1W5CE

Photosystem ii from thermosynechococcus elongatus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
77
structure length
76
Chain Sequence
RPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords PHOTOSYSTEM Q(B) PROTEIN 1
publication title Crystal Structure of Cyanobacterial Photosystem II at 3.2 A Resolution: A Closer Look at the Mn- Cluster
rcsb
total genus 14
structure length 76
sequence length 77
chains with identical sequence K
ec nomenclature
pdb deposition date 2004-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 1w5cE00
3WU2E 5GTIE 5E79E 4UB6E 2AXTE 3A0HE 5KAIE 4PJ0E 5GTHE 3A0BE 4IL6E 5H2FE 4UB8E 3KZIE 5KAFE 3JCUE 1S5LE 5B66E 5TISE 1W5CE 5B5EE
chains in the Genus database with same CATH superfamily
4H13B 4PJ0E 2SPZA 3AEBC 3NTNA 2WPSA 2JR8A 1MV8A 1KORA 2KZJA 1GW3A 3HUSB 4R4MA 1OVUA 4UB8H 3L71E 2RN0A 3E1IA 2YXRB 1S1CX 1KILD 3E1RA 1FZAA 2E76B 5AVQB 2ZXEB 1M56D 1PGOA 4C7RA 1BSHA 3KDPB 2M3BA 3L4FA 2GUVA 5AVXB 3MHVA 1PGQA 3H1HG 2FYUJ 1JO5A 3S1KA 1BCCD 4JF7A 3M9HA 4WY4A 5AW6B 1N73C 5CBNA 4N3YB 3CWBD 3BRVB 1W5CE 1BE3D 1JY2P 3T97A 3WU2E 2PRRA 2HFED 1FBMA 2QSIA 2P7JA 1HWTC 3L71J 1SQVK 1M1JC 1RE3C 1Q90D 2O01N 2IBZD 1FZCB 1K04A 5GTIH 3SSUA 3CCEP 1ZOYC 2N1TB 2OYIB 4Z1MH 3H1LD 1L2PA 3O8ZA 1NTKE 1PP9J 2OYHC 3B5ND 4Y99B 1SVFA 2WT7B 1JM0A 3M0DC 1DH3A 3RK3D 1FZEA 3CMEP 3TGUD 1Y47A 1P84I 3MD0A 3CLQA 3MIWA 1NU1E 1CI6B 3D71A 1NJIQ 1OXZA 1OIPA 5KKZB 1EQ7A 3H6PA 4JYBA 3TDKA 2P1JA 4GOEA 3HD7A 1WMKA 1JCCA 1NAYA 3L74E 3VMZA 2AEJA 2E74B 1DEBA 1NAFA 1NTKJ 1VF5D 1GU4A 1P84E 3CCVP 1CZQA 1YJWP 2ZFCA 3CCSP 3V4WA 2M5AA 2HODA 1GL2C 4MN4C 2RH0A 4HKZH 1SFCB 2HG5D 2IBZG 1JMMA 1JTHB 3G3ZA 4C7NB 2IYOA 3RGUA 4RKUJ 1JY2O 1NU1J 4EIJA 1KN7A 1KILE 2H43A 1GL2A 1N2DC 2RMZA 1J1DB 1YBKA 3HUSA 3W67A 4AQRD 2KXPB 5APTA 1NTZK 3WU2H 1X0TA 4KJMA 5AW5B 1DD3A 3GHGB 5AW1B 1JMBA 1BCCE 1SQXD 3CXHD 3AE3C 4D6TD 1FJPA 3CWBE 5AVSB 2W6JH 1BE3E 3PP5A 3R2PA 2O1JA 1BGYD 1L0LD 1VDFA 3O6QB 2B87B 1L0NK 1HUCA 2YO2A 2IBZE 1K73Q 2E5TA 4Y28J 3C9IA 1NTMG 1IFMA 1BDCA 1KYOD 3H1LE 3H1KD 1KQSO 1RQVA 1FZCA 1CSBA 4GOFA 1MZ9A 2D2CC 4GKGA 2E75C 1OWAA 4PV1B 3Q3DA 2E43A 2N1TA 2OYIA 2CPSA 3RK3E 2Q6QA 2M0BA 3CWBJ 3TGUE 2O01H 2C0WA 4R4LA 1OZHA 4DZOA 1VQNP 3NXSA 2WT7A 1P84H 1URQC 1X9VA 4WVZA 5AW7B 2IZ0A 5CCHC 1YI2P 3FGAD 4WBAA 4I7ZB 1LGHB 1CI6A 3RK2D 3IF4A 1NH4A 1SQXG 2Z5IA 1LP1B 2OGUA 1VQKP 2KUBA 2IDBA 5CMZA 4H44C 5CCGA 1W2EA 2QJPB 3GW6A 3SWKA 4W80A 1L4AC 1BGYG 4IFDK 5K5GB 3TGUJ 1N7SD 2YIUB 2KNCA 2W6AA 2AXTE 5EFWB 1IFIA 2WPVB 2QEXP 3H1KG 3G4SP 4YPCA 3Q1MA 1SFCA 3WMM0 2FYUD 3CC4P 3SWYA 1JTHA 2IZ1A 1Q81Q 4C7NA 2KSJA 2YKOA 3SWFA 4JBZA 4IOIH 3L70J 1N86A 2ZJSE 2K1AA 1LNQA 1SS1A 1KQLA 2XNDH 3LW5J 1SQXE 3CXHE 2WVRA 3CPWO 4LGDE 5TISE 4D6TE 2OTKE 2XKMA 3L75E 5CBOA 1EZVI 1SQBK 3MUDC 3HTKA 2XNXA 1BGYE 1L0LE 3A7OA 1IZNB 1OFCX 1GZLA 5KJ7A 1QVGO 1ZN5A 1PP9D 2M3EA 1EDLA 4WY4D 1KYOE 1NTMK 3H1KE 1N73B 2N9YB 3O6QA 2B87A 1HH0A 2H7HA 4IFFA 1ZP0C 3JC22 4M3LA 2BEZF 1PGPA 1FE6A 2ZAEB 1M1JB 1VL2A 3CX5I 1YJ9P 1G1JA 2ZYDA 2ZT9C 3I55P 3L75J 3TSIA 3A0HE 5CHXA 3IR9A 2YKPA 2JWAA 1MKMA 2WSEH 2ZVOB 3G71P 1JUNA 1VQ9P 2OYHB 2OTLP 4I7ZC 5AW3B 3GG2A 3L71G 3CX5E 2QM7A 3AE5C 4CPGA 5KLVJ 1SQXK 2AXTH 3W68A 1S9KE 5KTBA 2JKVA 3HRNA 3PHLA 2LKMA 4RO0A 1LP1A 1GK6A 1OMIA 1PP9G 1IK9A 2KLVA 5CJ4A 4OH8B 1NO4A 2IX7C 3CC7P 3CXHH 3L72D 2FYUE 4JPZB 2A06D 3V6IA 3V2NA 5TISH 1PFIA 1IJDB 2QJYC 4H0LC 1GL2B 4A7PA 2YO3A 1S5LE 1LT1A 3R4YA 3U1CA 1HF9A 2P58A 4H13D 2YMKA 1SQPJ 1K8AQ 3V2PA 2E5YA 3CL3D 2B9BA 1PGJA 1FC2C 3AE1C 1RF1B 1NTKG 1KYOH 1FDMA 1H0TB 1R8EA 1LTAC 3CCUP 1UIXA 1PP9E 4L75A 3H1ID 3KYQA 2MKVA 1EXIA 2FYNC 1NU1G 2Q1KA 3RL0C 3MZWB 4QMAA 3FX0A 2R5BA 5APQA 2H88C 2QVAA 1XTCC 2HPCB 1N7LA 1SQQE 2JP3A 3TYYA 4L76A 3L74G 1N73A 1W2BO 1H8AA 2WZ7A 1JCDA 2A06G 3MP7B 2K37A 1HGZA 1M1JA 1RE3A 3U59A 3ZDMA 3L73D 1CW5A 3WUVA 2QJKC 2D2CB 1RE4C 2OARA 2W8ZA 2E75B 4YXDC 4EOTA 5BU5A 1KV4A 3VMYA 4OGQC 4HB1A 3V2RA 1NOHA 1KB9I 2NPSC 3M0AA 3Q5RA 2UWJE 3KZIH 4TT3H 1ZMEC 4GODA 2AEMA 2WWWA 1JOCA 2OYHA 3M0DA 1SQQJ 1N8RQ 1X8YA 1URQB 4ZKPA 2NPSA 4PJ0H 2OQQA 4I1LA 3V5BA 3CCJP 1LTTC 1ZRTD 2CK3H 1BCCG 3CCRP 3L36A 2HYNA 1QX8A 1KC8Q 2KNCB 3L70D 2FFDC 3CWBG 3L72E 1RH5B 5CCGD 2A06E 1BE3G 4H44B 3USSA 1RF0C 2NZ2A 1L4AB 3C1LA 1JY3N 1X22A 2N9BA 2E74D 3VOPA 1VQLP 5KAIE 5GTHE 2Y0EA 1NTZJ 2K88A 1HJ0A 2RKLA 1KILC 4GT1A 3CI9A 3HE4B 3H1LG 3I56P 1RF1C 3ITKA 1SFCD 3P8CD 1GMJA 4XE5B 2JO1A 3FWNA 2Q9IA 1QEXA 1NTKK 4HJGH 4W7YA 4EYYQ 3D6ZA 3KQGA 3RL0g 1KILA 3AE6C 2K3RA 1S72P 1DIPA 2FXOA 3H1IE 3L72J 3TGUG 1RF1A 3HTKB 1L0NJ 2WSSH 4ZNCA 1H0TA 3EQ2A 1NU1K 1R5SA 3L75D 1H88A 1D7MA 1QL1A 3L35A 2B89A 3TF5A 1MUUA 4JYCA 2J59M 1KQGB 2FBWC 1HJBA 2VRSA 2KP8A 2FXPA 1S4XA 5KJ7D 2JDIH 4KHXA 3HE5B 3Q5SA 3L70G 2WSFJ 1FU1A 2K9YA 2HPCA 1ZW0A 1E5WA 1IFPA 5KLVD 2JEEA 2POHA 3L73E 2BCCJ 3B5NC 1EZVD 3H1IJ 4ZMDA 2NRGA 3TNUB 3NFQA 3RK3C 2I1KA 2A45I 1YTZI 3MGNA 1T3UA 3AEGC 2QG4A 3M9BA 2ZT9B 3H25A 3P32A 1BDDA 1T2KD 2P10A 3KHUA 3P7KA 1J1EC 4U3FE 1A02F 1LT9C 4PV1D 1JB0J 4I6MC 1X79B 4KT0J 3A0BE 4IL6E 1KFMA 1NKZB 3N7NA 1ZRTE 1GDTA 3TK1A 5GTHH 2Z4EA 1EDIA 1YITP 1AV1A 5AVUB 3CX5D 3EFFK 1URQA 1VF5C 2R32A 5CCHA 3L70E 4D6TG 2WITA 3L73J 1S9KD 4N78D 3L75G 1SQPD 1FOSE 4K35A 1L0LG 2KS1B 3D6YA 5APXA 4N6JA 4I2LC 3M91A 4U3FJ 2KOGA 1L4AA 2Q3IA 3BCCJ 1ZR2A 3SFEC 3P8CE 5KLVG 1NVOA 1K9MQ 1OX3A 1EZVG 2C9LY 1VQ6P 1T3JA 2QJYB 3OA7A 2LR2A 4H0LB 4WWIA 1YHQP 3HE4A 1SQBJ 1NGMB 1AVOA 1R5LA 2Y9ZA 2Q7CA 2XV5A 2WPQA 5AVTB 3AE4C 2G8YA 2HR3A 1M7LA 2IFNA 1J2JB 1NHLA 1Y9BA 1PIXA 1LTJC 4DJGA 2B88A 2W90A 2WMMA 2YXQB 3II6A 3H1JJ 4GIFA 4ZKUA 2V7QJ 2K9JB 2PP6A 3PTZA 1PPJD 1AFOA 3MUDA 2FYNB 3RL0B 1SQPG 1M90Q 1SP4A 3CCMP 4DOJA 3PH0A 5KLVE 1H89A 4RESB 4UB8E 1Q86Q 1EZVE 1DEEG 1YJNP 1Q82Q 3HE5A 3JCUE 1T8ZA 2IPPA 3A0BH 1SQQD 5B5EE 2Y0DA 3U1AA 2W83C 1ZR4A 3FXEA 1IFDA 1KD1Q 3G6EP 1HBWA 2ZXXA 3AEAC 2FYUG 3A5TA 1GK4A 1RQUA 3TNUA 3CCQP 5C39A 3ABVC 2I8DA 1S3JA 3LW5H 5APYA 3VMXA 3Q5PA 2QJKB 3RK2C 1IC2A 2PAJA 2WQYC 2C9NY 4OGQB 2NPSB 1IFNA 1NTZD 2JJLA 4N78E 1OVRA 4WB4A 1SQPE 3EWKA 3GMAA 2R3SA 2WTYA 4C46A 1DX7A 2Z5HA 1N7SC 1L0LK 3H1HD 3HD7D 4L73A 3M06A 5AVVB 5AVZB 3N4XA 1KB9D 3B8EB 3OAKA 2I1JA 1DD4A 4OWFA 4GDOA 5CJ0A 5BVZA 2FFDB 2KS1A 4IFMA 1L0ND 3WUTA 1OW6A 1M8OB 3VTPC 1FZGA 1PL5A 1FJKA 1QVFO 1SQQG 1AA0A 2YMYA 2KSEA 2BASA 4JQ0D 5AW9B 3C8VA 3BATA 3A2AA 3JSVC 1GW4A 1KILB 4NPDA 1YQ4C 1LJ2A 1GL2D 1IFJA 1KQFB 3GLMA 4EDFA 2W27A 1ZLLA 1LTIC 1EXJA 1VQ4P 3JCUH 2ZYAA 2E76D 2BCCD 2G3AA 5AW2B 1OVVA 3VP8A 5B5EH 3IN6A 1SQVJ 2QE7H 1EDJA 1PPJE 1NTZG 4WY4C 1FDOA 3AEDC 2QA4P 4EI2A 3VN0A 3A0HH 3OJAB 1RY3A 1SQPK 3AEFC 4DCKA 2K9JA 5AVRB 1S2EA 1U7MA 2Y0CA 3M9QA 1MFTA 2IFMA 2C0XA 1EC5A 5DJUB 1HVVA 3CX5H 1VQOP 3AE2C 3L72G 1L0NG 1AQTA 2Y9YA 2FYUK 2AXCA 2R5DA 2O1KA 5BU8B 5M1BA 3OW2O 4U7JA 3AE9C 3B5NB 3P8MC 2N1TD 3RK3B 1LWUC 4OVNF 1KMIZ 3A3YB 3S4RA 1NTZE 2V4HA 1KFNA 2D2CD 4U3FD 2E75D 1RE4A 1K05A 1J1EB 1LT9B 4NPFX 3V2QA 1GTWA 4BRYB 1LWUA 3BCCD 1VQ5P 4K3AA 3HD7C 3H1HE 2MJZA 5E79E 2BCCG 4TLFA 3H1IG 4LLHA 1S5LH 2ITAA 1T6AA 2PGDA 1KB9E 5APSA 1SQBD 1URQD 4ASWA 2P67A 1VF5B 3CMAP 1YTZT 1S5LX 5CCHD 1NKNA 1BSNA 1YQ3C 1L0NE 2GUSA 5KLIC 3QH9A 2PFXA 4PD4D 1FZBA 3EFGA 3F89A 2KZIA 1G2CA 1SQQK 4B86A 1LTBC 3BASA 2FFDA 1NTMD 4H13C 4H44D 3PJSK 3H1JD 5AW0B 2XZRA 1RF0A 2FY8A 4AYCA 1GD2E 3L37A 4YTPC 3UIAA 2QRXA 1L4AD 3VP9A 2OYOA 4DT0A 3H1HJ 3HUSC 3L73G 2R3CA 3QWOC 2KB7P 3LIDA 2YKQA 2O3JA 1TU3F 3IAOA 1FZFA 2WPRA 2E76C 2BCCE 5DJTB 1OW8A 2J5UA 1LTGC 1EDKA 2L91A 3RBXA 4U3FG 2O01J 3L74J 2IBZI 4ASVA 5L8RJ 3BCCG 3Q2YA 1LTJB 1A02J 1M1KQ 4YXWH 2J58A 2A45G 1FAVA 3G9RA 1SQBG 1LTSC 2HLOA 3AE8C 5KAFE 1AJYA 5B66E 1HTLC 1Y8AA 1FZCC 3H32B 1NWQA 1Z56A 3FXDA 2QM8A 1WRGA 3FWLA 1ZXGA 1YYCA 2N1TC 2OYIC 2Q5UA 3SFDC 1QL2A 1QGKB 5E79H 3PLNA 3H1JG 1KB9H 4Y99C 3B5NA 3KPEA 4PD4I 1BCCJ 4RJTA 1OW7A 1KZUB 3BCCE 1BE3J 2ZT9D 3CD6P 1FS0E 5KAIH 2FXMA 3RK2B 5KKZC 2W6BA 1LT9A 2XU6A 1SQBE 4UB6E 1IO4A 3D70A 4BRYA 4AUWA 1VQPP 5CCGC 3AEEC 2FYZA 3E7KA 5H2FE 4PD4E 5APWA 1VQMP 3H1LJ 2E74C 3VYIA 2WSFH 2P2UA 1N7SB 1YIJP 1NTME 2H8PD 5AVYB 2ZYGA 3H1JE 1KTMA 3NMDA 2OTJP 1SFCC 1XTGB 1SQVD 1RHZB 1IK7A 1JEKA 2KYVA 1Q2NA 3B4SA 1JY2N 1M57D 2KIKA 3B71A 1NYHA 3CXHI 2WSCJ 1UIIA 3CCLP 2E42A 1U7JA 1J1DC 3GF7A 1USEA 3AE7C 3GF3A 2H89C 1SLQA 2KK7A 1QLED 4H0LD 3BVHA 5KAFH 3GHGC 5B66H 1NTMJ 3L71D 2IYPA 2WSEJ 2R44A 3PRJA 1KYOI 1E79H 5KJ7C 4XFJA 1LTJA 1FDIA 3GHGA 3F5HA 1U57A 4WY4B 1JY3P 4LC1A 5AW8B 4W7ZA 1HGVA 1WT6A 1Q7YQ 1AVYA 3T97B 3IFMA 3LIEA 2DW3A 4IL6H 2Q3EA 2L5GB 2FKWB 2QIWA 2CPBA 3RL0D 1PZQA 4BWNA 2LXBA 3H32A 4IL6X 1ZV8A 3MTUE 2A45H 1T2KC 1SQVG 2WSCH 4UB6H 3V4QA 4PV1C 3AECC 3I5CA 1SQXJ 1FOSF 5AW4B 5AVWB 4NPEA 5H2FH 1VPCA 4PD4H 4D6TJ 3K5BA 4HYTB 2GA1A 1JNMA 1GU5A 1BGYJ 1L0LJ 1G1IA 1LWUB 3RBZA 1NTKD 4L74A 2ZVNB 2BEQD 5GTIE 2V7QH 1VQ7P 2KLUA 2YNYA 4BXLA 1AQ5A 4OGQD 3H1KJ 2NPSD 3CC2P 5TJHA 3S9OA 3HD7B 2KI7B 2XDJA 1NU1D 2QJPC 4HH2A 3KXDA 1PPJG 3BRTB 2GM4A 1G2CB 1SQVE 5APUA 2AEFA 1USDA 2YIUC 1N7SA 2M5AB 5KLIB 5KLVK 4XA4A 1VQ8P 3KZIE 2HODB 1PV3A 3L74D 2JWDA 5APVA 1JY3O 2M8RA 2LXCB 4O9BA 3VMAA 1MFZA 3WUUA 1P84D
chains in the Genus database with same CATH topology
3WU2E 5GTIE 5E79E 4UB6E 2AXTE 3A0HE 5KAIE 4PJ0E 5GTHE 3A0BE 4IL6E 5H2FE 4UB8E 3KZIE 5KAFE 3JCUE 1S5LE 5B66E 5TISE 1W5CE 5B5EE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU2 E;  5GTI E;  5E79 E;  4UB6 E;  2AXT E;  3A0H E;  5KAI E;  4PJ0 E;  5GTH E;  3A0B E;  4IL6 E;  5H2F E;  4UB8 E;  3KZI E;  5KAF E;  3JCU E;  1S5L E;  5B66 E;  5TIS E;  1W5C E;  5B5E E; 
#chains in the Genus database with same CATH topology
 4H13 B;  4PJ0 E;  2SPZ A;  3AEB C;  3NTN A;  2WPS A;  2JR8 A;  1MV8 A;  1KOR A;  2KZJ A;  1GW3 A;  3HUS B;  4R4M A;  1OVU A;  4UB8 H;  3L71 E;  2RN0 A;  3E1I A;  2YXR B;  1S1C X;  1KIL D;  3E1R A;  1FZA A;  2E76 B;  5AVQ B;  2ZXE B;  1M56 D;  1PGO A;  4C7R A;  1BSH A;  3KDP B;  2M3B A;  3L4F A;  2GUV A;  5AVX B;  3MHV A;  1PGQ A;  3H1H G;  2FYU J;  1JO5 A;  3S1K A;  1BCC D;  4JF7 A;  3M9H A;  4WY4 A;  5AW6 B;  1N73 C;  5CBN A;  4N3Y B;  3CWB D;  3BRV B;  1W5C E;  1BE3 D;  1JY2 P;  3T97 A;  3WU2 E;  2PRR A;  2HFE D;  1FBM A;  2QSI A;  2P7J A;  1HWT C;  3L71 J;  1SQV K;  1M1J C;  1RE3 C;  1Q90 D;  2O01 N;  2IBZ D;  1FZC B;  1K04 A;  5GTI H;  3SSU A;  3CCE P;  1ZOY C;  2N1T B;  2OYI B;  4Z1M H;  3H1L D;  1L2P A;  3O8Z A;  1NTK E;  1PP9 J;  2OYH C;  3B5N D;  4Y99 B;  1SVF A;  2WT7 B;  1JM0 A;  3M0D C;  1DH3 A;  3RK3 D;  1FZE A;  3CME P;  3TGU D;  1Y47 A;  1P84 I;  3MD0 A;  3CLQ A;  3MIW A;  1NU1 E;  1CI6 B;  3D71 A;  1NJI Q;  1OXZ A;  1OIP A;  5KKZ B;  1EQ7 A;  3H6P A;  4JYB A;  3TDK A;  2P1J A;  4GOE A;  3HD7 A;  1WMK A;  1JCC A;  1NAY A;  3L74 E;  3VMZ A;  2AEJ A;  2E74 B;  1DEB A;  1NAF A;  1NTK J;  1VF5 D;  1GU4 A;  1P84 E;  3CCV P;  1CZQ A;  1YJW P;  2ZFC A;  3CCS P;  3V4W A;  2M5A A;  2HOD A;  1GL2 C;  4MN4 C;  2RH0 A;  4HKZ H;  1SFC B;  2HG5 D;  2IBZ G;  1JMM A;  1JTH B;  3G3Z A;  4C7N B;  2IYO A;  3RGU A;  4RKU J;  1JY2 O;  1NU1 J;  4EIJ A;  1KN7 A;  1KIL E;  2H43 A;  1GL2 A;  1N2D C;  2RMZ A;  1J1D B;  1YBK A;  3HUS A;  3W67 A;  4AQR D;  2KXP B;  5APT A;  1NTZ K;  3WU2 H;  1X0T A;  4KJM A;  5AW5 B;  1DD3 A;  3GHG B;  5AW1 B;  1JMB A;  1BCC E;  1SQX D;  3CXH D;  3AE3 C;  4D6T D;  1FJP A;  3CWB E;  5AVS B;  2W6J H;  1BE3 E;  3PP5 A;  3R2P A;  2O1J A;  1BGY D;  1L0L D;  1VDF A;  3O6Q B;  2B87 B;  1L0N K;  1HUC A;  2YO2 A;  2IBZ E;  1K73 Q;  2E5T A;  4Y28 J;  3C9I A;  1NTM G;  1IFM A;  1BDC A;  1KYO D;  3H1L E;  3H1K D;  1KQS O;  1RQV A;  1FZC A;  1CSB A;  4GOF A;  1MZ9 A;  2D2C C;  4GKG A;  2E75 C;  1OWA A;  4PV1 B;  3Q3D A;  2E43 A;  2N1T A;  2OYI A;  2CPS A;  3RK3 E;  2Q6Q A;  2M0B A;  3CWB J;  3TGU E;  2O01 H;  2C0W A;  4R4L A;  1OZH A;  4DZO A;  1VQN P;  3NXS A;  2WT7 A;  1P84 H;  1URQ C;  1X9V A;  4WVZ A;  5AW7 B;  2IZ0 A;  5CCH C;  1YI2 P;  3FGA D;  4WBA A;  4I7Z B;  1LGH B;  1CI6 A;  3RK2 D;  3IF4 A;  1NH4 A;  1SQX G;  2Z5I A;  1LP1 B;  2OGU A;  1VQK P;  2KUB A;  2IDB A;  5CMZ A;  4H44 C;  5CCG A;  1W2E A;  2QJP B;  3GW6 A;  3SWK A;  4W80 A;  1L4A C;  1BGY G;  4IFD K;  5K5G B;  3TGU J;  1N7S D;  2YIU B;  2KNC A;  2W6A A;  2AXT E;  5EFW B;  1IFI A;  2WPV B;  2QEX P;  3H1K G;  3G4S P;  4YPC A;  3Q1M A;  1SFC A;  3WMM 0;  2FYU D;  3CC4 P;  3SWY A;  1JTH A;  2IZ1 A;  1Q81 Q;  4C7N A;  2KSJ A;  2YKO A;  3SWF A;  4JBZ A;  4IOI H;  3L70 J;  1N86 A;  2ZJS E;  2K1A A;  1LNQ A;  1SS1 A;  1KQL A;  2XND H;  3LW5 J;  1SQX E;  3CXH E;  2WVR A;  3CPW O;  4LGD E;  5TIS E;  4D6T E;  2OTK E;  2XKM A;  3L75 E;  5CBO A;  1EZV I;  1SQB K;  3MUD C;  3HTK A;  2XNX A;  1BGY E;  1L0L E;  3A7O A;  1IZN B;  1OFC X;  1GZL A;  5KJ7 A;  1QVG O;  1ZN5 A;  1PP9 D;  2M3E A;  1EDL A;  4WY4 D;  1KYO E;  1NTM K;  3H1K E;  1N73 B;  2N9Y B;  3O6Q A;  2B87 A;  1HH0 A;  2H7H A;  4IFF A;  1ZP0 C;  3JC2 2;  4M3L A;  2BEZ F;  1PGP A;  1FE6 A;  2ZAE B;  1M1J B;  1VL2 A;  3CX5 I;  1YJ9 P;  1G1J A;  2ZYD A;  2ZT9 C;  3I55 P;  3L75 J;  3TSI A;  3A0H E;  5CHX A;  3IR9 A;  2YKP A;  2JWA A;  1MKM A;  2WSE H;  2ZVO B;  3G71 P;  1JUN A;  1VQ9 P;  2OYH B;  2OTL P;  4I7Z C;  5AW3 B;  3GG2 A;  3L71 G;  3CX5 E;  2QM7 A;  3AE5 C;  4CPG A;  5KLV J;  1SQX K;  2AXT H;  3W68 A;  1S9K E;  5KTB A;  2JKV A;  3HRN A;  3PHL A;  2LKM A;  4RO0 A;  1LP1 A;  1GK6 A;  1OMI A;  1PP9 G;  1IK9 A;  2KLV A;  5CJ4 A;  4OH8 B;  1NO4 A;  2IX7 C;  3CC7 P;  3CXH H;  3L72 D;  2FYU E;  4JPZ B;  2A06 D;  3V6I A;  3V2N A;  5TIS H;  1PFI A;  1IJD B;  2QJY C;  4H0L C;  1GL2 B;  4A7P A;  2YO3 A;  1S5L E;  1LT1 A;  3R4Y A;  3U1C A;  1HF9 A;  2P58 A;  4H13 D;  2YMK A;  1SQP J;  1K8A Q;  3V2P A;  2E5Y A;  3CL3 D;  2B9B A;  1PGJ A;  1FC2 C;  3AE1 C;  1RF1 B;  1NTK G;  1KYO H;  1FDM A;  1H0T B;  1R8E A;  1LTA C;  3CCU P;  1UIX A;  1PP9 E;  4L75 A;  3H1I D;  3KYQ A;  2MKV A;  1EXI A;  2FYN C;  1NU1 G;  2Q1K A;  3RL0 C;  3MZW B;  4QMA A;  3FX0 A;  2R5B A;  5APQ A;  2H88 C;  2QVA A;  1XTC C;  2HPC B;  1N7L A;  1SQQ E;  2JP3 A;  3TYY A;  4L76 A;  3L74 G;  1N73 A;  1W2B O;  1H8A A;  2WZ7 A;  1JCD A;  2A06 G;  3MP7 B;  2K37 A;  1HGZ A;  1M1J A;  1RE3 A;  3U59 A;  3ZDM A;  3L73 D;  1CW5 A;  3WUV A;  2QJK C;  2D2C B;  1RE4 C;  2OAR A;  2W8Z A;  2E75 B;  4YXD C;  4EOT A;  5BU5 A;  1KV4 A;  3VMY A;  4OGQ C;  4HB1 A;  3V2R A;  1NOH A;  1KB9 I;  2NPS C;  3M0A A;  3Q5R A;  2UWJ E;  3KZI H;  4TT3 H;  1ZME C;  4GOD A;  2AEM A;  2WWW A;  1JOC A;  2OYH A;  3M0D A;  1SQQ J;  1N8R Q;  1X8Y A;  1URQ B;  4ZKP A;  2NPS A;  4PJ0 H;  2OQQ A;  4I1L A;  3V5B A;  3CCJ P;  1LTT C;  1ZRT D;  2CK3 H;  1BCC G;  3CCR P;  3L36 A;  2HYN A;  1QX8 A;  1KC8 Q;  2KNC B;  3L70 D;  2FFD C;  3CWB G;  3L72 E;  1RH5 B;  5CCG D;  2A06 E;  1BE3 G;  4H44 B;  3USS A;  1RF0 C;  2NZ2 A;  1L4A B;  3C1L A;  1JY3 N;  1X22 A;  2N9B A;  2E74 D;  3VOP A;  1VQL P;  5KAI E;  5GTH E;  2Y0E A;  1NTZ J;  2K88 A;  1HJ0 A;  2RKL A;  1KIL C;  4GT1 A;  3CI9 A;  3HE4 B;  3H1L G;  3I56 P;  1RF1 C;  3ITK A;  1SFC D;  3P8C D;  1GMJ A;  4XE5 B;  2JO1 A;  3FWN A;  2Q9I A;  1QEX A;  1NTK K;  4HJG H;  4W7Y A;  4EYY Q;  3D6Z A;  3KQG A;  3RL0 g;  1KIL A;  3AE6 C;  2K3R A;  1S72 P;  1DIP A;  2FXO A;  3H1I E;  3L72 J;  3TGU G;  1RF1 A;  3HTK B;  1L0N J;  2WSS H;  4ZNC A;  1H0T A;  3EQ2 A;  1NU1 K;  1R5S A;  3L75 D;  1H88 A;  1D7M A;  1QL1 A;  3L35 A;  2B89 A;  3TF5 A;  1MUU A;  4JYC A;  2J59 M;  1KQG B;  2FBW C;  1HJB A;  2VRS A;  2KP8 A;  2FXP A;  1S4X A;  5KJ7 D;  2JDI H;  4KHX A;  3HE5 B;  3Q5S A;  3L70 G;  2WSF J;  1FU1 A;  2K9Y A;  2HPC A;  1ZW0 A;  1E5W A;  1IFP A;  5KLV D;  2JEE A;  2POH A;  3L73 E;  2BCC J;  3B5N C;  1EZV D;  3H1I J;  4ZMD A;  2NRG A;  3TNU B;  3NFQ A;  3RK3 C;  2I1K A;  2A45 I;  1YTZ I;  3MGN A;  1T3U A;  3AEG C;  2QG4 A;  3M9B A;  2ZT9 B;  3H25 A;  3P32 A;  1BDD A;  1T2K D;  2P10 A;  3KHU A;  3P7K A;  1J1E C;  4U3F E;  1A02 F;  1LT9 C;  4PV1 D;  1JB0 J;  4I6M C;  1X79 B;  4KT0 J;  3A0B E;  4IL6 E;  1KFM A;  1NKZ B;  3N7N A;  1ZRT E;  1GDT A;  3TK1 A;  5GTH H;  2Z4E A;  1EDI A;  1YIT P;  1AV1 A;  5AVU B;  3CX5 D;  3EFF K;  1URQ A;  1VF5 C;  2R32 A;  5CCH A;  3L70 E;  4D6T G;  2WIT A;  3L73 J;  1S9K D;  4N78 D;  3L75 G;  1SQP D;  1FOS E;  4K35 A;  1L0L G;  2KS1 B;  3D6Y A;  5APX A;  4N6J A;  4I2L C;  3M91 A;  4U3F J;  2KOG A;  1L4A A;  2Q3I A;  3BCC J;  1ZR2 A;  3SFE C;  3P8C E;  5KLV G;  1NVO A;  1K9M Q;  1OX3 A;  1EZV G;  2C9L Y;  1VQ6 P;  1T3J A;  2QJY B;  3OA7 A;  2LR2 A;  4H0L B;  4WWI A;  1YHQ P;  3HE4 A;  1SQB J;  1NGM B;  1AVO A;  1R5L A;  2Y9Z A;  2Q7C A;  2XV5 A;  2WPQ A;  5AVT B;  3AE4 C;  2G8Y A;  2HR3 A;  1M7L A;  2IFN A;  1J2J B;  1NHL A;  1Y9B A;  1PIX A;  1LTJ C;  4DJG A;  2B88 A;  2W90 A;  2WMM A;  2YXQ B;  3II6 A;  3H1J J;  4GIF A;  4ZKU A;  2V7Q J;  2K9J B;  2PP6 A;  3PTZ A;  1PPJ D;  1AFO A;  3MUD A;  2FYN B;  3RL0 B;  1SQP G;  1M90 Q;  1SP4 A;  3CCM P;  4DOJ A;  3PH0 A;  5KLV E;  1H89 A;  4RES B;  4UB8 E;  1Q86 Q;  1EZV E;  1DEE G;  1YJN P;  1Q82 Q;  3HE5 A;  3JCU E;  1T8Z A;  2IPP A;  3A0B H;  1SQQ D;  5B5E E;  2Y0D A;  3U1A A;  2W83 C;  1ZR4 A;  3FXE A;  1IFD A;  1KD1 Q;  3G6E P;  1HBW A;  2ZXX A;  3AEA C;  2FYU G;  3A5T A;  1GK4 A;  1RQU A;  3TNU A;  3CCQ P;  5C39 A;  3ABV C;  2I8D A;  1S3J A;  3LW5 H;  5APY A;  3VMX A;  3Q5P A;  2QJK B;  3RK2 C;  1IC2 A;  2PAJ A;  2WQY C;  2C9N Y;  4OGQ B;  2NPS B;  1IFN A;  1NTZ D;  2JJL A;  4N78 E;  1OVR A;  4WB4 A;  1SQP E;  3EWK A;  3GMA A;  2R3S A;  2WTY A;  4C46 A;  1DX7 A;  2Z5H A;  1N7S C;  1L0L K;  3H1H D;  3HD7 D;  4L73 A;  3M06 A;  5AVV B;  5AVZ B;  3N4X A;  1KB9 D;  3B8E B;  3OAK A;  2I1J A;  1DD4 A;  4OWF A;  4GDO A;  5CJ0 A;  5BVZ A;  2FFD B;  2KS1 A;  4IFM A;  1L0N D;  3WUT A;  1OW6 A;  1M8O B;  3VTP C;  1FZG A;  1PL5 A;  1FJK A;  1QVF O;  1SQQ G;  1AA0 A;  2YMY A;  2KSE A;  2BAS A;  4JQ0 D;  5AW9 B;  3C8V A;  3BAT A;  3A2A A;  3JSV C;  1GW4 A;  1KIL B;  4NPD A;  1YQ4 C;  1LJ2 A;  1GL2 D;  1IFJ A;  1KQF B;  3GLM A;  4EDF A;  2W27 A;  1ZLL A;  1LTI C;  1EXJ A;  1VQ4 P;  3JCU H;  2ZYA A;  2E76 D;  2BCC D;  2G3A A;  5AW2 B;  1OVV A;  3VP8 A;  5B5E H;  3IN6 A;  1SQV J;  2QE7 H;  1EDJ A;  1PPJ E;  1NTZ G;  4WY4 C;  1FDO A;  3AED C;  2QA4 P;  4EI2 A;  3VN0 A;  3A0H H;  3OJA B;  1RY3 A;  1SQP K;  3AEF C;  4DCK A;  2K9J A;  5AVR B;  1S2E A;  1U7M A;  2Y0C A;  3M9Q A;  1MFT A;  2IFM A;  2C0X A;  1EC5 A;  5DJU B;  1HVV A;  3CX5 H;  1VQO P;  3AE2 C;  3L72 G;  1L0N G;  1AQT A;  2Y9Y A;  2FYU K;  2AXC A;  2R5D A;  2O1K A;  5BU8 B;  5M1B A;  3OW2 O;  4U7J A;  3AE9 C;  3B5N B;  3P8M C;  2N1T D;  3RK3 B;  1LWU C;  4OVN F;  1KMI Z;  3A3Y B;  3S4R A;  1NTZ E;  2V4H A;  1KFN A;  2D2C D;  4U3F D;  2E75 D;  1RE4 A;  1K05 A;  1J1E B;  1LT9 B;  4NPF X;  3V2Q A;  1GTW A;  4BRY B;  1LWU A;  3BCC D;  1VQ5 P;  4K3A A;  3HD7 C;  3H1H E;  2MJZ A;  5E79 E;  2BCC G;  4TLF A;  3H1I G;  4LLH A;  1S5L H;  2ITA A;  1T6A A;  2PGD A;  1KB9 E;  5APS A;  1SQB D;  1URQ D;  4ASW A;  2P67 A;  1VF5 B;  3CMA P;  1YTZ T;  1S5L X;  5CCH D;  1NKN A;  1BSN A;  1YQ3 C;  1L0N E;  2GUS A;  5KLI C;  3QH9 A;  2PFX A;  4PD4 D;  1FZB A;  3EFG A;  3F89 A;  2KZI A;  1G2C A;  1SQQ K;  4B86 A;  1LTB C;  3BAS A;  2FFD A;  1NTM D;  4H13 C;  4H44 D;  3PJS K;  3H1J D;  5AW0 B;  2XZR A;  1RF0 A;  2FY8 A;  4AYC A;  1GD2 E;  3L37 A;  4YTP C;  3UIA A;  2QRX A;  1L4A D;  3VP9 A;  2OYO A;  4DT0 A;  3H1H J;  3HUS C;  3L73 G;  2R3C A;  3QWO C;  2KB7 P;  3LID A;  2YKQ A;  2O3J A;  1TU3 F;  3IAO A;  1FZF A;  2WPR A;  2E76 C;  2BCC E;  5DJT B;  1OW8 A;  2J5U A;  1LTG C;  1EDK A;  2L91 A;  3RBX A;  4U3F G;  2O01 J;  3L74 J;  2IBZ I;  4ASV A;  5L8R J;  3BCC G;  3Q2Y A;  1LTJ B;  1A02 J;  1M1K Q;  4YXW H;  2J58 A;  2A45 G;  1FAV A;  3G9R A;  1SQB G;  1LTS C;  2HLO A;  3AE8 C;  5KAF E;  1AJY A;  5B66 E;  1HTL C;  1Y8A A;  1FZC C;  3H32 B;  1NWQ A;  1Z56 A;  3FXD A;  2QM8 A;  1WRG A;  3FWL A;  1ZXG A;  1YYC A;  2N1T C;  2OYI C;  2Q5U A;  3SFD C;  1QL2 A;  1QGK B;  5E79 H;  3PLN A;  3H1J G;  1KB9 H;  4Y99 C;  3B5N A;  3KPE A;  4PD4 I;  1BCC J;  4RJT A;  1OW7 A;  1KZU B;  3BCC E;  1BE3 J;  2ZT9 D;  3CD6 P;  1FS0 E;  5KAI H;  2FXM A;  3RK2 B;  5KKZ C;  2W6B A;  1LT9 A;  2XU6 A;  1SQB E;  4UB6 E;  1IO4 A;  3D70 A;  4BRY A;  4AUW A;  1VQP P;  5CCG C;  3AEE C;  2FYZ A;  3E7K A;  5H2F E;  4PD4 E;  5APW A;  1VQM P;  3H1L J;  2E74 C;  3VYI A;  2WSF H;  2P2U A;  1N7S B;  1YIJ P;  1NTM E;  2H8P D;  5AVY B;  2ZYG A;  3H1J E;  1KTM A;  3NMD A;  2OTJ P;  1SFC C;  1XTG B;  1SQV D;  1RHZ B;  1IK7 A;  1JEK A;  2KYV A;  1Q2N A;  3B4S A;  1JY2 N;  1M57 D;  2KIK A;  3B71 A;  1NYH A;  3CXH I;  2WSC J;  1UII A;  3CCL P;  2E42 A;  1U7J A;  1J1D C;  3GF7 A;  1USE A;  3AE7 C;  3GF3 A;  2H89 C;  1SLQ A;  2KK7 A;  1QLE D;  4H0L D;  3BVH A;  5KAF H;  3GHG C;  5B66 H;  1NTM J;  3L71 D;  2IYP A;  2WSE J;  2R44 A;  3PRJ A;  1KYO I;  1E79 H;  5KJ7 C;  4XFJ A;  1LTJ A;  1FDI A;  3GHG A;  3F5H A;  1U57 A;  4WY4 B;  1JY3 P;  4LC1 A;  5AW8 B;  4W7Z A;  1HGV A;  1WT6 A;  1Q7Y Q;  1AVY A;  3T97 B;  3IFM A;  3LIE A;  2DW3 A;  4IL6 H;  2Q3E A;  2L5G B;  2FKW B;  2QIW A;  2CPB A;  3RL0 D;  1PZQ A;  4BWN A;  2LXB A;  3H32 A;  4IL6 X;  1ZV8 A;  3MTU E;  2A45 H;  1T2K C;  1SQV G;  2WSC H;  4UB6 H;  3V4Q A;  4PV1 C;  3AEC C;  3I5C A;  1SQX J;  1FOS F;  5AW4 B;  5AVW B;  4NPE A;  5H2F H;  1VPC A;  4PD4 H;  4D6T J;  3K5B A;  4HYT B;  2GA1 A;  1JNM A;  1GU5 A;  1BGY J;  1L0L J;  1G1I A;  1LWU B;  3RBZ A;  1NTK D;  4L74 A;  2ZVN B;  2BEQ D;  5GTI E;  2V7Q H;  1VQ7 P;  2KLU A;  2YNY A;  4BXL A;  1AQ5 A;  4OGQ D;  3H1K J;  2NPS D;  3CC2 P;  5TJH A;  3S9O A;  3HD7 B;  2KI7 B;  2XDJ A;  1NU1 D;  2QJP C;  4HH2 A;  3KXD A;  1PPJ G;  3BRT B;  2GM4 A;  1G2C B;  1SQV E;  5APU A;  2AEF A;  1USD A;  2YIU C;  1N7S A;  2M5A B;  5KLI B;  5KLV K;  4XA4 A;  1VQ8 P;  3KZI E;  2HOD B;  1PV3 A;  3L74 D;  2JWD A;  5APV A;  1JY3 O;  2M8R A;  2LXC B;  4O9B A;  3VMA A;  1MFZ A;  3WUU A;  1P84 D; 
#chains in the Genus database with same CATH homology
 3WU2 E;  5GTI E;  5E79 E;  4UB6 E;  2AXT E;  3A0H E;  5KAI E;  4PJ0 E;  5GTH E;  3A0B E;  4IL6 E;  5H2F E;  4UB8 E;  3KZI E;  5KAF E;  3JCU E;  1S5L E;  5B66 E;  5TIS E;  1W5C E;  5B5E E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...