1OVVA

Crystal structure of four-helix bundle model di-co(ii)-df1-l13a (form ii)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQAIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords FOUR-HELIX BUNDLE MODEL di-Co(II)-DF1-L13A (form II)
publication title Response of a designed metalloprotein to changes in metal ion coordination, exogenous ligands, and active site volume determined by X-ray crystallography.
pubmed doi rcsb
total genus 22
structure length 48
sequence length 48
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1ovvA00
5CBNA 4ASVA 4BXLA 2B89A 1MFTA 1H0TA 1S3JA 5C39A 4ZNCA 2KS1B 2LXBA 4GOFA 4IOIH 2KZIA 4GOEA 4NPFX 1OVUA 2B87B 2OTKE 2LXCB 4HB1A 4ASWA 1DEEG 2I8DA 4CPGA 2UWJE 5K5GB 3FXEA 2LR2A 4NPDA 4K35A 1BDCA 2SPZA 2KIKA 4WWIA 4KJMA 5EFWB 2M5AB 4GODA 1EDIA 1EDLA 2QVAA 3QWOC 2JWDA 2HR3A 2B87A 3FXDA 5DJTB 2RKLA 1LP1B 1U7JA 3MZWB 2KUBA 1Q2NA 1BDDA 2R44A 1LT1A 1X0TA 4MN4C 4NPEA 1OVRA 1U7MA 1ZXGA 2KZJA 2Q1KA 5DJUB 1JM0A 3PH0A 2WMMA 1EDJA 5CBOA 4ZMDA 1H0TB 2M5AA 4HJGH 2B88A 1FC2C 4HKZH 1JMBA 3RGUA 4JBZA 3ZDMA 1ZW0A 4K3AA 3S1KA 1EDKA 2ZAEB 1EC5A 1OVVA 2K3RA 1LP1A 2KI7B 3MHVA 2M0BA 4EYYQ 1NVOA 2P58A 1SS1A 2QRXA 1Y47A
chains in the Genus database with same CATH superfamily
1PPJG 3IR9A 2E75B 2MJZA 2XZRA 2MKVA 1KILA 1KQSO 1HWTC 2YNYA 1RQVA 1EQ7A 5APWA 1NOHA 3R2PA 1SFCD 3HE5B 1ZOYC 1NU1J 4GOEA 2ZYDA 4YPCA 3CCUP 4H0LC 3F89A 1M1JB 2UWJE 1AQ5A 1ZR4A 2O3JA 2M3BA 2Y0DA 1SQPJ 2R5BA 5KAIE 4I1LA 1USDA 1RF1B 3USSA 4OVNF 3L70G 5BU8B 4QMAA 2J58A 2V7QH 3MUDC 1EZVE 3H1IJ 1L0NJ 1USEA 2D2CB 1S4XA 1RE4A 4AYCA 1KTMA 3RK2C 2O01H 2I1JA 3L75J 3GLMA 1ZRTE 3EWKA 1QL1A 1FZGA 1L0LJ 2KI7B 2PRRA 1X22A 1RF0C 4HH2A 3BCCJ 3H1JG 3L70E 1MKMA 3H1KJ 1JO5A 1NTKJ 1SFCC 4ASVA 4B86A 1SQQJ 2B89A 1H0TA 1S3JA 2YXRB 3AE5C 4Z1MH 2ZXEB 3BRTB 2E75D 3H1HE 3AEBC 3ITKA 2B87B 3RL0g 1GW4A 3WU2H 2FYNC 3V2PA 1HF9A 1H88A 1KFNA 1J1EC 3U1AA 2W6JH 1LT9B 2OTLP 2QJYC 3H1JE 1N8RQ 3H1KE 1W2EA 4Y28J 1VQ4P 1BE3E 5TISH 1FDMA 2QG4A 1SQQE 1KYOI 1KD1Q 2M3EA 2QVAA 1SLQA 1EXJA 4GDOA 1U7JA 4N3YB 1YYCA 1PV3A 3CCVP 4PD4H 3N4XA 3PH0A 4YXWH 3TDKA 2Z4EA 1VQ8P 2B88A 1GU4A 1OXZA 5CMZA 4JBZA 4N78E 3WU2E 2Q7CA 4JPZB 3S1KA 2XDJA 1SQVE 1HBWA 3H32A 3PLNA 5B66H 2M0BA 3RK3E 3L4FA 5TISE 2WSEH 2E75C 2QJPB 2KB7P 1KFMA 1D7MA 2Z5HA 1IO4A 1SQBK 3CCEP 3T97A 3Q5RA 1FAVA 2KS1B 2LXBA 3SWYA 3B5NA 1KILD 4IOIH 1JTHA 2KZIA 2OGUA 4BRYB 4PD4E 3AEFC 2WPQA 2SPZA 3V5BA 1FZFA 2NRGA 2Q9IA 3D71A 2HODA 1AVOA 3HUSA 1EDIA 2WITA 1YBKA 2A45G 1SQPK 5B66E 1OZHA 1WT6A 5APYA 1TU3F 4RO0A 1RE3A 5CHXA 4IFMA 3AEDC 5APVA 2XU6A 4MN4C 3IFMA 2Q6QA 2N1TB 2ZVOB 3MD0A 4A7PA 4IFDK 2W27A 5CCGC 5BVZA 2HPCA 1H8AA 2FYUD 1N73B 1K9MQ 4KT0J 2WSCH 1L0NK 2QIWA 4XFJA 3LW5J 2Y0CA 4DCKA 2ZFCA 2WWWA 3EFFK 3IN6A 1LP1A 2PAJA 3VMXA 2K9JB 1NHLA 3OAKA 1IZNB 2C0XA 2OTJP 1KILC 3L71E 3M9HA 1L0LK 1KN7A 2IZ1A 5CJ4A 1ZLLA 2OYOA 4I7ZB 3B5NB 2R32A 3GHGA 2OYHB 1BGYD 1R8EA 3OA7A 3P7KA 4YXDC 2GM4A 4KHXA 5AW1B 1SQQK 2QJKB 2JEEA 3PP5A 2DW3A 1GL2B 1HGZA 1NTMJ 1QLED 2KOGA 2BEZF 1LTSC 1L2PA 3LIDA 3CCSP 2ITAA 3O6QA 1E79H 1URQB 2NPSA 1PZQA 3B4SA 3JCUH 1MFZA 1VQ5P 2I1KA 3TNUA 4YTPC 4U3FE 1NH4A 3L72J 1SQVK 3CWBD 1LT1A 2WSFJ 3H1LD 1NJIQ 3ABVC 3OW2O 2XKMA 4LGDE 1RE4C 2KZJA 3M9QA 2G3AA 1YQ4C 1ZP0C 1EDJA 1GTWA 4HJGH 2IPPA 1XTGB 1DEBA 3W67A 5L8RJ 2A06G 4I2LC 1VQNP 3NFQA 3BATA 3L74D 1FOSF 1LTJA 3AE7C 3NTNA 2FFDA 4JF7A 3N7NA 3L73G 1EXIA 1LTGC 3G71P 4EYYQ 3CMAP 3OJAB 2L91A 3PHLA 1YI2P 4L76A 3L72E 3BASA 3JCUE 5KLIB 4ZKPA 1BGYG 1NTZJ 1RHZB 1VL2A 2A06E 5AW6B 1FE6A 3B5ND 4ASWA 3KYQA 5KLVJ 3R4YA 1S9KE 2KLVA 1IJDB 5AW9B 2POHA 2OYIB 3MP7B 3L73E 3AEGC 1OW7A 2E5YA 1JB0J 4C46A 3TGUJ 1AQTA 1KV4A 1KQLA 1GD2E 3WUUA 3KXDA 1AA0A 4UB6H 4JYBA 1JY3P 1EZVD 3GF7A 5KKZC 1JNMA 1VQ7P 2E74D 1M1JA 1J2JB 3V4WA 3VMYA 1SQPD 1X9VA 1KB9H 1Y8AA 1U7MA 2JWAA 2K37A 1RF1A 4ZKUA 1S1CX 1K8AQ 3GF3A 3L74G 1BSNA 2FFDB 1QVGO 4OGQB 3L70D 1BCCJ 3G3ZA 2KLUA 4GKGA 1SS1A 2IZ0A 1FS0E 5CBNA 2AXCA 1N7SB 1KQGB 3H1HD 3CCLP 3B5NC 4UB6E 1PP9G 1JY3N 2K88A 3PJSK 1IFNA 1NO4A 2BCCJ 2QJKC 1OVUA 5CCHA 2XNXA 1KB9E 3H1JD 1IFPA 3H1KD 3G9RA 1BE3D 4D6TJ 3LIEA 1SQQD 4PV1B 4WWIA 3HUSC 3NXSA 2FXPA 3CCJP 3CCMP 3FWLA 2E74C 1EDLA 1LTAC 3RL0B 1JCDA 2JWDA 1E5WA 2KK7A 1PP9E 2NPSD 2ZYGA 2W6BA 1EZVG 3CMEP 2B87A 1WMKA 1RE3C 3V6IA 2IBZE 2KUBA 1BDDA 1SQBE 1IFJA 1K04A 1SQPG 4EDFA 1LT9A 5KAFH 3HTKB 1NAFA 1X0TA 5AVVB 1JY2P 4H44D 4N78D 4GIFA 2YIUB 1SQVD 2E76B 3ZDMA 3EFGA 3RK3D 2Z5IA 1N2DC 1NU1E 2BASA 4R4MA 1KQFB 2WT7A 3MHVA 1L0NG 1XTCC 2KSJA 2E43A 3GW6A 3KHUA 3BVHA 2GA1A 1VQLP 2IFMA 1SQPE 1AVYA 3GHGC 5KLIC 4BXLA 3H1HG 2GUSA 1NYHA 4W7YA 1R5SA 3Q3DA 3A0BH 1PFIA 2IYPA 1RQUA 4PD4D 1L0LG 2BEQD 1NAYA 2ZT9B 2A45I 1JEKA 1FZCB 5KAFE 4RKUJ 3H1KG 1AV1A 1BE3G 1JY2N 2YXQB 5AVZB 1SQQG 3H1IE 1LWUB 1L0NE 1YQ3C 1YJNP 2NPSC 4TT3H 5KLVK 4W7ZA 2M5AB 1L4AA 4Y99C 2KS1A 3QWOC 3L75E 3E1IA 3HD7A 1CSBA 2W6AA 3H6PA 3P8CE 4BRYA 4H44C 1S72P 3FXDA 1L0LE 2V4HA 2JDIH 1M8OB 3BCCE 3RL0D 2H8PD 3RK3C 1AJYA 1NTKE 3TK1A 3A0BE 2Q1KA 3JC22 4LLHA 2JO1A 1SQVG 3Q1MA 1HJ0A 4BWNA 1LTJC 1P84H 1VQKP 2W90A 2FFDC 2WT7B 3TSIA 1PGJA 2JR8A 2AEMA 2K3RA 3VTPC 1Q90D 3L71D 1UIXA 2E76D 5APQA 2QRXA 1Y47A 1S5LH 3G6EP 2NZ2A 2G8YA 2N1TA 1N73A 2R3SA 2D2CD 2ZVNB 1NKNA 1YHQP 1WRGA 2LXCB 2HYNA 1X79B 1ZV8A 2K9JA 5K5GB 2O01N 5CCHD 1VF5B 2ZT9D 5TJHA 1L4AB 1W2BO 1P84E 3M91A 1HUCA 3MTUE 3HD7B 2OYHA 4U3FD 3SFEC 2HR3A 1M1JC 3CCRP 2YKOA 3B71A 1GL2A 1NU1K 1S5LE 3VMAA 2CK3H 3CC4P 3VOPA 1DH3A 1KZUB 1SVFA 3AE8C 1RF1C 5APTA 1LNQA 5CBOA 5AW4B 1URQA 1PIXA 2Y9ZA 1N86A 2RH0A 4L74A 1EDKA 3NMDA 1LTTC 3L72D 3L71G 3SWKA 3AEEC 1OIPA 1DX7A 3LW5H 4OH8B 1VQ6P 1J1DB 2J59M 2D2CC 3M9BA 5CJ0A 1HVVA 2GUVA 4PJ0H 1S5LX 2A06D 3A0HH 3EQ2A 1IK9A 5CCHC 1MV8A 1S9KD 2OARA 4GOFA 2ZT9C 3L73D 3M0DA 4NPFX 3S9OA 2RMZA 2KNCA 1KYOH 2YO2A 2OQQA 1JCCA 1GK6A 2KSEA 2N9YB 2QM7A 4WY4B 1W5CE 3SSUA 1NTKK 4LC1A 2C9NY 4U3FG 1VF5D 3L37A 1L4AD 4UB8H 2H88C 5KJ7D 2RKLA 1LT9C 3HD7D 3E1RA 2P10A 4H13B 5AW2B 2OYIA 2FYZA 4PJ0E 2ZYAA 3A0HE 3WUTA 1X8YA 2WSFH 2H7HA 1CI6B 3CX5D 3W68A 3V2QA 4K3AA 1JY2O 1KYOE 1EC5A 3L72G 1T2KD 4U7JA 1NTME 1RY3A 3V2NA 2FBWC 4H0LB 4GT1A 5AW0B 2K9YA 3H25A 3II6A 5AW3B 1IFDA 1FDIA 2N1TD 4UB8E 1KB9D 3C8VA 2HG5D 2KNCB 1SQXJ 2FYUJ 5B5EH 2FKWB 1EZVI 2P67A 2HFED 1G1IA 2LR2A 2QJPC 1Q86Q 1N7SA 1ZN5A 1L4AC 1FZBA 1PP9D 3VP8A 1A02F 3HD7C 2IBZD 2WQYC 1YJ9P 1SQBD 2FXMA 3RK2B 5KLVG 2ZJSE 3Q2YA 3M06A 2QEXP 1BGYJ 2YMYA 3CX5H 1SQXE 1N7LA 4C7NB 1T3JA 1GL2D 2H89C 1DD3A 1IFMA 3V2RA 1MUUA 1NU1D 1GW3A 1SFCB 1NTZE 5GTHH 3CXHH 1FZAA 2VRSA 2WPVB 5B5EE 2XV5A 3L36A 1URQD 1OVVA 1HJBA 5KLVE 3AE6C 3E7KA 2P58A 4EIJA 3G4SP 2N1TC 2FYNB 3HTKA 1DD4A 1KORA 1J1EB 3TGUE 5AW8B 1N73C 3A7OA 2QJYB 3CWBJ 3H1LJ 5AVXB 1GMJA 1VDFA 1A02J 1BCCG 1HTLC 3CX5E 3I56P 1PGOA 2KYVA 1NKZB 3IF4A 3H1ID 1VQ9P 1L0ND 1FOSE 1Q82Q 2E42A 3L74J 3PTZA 2WVRA 4I7ZC 3A2AA 3L75D 5GTHE 4RESB 2OYHC 1HGVA 3P8CD 3CXHE 4XE5B 4I6MC 4JQ0D 2IBZG 1CZQA 1L0LD 3AECC 5GTIH 1M7LA 2J5UA 4L75A 1SQBG 5AW5B 1NWQA 3BCCD 1GL2C 1BCCE 5KAIH 1FZCA 4D6TG 1NTKD 3A3YB 1YIJP 1GK4A 3CLQA 4DT0A 3AE4C 1NTMK 3L35A 3MGNA 1LWUA 1PGPA 3U1CA 1LGHB 1URQC 1NU1G 5DJUB 2M5AA 3S4RA 4HKZH 3RGUA 1OMIA 2BCCE 4M3LA 4PD4I 1NGMB 3HE4B 1NVOA 4D6TE 1G2CB 1PGQA 2K1AA 1KMIZ 2WZ7A 3D6ZA 4OWFA 1GZLA 5APXA 5GTIE 1K05A 1VQOP 2AEFA 1H89A 3D6YA 3M0DC 1M57D 1PPJE 2QSIA 2R5DA 3KQGA 4JYCA 3H1IG 2R3CA 3AEAC 2WPSA 3GG2A 1FDOA 1P84D 4OGQD 3WMM0 1UIIA 1SQXK 2IX7C 2P2UA 3L70J 3L75G 1LJ2A 2KIKA 3CL3D 2W83C 2FYUK 4HYTB 1N7SD 4TLFA 1JOCA 1T3UA 3BCCG 3Q5SA 2PP6A 1NTZK 4WB4A 1NTKG 3H1HJ 2OYIC 5APUA 2V7QJ 3U59A 1M90Q 2R44A 1FJKA 4NPEA 2O01J 1ZXGA 1JM0A 3TYYA 3H1JJ 5KJ7A 1KC8Q 1KILB 1U57A 1BE3J 4PV1D 5AVQB 1IC2A 2YKQA 2N9BA 4DOJA 3CC2P 4WBAA 1OW6A 1LTBC 1Z56A 3KZIH 4OGQC 1Q7YQ 5M1BA 3CI9A 5BU5A 4L73A 3UIAA 2IFNA 1SQVJ 2FY8A 1FU1A 2I8DA 1QVFO 1N7SC 3FXEA 1DIPA 4NPDA 4C7RA 1BDCA 4W80A 1YJWP 4GODA 1PL5A 3VMZA 2YKPA 5DJTB 1QL2A 5CCGD 4PV1C 1IK7A 4R4LA 3KZIE 5APSA 1VQMP 4IL6H 4WY4A 2QE7H 3RL0C 1H0TB 1KYOD 2P7JA 5AVUB 2O1JA 2CPSA 1FC2C 2RN0A 1NTMD 1JMBA 1ZW0A 2P1JA 3FX0A 2ZAEB 3M0AA 3C1LA 1YITP 1Y9BA 2JJLA 2YMKA 1FJPA 2WSEJ 1JY3O 2KP8A 3D70A 4IFFA 1GDTA 2A45H 2YIUC 2E76C 1CI6A 3B8EB 3Q5PA 4RJTA 2QM8A 4HB1A 3F5HA 2H43A 4IL6E 3I5CA 5KKZB 1IFIA 3L71J 5EFWB 3P8MC 1SQXD 3C9IA 1FZCC 2LKMA 3CX5I 1OX3A 3PRJA 3JSVC 3SFDC 3H32B 3SWFA 1LWUC 1YTZT 2PFXA 1Q2NA 1NTZD 4XA4A 3AE2C 1MZ9A 1OVRA 3CXHI 1FBMA 3MUDA 4ZMDA 2WSCJ 1Q81Q 1NTMG 4IL6X 3T97B 1OFCX 5KLVD 3GMAA 3AE3C 2C0WA 3CC7P 1KB9I 2W8ZA 1JTHB 1YTZI 1T6AA 2IYOA 3VN0A 3TGUD 2WSSH 4U3FJ 5AVYB 4C7NA 1RH5B 1GU5A 2AEJA 1RF0A 4DJGA 2YO3A 1MFTA 1QX8A 1M56D 1SFCA 5E79H 2HODB 3HUSB 5AVRB 4ZNCA 2O1KA 2IBZI 3VYIA 2E74B 2XNDH 3I55P 2FXOA 2OTKE 4N6JA 3CXHD 1KILE 3KPEA 1CW5A 2CPBA 4KJMA 1BCCD 2HPCB 1AFOA 1SQXG 1HH0A 2ZXXA 2QA4P 2FYUG 3AE1C 3O8ZA 3VP9A 2JP3A 1LP1B 1VF5C 3A5TA 2Y0EA 1VQPP 3BRVB 1NTZG 3L73J 5KJ7C 5E79E 3P32A 2BCCD 3IAOA 4DZOA 5H2FH 3CPWO 3GHGB 1JMMA 3FGAD 5AVTB 4WY4D 4D6TD 2WTYA 2FYUE 3TGUG 1LTIC 5AVWB 1ZMEC 1R5LA 3FWNA 2Y9YA 1QEXA 5AW7B 1T2KC 2M8RA 2AXTH 4H13D 1T8ZA 1PPJD 1M1KQ 3O6QB 2NPSB 5C39A 4AUWA 3KDPB 2JKVA 3RBZA 4Y99B 3RBXA 3TNUB 3MIWA 1K73Q 1J1DC 1BGYE 1DEEG 2Q3EA 3HE4A 3HE5A 1QGKB 4H44B 4CPGA 3CCQP 1JUNA 2IDBA 1G2CA 5H2FE 4K35A 3CWBG 3H1LG 3HRNA 2Q5UA 5AVSB 3RK3B 4H0LD 4EI2A 3CD6P 2HLOA 1ZRTD 1G1JA 3TF5A 3WUVA 2Q3IA 1OWAA 1S2EA 2KXPB 1LTJB 1OW8A 4AQRD 2L5GB 3MZWB 1VPCA 2E5TA 3V4QA 2AXTE 4WVZA 5KTBA 3K5BA 4WY4C 1SP4A 2WPRA 2BCCG 3QH9A 2WMMA 4O9BA 1BSHA 3CWBE 3H1LE 1FZEA 5CCGA 2C9LY 1PP9J 2B9BA 1ZR2A 3AE9C 4H13C 3RK2D 3L74E 4EOTA 2PGDA 1SQBJ 1P84I
chains in the Genus database with same CATH topology
5CBNA 4ASVA 4BXLA 2B89A 1MFTA 1H0TA 1S3JA 5C39A 4ZNCA 2KS1B 2LXBA 4GOFA 4IOIH 2KZIA 4GOEA 4NPFX 1OVUA 2B87B 2OTKE 2LXCB 4HB1A 4ASWA 1DEEG 2I8DA 4CPGA 2UWJE 5K5GB 3FXEA 2LR2A 4NPDA 4K35A 1BDCA 2SPZA 2KIKA 4WWIA 4KJMA 5EFWB 2M5AB 4GODA 1EDIA 1EDLA 2QVAA 3QWOC 2JWDA 2HR3A 2B87A 3FXDA 5DJTB 2RKLA 1LP1B 1U7JA 3MZWB 2KUBA 1Q2NA 1BDDA 2R44A 1LT1A 1X0TA 4MN4C 4NPEA 1OVRA 1U7MA 1ZXGA 2KZJA 2Q1KA 5DJUB 1JM0A 3PH0A 2WMMA 1EDJA 5CBOA 4ZMDA 1H0TB 2M5AA 4HJGH 2B88A 1FC2C 4HKZH 1JMBA 3RGUA 4JBZA 3ZDMA 1ZW0A 4K3AA 3S1KA 1EDKA 2ZAEB 1EC5A 1OVVA 2K3RA 1LP1A 2KI7B 3MHVA 2M0BA 4EYYQ 1NVOA 2P58A 1SS1A 2QRXA 1Y47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBN A;  4ASV A;  4BXL A;  2B89 A;  1MFT A;  1H0T A;  1S3J A;  5C39 A;  4ZNC A;  2KS1 B;  2LXB A;  4GOF A;  4IOI H;  2KZI A;  4GOE A;  4NPF X;  1OVU A;  2B87 B;  2OTK E;  2LXC B;  4HB1 A;  4ASW A;  1DEE G;  2I8D A;  4CPG A;  2UWJ E;  5K5G B;  3FXE A;  2LR2 A;  4NPD A;  4K35 A;  1BDC A;  2SPZ A;  2KIK A;  4WWI A;  4KJM A;  5EFW B;  2M5A B;  4GOD A;  1EDI A;  1EDL A;  2QVA A;  3QWO C;  2JWD A;  2HR3 A;  2B87 A;  3FXD A;  5DJT B;  2RKL A;  1LP1 B;  1U7J A;  3MZW B;  2KUB A;  1Q2N A;  1BDD A;  2R44 A;  1LT1 A;  1X0T A;  4MN4 C;  4NPE A;  1OVR A;  1U7M A;  1ZXG A;  2KZJ A;  2Q1K A;  5DJU B;  1JM0 A;  3PH0 A;  2WMM A;  1EDJ A;  5CBO A;  4ZMD A;  1H0T B;  2M5A A;  4HJG H;  2B88 A;  1FC2 C;  4HKZ H;  1JMB A;  3RGU A;  4JBZ A;  3ZDM A;  1ZW0 A;  4K3A A;  3S1K A;  1EDK A;  2ZAE B;  1EC5 A;  1OVV A;  2K3R A;  1LP1 A;  2KI7 B;  3MHV A;  2M0B A;  4EYY Q;  1NVO A;  2P58 A;  1SS1 A;  2QRX A;  1Y47 A; 
#chains in the Genus database with same CATH topology
 1PPJ G;  3IR9 A;  2E75 B;  2MJZ A;  2XZR A;  2MKV A;  1KIL A;  1KQS O;  1HWT C;  2YNY A;  1RQV A;  1EQ7 A;  5APW A;  1NOH A;  3R2P A;  1SFC D;  3HE5 B;  1ZOY C;  1NU1 J;  4GOE A;  2ZYD A;  4YPC A;  3CCU P;  4H0L C;  3F89 A;  1M1J B;  2UWJ E;  1AQ5 A;  1ZR4 A;  2O3J A;  2M3B A;  2Y0D A;  1SQP J;  2R5B A;  5KAI E;  4I1L A;  1USD A;  1RF1 B;  3USS A;  4OVN F;  3L70 G;  5BU8 B;  4QMA A;  2J58 A;  2V7Q H;  3MUD C;  1EZV E;  3H1I J;  1L0N J;  1USE A;  2D2C B;  1S4X A;  1RE4 A;  4AYC A;  1KTM A;  3RK2 C;  2O01 H;  2I1J A;  3L75 J;  3GLM A;  1ZRT E;  3EWK A;  1QL1 A;  1FZG A;  1L0L J;  2KI7 B;  2PRR A;  1X22 A;  1RF0 C;  4HH2 A;  3BCC J;  3H1J G;  3L70 E;  1MKM A;  3H1K J;  1JO5 A;  1NTK J;  1SFC C;  4ASV A;  4B86 A;  1SQQ J;  2B89 A;  1H0T A;  1S3J A;  2YXR B;  3AE5 C;  4Z1M H;  2ZXE B;  3BRT B;  2E75 D;  3H1H E;  3AEB C;  3ITK A;  2B87 B;  3RL0 g;  1GW4 A;  3WU2 H;  2FYN C;  3V2P A;  1HF9 A;  1H88 A;  1KFN A;  1J1E C;  3U1A A;  2W6J H;  1LT9 B;  2OTL P;  2QJY C;  3H1J E;  1N8R Q;  3H1K E;  1W2E A;  4Y28 J;  1VQ4 P;  1BE3 E;  5TIS H;  1FDM A;  2QG4 A;  1SQQ E;  1KYO I;  1KD1 Q;  2M3E A;  2QVA A;  1SLQ A;  1EXJ A;  4GDO A;  1U7J A;  4N3Y B;  1YYC A;  1PV3 A;  3CCV P;  4PD4 H;  3N4X A;  3PH0 A;  4YXW H;  3TDK A;  2Z4E A;  1VQ8 P;  2B88 A;  1GU4 A;  1OXZ A;  5CMZ A;  4JBZ A;  4N78 E;  3WU2 E;  2Q7C A;  4JPZ B;  3S1K A;  2XDJ A;  1SQV E;  1HBW A;  3H32 A;  3PLN A;  5B66 H;  2M0B A;  3RK3 E;  3L4F A;  5TIS E;  2WSE H;  2E75 C;  2QJP B;  2KB7 P;  1KFM A;  1D7M A;  2Z5H A;  1IO4 A;  1SQB K;  3CCE P;  3T97 A;  3Q5R A;  1FAV A;  2KS1 B;  2LXB A;  3SWY A;  3B5N A;  1KIL D;  4IOI H;  1JTH A;  2KZI A;  2OGU A;  4BRY B;  4PD4 E;  3AEF C;  2WPQ A;  2SPZ A;  3V5B A;  1FZF A;  2NRG A;  2Q9I A;  3D71 A;  2HOD A;  1AVO A;  3HUS A;  1EDI A;  2WIT A;  1YBK A;  2A45 G;  1SQP K;  5B66 E;  1OZH A;  1WT6 A;  5APY A;  1TU3 F;  4RO0 A;  1RE3 A;  5CHX A;  4IFM A;  3AED C;  5APV A;  2XU6 A;  4MN4 C;  3IFM A;  2Q6Q A;  2N1T B;  2ZVO B;  3MD0 A;  4A7P A;  4IFD K;  2W27 A;  5CCG C;  5BVZ A;  2HPC A;  1H8A A;  2FYU D;  1N73 B;  1K9M Q;  4KT0 J;  2WSC H;  1L0N K;  2QIW A;  4XFJ A;  3LW5 J;  2Y0C A;  4DCK A;  2ZFC A;  2WWW A;  3EFF K;  3IN6 A;  1LP1 A;  2PAJ A;  3VMX A;  2K9J B;  1NHL A;  3OAK A;  1IZN B;  2C0X A;  2OTJ P;  1KIL C;  3L71 E;  3M9H A;  1L0L K;  1KN7 A;  2IZ1 A;  5CJ4 A;  1ZLL A;  2OYO A;  4I7Z B;  3B5N B;  2R32 A;  3GHG A;  2OYH B;  1BGY D;  1R8E A;  3OA7 A;  3P7K A;  4YXD C;  2GM4 A;  4KHX A;  5AW1 B;  1SQQ K;  2QJK B;  2JEE A;  3PP5 A;  2DW3 A;  1GL2 B;  1HGZ A;  1NTM J;  1QLE D;  2KOG A;  2BEZ F;  1LTS C;  1L2P A;  3LID A;  3CCS P;  2ITA A;  3O6Q A;  1E79 H;  1URQ B;  2NPS A;  1PZQ A;  3B4S A;  3JCU H;  1MFZ A;  1VQ5 P;  2I1K A;  3TNU A;  4YTP C;  4U3F E;  1NH4 A;  3L72 J;  1SQV K;  3CWB D;  1LT1 A;  2WSF J;  3H1L D;  1NJI Q;  3ABV C;  3OW2 O;  2XKM A;  4LGD E;  1RE4 C;  2KZJ A;  3M9Q A;  2G3A A;  1YQ4 C;  1ZP0 C;  1EDJ A;  1GTW A;  4HJG H;  2IPP A;  1XTG B;  1DEB A;  3W67 A;  5L8R J;  2A06 G;  4I2L C;  1VQN P;  3NFQ A;  3BAT A;  3L74 D;  1FOS F;  1LTJ A;  3AE7 C;  3NTN A;  2FFD A;  4JF7 A;  3N7N A;  3L73 G;  1EXI A;  1LTG C;  3G71 P;  4EYY Q;  3CMA P;  3OJA B;  2L91 A;  3PHL A;  1YI2 P;  4L76 A;  3L72 E;  3BAS A;  3JCU E;  5KLI B;  4ZKP A;  1BGY G;  1NTZ J;  1RHZ B;  1VL2 A;  2A06 E;  5AW6 B;  1FE6 A;  3B5N D;  4ASW A;  3KYQ A;  5KLV J;  3R4Y A;  1S9K E;  2KLV A;  1IJD B;  5AW9 B;  2POH A;  2OYI B;  3MP7 B;  3L73 E;  3AEG C;  1OW7 A;  2E5Y A;  1JB0 J;  4C46 A;  3TGU J;  1AQT A;  1KV4 A;  1KQL A;  1GD2 E;  3WUU A;  3KXD A;  1AA0 A;  4UB6 H;  4JYB A;  1JY3 P;  1EZV D;  3GF7 A;  5KKZ C;  1JNM A;  1VQ7 P;  2E74 D;  1M1J A;  1J2J B;  3V4W A;  3VMY A;  1SQP D;  1X9V A;  1KB9 H;  1Y8A A;  1U7M A;  2JWA A;  2K37 A;  1RF1 A;  4ZKU A;  1S1C X;  1K8A Q;  3GF3 A;  3L74 G;  1BSN A;  2FFD B;  1QVG O;  4OGQ B;  3L70 D;  1BCC J;  3G3Z A;  2KLU A;  4GKG A;  1SS1 A;  2IZ0 A;  1FS0 E;  5CBN A;  2AXC A;  1N7S B;  1KQG B;  3H1H D;  3CCL P;  3B5N C;  4UB6 E;  1PP9 G;  1JY3 N;  2K88 A;  3PJS K;  1IFN A;  1NO4 A;  2BCC J;  2QJK C;  1OVU A;  5CCH A;  2XNX A;  1KB9 E;  3H1J D;  1IFP A;  3H1K D;  3G9R A;  1BE3 D;  4D6T J;  3LIE A;  1SQQ D;  4PV1 B;  4WWI A;  3HUS C;  3NXS A;  2FXP A;  3CCJ P;  3CCM P;  3FWL A;  2E74 C;  1EDL A;  1LTA C;  3RL0 B;  1JCD A;  2JWD A;  1E5W A;  2KK7 A;  1PP9 E;  2NPS D;  2ZYG A;  2W6B A;  1EZV G;  3CME P;  2B87 A;  1WMK A;  1RE3 C;  3V6I A;  2IBZ E;  2KUB A;  1BDD A;  1SQB E;  1IFJ A;  1K04 A;  1SQP G;  4EDF A;  1LT9 A;  5KAF H;  3HTK B;  1NAF A;  1X0T A;  5AVV B;  1JY2 P;  4H44 D;  4N78 D;  4GIF A;  2YIU B;  1SQV D;  2E76 B;  3ZDM A;  3EFG A;  3RK3 D;  2Z5I A;  1N2D C;  1NU1 E;  2BAS A;  4R4M A;  1KQF B;  2WT7 A;  3MHV A;  1L0N G;  1XTC C;  2KSJ A;  2E43 A;  3GW6 A;  3KHU A;  3BVH A;  2GA1 A;  1VQL P;  2IFM A;  1SQP E;  1AVY A;  3GHG C;  5KLI C;  4BXL A;  3H1H G;  2GUS A;  1NYH A;  4W7Y A;  1R5S A;  3Q3D A;  3A0B H;  1PFI A;  2IYP A;  1RQU A;  4PD4 D;  1L0L G;  2BEQ D;  1NAY A;  2ZT9 B;  2A45 I;  1JEK A;  1FZC B;  5KAF E;  4RKU J;  3H1K G;  1AV1 A;  1BE3 G;  1JY2 N;  2YXQ B;  5AVZ B;  1SQQ G;  3H1I E;  1LWU B;  1L0N E;  1YQ3 C;  1YJN P;  2NPS C;  4TT3 H;  5KLV K;  4W7Z A;  2M5A B;  1L4A A;  4Y99 C;  2KS1 A;  3QWO C;  3L75 E;  3E1I A;  3HD7 A;  1CSB A;  2W6A A;  3H6P A;  3P8C E;  4BRY A;  4H44 C;  1S72 P;  3FXD A;  1L0L E;  2V4H A;  2JDI H;  1M8O B;  3BCC E;  3RL0 D;  2H8P D;  3RK3 C;  1AJY A;  1NTK E;  3TK1 A;  3A0B E;  2Q1K A;  3JC2 2;  4LLH A;  2JO1 A;  1SQV G;  3Q1M A;  1HJ0 A;  4BWN A;  1LTJ C;  1P84 H;  1VQK P;  2W90 A;  2FFD C;  2WT7 B;  3TSI A;  1PGJ A;  2JR8 A;  2AEM A;  2K3R A;  3VTP C;  1Q90 D;  3L71 D;  1UIX A;  2E76 D;  5APQ A;  2QRX A;  1Y47 A;  1S5L H;  3G6E P;  2NZ2 A;  2G8Y A;  2N1T A;  1N73 A;  2R3S A;  2D2C D;  2ZVN B;  1NKN A;  1YHQ P;  1WRG A;  2LXC B;  2HYN A;  1X79 B;  1ZV8 A;  2K9J A;  5K5G B;  2O01 N;  5CCH D;  1VF5 B;  2ZT9 D;  5TJH A;  1L4A B;  1W2B O;  1P84 E;  3M91 A;  1HUC A;  3MTU E;  3HD7 B;  2OYH A;  4U3F D;  3SFE C;  2HR3 A;  1M1J C;  3CCR P;  2YKO A;  3B71 A;  1GL2 A;  1NU1 K;  1S5L E;  3VMA A;  2CK3 H;  3CC4 P;  3VOP A;  1DH3 A;  1KZU B;  1SVF A;  3AE8 C;  1RF1 C;  5APT A;  1LNQ A;  5CBO A;  5AW4 B;  1URQ A;  1PIX A;  2Y9Z A;  1N86 A;  2RH0 A;  4L74 A;  1EDK A;  3NMD A;  1LTT C;  3L72 D;  3L71 G;  3SWK A;  3AEE C;  1OIP A;  1DX7 A;  3LW5 H;  4OH8 B;  1VQ6 P;  1J1D B;  2J59 M;  2D2C C;  3M9B A;  5CJ0 A;  1HVV A;  2GUV A;  4PJ0 H;  1S5L X;  2A06 D;  3A0H H;  3EQ2 A;  1IK9 A;  5CCH C;  1MV8 A;  1S9K D;  2OAR A;  4GOF A;  2ZT9 C;  3L73 D;  3M0D A;  4NPF X;  3S9O A;  2RMZ A;  2KNC A;  1KYO H;  2YO2 A;  2OQQ A;  1JCC A;  1GK6 A;  2KSE A;  2N9Y B;  2QM7 A;  4WY4 B;  1W5C E;  3SSU A;  1NTK K;  4LC1 A;  2C9N Y;  4U3F G;  1VF5 D;  3L37 A;  1L4A D;  4UB8 H;  2H88 C;  5KJ7 D;  2RKL A;  1LT9 C;  3HD7 D;  3E1R A;  2P10 A;  4H13 B;  5AW2 B;  2OYI A;  2FYZ A;  4PJ0 E;  2ZYA A;  3A0H E;  3WUT A;  1X8Y A;  2WSF H;  2H7H A;  1CI6 B;  3CX5 D;  3W68 A;  3V2Q A;  4K3A A;  1JY2 O;  1KYO E;  1EC5 A;  3L72 G;  1T2K D;  4U7J A;  1NTM E;  1RY3 A;  3V2N A;  2FBW C;  4H0L B;  4GT1 A;  5AW0 B;  2K9Y A;  3H25 A;  3II6 A;  5AW3 B;  1IFD A;  1FDI A;  2N1T D;  4UB8 E;  1KB9 D;  3C8V A;  2HG5 D;  2KNC B;  1SQX J;  2FYU J;  5B5E H;  2FKW B;  1EZV I;  2P67 A;  2HFE D;  1G1I A;  2LR2 A;  2QJP C;  1Q86 Q;  1N7S A;  1ZN5 A;  1L4A C;  1FZB A;  1PP9 D;  3VP8 A;  1A02 F;  3HD7 C;  2IBZ D;  2WQY C;  1YJ9 P;  1SQB D;  2FXM A;  3RK2 B;  5KLV G;  2ZJS E;  3Q2Y A;  3M06 A;  2QEX P;  1BGY J;  2YMY A;  3CX5 H;  1SQX E;  1N7L A;  4C7N B;  1T3J A;  1GL2 D;  2H89 C;  1DD3 A;  1IFM A;  3V2R A;  1MUU A;  1NU1 D;  1GW3 A;  1SFC B;  1NTZ E;  5GTH H;  3CXH H;  1FZA A;  2VRS A;  2WPV B;  5B5E E;  2XV5 A;  3L36 A;  1URQ D;  1OVV A;  1HJB A;  5KLV E;  3AE6 C;  3E7K A;  2P58 A;  4EIJ A;  3G4S P;  2N1T C;  2FYN B;  3HTK A;  1DD4 A;  1KOR A;  1J1E B;  3TGU E;  5AW8 B;  1N73 C;  3A7O A;  2QJY B;  3CWB J;  3H1L J;  5AVX B;  1GMJ A;  1VDF A;  1A02 J;  1BCC G;  1HTL C;  3CX5 E;  3I56 P;  1PGO A;  2KYV A;  1NKZ B;  3IF4 A;  3H1I D;  1VQ9 P;  1L0N D;  1FOS E;  1Q82 Q;  2E42 A;  3L74 J;  3PTZ A;  2WVR A;  4I7Z C;  3A2A A;  3L75 D;  5GTH E;  4RES B;  2OYH C;  1HGV A;  3P8C D;  3CXH E;  4XE5 B;  4I6M C;  4JQ0 D;  2IBZ G;  1CZQ A;  1L0L D;  3AEC C;  5GTI H;  1M7L A;  2J5U A;  4L75 A;  1SQB G;  5AW5 B;  1NWQ A;  3BCC D;  1GL2 C;  1BCC E;  5KAI H;  1FZC A;  4D6T G;  1NTK D;  3A3Y B;  1YIJ P;  1GK4 A;  3CLQ A;  4DT0 A;  3AE4 C;  1NTM K;  3L35 A;  3MGN A;  1LWU A;  1PGP A;  3U1C A;  1LGH B;  1URQ C;  1NU1 G;  5DJU B;  2M5A A;  3S4R A;  4HKZ H;  3RGU A;  1OMI A;  2BCC E;  4M3L A;  4PD4 I;  1NGM B;  3HE4 B;  1NVO A;  4D6T E;  1G2C B;  1PGQ A;  2K1A A;  1KMI Z;  2WZ7 A;  3D6Z A;  4OWF A;  1GZL A;  5APX A;  5GTI E;  1K05 A;  1VQO P;  2AEF A;  1H89 A;  3D6Y A;  3M0D C;  1M57 D;  1PPJ E;  2QSI A;  2R5D A;  3KQG A;  4JYC A;  3H1I G;  2R3C A;  3AEA C;  2WPS A;  3GG2 A;  1FDO A;  1P84 D;  4OGQ D;  3WMM 0;  1UII A;  1SQX K;  2IX7 C;  2P2U A;  3L70 J;  3L75 G;  1LJ2 A;  2KIK A;  3CL3 D;  2W83 C;  2FYU K;  4HYT B;  1N7S D;  4TLF A;  1JOC A;  1T3U A;  3BCC G;  3Q5S A;  2PP6 A;  1NTZ K;  4WB4 A;  1NTK G;  3H1H J;  2OYI C;  5APU A;  2V7Q J;  3U59 A;  1M90 Q;  2R44 A;  1FJK A;  4NPE A;  2O01 J;  1ZXG A;  1JM0 A;  3TYY A;  3H1J J;  5KJ7 A;  1KC8 Q;  1KIL B;  1U57 A;  1BE3 J;  4PV1 D;  5AVQ B;  1IC2 A;  2YKQ A;  2N9B A;  4DOJ A;  3CC2 P;  4WBA A;  1OW6 A;  1LTB C;  1Z56 A;  3KZI H;  4OGQ C;  1Q7Y Q;  5M1B A;  3CI9 A;  5BU5 A;  4L73 A;  3UIA A;  2IFN A;  1SQV J;  2FY8 A;  1FU1 A;  2I8D A;  1QVF O;  1N7S C;  3FXE A;  1DIP A;  4NPD A;  4C7R A;  1BDC A;  4W80 A;  1YJW P;  4GOD A;  1PL5 A;  3VMZ A;  2YKP A;  5DJT B;  1QL2 A;  5CCG D;  4PV1 C;  1IK7 A;  4R4L A;  3KZI E;  5APS A;  1VQM P;  4IL6 H;  4WY4 A;  2QE7 H;  3RL0 C;  1H0T B;  1KYO D;  2P7J A;  5AVU B;  2O1J A;  2CPS A;  1FC2 C;  2RN0 A;  1NTM D;  1JMB A;  1ZW0 A;  2P1J A;  3FX0 A;  2ZAE B;  3M0A A;  3C1L A;  1YIT P;  1Y9B A;  2JJL A;  2YMK A;  1FJP A;  2WSE J;  1JY3 O;  2KP8 A;  3D70 A;  4IFF A;  1GDT A;  2A45 H;  2YIU C;  2E76 C;  1CI6 A;  3B8E B;  3Q5P A;  4RJT A;  2QM8 A;  4HB1 A;  3F5H A;  2H43 A;  4IL6 E;  3I5C A;  5KKZ B;  1IFI A;  3L71 J;  5EFW B;  3P8M C;  1SQX D;  3C9I A;  1FZC C;  2LKM A;  3CX5 I;  1OX3 A;  3PRJ A;  3JSV C;  3SFD C;  3H32 B;  3SWF A;  1LWU C;  1YTZ T;  2PFX A;  1Q2N A;  1NTZ D;  4XA4 A;  3AE2 C;  1MZ9 A;  1OVR A;  3CXH I;  1FBM A;  3MUD A;  4ZMD A;  2WSC J;  1Q81 Q;  1NTM G;  4IL6 X;  3T97 B;  1OFC X;  5KLV D;  3GMA A;  3AE3 C;  2C0W A;  3CC7 P;  1KB9 I;  2W8Z A;  1JTH B;  1YTZ I;  1T6A A;  2IYO A;  3VN0 A;  3TGU D;  2WSS H;  4U3F J;  5AVY B;  4C7N A;  1RH5 B;  1GU5 A;  2AEJ A;  1RF0 A;  4DJG A;  2YO3 A;  1MFT A;  1QX8 A;  1M56 D;  1SFC A;  5E79 H;  2HOD B;  3HUS B;  5AVR B;  4ZNC A;  2O1K A;  2IBZ I;  3VYI A;  2E74 B;  2XND H;  3I55 P;  2FXO A;  2OTK E;  4N6J A;  3CXH D;  1KIL E;  3KPE A;  1CW5 A;  2CPB A;  4KJM A;  1BCC D;  2HPC B;  1AFO A;  1SQX G;  1HH0 A;  2ZXX A;  2QA4 P;  2FYU G;  3AE1 C;  3O8Z A;  3VP9 A;  2JP3 A;  1LP1 B;  1VF5 C;  3A5T A;  2Y0E A;  1VQP P;  3BRV B;  1NTZ G;  3L73 J;  5KJ7 C;  5E79 E;  3P32 A;  2BCC D;  3IAO A;  4DZO A;  5H2F H;  3CPW O;  3GHG B;  1JMM A;  3FGA D;  5AVT B;  4WY4 D;  4D6T D;  2WTY A;  2FYU E;  3TGU G;  1LTI C;  5AVW B;  1ZME C;  1R5L A;  3FWN A;  2Y9Y A;  1QEX A;  5AW7 B;  1T2K C;  2M8R A;  2AXT H;  4H13 D;  1T8Z A;  1PPJ D;  1M1K Q;  3O6Q B;  2NPS B;  5C39 A;  4AUW A;  3KDP B;  2JKV A;  3RBZ A;  4Y99 B;  3RBX A;  3TNU B;  3MIW A;  1K73 Q;  1J1D C;  1BGY E;  1DEE G;  2Q3E A;  3HE4 A;  3HE5 A;  1QGK B;  4H44 B;  4CPG A;  3CCQ P;  1JUN A;  2IDB A;  1G2C A;  5H2F E;  4K35 A;  3CWB G;  3H1L G;  3HRN A;  2Q5U A;  5AVS B;  3RK3 B;  4H0L D;  4EI2 A;  3CD6 P;  2HLO A;  1ZRT D;  1G1J A;  3TF5 A;  3WUV A;  2Q3I A;  1OWA A;  1S2E A;  2KXP B;  1LTJ B;  1OW8 A;  4AQR D;  2L5G B;  3MZW B;  1VPC A;  2E5T A;  3V4Q A;  2AXT E;  4WVZ A;  5KTB A;  3K5B A;  4WY4 C;  1SP4 A;  2WPR A;  2BCC G;  3QH9 A;  2WMM A;  4O9B A;  1BSH A;  3CWB E;  3H1L E;  1FZE A;  5CCG A;  2C9L Y;  1PP9 J;  2B9B A;  1ZR2 A;  3AE9 C;  4H13 C;  3RK2 D;  3L74 E;  4EOT A;  2PGD A;  1SQB J;  1P84 I; 
#chains in the Genus database with same CATH homology
 5CBN A;  4ASV A;  4BXL A;  2B89 A;  1MFT A;  1H0T A;  1S3J A;  5C39 A;  4ZNC A;  2KS1 B;  2LXB A;  4GOF A;  4IOI H;  2KZI A;  4GOE A;  4NPF X;  1OVU A;  2B87 B;  2OTK E;  2LXC B;  4HB1 A;  4ASW A;  1DEE G;  2I8D A;  4CPG A;  2UWJ E;  5K5G B;  3FXE A;  2LR2 A;  4NPD A;  4K35 A;  1BDC A;  2SPZ A;  2KIK A;  4WWI A;  4KJM A;  5EFW B;  2M5A B;  4GOD A;  1EDI A;  1EDL A;  2QVA A;  3QWO C;  2JWD A;  2HR3 A;  2B87 A;  3FXD A;  5DJT B;  2RKL A;  1LP1 B;  1U7J A;  3MZW B;  2KUB A;  1Q2N A;  1BDD A;  2R44 A;  1LT1 A;  1X0T A;  4MN4 C;  4NPE A;  1OVR A;  1U7M A;  1ZXG A;  2KZJ A;  2Q1K A;  5DJU B;  1JM0 A;  3PH0 A;  2WMM A;  1EDJ A;  5CBO A;  4ZMD A;  1H0T B;  2M5A A;  4HJG H;  2B88 A;  1FC2 C;  4HKZ H;  1JMB A;  3RGU A;  4JBZ A;  3ZDM A;  1ZW0 A;  4K3A A;  3S1K A;  1EDK A;  2ZAE B;  1EC5 A;  1OVV A;  2K3R A;  1LP1 A;  2KI7 B;  3MHV A;  2M0B A;  4EYY Q;  1NVO A;  2P58 A;  1SS1 A;  2QRX A;  1Y47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...