1 A;  2ZXE B;  3BAS A;  3LW5 J;  3H1I E;  3SWY A;  1BCC E;  3ZDM A;  1AA0 A;  2ZYA A;  2WSC H;  1CSB A;  1W5C E;  1S9K E;  1JY3 N;  3RL0 D;  4WVZ A;  2Z5I A;  3D70 A;  3RK2 D;  2A06 D;  2OQQ A;  3RK3 E;  1PP9 G;  3CWB G;  3IN6 A;  1RQU A;  1ZW0 A;  3AE9 C;  3P8M C;  3SSU A;  1SQQ E;  2OTK E;  3AE2 C;  2OYI C;  3WUU A;  5KJ7 C;  1BDD A;  3II6 A;  3TGU G;  5AVS B;  5AW3 B;  1BGY D;  1KYO H;  5AVU B;  2YKO A;  1RHZ B;  2Y9Z A;  3F5H A;  4UB8 E;  5GTI H;  3CX5 H;  1K05 A;  3MIW A;  5EFW B;  1JCC A;  3A0H H;  4K3A A;  3SWK A;  1NTZ G;  1AVY A;  1URQ B;  1NTZ K;  3GMA A;  3AE7 C;  5APW A;  3HE4 A;  1QX8 A;  3H1I J;  3P8C E;  2K37 A;  1RF1 A;  2E5T A;  1PP9 E;  3CWB E;  1BCC J;  2YNY A;  1N7L A;  4I2L C;  1MZ9 A;  1DIP A;  1NKZ B;  1BSN A;  2MKV A;  1Y8A A;  1M1J A;  2JO1 A;  3A7O A;  1OW7 A;  1L0N G;  1P84 I;  2KSE A;  3TGU E;  3CCR P;  1L0N K;  1QVF O;  2M8R A;  1RE3 A;  1Q90 D;  3L70 D;  5APQ A;  1J1D C;  1M57 D;  3CCL P;  3B5N A;  5DJT B;  1NTZ E;  1YTZ I;  5B66 E;  1URQ C;  4I6M C;  2NPS A;  3EFG A;  1RQV A;  1JOC A;  2QM7 A;  3VTP C;  1L4A C;  3MTU E;  4JQ0 D;  3Q5P A;  3M0D C;  5KLI C;  1L0L G;  4HYT B;  1L0L K;  1L0N E;  3RK3 D;  2KZJ A;  3BAT A;  2E5Y A;  2W6B A;  3BCC D;  2FXP A;  4H44 D;  3L73 D;  1EZV I;  3I55 P;  1SQQ D;  2KSJ A;  4D6T G;  1PP9 J;  3HD7 D;  4DZO A;  1ZRT D;  2IBZ G;  5AW5 B;  2C9L Y;  1USE A;  3L71 J;  4C7R A;  3FGA D;  3TGU J;  2AXC A;  4AQR D;  2B88 A;  1SQP G;  5APS A;  3PRJ A;  1YI2 P;  2POH A;  2Y0C A;  2E76 B;  2WPR A;  3D6Y A;  2YO2 A;  1OWA A;  2H8P D;  1L0L E;  1N7S A;  1ZLL A;  1NTZ J;  3HTK A;  3CC2 P;  1NU1 K;  3GHG B;  1NO4 A;  1PGP A;  5KAF H;  3L4F A;  4D6T E;  5AVX B;  2KOG A;  1JY2 N;  3V2P A;  1NHL A;  1P84 D;  1L0N J;  2CPS A;  3NTN A;  3CCV P;  1EDK A;  1Y9B A;  1E5W A;  3BVH A;  1AFO A;  3GF7 A;  5AW7 B;  1FJP A;  3E1I A;  3N7N A;  5KAI H;  5CHX A;  1PPJ G;  1OXZ A;  3NMD A;  2O3J A;  2CK3 H;  2YMK A;  3R2P A;  2W6J H;  4PD4 I;  1EXI A;  2D2C B;  3TNU B;  1JY3 P;  3V4Q A;  1HGV A;  1Q7Y Q;  1L0L J;  4PV1 C;  2O1J A;  3PH0 A;  3CI9 A;  3M0A A;  4BRY B;  1JMM A;  5B5E H;  3EWK A;  3A3Y B;  1EZV D;  2FBW C;  3L37 A;  3E1R A;  4IL6 E;  2Q3E A;  1GL2 B;  2WSE H;  1VQP P;  4GT1 A;  3U1A A;  4D6T J;  1KC8 Q;  1PPJ E;  1KQS O;  3AEE C;  2E74 D;  2G8Y A;  1N7S D;  1LGH B;  1EQ7 A;  2J5U A;  1SQP J;  3CCS P;  2D2C C;  2RN0 A;  3H1J G;  3PHL A;  3H1K D;  4N78 E;  1NYH A;  2FYN C;  1X8Y A;  3GHG A;  1BE3 G;  2HYN A;  3H1L D;  1OMI A;  1OZH A;  4EYY Q;  1KIL B;  4IL6 X;  2B9B A;  1LWU A;  1IFM A;  3CXH I;  1VQ6 P;  2WT7 B;  1CW5 A;  3PP5 A;  2ZVN B;  3V4W A;  1NTM G;  3HUS B;  1NTM K;  4RJT A;  3L75 J;  1SQV G;  3T97 A;  2WSF H;  3H1J E;  1SQV K;  2R5B A;  3RK2 B;  1NU1 D;  1SQX K;  3FX0 A;  3KHU A;  2V4H A;  4PD4 D;  3GW6 A;  1KIL C;  2IZ1 A;  3S4R A;  5TIS H;  3M91 A;  1QEX A;  1P84 H;  3CME P;  3IF4 A;  4H0L B;  1BDC A;  1IFJ A;  2M5A A;  2OYH B;  1NTM E;  1N73 C;  1W2B O;  3RL0 C;  4HB1 A;  1GL2 A;  4JYC A;  4WY4 A;  1FOS E;  1SQV E;  2YO3 A;  2V7Q J;  3OW2 O;  2P10 A;  5APT A;  5BU8 B;  1SQX E;  3CCU P;  3RK2 C;  2IYO A;  2FYU D;  3L72 G;  4UB6 H;  3TK1 A;  1H0T B;  1LTI C;  2M3E A;  1RE4 A;  1FZA A;  1IO4 A;  2N9Y B;  1SFC B;  5E79 H;  1WT6 A;  4AYC A;  2XV5 A;  1RF0 C;  2BCC D;  3H1J J;  4B86 A;  1G2C A;  1RY3 A;  2FKW B;  2JR8 A;  1KIL E;  1WMK A;  4WBA A;  4IFF A;  3NXS A;  1BE3 J;  1KB9 E;  2QJP B;  2ZYG A;  4YPC A;  3MUD A;  3CCM P;  1DH3 A;  2KI7 B;  3CXH D;  2NRG A;  1JY2 P;  3KYQ A;  3L72 E;  1LJ2 A;  2WT7 A;  2A45 G;  4OVN F;  3AE6 C;  2N9B A;  3HUS A;  1VQ7 P;  1NTM J;  2H89 C;  5AVR B;  1NTK D;  1JO5 A;  1AV1 A;  1IK7 A;  1ZR4 A;  4KHX A;  1QVG O;  2KLU A;  2IPP A;  1JM0 A;  1PGJ A;  3V5B A;  3HD7 B;  4TT3 H;  3W68 A;  2JDI H;  2Q1K A;  1HUC A;  4OGQ D;  2KK7 A;  3AE8 C;  5H2F E;  2UWJ E;  2GA1 A;  1YJN P;  3MD0 A;  4WY4 D;  1VQL P;  3WUV A;  2YIU C;  3AEB C;  2HOD A;  1LNQ A;  1J2J B;  3IR9 A;  2OYH A;  1S2E A;  2R32 A;  1YIJ P;  1SQX D;  1LTJ A;  5KLV D;  3CD6 P;  3IFM A;  1EDI A;  3M9B A;  4H44 C;  2PP6 A;  3L72 J;  3HD7 C;  4PD4 H;  1SFC A;  5AW1 B;  5CCH A;  2WSS H;  3H1H G;  1SLQ A;  1HJB A;  1FDM A;  2Y9Y A;  1VPC A;  4U3F G;  2FXO A;  1G1J A;  1MUU A;  2KIK A;  3VMY A;  1EC5 A;  2BEZ F;  3MHV A;  1DX7 A;  1T6A A;  3CL3 D;  1GZL A;  3P7K A;  1MKM A;  3KQG A;  3L71 G;  4NPD A;  1DD3 A;  2KB7 P;  5CCG A;  1J1D B;  2H7H A;  4M3L A;  3Q3D A;  1KFM A;  3H1H E;  4H13 D;  1IK9 A;  1T8Z A;  2P58 A;  2RKL A;  2J58 A;  3U59 A;  1KZU B;  1L4A B;  3SWF A;  5APU A;  1Q81 Q;  1VF5 D;  1NVO A;  3L70 J;  1T2K D;  5KLI B;  3VN0 A;  2HFE D;  2WSE J;  3L71 E;  1Q82 Q;  1HGZ A;  1VQM P;  2OAR A;  2LR2 A;  3MGN A;  4L76 A;  1ZP0 C;  2Y0E A;  3E7K A;  1M8O B;  2O01 J;  2ZYD A;  3JCU H;  4O9B A;  2OYI A;  2WPQ A;  4WB4 A;  5CCH D;  4YTP C;  5KJ7 A;  4XE5 B;  3GG2 A;  3H1I D;  1OIP A;  3QWO C;  1Q2N A;  1BCC D;  2ZFC A;  2IYP A;  1S9K D;  1J1E C;  1ZR2 A;  1SP4 A;  3K5B A;  1GW3 A;  1G1I A;  3SFD C;  3VP8 A;  2AXT H;  2E74 C;  3V2R A;  3H1H J;  2I1K A;  1K8A Q;  3L74 G;  3EQ2 A;  2ZT9 B;  5CBN A;  4U3F J;  1JUN A;  2QSI A;  1PIX A;  1FZC C;  2W6A A;  3KZI H;  1U7M A;  2K3R A;  1LP1 B;  3D6Z A;  3A0B E;  2E43 A;  5CCG D;  1A02 F;  1IC2 A;  2AEJ A;  1SQB G;  4GOE A;  2QEX P;  3H1K G;  2WSF J;  2H43 A;  1W2E A;  3B4S A;  3MP7 B;  2WTY A;  2XKM A;  1SQP K;  3OAK A;  1XTG B;  2B87 B;  1HTL C;  2L91 A;  3G6E P;  3CC7 P;  2GM4 A;  1URQ A;  1YTZ T;  3P8C D;  3U1C A;  3VMX A;  3Q1M A;  3L74 E;  1PP9 D;  3CWB D;  2ZT9 C;  1U57 A;  2SPZ A;  1L4A A;  3PLN A;  3RGU A;  3M0D A;  2IFN A;  3TGU D;  4QMA A;  4W80 A;  2JP3 A;  2IBZ E;  4PV1 B;  1SQB E;  5APX A;  4LC1 A;  3B5N D;  3CCJ P;  3UIA A;  2FXM A;  3B8E B;  1SQP E;  5C39 A;  2NPS D;  3L75 G;  5APV A;  1NTZ D;  3GLM A;  1FE6 A;  2N1T B;  1R5S A;  1IJD B;  3NFQ A;  1YJ9 P;  1HJ0 A;  3O6Q B;  2NZ2 A;  1LT9 C;  1QLE D;  2FFD C;  4HH2 A;  2Q7C A;  1R8E A;  1L0N D;  5AVV B;  2IDB A;  1FZG A;  2P2U A;  1YQ3 C;  2FYN B;  3FWN A;  3WU2 H;  3L74 J;  1T3U A;  2HR3 A;  3L75 E;  2KNC B;  1PZQ A;  4I1L A;  1PL5 A;  1FS0 E;  2E75 B;  2N1T C;  4C7N B;  5BU5 A;  3HRN A;  1QGK B;  2P1J A;  2MJZ A;  1DEE G;  1SQB J;  3H1K J;  1URQ D;  4W7Y A;  3H25 A;  1DEB A;  4Y99 B;  1KMI Z;  1L0L D;  1LT1 A;  3PJS K;  1S3J A;  3VMZ A;  4TLF A;  2G3A A;  3VYI A;  1NAF A;  1OFC X;  4D6T D;  5AW0 B;  1KYO E;  3I56 P;  1LTB C;  3BRV B;  4R4M A;  5TJH A;  3CX5 I;  1EDJ A;  3H32 B;  5GTI E;  3CX5 E;  3OJA B;  2YKQ A;  2E75 C;  4JBZ A;  1JY3 O;  4BXL A;  4OGQ C;  1SQP D;  3A0H E;  1N73 B;  3RL0 B;  2M3B A;  5GTH H;  2WPS A;  1JEK A;  4Y99 C;  2LKM A;  1VQ8 P;  2BAS A;  4GDO A;  4RO0 A;  2WSC J;  1ZXG A;  2Q6Q A;  1FZE A;  3SFE C;  2HPC B;  2W8Z A;  1BE3 E;  3JSV C;  1JTH B;  4JYB A;  2RMZ A;  2H88 C;  2YXQ B;  1AJY A;  3TNU A;  1VDF A;  5KTB A;  2IZ0 A;  3ITK A;  5CMZ A;  2PGD A;  2ZJS E;  3M9Q A;  4BRY A;  1GTW A;  2XDJ A;  2HLO A;  1OX3 A;  5B66 H;  1HH0 A;  1PPJ D;  2I8D A;  4Y28 J;  2E76 D;  3G4S P;  5AVW B;  1VF5 B;  1FDO A;  1WRG A;  2A06 G;  3O8Z A;  1ZN5 A;  1MFZ A;  5CJ4 A;  4N78 D;  2ITA A;  3Q2Y A;  4GOD A;  1CI6 B;  5APY A;  1LTA C;  2J59 M;  1KYO D;  2RH0 A;  3Q5S A;  1KB9 I;  1BGY G;  2PRR A;  1UIX A;  1VL2 A;  4K35 A;  2P67 A;  1KIL A;  4LGD E;  1KQG B;  4EDF A;  5KKZ C;  3CX5 D;  3KXD A;  2YIU B;  1S72 P;  1E79 H;  1S5L H;  3QH9 A;  1VF5 C;  2WQY C;  2E42 A;  1N73 A;  1T2K C;  1VQ4 P;  3TSI A;  2OYO A;  3H1J D;  1LTG C;  2A06 E;  2WZ7 A;  3AEA C;  5AW4 B;  3TF5 A;  3RK3 B;  4OH8 B;  5KAF E;  1Z56 A;  2D2C D;  3HE5 B;  4H44 B;  4JF7 A;  1D7M A;  1BE3 D;  3MZW B;  1VQK P;  3AE4 C;  1BGY E;  4JPZ B;  4DT0 A;  2W83 C;  3L70 G;  3TYY A;  4IFD K;  1RF0 A;  2WVR A;  1AQT A;  4BWN A;  1N2D C;  2ZAE B;  1GL2 D;  2A45 I;  1NJI Q;  1PV3 A;  3ABV C;  1NTM D;  5KAI E;  1OVV A;  2JWA A;  2XZR A;  3GF3 A;  4RES B;  1SQV D;  1M1J B;  3RK3 C;  3VOP A;  3S9O A;  2QJY C;  1Q86 Q;  1H0T A;  1JY2 O;  1KN7 A;  4KJM A;  2JWD A;  2KZI A;  3BCC G;  1FC2 C;  3L73 G;  5B5E E;  1SQQ G;  2Z4E A;  3L70 E;  3B5N B;  1KFN A;  1KIL D;  1IFP A;  4YXW H;  1CI6 A;  1AVO A;  4IL6 H;  2OTJ P;  3BRT B;  1QL1 A;  2C0W A;  3V6I A;  1KB9 D;  1N86 A;  1RF1 C;  1DD4 A;  1BGY J;  2KS1 B;  3C9I A;  4DJG A;  1M1J C;  5BVZ A;  4N6J A;  3L72 D;  2B89 A;  1JMB A;  1VQN P;  5AVZ B;  2XNX A;  4IFM A;  1RE3 C;  1X79 B;  2Y0D A;  3BCC E;  3L73 E;  2WPV B;  3B5N C;  1KOR A;  4I7Z C;  1FBM A;  3HE5 A;  1FDI A;  2NPS C;  4U3F E;  1ZRT E;  5AW2 B;  3HD7 A;  2M0B A;  2V7Q H;  4L73 A;  4NPF X;  1J1E B;  2KXP B;  4N3Y B;  1PGQ A;  2QE7 H;  4H0L D;  5M1B A;  1ZV8 A;  1FZB A;  3EFF K;  1PGO A;  1IFD A;  5GTH E;  1RH5 B;  2E74 B;  1N7S B;  1GU5 A;  3CXH H;  3HTK B;  1QL2 A;  1EXJ A;  1FZC B;  1EDL A;  4HKZ H;  4WWI A;  1GD2 E;  5AVQ B;  2Q5U A;  1SFC D; 
#chains in the Genus database with same CATH homology
 4K35 A;  4ASV A;  5CBO A;  4NPD A;  5CBN A;  2B88 A;  1JM0 A;  2R44 A;  1OVU A;  1U7M A;  2K3R A;  3S1K A;  1LP1 B;  1ZXG A;  2KS1 B;  1BDC A;  2Q1K A;  2M5A A;  4IOI H;  4GOE A;  4HB1 A;  2UWJ E;  2KUB A;  2HR3 A;  2B89 A;  2P58 A;  2RKL A;  1JMB A;  4ZMD A;  2LXB A;  1SS1 A;  3MZW B;  2B87 B;  1X0T A;  3ZDM A;  1H0T B;  5DJU B;  1MFT A;  1NVO A;  5DJT B;  1DEE G;  4MN4 C;  5K5G B;  4CPG A;  4HJG H;  1EDI A;  4EYY Q;  1EDK A;  2ZAE B;  2SPZ A;  2I8D A;  2LR2 A;  2LXC B;  3FXE A;  4ASW A;  1LT1 A;  2M0B A;  1LP1 A;  4NPF X;  1OVV A;  3RGU A;  1S3J A;  4ZNC A;  2QVA A;  1ZW0 A;  2OTK E;  1OVR A;  3FXD A;  2M5A B;  2KZJ A;  3QWO C;  1Q2N A;  4NPE A;  1BDD A;  5C39 A;  1EDJ A;  2KI7 B;  4GOF A;  2B87 A;  4GOD A;  1EDL A;  1H0T A;  1U7J A;  4HKZ H;  4WWI A;  2KIK A;  1EC5 A;  4JBZ A;  4KJM A;  2WMM A;  2JWD A;  1Y47 A;  4BXL A;  3MHV A;  2KZI A;  1FC2 C;  3PH0 A;  2QRX A;  5EFW B;  4K3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...