1W5CE

Photosystem ii from thermosynechococcus elongatus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
77
structure length
76
Chain Sequence
b'RPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFAKQQVETFLEQLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM Q(B) PROTEIN 1
publication title Crystal Structure of Cyanobacterial Photosystem II at 3.2 A Resolution: A Closer Look at the Mn- Cluster
rcsb
molecule tags Photosynthesis
total genus 14
structure length 76
sequence length 77
chains with identical sequence K
ec nomenclature
pdb deposition date 2004-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 1w5cE00
5E79E 4UB6E 5B66E 3WU2E 4UB8E 4PJ0E 5GTIE 3KZIE 1S5LE 5KAFE 3JCUE 4IL6E 5TISE 5H2FE 2AXTE 3A0BE 3A0HE 5B5EE 1W5CE 5GTHE 5KAIE
chains in the Genus database with same CATH superfamily
2KS1B 1WRGA 4I7ZC 5EFWB 2QM7A 2A45H 2NPSA 1J1EC 3GMAA 4I1LA 2IFMA 5H2FE 2FY8A 3E7KA 2A06G 2M5AA 2ZVOB 1OFCX 3CPWO 3B71A 1OVRA 1VF5D 3RL0D 3CXHD 2L91A 1KQLA 1W2EA 3QWOC 3M9HA 4H13D 1L0LG 2WSSH 3V4WA 2FYUD 1KORA 2AXTE 3H1JG 1NTKJ 1FC2C 4WY4A 2N1TA 2MKVA 4UB6E 3L35A 3HUSC 1KB9D 1NU1J 1X22A 2D2CC 3H1IG 4OVNF 2P10A 3A2AA 1HH0A 1A02F 1IK9A 3ZDMA 1SQXK 1G2CB 3A5TA 4HKZH 4RESB 4GDOA 3MGNA 3M06A 1SQXE 5TISE 1GU5A 2YXRB 4IOIH 3W67A 1KILB 2KI7B 4H44D 2N9BA 2W90A 2ZYAA 2JWAA 3RK3E 1BDCA 3WU2E 2O01J 2J59M 4EDFA 4PJ0E 2YMKA 2Q9IA 3HTKB 5TJHA 2B87A 3HD7A 4IFFA 5KLVG 2L5GB 1DD4A 1D7MA 4DJGA 2HR3A 3RL0g 2A06D 1ZLLA 3D6YA 2WPSA 4H0LC 2HLOA 3GG2A 1AQTA 1NKNA 5AW4B 1HBWA 5APWA 1GW3A 1L0LD 4OGQC 2WQYC 3CCQP 1M7LA 2G3AA 2IFNA 3JCUH 1KMIZ 1M8OB 1NO4A 3H1JD 3H1IJ 1IFIA 4N6JA 1IO4A 5AVQB 3BRTB 2ZXXA 1SQVK 3E1IA 4I2LC 3CCRP 1VQ8P 2ZJSE 2QJYC 3K5BA 1N73B 1XTGB 3L71E 2OTLP 1YJNP 3KPEA 2P58A 3L36A 1SQVE 1ZRTD 2E43A 1CI6B 1GL2B 1JCCA 1AVYA 2C0WA 2RMZA 2IYOA 1NGMB 3UIAA 1Y8AA 3VP9A 1P84D 3AEGC 3I5CA 4A7PA 3Q5SA 3N4XA 1MZ9A 2KLUA 2HODA 2JP3A 2WPVB 1CZQA 3MUDA 1LTJA 2W8ZA 2Q3EA 1NTMD 1N86A 1URQB 1SQXG 2KP8A 5KLVD 5AVXB 1N7SA 3HRNA 1MKMA 1LNQA 3BRVB 1AQ5A 4JYCA 2XZRA 1VQ4P 5AW9B 3II6A 1SLQA 2FKWB 1FAVA 3HE5A 1PGQA 1NHLA 1H0TB 3VTPC 1ZV8A 1OMIA 4MN4C 3G71P 1HGVA 2O01N 2QSIA 1YTZT 1FZFA 2WTYA 2JEEA 3CC2P 3PP5A 3WUUA 1G1IA 5B66E 3TNUB 3F5HA 1SFCD 4BXLA 4UB8E 2LXCB 3AE8C 1JY3P 1LP1B 4XA4A 5BU5A 2YIUB 2WT7B 2Q3IA 5APXA 4C46A 3H1HG 2P67A 3KZIE 3H32A 3B8EB 3L74E 1S5LH 3ITKA 3JC22 2YXQB 2AEFA 4WWIA 3S9OA 2SPZA 3L72G 1VQOP 1SQBK 2WPQA 3SWYA 1SQVG 1MUUA 1FZBA 5E79E 4I6MC 5GTHH 3AECC 3Q5RA 2IBZE 1S3JA 2I8DA 3TGUJ 1M90Q 3CD6P 1NKZB 1JY2O 4N3YB 1SQXD 1SQBE 2KOGA 4K35A 1LTTC 1PPJE 2WZ7A 3M0AA 2H8PD 2QJPC 1FZCC 1NOHA 3KYQA 5APUA 1NAYA 2UWJE 2LXBA 2BEQD 1Y9BA 2O1KA 1IJDB 3W68A 2KUBA 1EDLA 1USDA 2M3BA 1KILD 1KQGB 3V4QA 1KB9E 4PV1C 3GLMA 1RH5B 1DD3A 2IYPA 3P8MC 2FYNC 2YKPA 1L4AB 3C1LA 1E5WA 3B5NC 1KYOE 2IZ1A 2M5AB 3CX5H 2HYNA 5KAIE 2NPSC 4EYYQ 5CCHD 3MZWB 4JYBA 3L71J 2OYIB 3H1HD 1FS0E 4TT3H 1RE3A 5AVRB 4R4LA 2XNXA 5AW5B 2H7HA 3R2PA 1OW8A 1GD2E 3L72D 3V2QA 1SQVD 4PD4I 5CCGA 2N1TB 1VQKP 2M0BA 2PFXA 2R3SA 2PAJA 3NFQA 2M8RA 3FGAD 1PGJA 2K9JA 1T2KC 2IBZG 4WB4A 3CL3D 3BCCJ 1M56D 3VMXA 1GL2D 3SFEC 3G4SP 2BCCG 1SQBG 4D6TJ 4DZOA 4IFDK 1RF1B 3L70E 1PPJG 2BEZF 1BE3J 3AE6C 1JY3N 4IL6X 2G8YA 5AVZB 2H43A 2O01H 1KB9I 1GTWA 1K05A 1ZRTE 2PP6A 2I1KA 1URQD 2GM4A 1S72P 1QL2A 1BCCE 3AE3C 3HE4B 1P84E 1HVVA 2RN0A 1S9KD 3V2PA 1PP9E 4LC1A 4EI2A 1W2BO 1X79B 3L74J 1IC2A 2PGDA 5GTIE 1FOSF 1VQ9P 1NTME 3RBZA 5KLIB 1L0NK 4GKGA 1JMMA 1VQPP 3H1KE 1BGYD 2Q1KA 4I7ZB 3Q2YA 1BDDA 3OJAB 2OYHA 1DEBA 4C7NA 3PJSK 3B5NA 3RK2B 3AEBC 1XTCC 1L0NE 1YQ4C 1OW6A 3Q3DA 2WPRA 5AVVB 3GHGC 1GK6A 5APYA 2IBZD 2KIKA 1KQFB 2K37A 2BCCD 3S4RA 1HJBA 1SQBD 2YO2A 2FYUJ 3M0DC 3AE9C 1JTHA 2QIWA 1ZR2A 3NXSA 3VYIA 1PPJD 2XDJA 3A7OA 3C8VA 3Q5PA 1SQQK 3SFDC 5AW2B 1GW4A 1PV3A 1JO5A 1NTZK 4CPGA 3H1LG 4JQ0D 3CWBE 1SP4A 3HUSB 2K9YA 3MUDC 2D2CB 1LTJC 1SQPK 3L70G 3VMYA 3WMM0 1SQQE 1GMJA 5BVZA 2JWDA 1KQSO 3O6QB 1N7SC 1DX7A 1NTZE 5APSA 2YMYA 1SQPE 3V2RA 1P84I 1KYOD 3MP7B 2HPCB 1J2JB 2QA4P 2C9LY 2I1JA 2Q5UA 1BCCG 4XFJA 1EDIA 2FXPA 1NU1D 1PP9G 2YKQA 1S2EA 1LTGC 1L4AD 3FXDA 1EXIA 3RK3C 4NPFX 4UB6H 1BSHA 2KSJA 1NTMG 2YO3A 3JCUE 3LW5J 5KAFH 3H1KG 2M3EA 3G9RA 1A02J 1JY2P 3CLQA 1L0LJ 5AVWB 1KILE 4XE5B 1FDMA 2FFDA 4OGQB 1L0NG 3H1JJ 5BU8B 2W27A 1AA0A 5DJUB 1EDJA 3JSVC 1JOCA 1GZLA 1Q2NA 4RJTA 3H1LD 1FDIA 1W5CE 2ITAA 5CCHC 1OW7A 2FBWC 1Q81Q 3L70D 2ZT9C 3U59A 5AW3B 3H1HE 3L73D 4N78D 4M3LA 1FJKA 2KK7A 5CMZA 1QX8A 2R5BA 3VP8A 2Z5HA 2B88A 3TYYA 2J58A 4YTPC 3CWBG 1QVGO 3L72E 3GHGA 3A0HH 2E74C 1N8RQ 4DCKA 3FX0A 1KZUB 1SQQG 1KTMA 1FU1A 3M0DA 4EIJA 5AW7B 1NTZG 1BCCD 3P32A 2P1JA 2KS1A 3VN0A 1SQPG 1JCDA 1PP9D 1EC5A 1SVFA 1YQ3C 2QJKB 1NTMJ 4Y99C 1LTIC 1NAFA 1AVOA 4BRYB 3EFGA 5KLVJ 1RE4A 2RKLA 3OA7A 1RQUA 3T97B 1N2DC 4HJGH 3LIEA 3L75E 4R4MA 5CBNA 3H1KD 4K3AA 4LGDE 1Y47A 1RE3C 1NJIQ 1H89A 3IF4A 1LT9B 4BWNA 1RF0A 1L0ND 4TLFA 2K88A 4GIFA 5CCGC 2Z4EA 3KDPB 2IDBA 5L8RJ 2K1AA 5KJ7D 3P8CE 1M1JC 1S5LE 1G2CA 1S9KE 3RK2D 4IFMA 2OQQA 1VQLP 3CCUP 3CWBD 5GTHE 3CCLP 2ZAEB 2ZYGA 3RGUA 3I56P 1SQQD 1PGPA 4GODA 1KILA 1LTBC 3C9IA 1YJ9P 3PTZA 2O3JA 1NTZD 4IL6H 2NZ2A 1BGYE 3CMEP 1KFMA 4WBAA 1Q82Q 1SQPD 1T3UA 2XV5A 2YIUC 3HTKA 4AUWA 1SQXJ 5B66H 4UB8H 5CCHA 1OWAA 4U3FE 2D2CD 2BCCE 1VF5C 1JY2N 3RL0C 5AVSB 3V2NA 1MV8A 2WWWA 3AE4C 5K5GB 2QJPB 1FZCB 1J1DB 2E76B 2K3RA 4H13C 2WSFJ 2BASA 4NPEA 1TU3F 2GUSA 3ABVC 1KV4A 4RO0A 2WMMA 3L75G 1OVUA 2KNCB 1VL2A 4PD4H 2CPBA 3BATA 1GDTA 1YYCA 2KZIA 4PV1B 1FOSE 1R5SA 5CHXA 5M1BA 1N73A 2FYNB 1PGOA 1NTKK 1VQ5P 4NPDA 3USSA 1NWQA 3B5NB 3GF3A 4DT0A 2VRSA 2OYHC 2NPSB 1CI6A 1GL2A 2Q6QA 3H1HJ 1NU1K 1H88A 3A0BH 3CXHH 3E1RA 5AW6B 3A3YB 3CCSP 2JDIH 2IPPA 2WSEJ 1FBMA 1DEEG 2Z5IA 2KZJA 3L72J 1SQVJ 4C7RA 4OGQD 5CBOA 4H44C 1NU1E 2W6AA 1AV1A 2NRGA 1KC8Q 4DOJA 1BSNA 3F89A 4GOFA 4WY4B 1OXZA 1N7LA 3G6EP 1LWUC 1URQA 4Z1MH 1KB9H 4AQRD 1BGYG 1M1JA 2POHA 2IBZI 3O8ZA 1YJWP 5AVUB 5KTBA 1T3JA 1H0TA 3AE5C 3MTUE 2QE7H 2KB7P 4U3FG 1WT6A 2E75B 1L2PA 1HWTC 3L75D 1LTSC 3H1LE 3OW2O 1PFIA 3BVHA 3TNUA 5B5EH 3WUVA 4Y28J 3L73E 2Y0CA 4N78E 1LP1A 3EQ2A 2DW3A 1EXJA 3AE1C 2WT7A 2B87B 3HD7B 1Z56A 4B86A 3PLNA 3LW5H 2GA1A 1VQ7P 2C9NY 3P8CD 1RF1C 1KYOI 1WMKA 1ZP0C 2FFDC 1CW5A 3AEFC 5KKZC 4YXDC 3AEEC 2JR8A 1EZVD 1LGHB 1BGYJ 1YBKA 1SS1A 1JUNA 1AFOA 1NU1G 1YIJP 2E5YA 4L73A 1M57D 1JMBA 4HH2A 1J1EB 1IFDA 1K8AQ 1JB0J 2WSCJ 5AVTB 2OTJP 2BCCJ 1SQBJ 1YITP 1RY3A 2KYVA 1P84H 1VPCA 1HUCA 4U3FD 1YHQP 2OTKE 1U57A 1SFCC 1QVFO 1K9MQ 3PH0A 2HODB 1L4AA 5GTIH 3U1AA 5CJ4A 3RK2C 3MIWA 1LWUA 1LTJB 4GT1A 4L74A 1JNMA 1RE4C 2OYIA 3BASA 1N7SB 3CX5D 2QG4A 1FZEA 5APTA 1FDOA 2CPSA 3L73G 3D70A 2YNYA 2E76D 3R4YA 1YI2P 5H2FH 3HE5B 1RF0C 1R8EA 3D6ZA 1FJPA 1NTKD 3NMDA 2MJZA 4PV1D 5KAFE 2RH0A 2HFED 5DJTB 2A45I 2WVRA 3RK3B 1UIIA 2AXTH 3Q1MA 2OYOA 3B5ND 1QL1A 2NPSD 3M9QA 2A45G 3IFMA 1CSBA 1S4XA 2W6BA 3H32B 1RF1A 3RBXA 4H0LB 3TGUE 4L75A 3SSUA 1KILC 2R44A 2B89A 3H1LJ 4WY4D 1ZW0A 5TISH 3L70J 2N1TD 3NTNA 5AW0B 3L73J 3A0HE 2ZT9B 3KXDA 3HE4A 2J5UA 2QJYB 2P7JA 1QEXA 3WU2H 1PL5A 4PJ0H 1T2KD 2ZYDA 3FXEA 2E74B 2WSFH 2YKOA 4GOEA 1ZN5A 2QM8A 3VOPA 1BCCJ 2ZFCA 2E75D 3H25A 5KJ7A 1S1CX 1Q7YQ 1KD1Q 2E42A 3H1ID 1Q90D 4W7YA 1PP9J 4HB1A 3VMZA 1SFCA 4L76A 2KLVA 3I55P 4Y99B 5APQA 1N73C 1QLED 1MFTA 2N9YB 1ZOYC 2FYZA 3HD7D 3H1KJ 1RHZB 1R5LA 1GL2C 3AEAC 3S1KA 4KJMA 2IZ0A 2WSEH 3L37A 1L0NJ 3FWNA 3U1CA 1GK4A 2QEXP 2QJKC 3IN6A 1H8AA 3SWKA 2HG5D 4ASWA 3HUSA 1LT1A 1MFZA 1DIPA 3IR9A 3BCCE 2W6JH 3TGUG 1FZAA 3D71A 4KHXA 1K04A 1NYHA 1URQC 1LTAC 2B9BA 2W83C 1K73Q 1U7MA 1M1JB 2R5DA 3O6QA 4EOTA 4D6TE 3TSIA 2FXOA 3CWBJ 1BE3E 4IL6E 4ASVA 2JO1A 2K9JB 1LT9C 3AEDC 3CMAP 3KHUA 1SQQJ 2HPCA 3MHVA 1HJ0A 1NTZJ 2GUVA 1EZVE 3AE2C 2WITA 2Y9YA 1X0TA 1HGZA 1SQPJ 1T6AA 1KN7A 5CJ0A 4ZKUA 2LKMA 4QMAA 4OWFA 3H6PA 3AE7C 1VF5B 1HTLC 2XNDH 3RL0B 1N7SD 2R32A 1IZNB 3L71G 2V4HA 1ZMEC 4PD4E 1VQ6P 2Q7CA 3OAKA 2CK3H 1HF9A 4ZKPA 4H13B 1EQ7A 1UIXA 1AJYA 3EWKA 1X8YA 2PRRA 1LJ2A 2KXPB 3KZIH 3PRJA 2FYUK 3A0BE 3CXHE 1PIXA 3FWLA 4RKUJ 3TGUD 3CX5E 4KT0J 2H89C 3TK1A 3RK3D 5E79H 3LIDA 1IFNA 2QVAA 1VQNP 2QRXA 2OYHB 2FYUE 1J1DC 2E76C 4C7NB 3CC7P 2WSCH 3V5BA 3G3ZA 2FXMA 2V7QH 3P7KA 3BCCG 1PZQA 3VMAA 3WUTA 3TF5A 1GU4A 5AW8B 1NTKE 4D6TG 4H0LD 3CCJP 4H44B 1JTHB 1E79H 1DH3A 2KSEA 1T8ZA 1BE3G 1EZVI 4BRYA 1LWUB 2Y0EA 1L4AC 3T97A 1Q86Q 1EZVG 2ZT9D 4WVZA 4JF7A 3SWFA 2OYIC 3L71D 1QGKB 4W80A 5B5EE 3PHLA 1KYOH 1VQMP 1IK7A 1LT9A 1X9VA 5C39A 1G1JA 4JBZA 2OGUA 1IFMA 2E74D 2OARA 5KAIH 1YTZI 3L75J 4JPZB 2C0XA 1IFJA 2ZXEB 4WY4C 1FZGA 3CCMP 3L74G 5AVYB 2E5TA 2JJLA 1L0LK 2N1TC 3IAOA 2A06E 4YXWH 3TDKA 2AXCA 1OIPA 5AW1B 1ZR4A 1NVOA 4YPCA 3CCEP 2XU6A 3CI9A 2O1JA 4OH8B 1M1KQ 3B4SA 1OVVA 3CXHI 1L0LE 3CX5I 1IFPA 3V6IA 1VDFA 3H1JE 2JKVA 1U7JA 2E75C 3KQGA 3BCCD 1KFNA 2Y0DA 1JY3O 1S5LX 4U7JA 4D6TD 3H1IE 2P2UA 2FYUG 2FFDB 4ZNCA 1BE3D 5KKZB 5APVA 5CCGD 3GF7A 3HD7C 2R3CA 4ZMDA 1NTKG 3M91A 2AEMA 3M9BA 4O9BA 1NTMK 2LR2A 4LLHA 4W7ZA 5KLVK 2H88C 3CC4P 1FZCA 2IX7C 1USEA 1ZXGA 1FE6A 1JEKA 3L4FA 1EDKA 4U3FJ 3GHGB 2AEJA 4HYTB 3GW6A 3QH9A 3CCVP 2V7QJ 2KNCA 3EFFK 5KLVE 3L74D 1OZHA 4AYCA 2Y9ZA 2XKMA 1SFCB 3N7NA 3MD0A 1JM0A 4PD4D 5KLIC 1RQVA 1NH4A 5KJ7C 2ZVNB 1OX3A
chains in the Genus database with same CATH topology
5E79E 4UB6E 5B66E 3WU2E 4UB8E 4PJ0E 5GTIE 3KZIE 1S5LE 5KAFE 3JCUE 4IL6E 5TISE 5H2FE 2AXTE 3A0BE 3A0HE 5B5EE 1W5CE 5GTHE 5KAIE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E79 E;  4UB6 E;  5B66 E;  3WU2 E;  4UB8 E;  4PJ0 E;  5GTI E;  3KZI E;  1S5L E;  5KAF E;  3JCU E;  4IL6 E;  5TIS E;  5H2F E;  2AXT E;  3A0B E;  3A0H E;  5B5E E;  1W5C E;  5GTH E;  5KAI E; 
#chains in the Genus database with same CATH topology
 2KS1 B;  1WRG A;  4I7Z C;  5EFW B;  2QM7 A;  2A45 H;  2NPS A;  1J1E C;  3GMA A;  4I1L A;  2IFM A;  5H2F E;  2FY8 A;  3E7K A;  2A06 G;  2M5A A;  2ZVO B;  1OFC X;  3CPW O;  3B71 A;  1OVR A;  1VF5 D;  3RL0 D;  3CXH D;  2L91 A;  1KQL A;  1W2E A;  3QWO C;  3M9H A;  4H13 D;  1L0L G;  2WSS H;  3V4W A;  2FYU D;  1KOR A;  2AXT E;  3H1J G;  1NTK J;  1FC2 C;  4WY4 A;  2N1T A;  2MKV A;  4UB6 E;  3L35 A;  3HUS C;  1KB9 D;  1NU1 J;  1X22 A;  2D2C C;  3H1I G;  4OVN F;  2P10 A;  3A2A A;  1HH0 A;  1A02 F;  1IK9 A;  3ZDM A;  1SQX K;  1G2C B;  3A5T A;  4HKZ H;  4RES B;  4GDO A;  3MGN A;  3M06 A;  1SQX E;  5TIS E;  1GU5 A;  2YXR B;  4IOI H;  3W67 A;  1KIL B;  2KI7 B;  4H44 D;  2N9B A;  2W90 A;  2ZYA A;  2JWA A;  3RK3 E;  1BDC A;  3WU2 E;  2O01 J;  2J59 M;  4EDF A;  4PJ0 E;  2YMK A;  2Q9I A;  3HTK B;  5TJH A;  2B87 A;  3HD7 A;  4IFF A;  5KLV G;  2L5G B;  1DD4 A;  1D7M A;  4DJG A;  2HR3 A;  3RL0 g;  2A06 D;  1ZLL A;  3D6Y A;  2WPS A;  4H0L C;  2HLO A;  3GG2 A;  1AQT A;  1NKN A;  5AW4 B;  1HBW A;  5APW A;  1GW3 A;  1L0L D;  4OGQ C;  2WQY C;  3CCQ P;  1M7L A;  2G3A A;  2IFN A;  3JCU H;  1KMI Z;  1M8O B;  1NO4 A;  3H1J D;  3H1I J;  1IFI A;  4N6J A;  1IO4 A;  5AVQ B;  3BRT B;  2ZXX A;  1SQV K;  3E1I A;  4I2L C;  3CCR P;  1VQ8 P;  2ZJS E;  2QJY C;  3K5B A;  1N73 B;  1XTG B;  3L71 E;  2OTL P;  1YJN P;  3KPE A;  2P58 A;  3L36 A;  1SQV E;  1ZRT D;  2E43 A;  1CI6 B;  1GL2 B;  1JCC A;  1AVY A;  2C0W A;  2RMZ A;  2IYO A;  1NGM B;  3UIA A;  1Y8A A;  3VP9 A;  1P84 D;  3AEG C;  3I5C A;  4A7P A;  3Q5S A;  3N4X A;  1MZ9 A;  2KLU A;  2HOD A;  2JP3 A;  2WPV B;  1CZQ A;  3MUD A;  1LTJ A;  2W8Z A;  2Q3E A;  1NTM D;  1N86 A;  1URQ B;  1SQX G;  2KP8 A;  5KLV D;  5AVX B;  1N7S A;  3HRN A;  1MKM A;  1LNQ A;  3BRV B;  1AQ5 A;  4JYC A;  2XZR A;  1VQ4 P;  5AW9 B;  3II6 A;  1SLQ A;  2FKW B;  1FAV A;  3HE5 A;  1PGQ A;  1NHL A;  1H0T B;  3VTP C;  1ZV8 A;  1OMI A;  4MN4 C;  3G71 P;  1HGV A;  2O01 N;  2QSI A;  1YTZ T;  1FZF A;  2WTY A;  2JEE A;  3CC2 P;  3PP5 A;  3WUU A;  1G1I A;  5B66 E;  3TNU B;  3F5H A;  1SFC D;  4BXL A;  4UB8 E;  2LXC B;  3AE8 C;  1JY3 P;  1LP1 B;  4XA4 A;  5BU5 A;  2YIU B;  2WT7 B;  2Q3I A;  5APX A;  4C46 A;  3H1H G;  2P67 A;  3KZI E;  3H32 A;  3B8E B;  3L74 E;  1S5L H;  3ITK A;  3JC2 2;  2YXQ B;  2AEF A;  4WWI A;  3S9O A;  2SPZ A;  3L72 G;  1VQO P;  1SQB K;  2WPQ A;  3SWY A;  1SQV G;  1MUU A;  1FZB A;  5E79 E;  4I6M C;  5GTH H;  3AEC C;  3Q5R A;  2IBZ E;  1S3J A;  2I8D A;  3TGU J;  1M90 Q;  3CD6 P;  1NKZ B;  1JY2 O;  4N3Y B;  1SQX D;  1SQB E;  2KOG A;  4K35 A;  1LTT C;  1PPJ E;  2WZ7 A;  3M0A A;  2H8P D;  2QJP C;  1FZC C;  1NOH A;  3KYQ A;  5APU A;  1NAY A;  2UWJ E;  2LXB A;  2BEQ D;  1Y9B A;  2O1K A;  1IJD B;  3W68 A;  2KUB A;  1EDL A;  1USD A;  2M3B A;  1KIL D;  1KQG B;  3V4Q A;  1KB9 E;  4PV1 C;  3GLM A;  1RH5 B;  1DD3 A;  2IYP A;  3P8M C;  2FYN C;  2YKP A;  1L4A B;  3C1L A;  1E5W A;  3B5N C;  1KYO E;  2IZ1 A;  2M5A B;  3CX5 H;  2HYN A;  5KAI E;  2NPS C;  4EYY Q;  5CCH D;  3MZW B;  4JYB A;  3L71 J;  2OYI B;  3H1H D;  1FS0 E;  4TT3 H;  1RE3 A;  5AVR B;  4R4L A;  2XNX A;  5AW5 B;  2H7H A;  3R2P A;  1OW8 A;  1GD2 E;  3L72 D;  3V2Q A;  1SQV D;  4PD4 I;  5CCG A;  2N1T B;  1VQK P;  2M0B A;  2PFX A;  2R3S A;  2PAJ A;  3NFQ A;  2M8R A;  3FGA D;  1PGJ A;  2K9J A;  1T2K C;  2IBZ G;  4WB4 A;  3CL3 D;  3BCC J;  1M56 D;  3VMX A;  1GL2 D;  3SFE C;  3G4S P;  2BCC G;  1SQB G;  4D6T J;  4DZO A;  4IFD K;  1RF1 B;  3L70 E;  1PPJ G;  2BEZ F;  1BE3 J;  3AE6 C;  1JY3 N;  4IL6 X;  2G8Y A;  5AVZ B;  2H43 A;  2O01 H;  1KB9 I;  1GTW A;  1K05 A;  1ZRT E;  2PP6 A;  2I1K A;  1URQ D;  2GM4 A;  1S72 P;  1QL2 A;  1BCC E;  3AE3 C;  3HE4 B;  1P84 E;  1HVV A;  2RN0 A;  1S9K D;  3V2P A;  1PP9 E;  4LC1 A;  4EI2 A;  1W2B O;  1X79 B;  3L74 J;  1IC2 A;  2PGD A;  5GTI E;  1FOS F;  1VQ9 P;  1NTM E;  3RBZ A;  5KLI B;  1L0N K;  4GKG A;  1JMM A;  1VQP P;  3H1K E;  1BGY D;  2Q1K A;  4I7Z B;  3Q2Y A;  1BDD A;  3OJA B;  2OYH A;  1DEB A;  4C7N A;  3PJS K;  3B5N A;  3RK2 B;  3AEB C;  1XTC C;  1L0N E;  1YQ4 C;  1OW6 A;  3Q3D A;  2WPR A;  5AVV B;  3GHG C;  1GK6 A;  5APY A;  2IBZ D;  2KIK A;  1KQF B;  2K37 A;  2BCC D;  3S4R A;  1HJB A;  1SQB D;  2YO2 A;  2FYU J;  3M0D C;  3AE9 C;  1JTH A;  2QIW A;  1ZR2 A;  3NXS A;  3VYI A;  1PPJ D;  2XDJ A;  3A7O A;  3C8V A;  3Q5P A;  1SQQ K;  3SFD C;  5AW2 B;  1GW4 A;  1PV3 A;  1JO5 A;  1NTZ K;  4CPG A;  3H1L G;  4JQ0 D;  3CWB E;  1SP4 A;  3HUS B;  2K9Y A;  3MUD C;  2D2C B;  1LTJ C;  1SQP K;  3L70 G;  3VMY A;  3WMM 0;  1SQQ E;  1GMJ A;  5BVZ A;  2JWD A;  1KQS O;  3O6Q B;  1N7S C;  1DX7 A;  1NTZ E;  5APS A;  2YMY A;  1SQP E;  3V2R A;  1P84 I;  1KYO D;  3MP7 B;  2HPC B;  1J2J B;  2QA4 P;  2C9L Y;  2I1J A;  2Q5U A;  1BCC G;  4XFJ A;  1EDI A;  2FXP A;  1NU1 D;  1PP9 G;  2YKQ A;  1S2E A;  1LTG C;  1L4A D;  3FXD A;  1EXI A;  3RK3 C;  4NPF X;  4UB6 H;  1BSH A;  2KSJ A;  1NTM G;  2YO3 A;  3JCU E;  3LW5 J;  5KAF H;  3H1K G;  2M3E A;  3G9R A;  1A02 J;  1JY2 P;  3CLQ A;  1L0L J;  5AVW B;  1KIL E;  4XE5 B;  1FDM A;  2FFD A;  4OGQ B;  1L0N G;  3H1J J;  5BU8 B;  2W27 A;  1AA0 A;  5DJU B;  1EDJ A;  3JSV C;  1JOC A;  1GZL A;  1Q2N A;  4RJT A;  3H1L D;  1FDI A;  1W5C E;  2ITA A;  5CCH C;  1OW7 A;  2FBW C;  1Q81 Q;  3L70 D;  2ZT9 C;  3U59 A;  5AW3 B;  3H1H E;  3L73 D;  4N78 D;  4M3L A;  1FJK A;  2KK7 A;  5CMZ A;  1QX8 A;  2R5B A;  3VP8 A;  2Z5H A;  2B88 A;  3TYY A;  2J58 A;  4YTP C;  3CWB G;  1QVG O;  3L72 E;  3GHG A;  3A0H H;  2E74 C;  1N8R Q;  4DCK A;  3FX0 A;  1KZU B;  1SQQ G;  1KTM A;  1FU1 A;  3M0D A;  4EIJ A;  5AW7 B;  1NTZ G;  1BCC D;  3P32 A;  2P1J A;  2KS1 A;  3VN0 A;  1SQP G;  1JCD A;  1PP9 D;  1EC5 A;  1SVF A;  1YQ3 C;  2QJK B;  1NTM J;  4Y99 C;  1LTI C;  1NAF A;  1AVO A;  4BRY B;  3EFG A;  5KLV J;  1RE4 A;  2RKL A;  3OA7 A;  1RQU A;  3T97 B;  1N2D C;  4HJG H;  3LIE A;  3L75 E;  4R4M A;  5CBN A;  3H1K D;  4K3A A;  4LGD E;  1Y47 A;  1RE3 C;  1NJI Q;  1H89 A;  3IF4 A;  1LT9 B;  4BWN A;  1RF0 A;  1L0N D;  4TLF A;  2K88 A;  4GIF A;  5CCG C;  2Z4E A;  3KDP B;  2IDB A;  5L8R J;  2K1A A;  5KJ7 D;  3P8C E;  1M1J C;  1S5L E;  1G2C A;  1S9K E;  3RK2 D;  4IFM A;  2OQQ A;  1VQL P;  3CCU P;  3CWB D;  5GTH E;  3CCL P;  2ZAE B;  2ZYG A;  3RGU A;  3I56 P;  1SQQ D;  1PGP A;  4GOD A;  1KIL A;  1LTB C;  3C9I A;  1YJ9 P;  3PTZ A;  2O3J A;  1NTZ D;  4IL6 H;  2NZ2 A;  1BGY E;  3CME P;  1KFM A;  4WBA A;  1Q82 Q;  1SQP D;  1T3U A;  2XV5 A;  2YIU C;  3HTK A;  4AUW A;  1SQX J;  5B66 H;  4UB8 H;  5CCH A;  1OWA A;  4U3F E;  2D2C D;  2BCC E;  1VF5 C;  1JY2 N;  3RL0 C;  5AVS B;  3V2N A;  1MV8 A;  2WWW A;  3AE4 C;  5K5G B;  2QJP B;  1FZC B;  1J1D B;  2E76 B;  2K3R A;  4H13 C;  2WSF J;  2BAS A;  4NPE A;  1TU3 F;  2GUS A;  3ABV C;  1KV4 A;  4RO0 A;  2WMM A;  3L75 G;  1OVU A;  2KNC B;  1VL2 A;  4PD4 H;  2CPB A;  3BAT A;  1GDT A;  1YYC A;  2KZI A;  4PV1 B;  1FOS E;  1R5S A;  5CHX A;  5M1B A;  1N73 A;  2FYN B;  1PGO A;  1NTK K;  1VQ5 P;  4NPD A;  3USS A;  1NWQ A;  3B5N B;  3GF3 A;  4DT0 A;  2VRS A;  2OYH C;  2NPS B;  1CI6 A;  1GL2 A;  2Q6Q A;  3H1H J;  1NU1 K;  1H88 A;  3A0B H;  3CXH H;  3E1R A;  5AW6 B;  3A3Y B;  3CCS P;  2JDI H;  2IPP A;  2WSE J;  1FBM A;  1DEE G;  2Z5I A;  2KZJ A;  3L72 J;  1SQV J;  4C7R A;  4OGQ D;  5CBO A;  4H44 C;  1NU1 E;  2W6A A;  1AV1 A;  2NRG A;  1KC8 Q;  4DOJ A;  1BSN A;  3F89 A;  4GOF A;  4WY4 B;  1OXZ A;  1N7L A;  3G6E P;  1LWU C;  1URQ A;  4Z1M H;  1KB9 H;  4AQR D;  1BGY G;  1M1J A;  2POH A;  2IBZ I;  3O8Z A;  1YJW P;  5AVU B;  5KTB A;  1T3J A;  1H0T A;  3AE5 C;  3MTU E;  2QE7 H;  2KB7 P;  4U3F G;  1WT6 A;  2E75 B;  1L2P A;  1HWT C;  3L75 D;  1LTS C;  3H1L E;  3OW2 O;  1PFI A;  3BVH A;  3TNU A;  5B5E H;  3WUV A;  4Y28 J;  3L73 E;  2Y0C A;  4N78 E;  1LP1 A;  3EQ2 A;  2DW3 A;  1EXJ A;  3AE1 C;  2WT7 A;  2B87 B;  3HD7 B;  1Z56 A;  4B86 A;  3PLN A;  3LW5 H;  2GA1 A;  1VQ7 P;  2C9N Y;  3P8C D;  1RF1 C;  1KYO I;  1WMK A;  1ZP0 C;  2FFD C;  1CW5 A;  3AEF C;  5KKZ C;  4YXD C;  3AEE C;  2JR8 A;  1EZV D;  1LGH B;  1BGY J;  1YBK A;  1SS1 A;  1JUN A;  1AFO A;  1NU1 G;  1YIJ P;  2E5Y A;  4L73 A;  1M57 D;  1JMB A;  4HH2 A;  1J1E B;  1IFD A;  1K8A Q;  1JB0 J;  2WSC J;  5AVT B;  2OTJ P;  2BCC J;  1SQB J;  1YIT P;  1RY3 A;  2KYV A;  1P84 H;  1VPC A;  1HUC A;  4U3F D;  1YHQ P;  2OTK E;  1U57 A;  1SFC C;  1QVF O;  1K9M Q;  3PH0 A;  2HOD B;  1L4A A;  5GTI H;  3U1A A;  5CJ4 A;  3RK2 C;  3MIW A;  1LWU A;  1LTJ B;  4GT1 A;  4L74 A;  1JNM A;  1RE4 C;  2OYI A;  3BAS A;  1N7S B;  3CX5 D;  2QG4 A;  1FZE A;  5APT A;  1FDO A;  2CPS A;  3L73 G;  3D70 A;  2YNY A;  2E76 D;  3R4Y A;  1YI2 P;  5H2F H;  3HE5 B;  1RF0 C;  1R8E A;  3D6Z A;  1FJP A;  1NTK D;  3NMD A;  2MJZ A;  4PV1 D;  5KAF E;  2RH0 A;  2HFE D;  5DJT B;  2A45 I;  2WVR A;  3RK3 B;  1UII A;  2AXT H;  3Q1M A;  2OYO A;  3B5N D;  1QL1 A;  2NPS D;  3M9Q A;  2A45 G;  3IFM A;  1CSB A;  1S4X A;  2W6B A;  3H32 B;  1RF1 A;  3RBX A;  4H0L B;  3TGU E;  4L75 A;  3SSU A;  1KIL C;  2R44 A;  2B89 A;  3H1L J;  4WY4 D;  1ZW0 A;  5TIS H;  3L70 J;  2N1T D;  3NTN A;  5AW0 B;  3L73 J;  3A0H E;  2ZT9 B;  3KXD A;  3HE4 A;  2J5U A;  2QJY B;  2P7J A;  1QEX A;  3WU2 H;  1PL5 A;  4PJ0 H;  1T2K D;  2ZYD A;  3FXE A;  2E74 B;  2WSF H;  2YKO A;  4GOE A;  1ZN5 A;  2QM8 A;  3VOP A;  1BCC J;  2ZFC A;  2E75 D;  3H25 A;  5KJ7 A;  1S1C X;  1Q7Y Q;  1KD1 Q;  2E42 A;  3H1I D;  1Q90 D;  4W7Y A;  1PP9 J;  4HB1 A;  3VMZ A;  1SFC A;  4L76 A;  2KLV A;  3I55 P;  4Y99 B;  5APQ A;  1N73 C;  1QLE D;  1MFT A;  2N9Y B;  1ZOY C;  2FYZ A;  3HD7 D;  3H1K J;  1RHZ B;  1R5L A;  1GL2 C;  3AEA C;  3S1K A;  4KJM A;  2IZ0 A;  2WSE H;  3L37 A;  1L0N J;  3FWN A;  3U1C A;  1GK4 A;  2QEX P;  2QJK C;  3IN6 A;  1H8A A;  3SWK A;  2HG5 D;  4ASW A;  3HUS A;  1LT1 A;  1MFZ A;  1DIP A;  3IR9 A;  3BCC E;  2W6J H;  3TGU G;  1FZA A;  3D71 A;  4KHX A;  1K04 A;  1NYH A;  1URQ C;  1LTA C;  2B9B A;  2W83 C;  1K73 Q;  1U7M A;  1M1J B;  2R5D A;  3O6Q A;  4EOT A;  4D6T E;  3TSI A;  2FXO A;  3CWB J;  1BE3 E;  4IL6 E;  4ASV A;  2JO1 A;  2K9J B;  1LT9 C;  3AED C;  3CMA P;  3KHU A;  1SQQ J;  2HPC A;  3MHV A;  1HJ0 A;  1NTZ J;  2GUV A;  1EZV E;  3AE2 C;  2WIT A;  2Y9Y A;  1X0T A;  1HGZ A;  1SQP J;  1T6A A;  1KN7 A;  5CJ0 A;  4ZKU A;  2LKM A;  4QMA A;  4OWF A;  3H6P A;  3AE7 C;  1VF5 B;  1HTL C;  2XND H;  3RL0 B;  1N7S D;  2R32 A;  1IZN B;  3L71 G;  2V4H A;  1ZME C;  4PD4 E;  1VQ6 P;  2Q7C A;  3OAK A;  2CK3 H;  1HF9 A;  4ZKP A;  4H13 B;  1EQ7 A;  1UIX A;  1AJY A;  3EWK A;  1X8Y A;  2PRR A;  1LJ2 A;  2KXP B;  3KZI H;  3PRJ A;  2FYU K;  3A0B E;  3CXH E;  1PIX A;  3FWL A;  4RKU J;  3TGU D;  3CX5 E;  4KT0 J;  2H89 C;  3TK1 A;  3RK3 D;  5E79 H;  3LID A;  1IFN A;  2QVA A;  1VQN P;  2QRX A;  2OYH B;  2FYU E;  1J1D C;  2E76 C;  4C7N B;  3CC7 P;  2WSC H;  3V5B A;  3G3Z A;  2FXM A;  2V7Q H;  3P7K A;  3BCC G;  1PZQ A;  3VMA A;  3WUT A;  3TF5 A;  1GU4 A;  5AW8 B;  1NTK E;  4D6T G;  4H0L D;  3CCJ P;  4H44 B;  1JTH B;  1E79 H;  1DH3 A;  2KSE A;  1T8Z A;  1BE3 G;  1EZV I;  4BRY A;  1LWU B;  2Y0E A;  1L4A C;  3T97 A;  1Q86 Q;  1EZV G;  2ZT9 D;  4WVZ A;  4JF7 A;  3SWF A;  2OYI C;  3L71 D;  1QGK B;  4W80 A;  5B5E E;  3PHL A;  1KYO H;  1VQM P;  1IK7 A;  1LT9 A;  1X9V A;  5C39 A;  1G1J A;  4JBZ A;  2OGU A;  1IFM A;  2E74 D;  2OAR A;  5KAI H;  1YTZ I;  3L75 J;  4JPZ B;  2C0X A;  1IFJ A;  2ZXE B;  4WY4 C;  1FZG A;  3CCM P;  3L74 G;  5AVY B;  2E5T A;  2JJL A;  1L0L K;  2N1T C;  3IAO A;  2A06 E;  4YXW H;  3TDK A;  2AXC A;  1OIP A;  5AW1 B;  1ZR4 A;  1NVO A;  4YPC A;  3CCE P;  2XU6 A;  3CI9 A;  2O1J A;  4OH8 B;  1M1K Q;  3B4S A;  1OVV A;  3CXH I;  1L0L E;  3CX5 I;  1IFP A;  3V6I A;  1VDF A;  3H1J E;  2JKV A;  1U7J A;  2E75 C;  3KQG A;  3BCC D;  1KFN A;  2Y0D A;  1JY3 O;  1S5L X;  4U7J A;  4D6T D;  3H1I E;  2P2U A;  2FYU G;  2FFD B;  4ZNC A;  1BE3 D;  5KKZ B;  5APV A;  5CCG D;  3GF7 A;  3HD7 C;  2R3C A;  4ZMD A;  1NTK G;  3M91 A;  2AEM A;  3M9B A;  4O9B A;  1NTM K;  2LR2 A;  4LLH A;  4W7Z A;  5KLV K;  2H88 C;  3CC4 P;  1FZC A;  2IX7 C;  1USE A;  1ZXG A;  1FE6 A;  1JEK A;  3L4F A;  1EDK A;  4U3F J;  3GHG B;  2AEJ A;  4HYT B;  3GW6 A;  3QH9 A;  3CCV P;  2V7Q J;  2KNC A;  3EFF K;  5KLV E;  3L74 D;  1OZH A;  4AYC A;  2Y9Z A;  2XKM A;  1SFC B;  3N7N A;  3MD0 A;  1JM0 A;  4PD4 D;  5KLI C;  1RQV A;  1NH4 A;  5KJ7 C;  2ZVN B;  1OX3 A; 
#chains in the Genus database with same CATH homology
 5E79 E;  4UB6 E;  5B66 E;  3WU2 E;  4UB8 E;  4PJ0 E;  5GTI E;  3KZI E;  1S5L E;  5KAF E;  3JCU E;  4IL6 E;  5TIS E;  5H2F E;  2AXT E;  3A0B E;  3A0H E;  5B5E E;  1W5C E;  5GTH E;  5KAI E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...