1OVVA

Crystal structure of four-helix bundle model di-co(ii)-df1-l13a (form ii)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQAIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Response of a designed metalloprotein to changes in metal ion coordination, exogenous ligands, and active site volume determined by X-ray crystallography.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords FOUR-HELIX BUNDLE MODEL di-Co(II)-DF1-L13A (form II)
total genus 22
structure length 48
sequence length 48
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1ovvA00
1NVOA 1JMBA 2JWDA 2QVAA 4NPFX 4MN4C 2B87A 1DEEG 4NPDA 2KZIA 1S3JA 2R44A 3QWOC 1OVUA 2I8DA 2M5AA 2HR3A 2LXCB 2SPZA 2LXBA 3FXDA 1LT1A 1H0TB 1EDIA 2Q1KA 4WWIA 4ASWA 2P58A 4GOFA 4HB1A 1MFTA 2ZAEB 3PH0A 3MZWB 1OVVA 4HJGH 4BXLA 1JM0A 2KS1B 1U7JA 2RKLA 1SS1A 1BDDA 4IOIH 1U7MA 1EDJA 5K5GB 4KJMA 5CBOA 1ZXGA 1H0TA 2LR2A 2B89A 2UWJE 1OVRA 1Y47A 2B88A 2QRXA 1LP1B 1Q2NA 4CPGA 4GODA 4ZNCA 3MHVA 4ASVA 2M0BA 3RGUA 4GOEA 4ZMDA 2KIKA 2KZJA 1EDKA 1BDCA 2M5AB 3FXEA 3S1KA 5DJTB 1EDLA 5EFWB 1FC2C 5CBNA 1LP1A 4JBZA 4K35A 1ZW0A 4K3AA 2KI7B 1EC5A 5C39A 2WMMA 2OTKE 2B87B 4HKZH 1X0TA 4EYYQ 2KUBA 2K3RA 5DJUB 3ZDMA 4NPEA
chains in the Genus database with same CATH superfamily
2H43A 3VN0A 1SQVJ 2XZRA 4L74A 4C7NB 5BU5A 3BASA 2WZ7A 5AVTB 3S4RA 3Q3DA 5M1BA 4C7RA 3KXDA 1GL2A 2FYUD 3AE2C 4GT1A 3HTKB 1NU1D 2M3EA 5APYA 5APUA 1PL5A 3CXHI 4I7ZB 1QLED 3L75G 5AVZB 5KLVG 1J1EC 3L71D 1EZVD 3RK3C 2PFXA 4C7NA 2C9LY 2OTLP 5AW9B 1NTKG 2JR8A 2WTYA 1DH3A 1H8AA 3CX5H 2FYUJ 2K37A 4H44B 1RQVA 1S5LH 2NPSC 3Q1MA 1K73Q 1LT9B 2IBZG 4O9BA 1AA0A 1T6AA 3FXDA 1GMJA 2LKMA 2YMKA 3II6A 2E5YA 2YIUC 1KZUB 1EDIA 1YYCA 4D6TE 2YIUB 4EDFA 2IFMA 3P8CD 1LTTC 3L37A 4EIJA 1M1KQ 5B5EE 1FZCB 1HVVA 1QL1A 5KTBA 4QMAA 1G2CA 4TT3H 4HB1A 1NAYA 1MFTA 2O01J 2IZ0A 3AE9C 3M91A 2W27A 5APSA 3B8EB 3GMAA 4D6TG 2WSSH 3MD0A 2W6AA 1RE4A 1K8AQ 3H1IJ 1PP9J 2H89C 1ZRTE 3A0BE 3VP9A 1EXIA 2YO3A 3CC4P 1LGHB 1EXJA 1KILE 3CWBG 5APQA 1T3UA 3GLMA 3I56P 1K04A 1Z56A 2CPSA 3MIWA 1L0LD 2K9YA 2XNDH 3AE1C 3WUTA 3CCRP 1AV1A 1IFNA 2Y0DA 4OWFA 3RBXA 1KB9I 2G3AA 3T97B 5CBOA 1LT9C 1S4XA 3IR9A 1ZXGA 4H44C 1RE3A 3H1KD 1SQBJ 3O6QB 3H1LD 3L75D 1NKZB 1NTKJ 1OX3A 1EZVG 1MKMA 2JO1A 1GU5A 2WITA 1J1EB 1SQPD 2WWWA 3OW2O 4GKGA 4I7ZC 1LTJC 2WSCJ 1YJ9P 3H1KE 1OVRA 4W7YA 2E76B 3AEAC 3EFFK 1URQB 5AW1B 3TSIA 1L0LE 4H44D 3TYYA 1XTCC 4CPGA 3TF5A 2QE7H 5AVWB 2YKQA 5AVXB 5AW3B 3L75J 2A45H 2ZVNB 5TJHA 3OA7A 5APWA 3MHVA 1H88A 2Z4EA 2M0BA 5KKZC 2O1JA 4EOTA 1LNQA 3ITKA 1A02J 3SFEC 1FDMA 2WSEJ 4OGQB 3RL0B 5AVVB 5CCGA 2KIKA 1EDKA 3VMZA 3L72E 2E75B 2N1TC 3P32A 1JOCA 1NTZG 2KNCA 3S1KA 3E7KA 1PP9D 1EDLA 3C9IA 3NTNA 1FC2C 5CCGD 2WT7A 1RQUA 1AQTA 2KYVA 3CC7P 3L72D 1R5LA 3RK2B 1BCCD 3SFDC 4K3AA 4LLHA 4B86A 1RHZB 2OYIC 5CCHA 5GTHE 1BE3D 1BSHA 3HE5B 5CCHC 3TNUA 4HKZH 1TU3F 3AECC 3M0DC 3CCEP 1M1JA 2KP8A 3ABVC 2BCCG 1NAFA 1FOSF 3U1AA 3H1LG 3V2QA 2BASA 1P84H 1L0NG 1KILD 2KNCB 1UIIA 2KXPB 1M56D 3C8VA 4WBAA 5AW5B 1P84I 1S72P 1KTMA 2IBZD 1LT9A 2XKMA 2GUVA 1L0NK 3L73D 3CCMP 1S9KE 3ZDMA 1AJYA 1HBWA 1JB0J 2ZYGA 1MV8A 3FX0A 1OFCX 3F5HA 3CCLP 2Z5IA 4RKUJ 4WB4A 1J2JB 4PJ0H 2JWDA 2QVAA 2KK7A 1DEBA 1KB9H 1PGJA 1KB9E 1PGQA 2P7JA 2Q6QA 4NPFX 5KLVE 4MN4C 5KLIC 2JP3A 3GF3A 1NGMB 1MUUA 2QJKB 4A7PA 1RE4C 3MUDA 1RF1A 4BRYB 1GL2C 3FWLA 5CCHD 3JSVC 4DCKA 1L2PA 1S3JA 2PRRA 3JCUH 3JCUE 1WT6A 1FOSE 3BCCJ 1NH4A 5KAFE 5KAFH 1AQ5A 4D6TD 2R3SA 4KT0J 3L74E 3CX5E 2O01N 3W67A 1T2KD 1S5LE 2E74B 1KILC 3HTKA 4RESB 3L73J 1JCDA 2K9JA 2ZXXA 1D7MA 1KFNA 2Q3IA 1WMKA 3E1IA 3PJSK 3L74G 3CLQA 3VOPA 3CPWO 3TDKA 1CI6A 3H1HE 1SQPJ 2AXCA 4JPZB 1FJKA 1HTLC 1SQBG 3CWBJ 2W6BA 3VMXA 4YXDC 2NPSB 1NU1E 2KLVA 2M8RA 1T3JA 3H1ID 2POHA 4WWIA 3L71E 4U3FD 4ASWA 2P58A 5BVZA 4GOFA 4EI2A 1ZR4A 2A06D 5AW6B 1ZR2A 3B71A 1P84E 2Y0CA 3PH0A 5CHXA 1GZLA 2RMZA 4HJGH 1FU1A 1KYOD 1SQPG 5AVRB 4BXLA 2HPCA 1JM0A 1QGKB 1PPJE 1W5CE 1JY3P 1LJ2A 1NTMD 1VPCA 2CK3H 2IX7C 4ZKPA 1IFDA 2ZYDA 1SS1A 3PP5A 3KZIH 3L70G 3KZIE 3H25A 1DX7A 1T2KC 3OAKA 2C9NY 1VF5B 3L71J 4IOIH 1E79H 1PPJD 3HUSB 1VF5C 2N1TD 1VQ4P 3HUSC 1VQ9P 1RY3A 2E42A 1NU1J 1AVYA 2QEXP 1EZVI 3CWBE 1SFCD 1LTAC 1SQXD 2FKWB 2JWAA 3OJAB 4KJMA 5K5GB 1VQMP 3B5NB 1SQPE 5GTHH 2FYZA 3H1HJ 3MTUE 3WU2E 3O8ZA 4IFMA 5KJ7D 2Y9ZA 1JY2N 5AVQB 5KLVD 1HWTC 3AE7C 3L73E 1OWAA 3H1KG 2B89A 1L4AC 2P10A 2GM4A 2KS1A 3LIEA 2HPCB 2W8ZA 3L74J 3Q5PA 1N7LA 5AVUB 3BCCE 3V2NA 1NYHA 4RO0A 1HGVA 2H8PD 4UB8H 2FFDA 1YBKA 3L72G 2E76D 1M1JB 2B88A 2OYIB 2MJZA 2PAJA 3BCCG 2A45I 1Q2NA 2YKPA 3BRTB 3CCSP 2QA4P 5AW4B 1S5LX 5KLVJ 1KN7A 3M06A 5L8RJ 1SQBD 1A02F 2ZT9D 1GD2E 1X22A 4H13B 3C1LA 3SSUA 3G6EP 4GOEA 2IYOA 4YPCA 1NO4A 2Q3EA 3AE5C 3VMAA 4IFFA 3CX5I 1FZEA 1ZLLA 3FWNA 1J1DB 2ZFCA 2H88C 2M5AB 2FBWC 1RF0C 2O1KA 2WPRA 3Q2YA 1U57A 2E75D 1HJ0A 1LWUA 2N9YB 1KILA 1NTMG 4HH2A 2BEZF 1NOHA 3V4QA 3VMYA 2A45G 1FZBA 4AUWA 1MFZA 4BRYA 2WPQA 2NRGA 2DW3A 1IJDB 2KI7B 2QJKC 1BCCG 3AEBC 3H6PA 2WMMA 2YXQB 5C39A 3MUDC 1KV4A 3VYIA 1RF1C 3WU2H 1RF1B 1KQLA 1KYOH 3Q5RA 1BE3G 4N6JA 3BATA 2QM8A 3VP8A 4EYYQ 4WY4C 1JY2P 4WY4B 2WQYC 2OARA 2J5UA 3MGNA 1VQ8P 1N7SA 3L72J 2IPPA 5DJUB 1IZNB 2PGDA 1N7SC 2ZVOB 3JC22 1N73B 2FYUK 1QVFO 1L4AB 2B9BA 1YHQP 4R4MA 2O3JA 1JMBA 1VQLP 4PJ0E 4WY4A 3VTPC 3RK2C 3L36A 3H1HD 3K5BA 3KYQA 2OGUA 3HD7C 3L75E 3TK1A 3EFGA 3F89A 4PV1D 1L0LJ 1GW3A 1DEEG 3PRJA 5H2FE 4NPDA 2KZIA 2WVRA 2YXRB 1SLQA 5AVSB 2OYIA 1FZCC 5CJ4A 1ZMEC 1CW5A 3H1KJ 2WSCH 3RK3B 2IBZE 2IFNA 3QWOC 1OVUA 1OW7A 2HR3A 1E5WA 1NTZD 3S9OA 3G71P 3AE3C 1NTKE 2E74D 3G9RA 1CZQA 2LXBA 1LT1A 1FZCA 1SQBE 1H0TB 2WSFJ 2ZYAA 1R8EA 4UB8E 1PPJG 3E1RA 2Q1KA 1G2CB 1BSNA 1NTKK 2J59M 2ZJSE 3G3ZA 3L74D 4IL6H 3I55P 4IFDK 5KKZB 3RBZA 1BGYG 1SQXG 3RGUA 1JO5A 1PGOA 2JJLA 1Q90D 2K9JB 2FY8A 3B5NC 4GDOA 3HE5A 4H0LB 3H1IG 4JF7A 2AEMA 2CPBA 4YTPC 1CI6B 4ZKUA 2W6JH 1M8OB 1G1JA 2MKVA 3CCUP 2FFDB 2L5GB 1KQFB 1H89A 1Q82Q 2FYNC 1PP9E 3H1IE 1NKNA 2GUSA 2W83C 1OVVA 1PV3A 1M90Q 1L0ND 1SQQG 1OXZA 4JQ0D 1W2EA 2KS1B 2ZT9C 1U7JA 2R3CA 2RKLA 3BRVB 4PD4D 3HD7B 1M1JC 3D70A 2E5TA 1VL2A 3L73G 1S1CX 1KD1Q 1JY2O 1YTZI 1M57D 1BDDA 1K05A 3LW5J 2O01H 2AXTH 3P8CE 4TLFA 3WUVA 5KJ7A 1FE6A 1VQOP 2BEQD 1SQBK 3UIAA 1N73C 1CSBA 2HYNA 1U7MA 2OTJP 1IFPA 2IYPA 2HFED 1SP4A 4Y99B 4OGQD 1GK6A 5CJ0A 5H2FH 1KQGB 3RL0D 2WT7B 2XV5A 1LWUB 1JTHB 3B5ND 2IBZI 1LWUC 4OH8B 4D6TJ 3L35A 3CL3D 4BWNA 1KYOE 1FS0E 3P7KA 3QH9A 1RF0A 3I5CA 2D2CC 1W2BO 1EQ7A 2JDIH 3CCJP 3R4YA 2FYUE 1URQA 1ZOYC 1ZP0C 3V4WA 2JKVA 1S9KD 1FZGA 1SVFA 5CCGC 1YI2P 1DIPA 3RL0g 1VDFA 3TNUB 1FDOA 5KLVK 1Q81Q 1NJIQ 3W68A 1VQ7P 3CMAP 1Y47A 3CD6P 1SQVD 1SQXK 3AEDC 1IFJA 1T8ZA 4IL6E 1GDTA 1IK7A 3H32A 1YJNP 1GK4A 2N9BA 2YNYA 2AEJA 1KORA 2KSEA 2OYHC 2K88A 1JTHA 4ASVA 1EZVE 4N3YB 1SQVE 2FYUG 3EQ2A 3KDPB 2ZT9B 4U3FG 4N78D 1YTZT 4H13D 4XA4A 3CCQP 3AE4C 3HRNA 1N73A 1SQQK 4ZMDA 2Q9IA 1BCCJ 2AEFA 2KSJA 1SQVK 2KZJA 2R5BA 1NWQA 4U3FE 1BDCA 5AVYB 1G1IA 1HJBA 5AW8B 1LTBC 3LIDA 1N7SB 3FXEA 1BE3J 2RH0A 3AEFC 1AVOA 1SFCC 1NTMJ 2AXTE 2ITAA 2Y0EA 5EFWB 3H1JE 3AEGC 3SWKA 3T97A 5CBNA 1N86A 3GF7A 2OYHA 2HLOA 2GA1A 1YITP 1LP1A 1N2DC 4JBZA 4JYBA 5KJ7C 1JMMA 1ZW0A 2D2CB 3HUSA 4PD4I 1EC5A 2JEEA 1OW6A 2QJYC 2P67A 3R2PA 4L73A 1KYOI 1GL2D 1JCCA 4OVNF 2B87B 1X0TA 3IAOA 4UB6H 4UB6E 3M9BA 1IFIA 1L0NJ 3NFQA 4DT0A 2HODA 1VQPP 3TGUG 1R5SA 3NMDA 3CCVP 1LTGC 1GW4A 1YQ4C 2I1JA 2M3BA 2QM7A 3M9HA 5GTIE 2IDBA 2K1AA 2BCCE 5TISH 2P2UA 2V7QH 2K3RA 2E43A 4W80A 3A0HE 3A0HH 3CXHD 1NTZJ 2W90A 2WSEH 4NPEA 2QIWA 1LTSC 3GHGC 4LGDE 1X9VA 1NVOA 4YXWH 3BCCD 1BGYD 3GHGA 2QJPB 3P8MC 5AW7B 1FZAA 3A2AA 1QX8A 3A3YB 3H1LE 3TGUJ 2NZ2A 3H1HG 3HD7A 2B87A 4XE5B 2VRSA 4PV1B 1KQSO 2Q7CA 3CC2P 3U1CA 1JUNA 1NTKD 1BGYE 2FYNB 2KB7P 1PGPA 1RH5B 1USDA 2WPSA 3EWKA 2C0WA 3M9QA 3KHUA 3PLNA 1LTIC 2R44A 3PTZA 4I2LC 3IFMA 2G8YA 4OGQC 1IFMA 2I8DA 2M5AA 3RL0C 4C46A 1IO4A 3L70J 1NTZK 1OIPA 1XTGB 2KOGA 1DD3A 2LXCB 1KILB 1OZHA 2SPZA 3O6QA 1IK9A 2NPSA 2FXOA 4PD4E 2RN0A 1SQQE 1YJWP 4W7ZA 4JYCA 2XU6A 1FDIA 1IC2A 1YQ3C 3H1JD 4L76A 5E79H 1PZQA 3CMEP 5B5EH 1SFCA 3HE4B 4DZOA 1VQ6P 1FJPA 3IF4A 4H0LD 1JEKA 3KPEA 1SQXE 1J1DC 3M0AA 1NU1G 4R4LA 2ZAEB 1M7LA 5BU8B 3AEEC 1S2EA 2QJYB 4XFJA 4DJGA 2I1KA 3MZWB 3L71G 5AW2B 3H32B 5TISE 3V5BA 2WPVB 2PP6A 3V6IA 3A7OA 3D6ZA 2YO2A 3USSA 4M3LA 1SQQD 1PP9G 1OW8A 3M0DA 4H13C 3HD7D 2OQQA 1HH0A 4I1LA 5CMZA 3U59A 5B66E 1FZFA 3A0BH 4HYTB 1PIXA 1SQXJ 1HUCA 4L75A 2Z5HA 3L70D 4AYCA 5APXA 1ZRTD 4U7JA 1EDJA 3TGUD 2J58A 2R32A 2N1TA 3GHGB 3SWYA 3A5TA 3D71A 1LTJB 1P84D 3N4XA 2QG4A 1UIXA 2NPSD 4AQRD 1SQQJ 2E74C 1PFIA 2OYOA 2XNXA 1H0TA 1K9MQ 1SQPK 3CXHE 2LR2A 1X79B 3CXHH 2ZXEB 3L4FA 3CI9A 3L70E 2UWJE 1VQ5P 1QVGO 1KC8Q 2Q5UA 2H7HA 1JNMA 1Y9BA 1USEA 2R5DA 3D6YA 2XDJA 3Q5SA 1WRGA 1KB9D 1BGYJ 1URQD 5APVA 5KAIH 1HGZA 1Y8AA 3GW6A 3CX5D 4N78E 2QRXA 1L0LK 3CWBD 1LP1B 5E79E 1SQVG 3V2PA 3H1LJ 1ZV8A 4GODA 3TGUE 4ZNCA 3PHLA 3H1JG 1GTWA 1VF5D 1N8RQ 1LTJA 1L0LG 2N1TB 4GIFA 4WVZA 3AE6C 3NXSA 1MZ9A 1L4AA 4WY4D 4Y28J 1SFCB 2C0XA 3HE4A 4Y99C 5APTA 4Z1MH 1OMIA 1FBMA 1NTZE 4IL6X 3WUUA 2Y9YA 1RE3C 3KQGA 2YMYA 1QEXA 1QL2A 2V7QJ 1X8YA 2BCCJ 3B4SA 3FGAD 3IN6A 3SWFA 1Q86Q 1N7SD 1L4AD 2A06E 5DJTB 1FAVA 3MP7B 3B5NA 3V2RA 3WMM0 1HF9A 4RJTA 1L0NE 3AE8C 3RK2D 5B66H 2KLUA 2P1JA 4K35A 1URQC 4PD4H 2QJPC 1GU4A 4DOJA 2E76C 2L91A 3GG2A 2D2CD 4PV1C 1AFOA 1JY3N 2HG5D 1VQKP 4I6MC 2FFDC 2OTKE 2FXMA 3N7NA 1Q7YQ 2WSFH 2BCCD 1GL2B 2YKOA 3RK3D 2OYHB 5AW0B 1DD4A 1KMIZ 2A06G 2IZ1A 3H1JJ 1JY3O 1NTME 3LW5H 2KUBA 5GTIH 1NHLA 1BE3E 1ZN5A 2FXPA 3G4SP 3RK3E 1NTMK 4H0LC 4U3FJ 5KAIE 3BVHA 4KHXA 5KLIB 1BCCE 1NU1K 2E75C 2HODB 2V4HA 2QSIA 4LC1A 1YIJP 1VQNP 1KFMA
chains in the Genus database with same CATH topology
1NVOA 1JMBA 2JWDA 2QVAA 4NPFX 4MN4C 2B87A 1DEEG 4NPDA 2KZIA 1S3JA 2R44A 3QWOC 1OVUA 2I8DA 2M5AA 2HR3A 2LXCB 2SPZA 2LXBA 3FXDA 1LT1A 1H0TB 1EDIA 2Q1KA 4WWIA 4ASWA 2P58A 4GOFA 4HB1A 1MFTA 2ZAEB 3PH0A 3MZWB 1OVVA 4HJGH 4BXLA 1JM0A 2KS1B 1U7JA 2RKLA 1SS1A 1BDDA 4IOIH 1U7MA 1EDJA 5K5GB 4KJMA 5CBOA 1ZXGA 1H0TA 2LR2A 2B89A 2UWJE 1OVRA 1Y47A 2B88A 2QRXA 1LP1B 1Q2NA 4CPGA 4GODA 4ZNCA 3MHVA 4ASVA 2M0BA 3RGUA 4GOEA 4ZMDA 2KIKA 2KZJA 1EDKA 1BDCA 2M5AB 3FXEA 3S1KA 5DJTB 1EDLA 5EFWB 1FC2C 5CBNA 1LP1A 4JBZA 4K35A 1ZW0A 4K3AA 2KI7B 1EC5A 5C39A 2WMMA 2OTKE 2B87B 4HKZH 1X0TA 4EYYQ 2KUBA 2K3RA 5DJUB 3ZDMA 4NPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NVO A;  1JMB A;  2JWD A;  2QVA A;  4NPF X;  4MN4 C;  2B87 A;  1DEE G;  4NPD A;  2KZI A;  1S3J A;  2R44 A;  3QWO C;  1OVU A;  2I8D A;  2M5A A;  2HR3 A;  2LXC B;  2SPZ A;  2LXB A;  3FXD A;  1LT1 A;  1H0T B;  1EDI A;  2Q1K A;  4WWI A;  4ASW A;  2P58 A;  4GOF A;  4HB1 A;  1MFT A;  2ZAE B;  3PH0 A;  3MZW B;  1OVV A;  4HJG H;  4BXL A;  1JM0 A;  2KS1 B;  1U7J A;  2RKL A;  1SS1 A;  1BDD A;  4IOI H;  1U7M A;  1EDJ A;  5K5G B;  4KJM A;  5CBO A;  1ZXG A;  1H0T A;  2LR2 A;  2B89 A;  2UWJ E;  1OVR A;  1Y47 A;  2B88 A;  2QRX A;  1LP1 B;  1Q2N A;  4CPG A;  4GOD A;  4ZNC A;  3MHV A;  4ASV A;  2M0B A;  3RGU A;  4GOE A;  4ZMD A;  2KIK A;  2KZJ A;  1EDK A;  1BDC A;  2M5A B;  3FXE A;  3S1K A;  5DJT B;  1EDL A;  5EFW B;  1FC2 C;  5CBN A;  1LP1 A;  4JBZ A;  4K35 A;  1ZW0 A;  4K3A A;  2KI7 B;  1EC5 A;  5C39 A;  2WMM A;  2OTK E;  2B87 B;  4HKZ H;  1X0T A;  4EYY Q;  2KUB A;  2K3R A;  5DJU B;  3ZDM A;  4NPE A; 
#chains in the Genus database with same CATH topology
 2H43 A;  3VN0 A;  1SQV J;  2XZR A;  4L74 A;  4C7N B;  5BU5 A;  3BAS A;  2WZ7 A;  5AVT B;  3S4R A;  3Q3D A;  5M1B A;  4C7R A;  3KXD A;  1GL2 A;  2FYU D;  3AE2 C;  4GT1 A;  3HTK B;  1NU1 D;  2M3E A;  5APY A;  5APU A;  1PL5 A;  3CXH I;  4I7Z B;  1QLE D;  3L75 G;  5AVZ B;  5KLV G;  1J1E C;  3L71 D;  1EZV D;  3RK3 C;  2PFX A;  4C7N A;  2C9L Y;  2OTL P;  5AW9 B;  1NTK G;  2JR8 A;  2WTY A;  1DH3 A;  1H8A A;  3CX5 H;  2FYU J;  2K37 A;  4H44 B;  1RQV A;  1S5L H;  2NPS C;  3Q1M A;  1K73 Q;  1LT9 B;  2IBZ G;  4O9B A;  1AA0 A;  1T6A A;  3FXD A;  1GMJ A;  2LKM A;  2YMK A;  3II6 A;  2E5Y A;  2YIU C;  1KZU B;  1EDI A;  1YYC A;  4D6T E;  2YIU B;  4EDF A;  2IFM A;  3P8C D;  1LTT C;  3L37 A;  4EIJ A;  1M1K Q;  5B5E E;  1FZC B;  1HVV A;  1QL1 A;  5KTB A;  4QMA A;  1G2C A;  4TT3 H;  4HB1 A;  1NAY A;  1MFT A;  2O01 J;  2IZ0 A;  3AE9 C;  3M91 A;  2W27 A;  5APS A;  3B8E B;  3GMA A;  4D6T G;  2WSS H;  3MD0 A;  2W6A A;  1RE4 A;  1K8A Q;  3H1I J;  1PP9 J;  2H89 C;  1ZRT E;  3A0B E;  3VP9 A;  1EXI A;  2YO3 A;  3CC4 P;  1LGH B;  1EXJ A;  1KIL E;  3CWB G;  5APQ A;  1T3U A;  3GLM A;  3I56 P;  1K04 A;  1Z56 A;  2CPS A;  3MIW A;  1L0L D;  2K9Y A;  2XND H;  3AE1 C;  3WUT A;  3CCR P;  1AV1 A;  1IFN A;  2Y0D A;  4OWF A;  3RBX A;  1KB9 I;  2G3A A;  3T97 B;  5CBO A;  1LT9 C;  1S4X A;  3IR9 A;  1ZXG A;  4H44 C;  1RE3 A;  3H1K D;  1SQB J;  3O6Q B;  3H1L D;  3L75 D;  1NKZ B;  1NTK J;  1OX3 A;  1EZV G;  1MKM A;  2JO1 A;  1GU5 A;  2WIT A;  1J1E B;  1SQP D;  2WWW A;  3OW2 O;  4GKG A;  4I7Z C;  1LTJ C;  2WSC J;  1YJ9 P;  3H1K E;  1OVR A;  4W7Y A;  2E76 B;  3AEA C;  3EFF K;  1URQ B;  5AW1 B;  3TSI A;  1L0L E;  4H44 D;  3TYY A;  1XTC C;  4CPG A;  3TF5 A;  2QE7 H;  5AVW B;  2YKQ A;  5AVX B;  5AW3 B;  3L75 J;  2A45 H;  2ZVN B;  5TJH A;  3OA7 A;  5APW A;  3MHV A;  1H88 A;  2Z4E A;  2M0B A;  5KKZ C;  2O1J A;  4EOT A;  1LNQ A;  3ITK A;  1A02 J;  3SFE C;  1FDM A;  2WSE J;  4OGQ B;  3RL0 B;  5AVV B;  5CCG A;  2KIK A;  1EDK A;  3VMZ A;  3L72 E;  2E75 B;  2N1T C;  3P32 A;  1JOC A;  1NTZ G;  2KNC A;  3S1K A;  3E7K A;  1PP9 D;  1EDL A;  3C9I A;  3NTN A;  1FC2 C;  5CCG D;  2WT7 A;  1RQU A;  1AQT A;  2KYV A;  3CC7 P;  3L72 D;  1R5L A;  3RK2 B;  1BCC D;  3SFD C;  4K3A A;  4LLH A;  4B86 A;  1RHZ B;  2OYI C;  5CCH A;  5GTH E;  1BE3 D;  1BSH A;  3HE5 B;  5CCH C;  3TNU A;  4HKZ H;  1TU3 F;  3AEC C;  3M0D C;  3CCE P;  1M1J A;  2KP8 A;  3ABV C;  2BCC G;  1NAF A;  1FOS F;  3U1A A;  3H1L G;  3V2Q A;  2BAS A;  1P84 H;  1L0N G;  1KIL D;  2KNC B;  1UII A;  2KXP B;  1M56 D;  3C8V A;  4WBA A;  5AW5 B;  1P84 I;  1S72 P;  1KTM A;  2IBZ D;  1LT9 A;  2XKM A;  2GUV A;  1L0N K;  3L73 D;  3CCM P;  1S9K E;  3ZDM A;  1AJY A;  1HBW A;  1JB0 J;  2ZYG A;  1MV8 A;  3FX0 A;  1OFC X;  3F5H A;  3CCL P;  2Z5I A;  4RKU J;  4WB4 A;  1J2J B;  4PJ0 H;  2JWD A;  2QVA A;  2KK7 A;  1DEB A;  1KB9 H;  1PGJ A;  1KB9 E;  1PGQ A;  2P7J A;  2Q6Q A;  4NPF X;  5KLV E;  4MN4 C;  5KLI C;  2JP3 A;  3GF3 A;  1NGM B;  1MUU A;  2QJK B;  4A7P A;  1RE4 C;  3MUD A;  1RF1 A;  4BRY B;  1GL2 C;  3FWL A;  5CCH D;  3JSV C;  4DCK A;  1L2P A;  1S3J A;  2PRR A;  3JCU H;  3JCU E;  1WT6 A;  1FOS E;  3BCC J;  1NH4 A;  5KAF E;  5KAF H;  1AQ5 A;  4D6T D;  2R3S A;  4KT0 J;  3L74 E;  3CX5 E;  2O01 N;  3W67 A;  1T2K D;  1S5L E;  2E74 B;  1KIL C;  3HTK A;  4RES B;  3L73 J;  1JCD A;  2K9J A;  2ZXX A;  1D7M A;  1KFN A;  2Q3I A;  1WMK A;  3E1I A;  3PJS K;  3L74 G;  3CLQ A;  3VOP A;  3CPW O;  3TDK A;  1CI6 A;  3H1H E;  1SQP J;  2AXC A;  4JPZ B;  1FJK A;  1HTL C;  1SQB G;  3CWB J;  2W6B A;  3VMX A;  4YXD C;  2NPS B;  1NU1 E;  2KLV A;  2M8R A;  1T3J A;  3H1I D;  2POH A;  4WWI A;  3L71 E;  4U3F D;  4ASW A;  2P58 A;  5BVZ A;  4GOF A;  4EI2 A;  1ZR4 A;  2A06 D;  5AW6 B;  1ZR2 A;  3B71 A;  1P84 E;  2Y0C A;  3PH0 A;  5CHX A;  1GZL A;  2RMZ A;  4HJG H;  1FU1 A;  1KYO D;  1SQP G;  5AVR B;  4BXL A;  2HPC A;  1JM0 A;  1QGK B;  1PPJ E;  1W5C E;  1JY3 P;  1LJ2 A;  1NTM D;  1VPC A;  2CK3 H;  2IX7 C;  4ZKP A;  1IFD A;  2ZYD A;  1SS1 A;  3PP5 A;  3KZI H;  3L70 G;  3KZI E;  3H25 A;  1DX7 A;  1T2K C;  3OAK A;  2C9N Y;  1VF5 B;  3L71 J;  4IOI H;  1E79 H;  1PPJ D;  3HUS B;  1VF5 C;  2N1T D;  1VQ4 P;  3HUS C;  1VQ9 P;  1RY3 A;  2E42 A;  1NU1 J;  1AVY A;  2QEX P;  1EZV I;  3CWB E;  1SFC D;  1LTA C;  1SQX D;  2FKW B;  2JWA A;  3OJA B;  4KJM A;  5K5G B;  1VQM P;  3B5N B;  1SQP E;  5GTH H;  2FYZ A;  3H1H J;  3MTU E;  3WU2 E;  3O8Z A;  4IFM A;  5KJ7 D;  2Y9Z A;  1JY2 N;  5AVQ B;  5KLV D;  1HWT C;  3AE7 C;  3L73 E;  1OWA A;  3H1K G;  2B89 A;  1L4A C;  2P10 A;  2GM4 A;  2KS1 A;  3LIE A;  2HPC B;  2W8Z A;  3L74 J;  3Q5P A;  1N7L A;  5AVU B;  3BCC E;  3V2N A;  1NYH A;  4RO0 A;  1HGV A;  2H8P D;  4UB8 H;  2FFD A;  1YBK A;  3L72 G;  2E76 D;  1M1J B;  2B88 A;  2OYI B;  2MJZ A;  2PAJ A;  3BCC G;  2A45 I;  1Q2N A;  2YKP A;  3BRT B;  3CCS P;  2QA4 P;  5AW4 B;  1S5L X;  5KLV J;  1KN7 A;  3M06 A;  5L8R J;  1SQB D;  1A02 F;  2ZT9 D;  1GD2 E;  1X22 A;  4H13 B;  3C1L A;  3SSU A;  3G6E P;  4GOE A;  2IYO A;  4YPC A;  1NO4 A;  2Q3E A;  3AE5 C;  3VMA A;  4IFF A;  3CX5 I;  1FZE A;  1ZLL A;  3FWN A;  1J1D B;  2ZFC A;  2H88 C;  2M5A B;  2FBW C;  1RF0 C;  2O1K A;  2WPR A;  3Q2Y A;  1U57 A;  2E75 D;  1HJ0 A;  1LWU A;  2N9Y B;  1KIL A;  1NTM G;  4HH2 A;  2BEZ F;  1NOH A;  3V4Q A;  3VMY A;  2A45 G;  1FZB A;  4AUW A;  1MFZ A;  4BRY A;  2WPQ A;  2NRG A;  2DW3 A;  1IJD B;  2KI7 B;  2QJK C;  1BCC G;  3AEB C;  3H6P A;  2WMM A;  2YXQ B;  5C39 A;  3MUD C;  1KV4 A;  3VYI A;  1RF1 C;  3WU2 H;  1RF1 B;  1KQL A;  1KYO H;  3Q5R A;  1BE3 G;  4N6J A;  3BAT A;  2QM8 A;  3VP8 A;  4EYY Q;  4WY4 C;  1JY2 P;  4WY4 B;  2WQY C;  2OAR A;  2J5U A;  3MGN A;  1VQ8 P;  1N7S A;  3L72 J;  2IPP A;  5DJU B;  1IZN B;  2PGD A;  1N7S C;  2ZVO B;  3JC2 2;  1N73 B;  2FYU K;  1QVF O;  1L4A B;  2B9B A;  1YHQ P;  4R4M A;  2O3J A;  1JMB A;  1VQL P;  4PJ0 E;  4WY4 A;  3VTP C;  3RK2 C;  3L36 A;  3H1H D;  3K5B A;  3KYQ A;  2OGU A;  3HD7 C;  3L75 E;  3TK1 A;  3EFG A;  3F89 A;  4PV1 D;  1L0L J;  1GW3 A;  1DEE G;  3PRJ A;  5H2F E;  4NPD A;  2KZI A;  2WVR A;  2YXR B;  1SLQ A;  5AVS B;  2OYI A;  1FZC C;  5CJ4 A;  1ZME C;  1CW5 A;  3H1K J;  2WSC H;  3RK3 B;  2IBZ E;  2IFN A;  3QWO C;  1OVU A;  1OW7 A;  2HR3 A;  1E5W A;  1NTZ D;  3S9O A;  3G71 P;  3AE3 C;  1NTK E;  2E74 D;  3G9R A;  1CZQ A;  2LXB A;  1LT1 A;  1FZC A;  1SQB E;  1H0T B;  2WSF J;  2ZYA A;  1R8E A;  4UB8 E;  1PPJ G;  3E1R A;  2Q1K A;  1G2C B;  1BSN A;  1NTK K;  2J59 M;  2ZJS E;  3G3Z A;  3L74 D;  4IL6 H;  3I55 P;  4IFD K;  5KKZ B;  3RBZ A;  1BGY G;  1SQX G;  3RGU A;  1JO5 A;  1PGO A;  2JJL A;  1Q90 D;  2K9J B;  2FY8 A;  3B5N C;  4GDO A;  3HE5 A;  4H0L B;  3H1I G;  4JF7 A;  2AEM A;  2CPB A;  4YTP C;  1CI6 B;  4ZKU A;  2W6J H;  1M8O B;  1G1J A;  2MKV A;  3CCU P;  2FFD B;  2L5G B;  1KQF B;  1H89 A;  1Q82 Q;  2FYN C;  1PP9 E;  3H1I E;  1NKN A;  2GUS A;  2W83 C;  1OVV A;  1PV3 A;  1M90 Q;  1L0N D;  1SQQ G;  1OXZ A;  4JQ0 D;  1W2E A;  2KS1 B;  2ZT9 C;  1U7J A;  2R3C A;  2RKL A;  3BRV B;  4PD4 D;  3HD7 B;  1M1J C;  3D70 A;  2E5T A;  1VL2 A;  3L73 G;  1S1C X;  1KD1 Q;  1JY2 O;  1YTZ I;  1M57 D;  1BDD A;  1K05 A;  3LW5 J;  2O01 H;  2AXT H;  3P8C E;  4TLF A;  3WUV A;  5KJ7 A;  1FE6 A;  1VQO P;  2BEQ D;  1SQB K;  3UIA A;  1N73 C;  1CSB A;  2HYN A;  1U7M A;  2OTJ P;  1IFP A;  2IYP A;  2HFE D;  1SP4 A;  4Y99 B;  4OGQ D;  1GK6 A;  5CJ0 A;  5H2F H;  1KQG B;  3RL0 D;  2WT7 B;  2XV5 A;  1LWU B;  1JTH B;  3B5N D;  2IBZ I;  1LWU C;  4OH8 B;  4D6T J;  3L35 A;  3CL3 D;  4BWN A;  1KYO E;  1FS0 E;  3P7K A;  3QH9 A;  1RF0 A;  3I5C A;  2D2C C;  1W2B O;  1EQ7 A;  2JDI H;  3CCJ P;  3R4Y A;  2FYU E;  1URQ A;  1ZOY C;  1ZP0 C;  3V4W A;  2JKV A;  1S9K D;  1FZG A;  1SVF A;  5CCG C;  1YI2 P;  1DIP A;  3RL0 g;  1VDF A;  3TNU B;  1FDO A;  5KLV K;  1Q81 Q;  1NJI Q;  3W68 A;  1VQ7 P;  3CMA P;  1Y47 A;  3CD6 P;  1SQV D;  1SQX K;  3AED C;  1IFJ A;  1T8Z A;  4IL6 E;  1GDT A;  1IK7 A;  3H32 A;  1YJN P;  1GK4 A;  2N9B A;  2YNY A;  2AEJ A;  1KOR A;  2KSE A;  2OYH C;  2K88 A;  1JTH A;  4ASV A;  1EZV E;  4N3Y B;  1SQV E;  2FYU G;  3EQ2 A;  3KDP B;  2ZT9 B;  4U3F G;  4N78 D;  1YTZ T;  4H13 D;  4XA4 A;  3CCQ P;  3AE4 C;  3HRN A;  1N73 A;  1SQQ K;  4ZMD A;  2Q9I A;  1BCC J;  2AEF A;  2KSJ A;  1SQV K;  2KZJ A;  2R5B A;  1NWQ A;  4U3F E;  1BDC A;  5AVY B;  1G1I A;  1HJB A;  5AW8 B;  1LTB C;  3LID A;  1N7S B;  3FXE A;  1BE3 J;  2RH0 A;  3AEF C;  1AVO A;  1SFC C;  1NTM J;  2AXT E;  2ITA A;  2Y0E A;  5EFW B;  3H1J E;  3AEG C;  3SWK A;  3T97 A;  5CBN A;  1N86 A;  3GF7 A;  2OYH A;  2HLO A;  2GA1 A;  1YIT P;  1LP1 A;  1N2D C;  4JBZ A;  4JYB A;  5KJ7 C;  1JMM A;  1ZW0 A;  2D2C B;  3HUS A;  4PD4 I;  1EC5 A;  2JEE A;  1OW6 A;  2QJY C;  2P67 A;  3R2P A;  4L73 A;  1KYO I;  1GL2 D;  1JCC A;  4OVN F;  2B87 B;  1X0T A;  3IAO A;  4UB6 H;  4UB6 E;  3M9B A;  1IFI A;  1L0N J;  3NFQ A;  4DT0 A;  2HOD A;  1VQP P;  3TGU G;  1R5S A;  3NMD A;  3CCV P;  1LTG C;  1GW4 A;  1YQ4 C;  2I1J A;  2M3B A;  2QM7 A;  3M9H A;  5GTI E;  2IDB A;  2K1A A;  2BCC E;  5TIS H;  2P2U A;  2V7Q H;  2K3R A;  2E43 A;  4W80 A;  3A0H E;  3A0H H;  3CXH D;  1NTZ J;  2W90 A;  2WSE H;  4NPE A;  2QIW A;  1LTS C;  3GHG C;  4LGD E;  1X9V A;  1NVO A;  4YXW H;  3BCC D;  1BGY D;  3GHG A;  2QJP B;  3P8M C;  5AW7 B;  1FZA A;  3A2A A;  1QX8 A;  3A3Y B;  3H1L E;  3TGU J;  2NZ2 A;  3H1H G;  3HD7 A;  2B87 A;  4XE5 B;  2VRS A;  4PV1 B;  1KQS O;  2Q7C A;  3CC2 P;  3U1C A;  1JUN A;  1NTK D;  1BGY E;  2FYN B;  2KB7 P;  1PGP A;  1RH5 B;  1USD A;  2WPS A;  3EWK A;  2C0W A;  3M9Q A;  3KHU A;  3PLN A;  1LTI C;  2R44 A;  3PTZ A;  4I2L C;  3IFM A;  2G8Y A;  4OGQ C;  1IFM A;  2I8D A;  2M5A A;  3RL0 C;  4C46 A;  1IO4 A;  3L70 J;  1NTZ K;  1OIP A;  1XTG B;  2KOG A;  1DD3 A;  2LXC B;  1KIL B;  1OZH A;  2SPZ A;  3O6Q A;  1IK9 A;  2NPS A;  2FXO A;  4PD4 E;  2RN0 A;  1SQQ E;  1YJW P;  4W7Z A;  4JYC A;  2XU6 A;  1FDI A;  1IC2 A;  1YQ3 C;  3H1J D;  4L76 A;  5E79 H;  1PZQ A;  3CME P;  5B5E H;  1SFC A;  3HE4 B;  4DZO A;  1VQ6 P;  1FJP A;  3IF4 A;  4H0L D;  1JEK A;  3KPE A;  1SQX E;  1J1D C;  3M0A A;  1NU1 G;  4R4L A;  2ZAE B;  1M7L A;  5BU8 B;  3AEE C;  1S2E A;  2QJY B;  4XFJ A;  4DJG A;  2I1K A;  3MZW B;  3L71 G;  5AW2 B;  3H32 B;  5TIS E;  3V5B A;  2WPV B;  2PP6 A;  3V6I A;  3A7O A;  3D6Z A;  2YO2 A;  3USS A;  4M3L A;  1SQQ D;  1PP9 G;  1OW8 A;  3M0D A;  4H13 C;  3HD7 D;  2OQQ A;  1HH0 A;  4I1L A;  5CMZ A;  3U59 A;  5B66 E;  1FZF A;  3A0B H;  4HYT B;  1PIX A;  1SQX J;  1HUC A;  4L75 A;  2Z5H A;  3L70 D;  4AYC A;  5APX A;  1ZRT D;  4U7J A;  1EDJ A;  3TGU D;  2J58 A;  2R32 A;  2N1T A;  3GHG B;  3SWY A;  3A5T A;  3D71 A;  1LTJ B;  1P84 D;  3N4X A;  2QG4 A;  1UIX A;  2NPS D;  4AQR D;  1SQQ J;  2E74 C;  1PFI A;  2OYO A;  2XNX A;  1H0T A;  1K9M Q;  1SQP K;  3CXH E;  2LR2 A;  1X79 B;  3CXH H;  2ZXE B;  3L4F A;  3CI9 A;  3L70 E;  2UWJ E;  1VQ5 P;  1QVG O;  1KC8 Q;  2Q5U A;  2H7H A;  1JNM A;  1Y9B A;  1USE A;  2R5D A;  3D6Y A;  2XDJ A;  3Q5S A;  1WRG A;  1KB9 D;  1BGY J;  1URQ D;  5APV A;  5KAI H;  1HGZ A;  1Y8A A;  3GW6 A;  3CX5 D;  4N78 E;  2QRX A;  1L0L K;  3CWB D;  1LP1 B;  5E79 E;  1SQV G;  3V2P A;  3H1L J;  1ZV8 A;  4GOD A;  3TGU E;  4ZNC A;  3PHL A;  3H1J G;  1GTW A;  1VF5 D;  1N8R Q;  1LTJ A;  1L0L G;  2N1T B;  4GIF A;  4WVZ A;  3AE6 C;  3NXS A;  1MZ9 A;  1L4A A;  4WY4 D;  4Y28 J;  1SFC B;  2C0X A;  3HE4 A;  4Y99 C;  5APT A;  4Z1M H;  1OMI A;  1FBM A;  1NTZ E;  4IL6 X;  3WUU A;  2Y9Y A;  1RE3 C;  3KQG A;  2YMY A;  1QEX A;  1QL2 A;  2V7Q J;  1X8Y A;  2BCC J;  3B4S A;  3FGA D;  3IN6 A;  3SWF A;  1Q86 Q;  1N7S D;  1L4A D;  2A06 E;  5DJT B;  1FAV A;  3MP7 B;  3B5N A;  3V2R A;  3WMM 0;  1HF9 A;  4RJT A;  1L0N E;  3AE8 C;  3RK2 D;  5B66 H;  2KLU A;  2P1J A;  4K35 A;  1URQ C;  4PD4 H;  2QJP C;  1GU4 A;  4DOJ A;  2E76 C;  2L91 A;  3GG2 A;  2D2C D;  4PV1 C;  1AFO A;  1JY3 N;  2HG5 D;  1VQK P;  4I6M C;  2FFD C;  2OTK E;  2FXM A;  3N7N A;  1Q7Y Q;  2WSF H;  2BCC D;  1GL2 B;  2YKO A;  3RK3 D;  2OYH B;  5AW0 B;  1DD4 A;  1KMI Z;  2A06 G;  2IZ1 A;  3H1J J;  1JY3 O;  1NTM E;  3LW5 H;  2KUB A;  5GTI H;  1NHL A;  1BE3 E;  1ZN5 A;  2FXP A;  3G4S P;  3RK3 E;  1NTM K;  4H0L C;  4U3F J;  5KAI E;  3BVH A;  4KHX A;  5KLI B;  1BCC E;  1NU1 K;  2E75 C;  2HOD B;  2V4H A;  2QSI A;  4LC1 A;  1YIJ P;  1VQN P;  1KFM A; 
#chains in the Genus database with same CATH homology
 1NVO A;  1JMB A;  2JWD A;  2QVA A;  4NPF X;  4MN4 C;  2B87 A;  1DEE G;  4NPD A;  2KZI A;  1S3J A;  2R44 A;  3QWO C;  1OVU A;  2I8D A;  2M5A A;  2HR3 A;  2LXC B;  2SPZ A;  2LXB A;  3FXD A;  1LT1 A;  1H0T B;  1EDI A;  2Q1K A;  4WWI A;  4ASW A;  2P58 A;  4GOF A;  4HB1 A;  1MFT A;  2ZAE B;  3PH0 A;  3MZW B;  1OVV A;  4HJG H;  4BXL A;  1JM0 A;  2KS1 B;  1U7J A;  2RKL A;  1SS1 A;  1BDD A;  4IOI H;  1U7M A;  1EDJ A;  5K5G B;  4KJM A;  5CBO A;  1ZXG A;  1H0T A;  2LR2 A;  2B89 A;  2UWJ E;  1OVR A;  1Y47 A;  2B88 A;  2QRX A;  1LP1 B;  1Q2N A;  4CPG A;  4GOD A;  4ZNC A;  3MHV A;  4ASV A;  2M0B A;  3RGU A;  4GOE A;  4ZMD A;  2KIK A;  2KZJ A;  1EDK A;  1BDC A;  2M5A B;  3FXE A;  3S1K A;  5DJT B;  1EDL A;  5EFW B;  1FC2 C;  5CBN A;  1LP1 A;  4JBZ A;  4K35 A;  1ZW0 A;  4K3A A;  2KI7 B;  1EC5 A;  5C39 A;  2WMM A;  2OTK E;  2B87 B;  4HKZ H;  1X0T A;  4EYY Q;  2KUB A;  2K3R A;  5DJU B;  3ZDM A;  4NPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...