1OVVA

Crystal structure of four-helix bundle model di-co(ii)-df1-l13a (form ii)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
48
structure length
48
Chain Sequence
b'DYLRELLKLELQAIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FOUR-HELIX BUNDLE MODEL di-Co(II)-DF1-L13A (form II)
publication title Response of a designed metalloprotein to changes in metal ion coordination, exogenous ligands, and active site volume determined by X-ray crystallography.
pubmed doi rcsb
molecule tags De novo protein
total genus 22
structure length 48
sequence length 48
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1ovvA00
1EDKA 3RGUA 4ZMDA 3ZDMA 4ASVA 1BDDA 3FXEA 2WMMA 2B87A 1Q2NA 4K35A 1EDLA 4ASWA 2LR2A 4WWIA 1SS1A 2M0BA 1LT1A 2QVAA 5DJUB 5CBOA 3PH0A 5K5GB 2KI7B 4ZNCA 5EFWB 5CBNA 1FC2C 2M5AB 1LP1B 4GOEA 1U7JA 2KIKA 1JMBA 5C39A 4EYYQ 4NPEA 4IOIH 4NPFX 3FXDA 2UWJE 3MZWB 4K3AA 1X0TA 1DEEG 2M5AA 1MFTA 2I8DA 1LP1A 2P58A 4BXLA 2RKLA 3MHVA 1NVOA 4HB1A 2KZIA 3S1KA 4HJGH 4CPGA 2QRXA 1S3JA 2OTKE 4KJMA 2Q1KA 4GODA 4HKZH 1BDCA 1EC5A 4MN4C 4JBZA 2B89A 2ZAEB 5DJTB 2HR3A 2B88A 2KUBA 1JM0A 2KS1B 1H0TB 2LXCB 1OVUA 1ZW0A 1ZXGA 2K3RA 1EDJA 1OVRA 2R44A 1EDIA 2JWDA 2KZJA 2B87B 1Y47A 2SPZA 1OVVA 3QWOC 1U7MA 4NPDA 4GOFA 2LXBA 1H0TA
chains in the Genus database with same CATH superfamily
1H8AA 1RY3A 4U3FE 1YJWP 1IJDB 2YKQA 1SQVD 4LC1A 2Z5IA 2KP8A 5AVXB 1BGYE 2XV5A 3R2PA 2VRSA 3CWBG 4BRYB 2CPSA 1NTKD 5BU5A 1GL2D 2FYNC 2QJPC 1T2KD 1N7SD 4I6MC 4ZNCA 4IFFA 2JO1A 5EFWB 1FAVA 3GLMA 3W68A 2R32A 5KLIB 4L76A 3EQ2A 4PV1B 3UIAA 1L4AA 1IC2A 1IFJA 1KB9E 1KILC 3M91A 1WMKA 1T8ZA 2FYUJ 2H89C 3II6A 3G3ZA 4L73A 2RKLA 2WZ7A 1JCDA 4H44D 2QM7A 2XNDH 3B71A 1QEXA 2W83C 2QRXA 1VQ9P 3BATA 3L75G 2NPSB 2FXOA 1OX3A 1YQ4C 4EIJA 5TISE 2NZ2A 1E79H 4H0LD 1GL2A 1SFCC 3H1JE 1N7SA 1OVUA 1ZW0A 2ZJSE 3MUDC 1S1CX 1J1EC 3O6QA 3H1KE 2FYZA 3KDPB 1KN7A 1Y8AA 2IYPA 2YXQB 4ASVA 2YNYA 3VMXA 1SQBD 1IFNA 3TK1A 1KFMA 3HTKB 1EDLA 4EDFA 3USSA 2R5DA 3H1LG 2V7QH 5K5GB 1M1JC 4PJ0E 1WRGA 1JTHA 3TNUB 2JJLA 1P84E 5CCGC 1SQQK 3WU2E 2XNXA 1RHZB 4R4MA 1SQVE 3GHGB 3V5BA 3H6PA 2ZT9B 1S9KD 2ZFCA 5AW6B 2C9NY 4HB1A 1AQ5A 1LT9C 1L0NE 2IX7C 2MJZA 4W7ZA 1OW7A 2FYUG 2E76D 2WSSH 2BCCG 4HKZH 3P8CE 5AVWB 2OTLP 3CCSP 1ZOYC 1J1DC 3TGUJ 3BCCD 1MV8A 5KLVD 2LXCB 2K3RA 1OVRA 1TU3F 5AVUB 1SQQJ 1OW8A 1NH4A 1DIPA 4WY4B 2E75C 1OXZA 2Y0DA 2JR8A 1GK6A 1NU1D 5AW8B 1FZCB 1HBWA 1EZVD 5AVRB 2IZ1A 1NTZE 2BEZF 2N1TD 3AEBC 4LLHA 3RK2C 3D6YA 4GT1A 2WSFH 2KLUA 4W7YA 3JCUH 2R3CA 2Q3IA 5APTA 3V2RA 1X22A 5E79E 5TJHA 2QJKC 2KI7B 2OYHC 1VQKP 4B86A 4KT0J 1CSBA 5AW2B 1YBKA 1K9MQ 1KB9H 4ZKUA 1HGZA 1R5SA 1Q7YQ 1LTAC 1AVOA 4DCKA 2UWJE 1QVFO 1LWUA 3CD6P 3H1HE 1SQBE 3CMEP 1FS0E 1GZLA 3IAOA 1NYHA 1VQ4P 1FJPA 1VQNP 2N1TA 1SVFA 5TISH 1BDCA 2XZRA 1HGVA 1L4AC 2IFMA 1BCCE 5KJ7C 2D2CD 2IBZD 3D70A 3L72E 1KQFB 2HFED 1H0TA 3IN6A 2KNCB 1SFCD 1PGPA 2H43A 3L71D 3ITKA 4PD4E 2IFNA 3TGUG 2RMZA 5APUA 1JCCA 1FZGA 1XTCC 1SQQG 1KQGB 4ASWA 1FZAA 1FOSE 2A06E 4C7NA 3VYIA 1Q90D 4EI2A 1EZVI 3L74J 1IFDA 2QVAA 3PJSK 1GL2C 3HUSB 3BCCE 3RL0B 3SWYA 5KLVE 3W67A 1T2KC 1N7SC 2M5AB 1P84H 1GDTA 1RE3A 1JMBA 3SSUA 1BSNA 1Q86Q 5KAIE 1LJ2A 3RK3E 2KYVA 1NU1E 3M0DC 5CHXA 4IFDK 3L37A 1HJ0A 2OARA 1SQPD 3C1LA 1GU5A 2N9YB 4WBAA 2QJYB 3CCRP 3AE9C 1JUNA 2QEXP 4H44C 3N7NA 1G2CA 4GODA 1NO4A 1HVVA 2W8ZA 4JF7A 5APWA 2HODB 5M1BA 4YPCA 1RF1B 4U3FD 2OGUA 3CCMP 1CI6A 4IL6E 1EDJA 4H0LC 3L36A 1BGYD 1VQ6P 4U3FJ 1S2EA 1YITP 3HE4B 1BGYJ 1RQUA 4YXDC 4UB8E 4WVZA 2IBZI 3Q1MA 3B5ND 3H1IE 1K04A 2FY8A 3A3YB 3ABVC 3GW6A 4GIFA 1L0LK 3KYQA 3CXHE 4JPZB 1GTWA 1URQD 3O8ZA 3L4FA 1KB9D 1SQXK 1N73A 2PAJA 5CBOA 3PTZA 2V4HA 3SWFA 2WT7B 1BSHA 5CBNA 1DD3A 5GTIH 2O01J 5APXA 4GOEA 3L70D 2E43A 4EYYQ 2KLVA 2AXTH 1ZV8A 5AW4B 3PHLA 4NPFX 1DD4A 3L74G 1IZNB 2WSCH 2JDIH 4OGQD 1L0LJ 2QJPB 3RL0g 1NJIQ 1VQLP 3H1JD 3B5NA 1NAYA 1SQXJ 2W6JH 4KHXA 4RKUJ 1NWQA 4D6TD 2AEFA 2WITA 1W2EA 1Q82Q 5KKZC 1URQA 4AQRD 1KILB 1PP9D 2E76C 1D7MA 3PP5A 2QE7H 2K88A 3MTUE 3KHUA 3U1CA 1ZXGA 3H1KJ 2O1JA 4RO0A 3JSVC 2ZYGA 1YJNP 2GM4A 1LWUC 4PD4H 1T3JA 1BDDA 5KJ7D 2B87A 5APSA 3RK3C 1NTKK 3CC7P 2L5GB 3TSIA 1PIXA 1JO5A 2M3BA 4U3FG 1SFCB 1P84D 2NRGA 2N1TC 5CCHD 2FYUK 1J1EB 1BGYG 1KB9I 4AUWA 1NKNA 2ZVNB 1L2PA 1LP1B 3M0AA 2AEJA 1VQ5P 2K9JB 2RN0A 1YHQP 3G9RA 1SQVJ 1WT6A 1L0ND 5KAIH 3FXDA 4K3AA 2OYIC 3AE8C 2OYOA 1RQVA 3JCUE 1R8EA 2FXMA 1L0NJ 3P8CD 1KFNA 2ZXEB 1NTKJ 1M56D 1M1JB 3L73D 1NGMB 5KJ7A 2LKMA 1G1JA 1QL1A 4WB4A 5APVA 1NTMD 4Y99C 5CCHA 2PGDA 3L70E 3CCJP 1L0LG 2IDBA 4IL6H 4JYCA 3A0BH 2Y9ZA 1RE3C 2ITAA 2KZJA 1SQXG 2AEMA 2SPZA 3OAKA 1NTZD 4OWFA 3E1RA 2D2CC 2LXBA 1LT9B 3AECC 4UB8H 2XKMA 1X8YA 1N8RQ 2FFDC 2JWAA 3H1KG 3CXHH 1RH5B 4D6TE 4K35A 5B66H 1J1DB 2HPCA 1FE6A 2PFXA 1PP9E 1A02F 2WSEH 1M8OB 3C9IA 1SLQA 1P84I 3TYYA 2O01N 3BRTB 3M0DA 1LGHB 3H1HD 2E75B 2YIUC 3LW5H 1U7JA 1PZQA 1SQBJ 2M3EA 1K8AQ 1ZRTD 1QVGO 4C46A 1OMIA 3HE5A 3RK2B 3D71A 2QA4P 2P10A 1NVOA 3CPWO 5BVZA 2QJKB 1JNMA 2B9BA 2OYHB 2O3JA 3NTNA 1BCCD 1SQVG 2A45I 3H32B 2OTKE 1N73C 2WQYC 1MZ9A 1VQ8P 5AW0B 3VMYA 3WUUA 3G71P 1EC5A 1MKMA 1BCCJ 3L72D 4DT0A 1L0NG 3IR9A 1NTKG 4PD4D 1FBMA 1UIIA 3L72J 2KSEA 3OA7A 3V6IA 2WPRA 2RH0A 4NPDA 2A06D 3RGUA 3AE5C 2ZYAA 1OZHA 3WMM0 2YO2A 4XE5B 3L73E 1IFMA 4C7RA 3B5NC 1PPJD 1Z56A 2WPQA 1M90Q 1NHLA 2P2UA 3AEGC 1L4AB 1URQC 3BCCJ 5KLVJ 1NTME 3C8VA 4H13D 2FYUE 1IO4A 3RK3D 2YXRB 2BCCE 1JMMA 2J59M 2HG5D 5AW7B 1NU1J 1X0TA 1A02J 3KXDA 5AVQB 3T97A 3Q5SA 1OIPA 3KZIE 4IL6X 5GTIE 2ZXXA 4OGQC 1GL2B 1SQBG 2GUVA 1N7SB 2AXTE 3U59A 2E5TA 2QIWA 1IFIA 3O6QB 2E42A 4JQ0D 3CCLP 1E5WA 3H1ID 2W6AA 5H2FH 1PFIA 3RBZA 3CXHD 4PD4I 2KXPB 3V4WA 1ZRTE 1KTMA 1AJYA 1LTJA 4H44B 4W80A 1JY3O 2E74D 1M57D 3GF3A 3L72G 2QG4A 2JP3A 1JTHB 1FZEA 2P1JA 4H0LB 2ZYDA 2QM8A 2OYIA 3CCVP 3FX0A 4I7ZC 5CCHC 2XU6A 2FXPA 4L74A 3L35A 1KMIZ 3L71J 1YTZT 2V7QJ 2BASA 1VF5D 3HD7D 1VL2A 3BCCG 5KLVG 1SQPK 1KYOH 2I1KA 2I1JA 3M06A 1HH0A 1PPJE 2KOGA 2G8YA 1NU1G 3CX5H 1S3JA 3VP9A 1SQQE 1VQMP 1EZVG 5DJTB 1BE3D 5AVZB 1RE4A 2BEQD 1HUCA 2FFDA 3E7KA 4IFMA 3MD0A 2FKWB 1YIJP 4PV1D 3CI9A 1SQPJ 3P7KA 2KS1A 2Q3EA 3NFQA 3CXHI 3HD7A 5KTBA 1T3UA 3EWKA 5KKZB 1LTIC 1OWAA 2E76B 3A0BE 1JY2P 5AW1B 4WWIA 2W6BA 3K5BA 3PH0A 1KQLA 2NPSD 4BRYA 3SFDC 1LWUB 3MIWA 4OVNF 2WSFJ 1U57A 5B66E 1KZUB 1GMJA 2YMKA 1H89A 5AW9B 3AE4C 3G4SP 2J5UA 1H88A 2N1TB 2IBZG 3KZIH 5AW5B 1QGKB 3L71G 3HUSC 2JKVA 3OJAB 2Z4EA 1ZLLA 3L70J 2M8RA 2L91A 1EXJA 2OYIB 2KUBA 1H0TB 2POHA 2FYNB 3JC22 2NPSA 1GK4A 3V2PA 3HRNA 1CW5A 1U7MA 3IF4A 1IK9A 3CL3D 1GD2E 3H1JJ 3A0HE 3ZDMA 4C7NB 1VDFA 3V2QA 4D6TJ 3FXEA 3L75D 3F5HA 4YXWH 1PP9J 2ZT9D 1QLED 4I2LC 4U7JA 4Y99B 1JEKA 1SQPG 1SQVK 2MKVA 1JOCA 3GF7A 1BE3E 3HTKA 1KYOD 3VOPA 2GA1A 1L0NK 2D2CB 4H13C 3N4XA 2YO3A 2O1KA 5C39A 2Q9IA 1OFCX 3AE2C 2CPBA 3CX5D 1LTJC 1MFTA 3TNUA 3NMDA 1G2CB 4WY4D 1IK7A 4Y28J 2AXCA 1VQ7P 3H1LD 2KZIA 1HF9A 1W2BO 3AE6C 1YI2P 3GHGA 1CI6B 2YIUB 4DZOA 1VQOP 1S5LH 1NTZK 2HYNA 3FWNA 2R44A 2Y0CA 1DX7A 1ZR2A 2GUSA 1AFOA 4EOTA 3SWKA 4UB6H 3QWOC 1G1IA 3I5CA 3L70G 1VPCA 3L73J 1PGOA 3CWBE 2KSJA 1N73B 1K05A 2FYUD 1FOSF 3TF5A 2BCCD 4WY4A 3CCUP 1GW3A 5H2FE 3V4QA 2E74C 1NTMJ 1Y9BA 2IPPA 1SS1A 2BCCJ 1SQBK 2H8PD 2E5YA 2FBWC 2ZVOB 5DJUB 5B5EH 3H1JG 1FZCA 1EXIA 4XA4A 4D6TG 3P8MC 1JY2N 1RE4C 3VN0A 1NTZJ 1PP9G 1KYOI 1KV4A 1FDOA 3AE1C 4NPEA 1L0LE 3MGNA 4IOIH 4HH2A 2WTYA 3B5NB 1FDMA 1SQXE 1VF5C 3HD7C 3S9OA 3L75E 3CX5I 1URQB 4ZKPA 2Q7CA 1HTLC 2QSIA 3H1HJ 3CMAP 2Q1KA 2WSCJ 5KAFH 4JYBA 1KYOE 1MUUA 3BASA 3RL0D 1EDIA 3AE7C 2JWDA 2B87B 1OVVA 3CX5E 5KLIC 4OGQB 2K1AA 4PV1C 3A0HH 5KLVK 4ZMDA 2IYOA 1LTBC 1X79B 1RF0A 3V2NA 3CC2P 1XTGB 3H1LE 1QL2A 3D6ZA 1Q81Q 4L75A 2KNCA 1LTGC 3OW2O 1NU1K 2A45G 1KC8Q 4QMAA 1YTZI 3L73G 2PP6A 3QH9A 4RESB 2R3SA 1ZN5A 2P7JA 4XFJA 2NPSC 3VMAA 4LGDE 1LTTC 1NTMG 2K37A 1NTKE 1CZQA 2WPSA 3HUSA 3TGUD 3I56P 3S4RA 2YMYA 5AVYB 1DEEG 2M5AA 1JY3P 1SQQD 1JB0J 1AV1A 2C0XA 1S5LX 3CLQA 1NTZG 5BU8B 5L8RJ 3S1KA 4HJGH 4I7ZB 1NOHA 3AEAC 2JEEA 3B4SA 5GTHH 3KPEA 1KQSO 4JBZA 3U1AA 5CJ4A 3H1HG 1FJKA 3SFEC 2HODA 1DH3A 3M9HA 2YKOA 1RF1A 4I1LA 3VTPC 2K9YA 4TT3H 2HPCB 1M1KQ 2WMMA 3PRJA 2R5BA 4Z1MH 3HE4A 4R4LA 2O01H 4RJTA 1QX8A 1FZFA 3GHGC 2ZT9C 5APQA 1N86A 3H1IJ 4AYCA 1BCCG 2XDJA 4N78D 4YTPC 1FC2C 3Q5RA 3GG2A 1KILD 3VP8A 3HE5B 4TLFA 3PLNA 3GMAA 2WSEJ 3EFGA 2WT7A 3MZWB 3CC4P 4BWNA 2OTJP 3LW5J 1ZR4A 3R4YA 1X9VA 4A7PA 3E1IA 4WY4C 2A06G 4CPGA 1LTSC 1S72P 3LIEA 2OQQA 1PPJG 3P32A 4GDOA 1FZCC 1S9KE 1N2DC 1T6AA 4N6JA 3B8EB 3L74D 3BRVB 2WVRA 2WWWA 1S4XA 5AVTB 1MFZA 2H88C 3A7OA 3NXSA 1KILA 3TGUE 1PGQA 5CMZA 2YKPA 4PJ0H 1GU4A 3AEFC 1S5LE 3FWLA 3WU2H 2J58A 2LR2A 1BE3J 1UIXA 1YYCA 2M0BA 2W90A 4UB6E 1USDA 5CCGD 1EZVE 1SFCA 2Y9YA 3T97B 1GW4A 1J2JB 1FU1A 3MUDA 2Z5HA 1AA0A 5APYA 4DJGA 3AEDC 2KB7P 4DOJA 3TDKA 3H1IG 5AVSB 2I8DA 1LP1A 1OW6A 5B5EE 2K9JA 2P58A 2A45H 3Q5PA 2Y0EA 1RF0C 4BXLA 3Q2YA 3MHVA 2C9LY 2N9BA 1HJBA 1PL5A 3WUTA 1DEBA 1JY3N 5CJ0A 3RBXA 4H13B 3FGAD 4OH8B 3RK3B 1PGJA 4N78E 1KD1Q 1HWTC 1M1JA 1KILE 3CWBD 1EQ7A 1ZP0C 2HR3A 3A2AA 2B88A 1JM0A 1LTJB 3MP7B 2W27A 3WUVA 5CCGA 2E75D 2G3AA 3CWBJ 1Y47A 3A5TA 3RL0C 4O9BA 5E79H 3BVHA 5KAFE 2P67A 1EDKA 3LIDA 3RK2D 1KORA 1YQ3C 5AW3B 1Q2NA 2IZ0A 1LT9A 2H7HA 2IBZE 1R5LA 2HLOA 2Q6QA 1LT1A 1ZMEC 1L0LD 1NKZB 3L71E 1YJ9P 3VMZA 3IFMA 2QJYC 1SQXD 3AEEC 1K73Q 3L74E 2CK3H 1AVYA 3EFFK 2KIKA 3F89A 4GKGA 2KK7A 3I55P 1BE3G 4N3YB 1JY2O 1M7LA 3L75J 1RF1C 3H1KD 3H25A 2E74B 1N7LA 3M9BA 2C0WA 5AVVB 1SP4A 3M9QA 2WPVB 3KQGA 3G6EP 3Q3DA 1USEA 1NAFA 1AQTA 2Q5UA 2DW3A 1IFPA 2FFDB 4KJMA 1W5CE 3CCQP 4MN4C 1L4AD 2B89A 1SQPE 2OYHA 2ZAEB 1PV3A 2KS1B 3H32A 1VQPP 1VF5B 3HD7B 4M3LA 3CCEP 1FZBA 1LNQA 2PRRA 4HYTB 1NTMK 3AE3C 4GOFA 5GTHE 3H1LJ 1FDIA
chains in the Genus database with same CATH topology
1EDKA 3RGUA 4ZMDA 3ZDMA 4ASVA 1BDDA 3FXEA 2WMMA 2B87A 1Q2NA 4K35A 1EDLA 4ASWA 2LR2A 4WWIA 1SS1A 2M0BA 1LT1A 2QVAA 5DJUB 5CBOA 3PH0A 5K5GB 2KI7B 4ZNCA 5EFWB 5CBNA 1FC2C 2M5AB 1LP1B 4GOEA 1U7JA 2KIKA 1JMBA 5C39A 4EYYQ 4NPEA 4IOIH 4NPFX 3FXDA 2UWJE 3MZWB 4K3AA 1X0TA 1DEEG 2M5AA 1MFTA 2I8DA 1LP1A 2P58A 4BXLA 2RKLA 3MHVA 1NVOA 4HB1A 2KZIA 3S1KA 4HJGH 4CPGA 2QRXA 1S3JA 2OTKE 4KJMA 2Q1KA 4GODA 4HKZH 1BDCA 1EC5A 4MN4C 4JBZA 2B89A 2ZAEB 5DJTB 2HR3A 2B88A 2KUBA 1JM0A 2KS1B 1H0TB 2LXCB 1OVUA 1ZW0A 1ZXGA 2K3RA 1EDJA 1OVRA 2R44A 1EDIA 2JWDA 2KZJA 2B87B 1Y47A 2SPZA 1OVVA 3QWOC 1U7MA 4NPDA 4GOFA 2LXBA 1H0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EDK A;  3RGU A;  4ZMD A;  3ZDM A;  4ASV A;  1BDD A;  3FXE A;  2WMM A;  2B87 A;  1Q2N A;  4K35 A;  1EDL A;  4ASW A;  2LR2 A;  4WWI A;  1SS1 A;  2M0B A;  1LT1 A;  2QVA A;  5DJU B;  5CBO A;  3PH0 A;  5K5G B;  2KI7 B;  4ZNC A;  5EFW B;  5CBN A;  1FC2 C;  2M5A B;  1LP1 B;  4GOE A;  1U7J A;  2KIK A;  1JMB A;  5C39 A;  4EYY Q;  4NPE A;  4IOI H;  4NPF X;  3FXD A;  2UWJ E;  3MZW B;  4K3A A;  1X0T A;  1DEE G;  2M5A A;  1MFT A;  2I8D A;  1LP1 A;  2P58 A;  4BXL A;  2RKL A;  3MHV A;  1NVO A;  4HB1 A;  2KZI A;  3S1K A;  4HJG H;  4CPG A;  2QRX A;  1S3J A;  2OTK E;  4KJM A;  2Q1K A;  4GOD A;  4HKZ H;  1BDC A;  1EC5 A;  4MN4 C;  4JBZ A;  2B89 A;  2ZAE B;  5DJT B;  2HR3 A;  2B88 A;  2KUB A;  1JM0 A;  2KS1 B;  1H0T B;  2LXC B;  1OVU A;  1ZW0 A;  1ZXG A;  2K3R A;  1EDJ A;  1OVR A;  2R44 A;  1EDI A;  2JWD A;  2KZJ A;  2B87 B;  1Y47 A;  2SPZ A;  1OVV A;  3QWO C;  1U7M A;  4NPD A;  4GOF A;  2LXB A;  1H0T A; 
#chains in the Genus database with same CATH topology
 1H8A A;  1RY3 A;  4U3F E;  1YJW P;  1IJD B;  2YKQ A;  1SQV D;  4LC1 A;  2Z5I A;  2KP8 A;  5AVX B;  1BGY E;  2XV5 A;  3R2P A;  2VRS A;  3CWB G;  4BRY B;  2CPS A;  1NTK D;  5BU5 A;  1GL2 D;  2FYN C;  2QJP C;  1T2K D;  1N7S D;  4I6M C;  4ZNC A;  4IFF A;  2JO1 A;  5EFW B;  1FAV A;  3GLM A;  3W68 A;  2R32 A;  5KLI B;  4L76 A;  3EQ2 A;  4PV1 B;  3UIA A;  1L4A A;  1IC2 A;  1IFJ A;  1KB9 E;  1KIL C;  3M91 A;  1WMK A;  1T8Z A;  2FYU J;  2H89 C;  3II6 A;  3G3Z A;  4L73 A;  2RKL A;  2WZ7 A;  1JCD A;  4H44 D;  2QM7 A;  2XND H;  3B71 A;  1QEX A;  2W83 C;  2QRX A;  1VQ9 P;  3BAT A;  3L75 G;  2NPS B;  2FXO A;  1OX3 A;  1YQ4 C;  4EIJ A;  5TIS E;  2NZ2 A;  1E79 H;  4H0L D;  1GL2 A;  1SFC C;  3H1J E;  1N7S A;  1OVU A;  1ZW0 A;  2ZJS E;  3MUD C;  1S1C X;  1J1E C;  3O6Q A;  3H1K E;  2FYZ A;  3KDP B;  1KN7 A;  1Y8A A;  2IYP A;  2YXQ B;  4ASV A;  2YNY A;  3VMX A;  1SQB D;  1IFN A;  3TK1 A;  1KFM A;  3HTK B;  1EDL A;  4EDF A;  3USS A;  2R5D A;  3H1L G;  2V7Q H;  5K5G B;  1M1J C;  4PJ0 E;  1WRG A;  1JTH A;  3TNU B;  2JJL A;  1P84 E;  5CCG C;  1SQQ K;  3WU2 E;  2XNX A;  1RHZ B;  4R4M A;  1SQV E;  3GHG B;  3V5B A;  3H6P A;  2ZT9 B;  1S9K D;  2ZFC A;  5AW6 B;  2C9N Y;  4HB1 A;  1AQ5 A;  1LT9 C;  1L0N E;  2IX7 C;  2MJZ A;  4W7Z A;  1OW7 A;  2FYU G;  2E76 D;  2WSS H;  2BCC G;  4HKZ H;  3P8C E;  5AVW B;  2OTL P;  3CCS P;  1ZOY C;  1J1D C;  3TGU J;  3BCC D;  1MV8 A;  5KLV D;  2LXC B;  2K3R A;  1OVR A;  1TU3 F;  5AVU B;  1SQQ J;  1OW8 A;  1NH4 A;  1DIP A;  4WY4 B;  2E75 C;  1OXZ A;  2Y0D A;  2JR8 A;  1GK6 A;  1NU1 D;  5AW8 B;  1FZC B;  1HBW A;  1EZV D;  5AVR B;  2IZ1 A;  1NTZ E;  2BEZ F;  2N1T D;  3AEB C;  4LLH A;  3RK2 C;  3D6Y A;  4GT1 A;  2WSF H;  2KLU A;  4W7Y A;  3JCU H;  2R3C A;  2Q3I A;  5APT A;  3V2R A;  1X22 A;  5E79 E;  5TJH A;  2QJK C;  2KI7 B;  2OYH C;  1VQK P;  4B86 A;  4KT0 J;  1CSB A;  5AW2 B;  1YBK A;  1K9M Q;  1KB9 H;  4ZKU A;  1HGZ A;  1R5S A;  1Q7Y Q;  1LTA C;  1AVO A;  4DCK A;  2UWJ E;  1QVF O;  1LWU A;  3CD6 P;  3H1H E;  1SQB E;  3CME P;  1FS0 E;  1GZL A;  3IAO A;  1NYH A;  1VQ4 P;  1FJP A;  1VQN P;  2N1T A;  1SVF A;  5TIS H;  1BDC A;  2XZR A;  1HGV A;  1L4A C;  2IFM A;  1BCC E;  5KJ7 C;  2D2C D;  2IBZ D;  3D70 A;  3L72 E;  1KQF B;  2HFE D;  1H0T A;  3IN6 A;  2KNC B;  1SFC D;  1PGP A;  2H43 A;  3L71 D;  3ITK A;  4PD4 E;  2IFN A;  3TGU G;  2RMZ A;  5APU A;  1JCC A;  1FZG A;  1XTC C;  1SQQ G;  1KQG B;  4ASW A;  1FZA A;  1FOS E;  2A06 E;  4C7N A;  3VYI A;  1Q90 D;  4EI2 A;  1EZV I;  3L74 J;  1IFD A;  2QVA A;  3PJS K;  1GL2 C;  3HUS B;  3BCC E;  3RL0 B;  3SWY A;  5KLV E;  3W67 A;  1T2K C;  1N7S C;  2M5A B;  1P84 H;  1GDT A;  1RE3 A;  1JMB A;  3SSU A;  1BSN A;  1Q86 Q;  5KAI E;  1LJ2 A;  3RK3 E;  2KYV A;  1NU1 E;  3M0D C;  5CHX A;  4IFD K;  3L37 A;  1HJ0 A;  2OAR A;  1SQP D;  3C1L A;  1GU5 A;  2N9Y B;  4WBA A;  2QJY B;  3CCR P;  3AE9 C;  1JUN A;  2QEX P;  4H44 C;  3N7N A;  1G2C A;  4GOD A;  1NO4 A;  1HVV A;  2W8Z A;  4JF7 A;  5APW A;  2HOD B;  5M1B A;  4YPC A;  1RF1 B;  4U3F D;  2OGU A;  3CCM P;  1CI6 A;  4IL6 E;  1EDJ A;  4H0L C;  3L36 A;  1BGY D;  1VQ6 P;  4U3F J;  1S2E A;  1YIT P;  3HE4 B;  1BGY J;  1RQU A;  4YXD C;  4UB8 E;  4WVZ A;  2IBZ I;  3Q1M A;  3B5N D;  3H1I E;  1K04 A;  2FY8 A;  3A3Y B;  3ABV C;  3GW6 A;  4GIF A;  1L0L K;  3KYQ A;  3CXH E;  4JPZ B;  1GTW A;  1URQ D;  3O8Z A;  3L4F A;  1KB9 D;  1SQX K;  1N73 A;  2PAJ A;  5CBO A;  3PTZ A;  2V4H A;  3SWF A;  2WT7 B;  1BSH A;  5CBN A;  1DD3 A;  5GTI H;  2O01 J;  5APX A;  4GOE A;  3L70 D;  2E43 A;  4EYY Q;  2KLV A;  2AXT H;  1ZV8 A;  5AW4 B;  3PHL A;  4NPF X;  1DD4 A;  3L74 G;  1IZN B;  2WSC H;  2JDI H;  4OGQ D;  1L0L J;  2QJP B;  3RL0 g;  1NJI Q;  1VQL P;  3H1J D;  3B5N A;  1NAY A;  1SQX J;  2W6J H;  4KHX A;  4RKU J;  1NWQ A;  4D6T D;  2AEF A;  2WIT A;  1W2E A;  1Q82 Q;  5KKZ C;  1URQ A;  4AQR D;  1KIL B;  1PP9 D;  2E76 C;  1D7M A;  3PP5 A;  2QE7 H;  2K88 A;  3MTU E;  3KHU A;  3U1C A;  1ZXG A;  3H1K J;  2O1J A;  4RO0 A;  3JSV C;  2ZYG A;  1YJN P;  2GM4 A;  1LWU C;  4PD4 H;  1T3J A;  1BDD A;  5KJ7 D;  2B87 A;  5APS A;  3RK3 C;  1NTK K;  3CC7 P;  2L5G B;  3TSI A;  1PIX A;  1JO5 A;  2M3B A;  4U3F G;  1SFC B;  1P84 D;  2NRG A;  2N1T C;  5CCH D;  2FYU K;  1J1E B;  1BGY G;  1KB9 I;  4AUW A;  1NKN A;  2ZVN B;  1L2P A;  1LP1 B;  3M0A A;  2AEJ A;  1VQ5 P;  2K9J B;  2RN0 A;  1YHQ P;  3G9R A;  1SQV J;  1WT6 A;  1L0N D;  5KAI H;  3FXD A;  4K3A A;  2OYI C;  3AE8 C;  2OYO A;  1RQV A;  3JCU E;  1R8E A;  2FXM A;  1L0N J;  3P8C D;  1KFN A;  2ZXE B;  1NTK J;  1M56 D;  1M1J B;  3L73 D;  1NGM B;  5KJ7 A;  2LKM A;  1G1J A;  1QL1 A;  4WB4 A;  5APV A;  1NTM D;  4Y99 C;  5CCH A;  2PGD A;  3L70 E;  3CCJ P;  1L0L G;  2IDB A;  4IL6 H;  4JYC A;  3A0B H;  2Y9Z A;  1RE3 C;  2ITA A;  2KZJ A;  1SQX G;  2AEM A;  2SPZ A;  3OAK A;  1NTZ D;  4OWF A;  3E1R A;  2D2C C;  2LXB A;  1LT9 B;  3AEC C;  4UB8 H;  2XKM A;  1X8Y A;  1N8R Q;  2FFD C;  2JWA A;  3H1K G;  3CXH H;  1RH5 B;  4D6T E;  4K35 A;  5B66 H;  1J1D B;  2HPC A;  1FE6 A;  2PFX A;  1PP9 E;  1A02 F;  2WSE H;  1M8O B;  3C9I A;  1SLQ A;  1P84 I;  3TYY A;  2O01 N;  3BRT B;  3M0D A;  1LGH B;  3H1H D;  2E75 B;  2YIU C;  3LW5 H;  1U7J A;  1PZQ A;  1SQB J;  2M3E A;  1K8A Q;  1ZRT D;  1QVG O;  4C46 A;  1OMI A;  3HE5 A;  3RK2 B;  3D71 A;  2QA4 P;  2P10 A;  1NVO A;  3CPW O;  5BVZ A;  2QJK B;  1JNM A;  2B9B A;  2OYH B;  2O3J A;  3NTN A;  1BCC D;  1SQV G;  2A45 I;  3H32 B;  2OTK E;  1N73 C;  2WQY C;  1MZ9 A;  1VQ8 P;  5AW0 B;  3VMY A;  3WUU A;  3G71 P;  1EC5 A;  1MKM A;  1BCC J;  3L72 D;  4DT0 A;  1L0N G;  3IR9 A;  1NTK G;  4PD4 D;  1FBM A;  1UII A;  3L72 J;  2KSE A;  3OA7 A;  3V6I A;  2WPR A;  2RH0 A;  4NPD A;  2A06 D;  3RGU A;  3AE5 C;  2ZYA A;  1OZH A;  3WMM 0;  2YO2 A;  4XE5 B;  3L73 E;  1IFM A;  4C7R A;  3B5N C;  1PPJ D;  1Z56 A;  2WPQ A;  1M90 Q;  1NHL A;  2P2U A;  3AEG C;  1L4A B;  1URQ C;  3BCC J;  5KLV J;  1NTM E;  3C8V A;  4H13 D;  2FYU E;  1IO4 A;  3RK3 D;  2YXR B;  2BCC E;  1JMM A;  2J59 M;  2HG5 D;  5AW7 B;  1NU1 J;  1X0T A;  1A02 J;  3KXD A;  5AVQ B;  3T97 A;  3Q5S A;  1OIP A;  3KZI E;  4IL6 X;  5GTI E;  2ZXX A;  4OGQ C;  1GL2 B;  1SQB G;  2GUV A;  1N7S B;  2AXT E;  3U59 A;  2E5T A;  2QIW A;  1IFI A;  3O6Q B;  2E42 A;  4JQ0 D;  3CCL P;  1E5W A;  3H1I D;  2W6A A;  5H2F H;  1PFI A;  3RBZ A;  3CXH D;  4PD4 I;  2KXP B;  3V4W A;  1ZRT E;  1KTM A;  1AJY A;  1LTJ A;  4H44 B;  4W80 A;  1JY3 O;  2E74 D;  1M57 D;  3GF3 A;  3L72 G;  2QG4 A;  2JP3 A;  1JTH B;  1FZE A;  2P1J A;  4H0L B;  2ZYD A;  2QM8 A;  2OYI A;  3CCV P;  3FX0 A;  4I7Z C;  5CCH C;  2XU6 A;  2FXP A;  4L74 A;  3L35 A;  1KMI Z;  3L71 J;  1YTZ T;  2V7Q J;  2BAS A;  1VF5 D;  3HD7 D;  1VL2 A;  3BCC G;  5KLV G;  1SQP K;  1KYO H;  2I1K A;  2I1J A;  3M06 A;  1HH0 A;  1PPJ E;  2KOG A;  2G8Y A;  1NU1 G;  3CX5 H;  1S3J A;  3VP9 A;  1SQQ E;  1VQM P;  1EZV G;  5DJT B;  1BE3 D;  5AVZ B;  1RE4 A;  2BEQ D;  1HUC A;  2FFD A;  3E7K A;  4IFM A;  3MD0 A;  2FKW B;  1YIJ P;  4PV1 D;  3CI9 A;  1SQP J;  3P7K A;  2KS1 A;  2Q3E A;  3NFQ A;  3CXH I;  3HD7 A;  5KTB A;  1T3U A;  3EWK A;  5KKZ B;  1LTI C;  1OWA A;  2E76 B;  3A0B E;  1JY2 P;  5AW1 B;  4WWI A;  2W6B A;  3K5B A;  3PH0 A;  1KQL A;  2NPS D;  4BRY A;  3SFD C;  1LWU B;  3MIW A;  4OVN F;  2WSF J;  1U57 A;  5B66 E;  1KZU B;  1GMJ A;  2YMK A;  1H89 A;  5AW9 B;  3AE4 C;  3G4S P;  2J5U A;  1H88 A;  2N1T B;  2IBZ G;  3KZI H;  5AW5 B;  1QGK B;  3L71 G;  3HUS C;  2JKV A;  3OJA B;  2Z4E A;  1ZLL A;  3L70 J;  2M8R A;  2L91 A;  1EXJ A;  2OYI B;  2KUB A;  1H0T B;  2POH A;  2FYN B;  3JC2 2;  2NPS A;  1GK4 A;  3V2P A;  3HRN A;  1CW5 A;  1U7M A;  3IF4 A;  1IK9 A;  3CL3 D;  1GD2 E;  3H1J J;  3A0H E;  3ZDM A;  4C7N B;  1VDF A;  3V2Q A;  4D6T J;  3FXE A;  3L75 D;  3F5H A;  4YXW H;  1PP9 J;  2ZT9 D;  1QLE D;  4I2L C;  4U7J A;  4Y99 B;  1JEK A;  1SQP G;  1SQV K;  2MKV A;  1JOC A;  3GF7 A;  1BE3 E;  3HTK A;  1KYO D;  3VOP A;  2GA1 A;  1L0N K;  2D2C B;  4H13 C;  3N4X A;  2YO3 A;  2O1K A;  5C39 A;  2Q9I A;  1OFC X;  3AE2 C;  2CPB A;  3CX5 D;  1LTJ C;  1MFT A;  3TNU A;  3NMD A;  1G2C B;  4WY4 D;  1IK7 A;  4Y28 J;  2AXC A;  1VQ7 P;  3H1L D;  2KZI A;  1HF9 A;  1W2B O;  3AE6 C;  1YI2 P;  3GHG A;  1CI6 B;  2YIU B;  4DZO A;  1VQO P;  1S5L H;  1NTZ K;  2HYN A;  3FWN A;  2R44 A;  2Y0C A;  1DX7 A;  1ZR2 A;  2GUS A;  1AFO A;  4EOT A;  3SWK A;  4UB6 H;  3QWO C;  1G1I A;  3I5C A;  3L70 G;  1VPC A;  3L73 J;  1PGO A;  3CWB E;  2KSJ A;  1N73 B;  1K05 A;  2FYU D;  1FOS F;  3TF5 A;  2BCC D;  4WY4 A;  3CCU P;  1GW3 A;  5H2F E;  3V4Q A;  2E74 C;  1NTM J;  1Y9B A;  2IPP A;  1SS1 A;  2BCC J;  1SQB K;  2H8P D;  2E5Y A;  2FBW C;  2ZVO B;  5DJU B;  5B5E H;  3H1J G;  1FZC A;  1EXI A;  4XA4 A;  4D6T G;  3P8M C;  1JY2 N;  1RE4 C;  3VN0 A;  1NTZ J;  1PP9 G;  1KYO I;  1KV4 A;  1FDO A;  3AE1 C;  4NPE A;  1L0L E;  3MGN A;  4IOI H;  4HH2 A;  2WTY A;  3B5N B;  1FDM A;  1SQX E;  1VF5 C;  3HD7 C;  3S9O A;  3L75 E;  3CX5 I;  1URQ B;  4ZKP A;  2Q7C A;  1HTL C;  2QSI A;  3H1H J;  3CMA P;  2Q1K A;  2WSC J;  5KAF H;  4JYB A;  1KYO E;  1MUU A;  3BAS A;  3RL0 D;  1EDI A;  3AE7 C;  2JWD A;  2B87 B;  1OVV A;  3CX5 E;  5KLI C;  4OGQ B;  2K1A A;  4PV1 C;  3A0H H;  5KLV K;  4ZMD A;  2IYO A;  1LTB C;  1X79 B;  1RF0 A;  3V2N A;  3CC2 P;  1XTG B;  3H1L E;  1QL2 A;  3D6Z A;  1Q81 Q;  4L75 A;  2KNC A;  1LTG C;  3OW2 O;  1NU1 K;  2A45 G;  1KC8 Q;  4QMA A;  1YTZ I;  3L73 G;  2PP6 A;  3QH9 A;  4RES B;  2R3S A;  1ZN5 A;  2P7J A;  4XFJ A;  2NPS C;  3VMA A;  4LGD E;  1LTT C;  1NTM G;  2K37 A;  1NTK E;  1CZQ A;  2WPS A;  3HUS A;  3TGU D;  3I56 P;  3S4R A;  2YMY A;  5AVY B;  1DEE G;  2M5A A;  1JY3 P;  1SQQ D;  1JB0 J;  1AV1 A;  2C0X A;  1S5L X;  3CLQ A;  1NTZ G;  5BU8 B;  5L8R J;  3S1K A;  4HJG H;  4I7Z B;  1NOH A;  3AEA C;  2JEE A;  3B4S A;  5GTH H;  3KPE A;  1KQS O;  4JBZ A;  3U1A A;  5CJ4 A;  3H1H G;  1FJK A;  3SFE C;  2HOD A;  1DH3 A;  3M9H A;  2YKO A;  1RF1 A;  4I1L A;  3VTP C;  2K9Y A;  4TT3 H;  2HPC B;  1M1K Q;  2WMM A;  3PRJ A;  2R5B A;  4Z1M H;  3HE4 A;  4R4L A;  2O01 H;  4RJT A;  1QX8 A;  1FZF A;  3GHG C;  2ZT9 C;  5APQ A;  1N86 A;  3H1I J;  4AYC A;  1BCC G;  2XDJ A;  4N78 D;  4YTP C;  1FC2 C;  3Q5R A;  3GG2 A;  1KIL D;  3VP8 A;  3HE5 B;  4TLF A;  3PLN A;  3GMA A;  2WSE J;  3EFG A;  2WT7 A;  3MZW B;  3CC4 P;  4BWN A;  2OTJ P;  3LW5 J;  1ZR4 A;  3R4Y A;  1X9V A;  4A7P A;  3E1I A;  4WY4 C;  2A06 G;  4CPG A;  1LTS C;  1S72 P;  3LIE A;  2OQQ A;  1PPJ G;  3P32 A;  4GDO A;  1FZC C;  1S9K E;  1N2D C;  1T6A A;  4N6J A;  3B8E B;  3L74 D;  3BRV B;  2WVR A;  2WWW A;  1S4X A;  5AVT B;  1MFZ A;  2H88 C;  3A7O A;  3NXS A;  1KIL A;  3TGU E;  1PGQ A;  5CMZ A;  2YKP A;  4PJ0 H;  1GU4 A;  3AEF C;  1S5L E;  3FWL A;  3WU2 H;  2J58 A;  2LR2 A;  1BE3 J;  1UIX A;  1YYC A;  2M0B A;  2W90 A;  4UB6 E;  1USD A;  5CCG D;  1EZV E;  1SFC A;  2Y9Y A;  3T97 B;  1GW4 A;  1J2J B;  1FU1 A;  3MUD A;  2Z5H A;  1AA0 A;  5APY A;  4DJG A;  3AED C;  2KB7 P;  4DOJ A;  3TDK A;  3H1I G;  5AVS B;  2I8D A;  1LP1 A;  1OW6 A;  5B5E E;  2K9J A;  2P58 A;  2A45 H;  3Q5P A;  2Y0E A;  1RF0 C;  4BXL A;  3Q2Y A;  3MHV A;  2C9L Y;  2N9B A;  1HJB A;  1PL5 A;  3WUT A;  1DEB A;  1JY3 N;  5CJ0 A;  3RBX A;  4H13 B;  3FGA D;  4OH8 B;  3RK3 B;  1PGJ A;  4N78 E;  1KD1 Q;  1HWT C;  1M1J A;  1KIL E;  3CWB D;  1EQ7 A;  1ZP0 C;  2HR3 A;  3A2A A;  2B88 A;  1JM0 A;  1LTJ B;  3MP7 B;  2W27 A;  3WUV A;  5CCG A;  2E75 D;  2G3A A;  3CWB J;  1Y47 A;  3A5T A;  3RL0 C;  4O9B A;  5E79 H;  3BVH A;  5KAF E;  2P67 A;  1EDK A;  3LID A;  3RK2 D;  1KOR A;  1YQ3 C;  5AW3 B;  1Q2N A;  2IZ0 A;  1LT9 A;  2H7H A;  2IBZ E;  1R5L A;  2HLO A;  2Q6Q A;  1LT1 A;  1ZME C;  1L0L D;  1NKZ B;  3L71 E;  1YJ9 P;  3VMZ A;  3IFM A;  2QJY C;  1SQX D;  3AEE C;  1K73 Q;  3L74 E;  2CK3 H;  1AVY A;  3EFF K;  2KIK A;  3F89 A;  4GKG A;  2KK7 A;  3I55 P;  1BE3 G;  4N3Y B;  1JY2 O;  1M7L A;  3L75 J;  1RF1 C;  3H1K D;  3H25 A;  2E74 B;  1N7L A;  3M9B A;  2C0W A;  5AVV B;  1SP4 A;  3M9Q A;  2WPV B;  3KQG A;  3G6E P;  3Q3D A;  1USE A;  1NAF A;  1AQT A;  2Q5U A;  2DW3 A;  1IFP A;  2FFD B;  4KJM A;  1W5C E;  3CCQ P;  4MN4 C;  1L4A D;  2B89 A;  1SQP E;  2OYH A;  2ZAE B;  1PV3 A;  2KS1 B;  3H32 A;  1VQP P;  1VF5 B;  3HD7 B;  4M3L A;  3CCE P;  1FZB A;  1LNQ A;  2PRR A;  4HYT B;  1NTM K;  3AE3 C;  4GOF A;  5GTH E;  3H1L J;  1FDI A; 
#chains in the Genus database with same CATH homology
 1EDK A;  3RGU A;  4ZMD A;  3ZDM A;  4ASV A;  1BDD A;  3FXE A;  2WMM A;  2B87 A;  1Q2N A;  4K35 A;  1EDL A;  4ASW A;  2LR2 A;  4WWI A;  1SS1 A;  2M0B A;  1LT1 A;  2QVA A;  5DJU B;  5CBO A;  3PH0 A;  5K5G B;  2KI7 B;  4ZNC A;  5EFW B;  5CBN A;  1FC2 C;  2M5A B;  1LP1 B;  4GOE A;  1U7J A;  2KIK A;  1JMB A;  5C39 A;  4EYY Q;  4NPE A;  4IOI H;  4NPF X;  3FXD A;  2UWJ E;  3MZW B;  4K3A A;  1X0T A;  1DEE G;  2M5A A;  1MFT A;  2I8D A;  1LP1 A;  2P58 A;  4BXL A;  2RKL A;  3MHV A;  1NVO A;  4HB1 A;  2KZI A;  3S1K A;  4HJG H;  4CPG A;  2QRX A;  1S3J A;  2OTK E;  4KJM A;  2Q1K A;  4GOD A;  4HKZ H;  1BDC A;  1EC5 A;  4MN4 C;  4JBZ A;  2B89 A;  2ZAE B;  5DJT B;  2HR3 A;  2B88 A;  2KUB A;  1JM0 A;  2KS1 B;  1H0T B;  2LXC B;  1OVU A;  1ZW0 A;  1ZXG A;  2K3R A;  1EDJ A;  1OVR A;  2R44 A;  1EDI A;  2JWD A;  2KZJ A;  2B87 B;  1Y47 A;  2SPZ A;  1OVV A;  3QWO C;  1U7M A;  4NPD A;  4GOF A;  2LXB A;  1H0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...