1W5CE

Photosystem ii from thermosynechococcus elongatus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
77
structure length
76
Chain Sequence
RPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM Q(B) PROTEIN 1
publication title Crystal Structure of Cyanobacterial Photosystem II at 3.2 A Resolution: A Closer Look at the Mn- Cluster
rcsb
molecule tags Photosynthesis
total genus 14
structure length 76
sequence length 77
chains with identical sequence K
ec nomenclature
pdb deposition date 2004-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 1w5cE00
4IL6E 4UB6E 5GTHE 5KAFE 4UB8E 5GTIE 3WU2E 5B66E 3A0HE 4PJ0E 1W5CE 5H2FE 3A0BE 5E79E 5KAIE 1S5LE 3JCUE 5B5EE 5TISE 2AXTE 3KZIE
chains in the Genus database with same CATH superfamily
3L35A 2KZIA 5AW0B 2D2CB 2A06D 1JM0A 3B4SA 4H0LC 1FJKA 1SQPD 3A2AA 3TGUE 2HODB 4D6TJ 2N1TB 2R3CA 3L74E 2CPBA 1NYHA 1SFCD 3RL0C 3H1JD 2ZYAA 1IFNA 1USDA 1X22A 2E75B 2P58A 3FX0A 3TGUD 1QX8A 3L74D 2WPSA 1M90Q 3H1IJ 2Q9IA 1SFCA 2Y9YA 2KS1A 2O1JA 1FBMA 1ZRTE 1FS0E 1KC8Q 1L0LK 2W90A 2GM4A 2FYUG 1K73Q 2OYHA 1VQPP 5KAIH 5APWA 3V2NA 1M7LA 1KZUB 1N7SB 2M0BA 1JY2P 1NGMB 1PGPA 2HG5D 4LC1A 1NH4A 1JMBA 1HUCA 1JY3O 2E76B 1RE3C 1OVRA 1NTZE 3LW5H 1RQUA 3GW6A 3EWKA 1HGZA 2KI7B 2YKOA 1HJBA 4A7PA 1L0LE 3G9RA 1LTJA 3ABVC 3BASA 2K9JB 2KYVA 2WSSH 3H32B 3H1HJ 4H44B 4D6TG 1L2PA 3I55P 1NTZD 1FOSF 2D2CC 3Q3DA 3W67A 1T2KC 3HRNA 3E1IA 5AVZB 1IFIA 2N1TC 5GTHE 1FZAA 1OW8A 1QGKB 5KKZC 1LTAC 3H1IG 1U7MA 4GIFA 5APYA 4I1LA 1YIJP 2J5UA 3A0BE 5E79E 3OW2O 1NTMK 1SQPJ 2E75C 4ASWA 1VQNP 2M3EA 3FWNA 2YMYA 3H1JJ 4BXLA 4PD4I 4PJ0H 3KHUA 2B9BA 2BCCE 1S5LX 3WUUA 3CWBE 2W6JH 4KT0J 2YIUB 4JYCA 3TGUJ 1T3UA 3L74J 1YTZT 1MUUA 2UWJE 5TISH 3CC4P 4I2LC 4CPGA 1SFCB 2KS1B 5CCHD 1N7SC 2KLUA 2H7HA 2FFDA 5APTA 1HBWA 1GW3A 5GTIE 3IR9A 1NTME 3JC22 3SFDC 2OYHB 2E76C 3H1HG 1SP4A 1J1DB 2G8YA 1Q86Q 3M06A 5KLVG 4OVNF 5CCHA 3L72E 1EZVI 4EOTA 1LP1A 5AW8B 4DZOA 1URQD 4H44C 1EC5A 1VQMP 4PD4E 1S5LE 2RH0A 1HF9A 1LT9A 1W2BO 2A06G 4M3LA 3M9BA 1LTJB 5AVTB 1SQPG 2W83C 3V2RA 1NTZJ 4OGQD 1LT1A 1KV4A 4PD4D 3H1JG 3IFMA 2WITA 2J58A 2IZ0A 1SQBD 1A02J 1YHQP 4K3AA 2FYZA 4JF7A 1N8RQ 4XFJA 3CCLP 2IPPA 2PP6A 5CHXA 2WSFH 2YIUC 1GL2D 1YQ3C 3GF3A 1MZ9A 5M1BA 3BRVB 5AW6B 3WU2E 1S9KE 3G3ZA 3N7NA 1SFCC 5AVQB 1E5WA 1OVUA 3SWFA 3AE6C 1PGQA 3PLNA 5C39A 1H8AA 1GL2A 1GK6A 1SLQA 1M1JA 2OYHC 2IX7C 2ZVOB 4DJGA 4YXDC 2FY8A 3MIWA 3L36A 2QVAA 2FYUK 1NU1J 1NJIQ 2FFDB 2WVRA 1NVOA 2XDJA 1OZHA 3I56P 1PP9D 3VN0A 2PGDA 2I1JA 2KXPB 1AFOA 4IL6X 3CX5D 4OWFA 1NTZG 2K88A 1P84I 3NFQA 2Z5HA 1KFMA 4WVZA 1LTJC 1IO4A 3TSIA 2FYUE 1S72P 1LT9B 2ZXXA 1SQXK 2I8DA 1QEXA 1Q90D 1DEEG 4KHXA 1MKMA 4L73A 3EFFK 1ZV8A 4IL6E 3EQ2A 1SQBJ 4C7RA 4DOJA 5AVRB 3C9IA 3VMYA 2KP8A 2ZAEB 1M56D 1P84E 1Y47A 1NU1G 4D6TE 1FZCA 3L70D 1K04A 1S3JA 1RE4A 1FZFA 1SQXE 1J1EB 1OW7A 3VOPA 2OTLP 4L75A 1Y9BA 3D6ZA 4LGDE 1R5SA 1FE6A 2R5BA 5AW7B 2LXBA 4KJMA 1AJYA 1Q7YQ 2FFDC 1KQGB 3O6QA 1K8AQ 2RKLA 3F89A 1AV1A 2K3RA 3H1IE 1SQXD 3FGAD 1M1JB 1VQ9P 4OH8B 5GTHH 1LTIC 1VDFA 3VTPC 3A0BH 5E79H 3C8VA 1PP9J 2QA4P 1KILC 1JTHB 2H88C 5KLVK 3R2PA 2O01J 3B5ND 2KZJA 1VF5D 1SVFA 2OGUA 2OARA 3NXSA 1QL2A 3TK1A 1LT9C 4GT1A 4JPZB 5H2FE 1PPJD 3AEAC 3B5NA 1SQBG 4N3YB 1EDJA 2Q6QA 1H0TA 1SQPK 3L73G 5GTIH 1XTGB 3H1HE 3T97A 1JNMA 3L75D 5KLVE 3II6A 1IK9A 1S4XA 4IFMA 3QH9A 4GKGA 1FZGA 2B87A 1BE3E 4WBAA 4WWIA 2XZRA 3MZWB 2WPVB 1DH3A 5CBOA 2O01N 2E74D 3CCUP 2Z4EA 4Y99B 3QWOC 1OMIA 1SQQD 4GOFA 5KLVD 1VL2A 2B89A 2W6BA 1AQTA 1Q82Q 2OYIA 2HPCA 4PD4H 2R3SA 1FAVA 2CPSA 1S5LH 3KPEA 1BE3D 5AW1B 2E42A 1SQPE 1L4AD 1LWUA 3L70J 1FZCB 3GG2A 1PP9G 2W27A 3H1JE 3HE5A 1GU4A 3RBXA 2FBWC 1BCCD 1L4AA 4NPEA 5KLIB 3O6QB 3M0DC 1SQXJ 3TDKA 1AQ5A 4GODA 3PRJA 1EXJA 2KK7A 2C9NY 3AE1C 3CCVP 5KJ7C 3A5TA 1LGHB 3AEGC 4DT0A 3G6EP 1T6AA 1NTZK 3VMAA 1NAFA 2SPZA 3WU2H 3G71P 2JWDA 1EDIA 2W8ZA 2DW3A 4BRYA 2ZXEB 2O01H 3EFGA 1EDLA 3HTKA 2AEMA 3B5NB 1VF5B 1ZW0A 3HE4A 3H1LE 3TF5A 1OIPA 2WSCJ 1H0TB 3IAOA 3L75J 3L70G 3T97B 4Y99C 2WWWA 3SWKA 2K9YA 1T3JA 1KN7A 5CBNA 2B87B 4NPDA 3H1LD 2ITAA 1FOSE 3ITKA 3CCSP 1LNQA 5KAFE 1T8ZA 1SQQJ 5BVZA 4TLFA 1FZCC 2N9YB 5KLVJ 1RE4C 3CL3D 1SQXG 1IFJA 4W7YA 1J2JB 1NU1K 2OYIB 4TT3H 1GK4A 2HPCB 1BE3J 2CK3H 2QJKB 4LLHA 1MFTA 1G2CA 4WY4D 3V2PA 2E74B 1M57D 3MHVA 2IYOA 1LWUB 5KLIC 1DD4A 3A0HE 1BGYD 2WSEH 1FU1A 3KXDA 3JSVC 4WB4A 1K05A 2N9BA 2Y0EA 1BCCJ 2A45G 4WY4A 1OXZA 2QJYB 1H88A 1IC2A 3Q1MA 2WTYA 4IL6H 1PGJA 4U7JA 1PPJG 3GHGA 2Y0DA 1NU1E 2GA1A 4BWNA 2QSIA 5BU8B 1P84H 1WRGA 2KNCA 3L75G 1RQVA 1Y8AA 2L5GB 3FXEA 1NU1D 1VF5C 4ZNCA 1IFMA 4C46A 3H1KE 1SQBK 3PH0A 5B5EE 1SQQG 1E79H 4BRYB 2WPRA 3GLMA 1CW5A 3HTKB 2QRXA 2A45H 3HE4B 1BE3G 1G1IA 2C0XA 3H1KD 3PTZA 1FZBA 1NWQA 3CI9A 2HFED 1GW4A 5AVSB 3RK3E 2IZ1A 3MUDC 1HJ0A 3H1LJ 2E5TA 2WSCH 2M3BA 4YPCA 1BCCG 1SQBE 3FXDA 2QJKC 2IFNA 1FJPA 3CLQA 2E74C 1LWUC 1URQA 5H2FH 1N73A 3CX5I 1VQKP 3L73E 3IN6A 3JCUE 4Y28J 1RF1A 2M8RA 2NPSD 3RK3D 3L71E 2QG4A 5CJ0A 2JEEA 4IOIH 3AEDC 2R32A 1BGYJ 5L8RJ 5AW5B 3L73D 2ZYGA 1OX3A 2NPSA 1DEBA 2J59M 3L71D 2BASA 1GTWA 4NPFX 3BRTB 4WY4B 2WZ7A 1IZNB 2P2UA 3HUSA 1ZN5A 1RHZB 1JY3P 4RESB 3Q5PA 4ZKPA 3D71A 5EFWB 2P67A 1JOCA 3CMAP 1PP9E 2KOGA 3FWLA 3RGUA 3MGNA 1KD1Q 1RF0A 1NOHA 1NKNA 2RMZA 3CX5E 4EI2A 1PFIA 1HH0A 1J1DC 1WT6A 2POHA 1PGOA 5B66E 2MJZA 3H1LG 3AEEC 3RL0D 1PIXA 3H25A 3NTNA 3TYYA 1K9MQ 2JP3A 1JY2N 3H1KJ 1H89A 1ZP0C 1JO5A 1LP1B 2BEZF 2H89C 1KB9I 4JYBA 5TJHA 2AXTE 4GOEA 1BGYG 1Q2NA 5AVWB 4UB6E 3M9QA 2YO3A 2YNYA 1URQB 2KSEA 1N73B 1EXIA 2A45I 2OTJP 3L70E 1RF1B 2PAJA 1VQ7P 2IYPA 2HLOA 3CMEP 2L91A 2MKVA 4L76A 4OGQB 1LTSC 5AW4B 1L0NE 3L73J 1DX7A 2NPSB 3RK3B 3I5CA 4K35A 2JWAA 3L71J 1IFDA 5KAFH 1KB9E 4IFDK 1T2KD 3HUSB 1L0ND 4AYCA 1JY2O 2N1TD 1YI2P 2GUSA 1SQVK 4I6MC 1VQ4P 5APVA 2NRGA 3H1KG 3VP8A 1UIXA 1UIIA 1GL2B 1KB9D 3V4WA 3A0HH 1AVYA 1JMMA 2E75D 1JCCA 2WPQA 2HODA 5CCHC 2XNDH 1FDIA 1SQQK 1PPJE 1N7LA 4ZMDA 3AECC 4AQRD 2XU6A 3W68A 2NZ2A 1LTTC 3U59A 3KQGA 1SQVE 3L75E 1KYOI 2RN0A 1N7SD 4QMAA 2XV5A 3TNUA 1URQC 1XTCC 1EQ7A 1SQQE 1CI6A 3P8MC 1RF1C 2Q3EA 1SQVD 1KMIZ 3D70A 1FDMA 3BCCD 3L71G 2GUVA 3LW5J 3C1LA 1N7SA 3N4XA 5B5EH 1RY3A 4OGQC 3RK2D 2XKMA 3AE8C 3CC2P 2NPSC 3RK3C 4DCKA 4RO0A 1J1EC 1LTBC 1YQ4C 1U57A 1NTKK 1QVGO 3HUSC 1BCCE 2FXOA 2QJPB 3WUTA 2WQYC 1KYOE 1CSBA 2WT7A 3A7OA 4PV1D 3VMXA 1YITP 1GL2C 1M1JC 4H13D 3JCUH 1R5LA 1L0NJ 2Q3IA 3V6IA 1KYOD 3M9HA 2AEJA 5CCGD 2YXQB 5BU5A 1NTKE 1ZR2A 1KQSO 3GMAA 3V4QA 2ZT9D 2IBZD 1OW6A 5KKZB 1S2EA 5CCGA 5KTBA 2YMKA 1S1CX 2OYOA 4UB8H 2OQQA 2HYNA 1NTKD 1ZR4A 3SFEC 2P7JA 1YJNP 5APXA 3K5BA 2AXCA 4N6JA 1OVVA 1W2EA 2VRSA 5DJUB 2JKVA 3F5HA 3CX5H 2KLVA 3TNUB 3BVHA 2JDIH 4EIJA 4HYTB 3U1CA 1OFCX 5B66H 1ZMEC 1M1KQ 1JCDA 1CI6B 1SQVJ 1FDOA 2IFMA 3BCCJ 1YJWP 5APQA 1ZRTD 2KIKA 3GF7A 3S1KA 2Y0CA 2QE7H 2QJPC 1L0NG 3E1RA 3P8CE 3VMZA 1BGYE 3L37A 1PL5A 1X9VA 2M5AA 3CCJP 2AXTH 3O8ZA 3RK2B 2LR2A 2E5YA 2QM8A 1BSNA 4Z1MH 4UB6H 2WT7B 3P8CD 3IF4A 3CPWO 3ZDMA 3LIEA 1KQFB 3UIAA 3HE5B 1L0LD 1A02F 2JO1A 1L4AB 2WSFJ 1NHLA 3KZIE 2ZVNB 4PV1B 2YO2A 2FYNB 5AW2B 1HTLC 4I7ZB 3CXHI 3SWYA 4L74A 4H13B 1LTGC 3PP5A 1GD2E 2PFXA 2WMMA 1SQVG 2Y9ZA 1BDCA 3BCCG 1EDKA 2YKQA 1KB9H 2YXRB 1IK7A 2ZYDA 3B5NC 3RL0g 1KILE 2V7QJ 4EDFA 4N78E 1NTKJ 5AW3B 4YXWH 2ZT9B 5AVUB 3CCRP 5AVXB 4ZKUA 3RBZA 2B88A 1AA0A 4ASVA 1ZOYC 4AUWA 1KILD 2BCCD 4N78D 3HD7D 3CWBD 1FC2C 3AE5C 3WUVA 3B71A 2KSJA 3MD0A 2KB7P 4IFFA 2QIWA 3CXHE 3A3YB 3PHLA 3R4YA 2OYIC 4EYYQ 1KILA 3HD7A 1NTMD 3RK2C 2QEXP 3AEFC 2P10A 4U3FE 1VQLP 1DIPA 5AW9B 2OTKE 1YTZI 3CXHD 2M5AB 5AVVB 4O9BA 1PV3A 1YBKA 2H43A 3L72D 4HKZH 2LXCB 2IBZG 1G2CB 1L4AC 2QJYC 4C7NA 2K37A 1KTMA 4U3FD 4PV1C 1GDTA 1ZXGA 2FYNC 3AE7C 4I7ZC 4XA4A 3Q2YA 2FXMA 3NMDA 1L0LJ 4H13C 1NTKG 2Q1KA 1M8OB 3TGUG 4UB8E 3V5BA 3L74G 4JQ0D 1U7JA 5CCGC 3GHGB 1IJDB 5DJTB 2BEQD 1EZVE 3SSUA 4R4MA 1NO4A 2IDBA 2ZT9C 1KYOH 1QVFO 2KNCB 4H0LD 1GZLA 1ZLLA 4W7ZA 2AEFA 3OA7A 1GU5A 2E43A 1EZVD 1X79B 5KAIE 3PJSK 1Z56A 2Z5IA 5KJ7D 3OJAB 5K5GB 1S9KD 3USSA 2V7QH 1G1JA 3M0DA 2BCCJ 2V4HA 3CWBJ 1JTHA 1MFZA 4XE5B 4W80A 1TU3F 2O3JA 3KDPB 2PRRA 4YTPC 5KJ7A 4R4LA 3S9OA 1L0NK 1X0TA 2P1JA 2C0WA 1KILB 1L0LG 1NTMJ 3AEBC 3HD7B 2QM7A 1KORA 1D7MA 1KQLA 3MP7B 1CZQA 3L72J 2O1KA 4RKUJ 4B86A 2K1AA 3Q5SA 2YKPA 1NKZB 3AE9C 3U1AA 4HJGH 4WY4C 4C7NB 4U3FJ 2HR3A 1N86A 2FYUD 3L4FA 3AE3C 3GHGC 3M91A 3VP9A 1RE3A 1USEA 2LKMA 1YJ9P 4GDOA 2ZFCA 2C9LY 1QL1A 1JB0J 2D2CD 3KYQA 4PJ0E 5CJ4A 3M0AA 1W5CE 1SS1A 3CCEP 1AVOA 1GMJA 3D6YA 2H8PD 2BCCG 1JUNA 1HGVA 5TISE 2ZJSE 1BDDA 3P32A 3CWBG 1VQ5P 1VQOP 4JBZA 1P84D 2JJLA 1DD3A 2N1TA 4D6TD 1JEKA 1NTMG 5CMZA 3KZIH 3P7KA 3CD6P 4H0LB 1HVVA 3B8EB 1VQ6P 1R8EA 1KFNA 3L72G 3BCCE 3RL0B 3HD7C 3H1ID 1RH5B 2R44A 4U3FG 1FZEA 1N73C 2Q7CA 1HWTC 3CCQP 2IBZI 2E76D 1WMKA 3CC7P 2W6AA 3WMM0 2KUBA 3LIDA 3CCMP 3AE4C 5APUA 5AVYB 2R5DA 1VPCA 3OAKA 1LJ2A 4HH2A 3H6PA 1VQ8P 2G3AA 1NAYA 4H44D 2FXPA 2XNXA 4MN4C 4HB1A 1X8YA 1QLED 3VYIA 1MV8A 1N2DC 1IFPA 2Q5UA 4RJTA 3V2QA 3CXHH 3AE2C 3G4SP 2FYUJ 3S4RA 2K9JA 3H32A 5APSA 1PZQA 1EZVG 2JR8A 3H1HD 1YYCA 2I1KA 1RF0C 3BATA 1Q81Q 2A06E 3MUDA 2FKWB 3MTUE 2WSEJ 1BSHA 1OWAA 3E7KA 2IBZE 3Q5RA 1JY3N
chains in the Genus database with same CATH topology
4IL6E 4UB6E 5GTHE 5KAFE 4UB8E 5GTIE 3WU2E 5B66E 3A0HE 4PJ0E 1W5CE 5H2FE 3A0BE 5E79E 5KAIE 1S5LE 3JCUE 5B5EE 5TISE 2AXTE 3KZIE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IL6 E;  4UB6 E;  5GTH E;  5KAF E;  4UB8 E;  5GTI E;  3WU2 E;  5B66 E;  3A0H E;  4PJ0 E;  1W5C E;  5H2F E;  3A0B E;  5E79 E;  5KAI E;  1S5L E;  3JCU E;  5B5E E;  5TIS E;  2AXT E;  3KZI E; 
#chains in the Genus database with same CATH topology
 3L35 A;  2KZI A;  5AW0 B;  2D2C B;  2A06 D;  1JM0 A;  3B4S A;  4H0L C;  1FJK A;  1SQP D;  3A2A A;  3TGU E;  2HOD B;  4D6T J;  2N1T B;  2R3C A;  3L74 E;  2CPB A;  1NYH A;  1SFC D;  3RL0 C;  3H1J D;  2ZYA A;  1IFN A;  1USD A;  1X22 A;  2E75 B;  2P58 A;  3FX0 A;  3TGU D;  1QX8 A;  3L74 D;  2WPS A;  1M90 Q;  3H1I J;  2Q9I A;  1SFC A;  2Y9Y A;  2KS1 A;  2O1J A;  1FBM A;  1ZRT E;  1FS0 E;  1KC8 Q;  1L0L K;  2W90 A;  2GM4 A;  2FYU G;  1K73 Q;  2OYH A;  1VQP P;  5KAI H;  5APW A;  3V2N A;  1M7L A;  1KZU B;  1N7S B;  2M0B A;  1JY2 P;  1NGM B;  1PGP A;  2HG5 D;  4LC1 A;  1NH4 A;  1JMB A;  1HUC A;  1JY3 O;  2E76 B;  1RE3 C;  1OVR A;  1NTZ E;  3LW5 H;  1RQU A;  3GW6 A;  3EWK A;  1HGZ A;  2KI7 B;  2YKO A;  1HJB A;  4A7P A;  1L0L E;  3G9R A;  1LTJ A;  3ABV C;  3BAS A;  2K9J B;  2KYV A;  2WSS H;  3H32 B;  3H1H J;  4H44 B;  4D6T G;  1L2P A;  3I55 P;  1NTZ D;  1FOS F;  2D2C C;  3Q3D A;  3W67 A;  1T2K C;  3HRN A;  3E1I A;  5AVZ B;  1IFI A;  2N1T C;  5GTH E;  1FZA A;  1OW8 A;  1QGK B;  5KKZ C;  1LTA C;  3H1I G;  1U7M A;  4GIF A;  5APY A;  4I1L A;  1YIJ P;  2J5U A;  3A0B E;  5E79 E;  3OW2 O;  1NTM K;  1SQP J;  2E75 C;  4ASW A;  1VQN P;  2M3E A;  3FWN A;  2YMY A;  3H1J J;  4BXL A;  4PD4 I;  4PJ0 H;  3KHU A;  2B9B A;  2BCC E;  1S5L X;  3WUU A;  3CWB E;  2W6J H;  4KT0 J;  2YIU B;  4JYC A;  3TGU J;  1T3U A;  3L74 J;  1YTZ T;  1MUU A;  2UWJ E;  5TIS H;  3CC4 P;  4I2L C;  4CPG A;  1SFC B;  2KS1 B;  5CCH D;  1N7S C;  2KLU A;  2H7H A;  2FFD A;  5APT A;  1HBW A;  1GW3 A;  5GTI E;  3IR9 A;  1NTM E;  3JC2 2;  3SFD C;  2OYH B;  2E76 C;  3H1H G;  1SP4 A;  1J1D B;  2G8Y A;  1Q86 Q;  3M06 A;  5KLV G;  4OVN F;  5CCH A;  3L72 E;  1EZV I;  4EOT A;  1LP1 A;  5AW8 B;  4DZO A;  1URQ D;  4H44 C;  1EC5 A;  1VQM P;  4PD4 E;  1S5L E;  2RH0 A;  1HF9 A;  1LT9 A;  1W2B O;  2A06 G;  4M3L A;  3M9B A;  1LTJ B;  5AVT B;  1SQP G;  2W83 C;  3V2R A;  1NTZ J;  4OGQ D;  1LT1 A;  1KV4 A;  4PD4 D;  3H1J G;  3IFM A;  2WIT A;  2J58 A;  2IZ0 A;  1SQB D;  1A02 J;  1YHQ P;  4K3A A;  2FYZ A;  4JF7 A;  1N8R Q;  4XFJ A;  3CCL P;  2IPP A;  2PP6 A;  5CHX A;  2WSF H;  2YIU C;  1GL2 D;  1YQ3 C;  3GF3 A;  1MZ9 A;  5M1B A;  3BRV B;  5AW6 B;  3WU2 E;  1S9K E;  3G3Z A;  3N7N A;  1SFC C;  5AVQ B;  1E5W A;  1OVU A;  3SWF A;  3AE6 C;  1PGQ A;  3PLN A;  5C39 A;  1H8A A;  1GL2 A;  1GK6 A;  1SLQ A;  1M1J A;  2OYH C;  2IX7 C;  2ZVO B;  4DJG A;  4YXD C;  2FY8 A;  3MIW A;  3L36 A;  2QVA A;  2FYU K;  1NU1 J;  1NJI Q;  2FFD B;  2WVR A;  1NVO A;  2XDJ A;  1OZH A;  3I56 P;  1PP9 D;  3VN0 A;  2PGD A;  2I1J A;  2KXP B;  1AFO A;  4IL6 X;  3CX5 D;  4OWF A;  1NTZ G;  2K88 A;  1P84 I;  3NFQ A;  2Z5H A;  1KFM A;  4WVZ A;  1LTJ C;  1IO4 A;  3TSI A;  2FYU E;  1S72 P;  1LT9 B;  2ZXX A;  1SQX K;  2I8D A;  1QEX A;  1Q90 D;  1DEE G;  4KHX A;  1MKM A;  4L73 A;  3EFF K;  1ZV8 A;  4IL6 E;  3EQ2 A;  1SQB J;  4C7R A;  4DOJ A;  5AVR B;  3C9I A;  3VMY A;  2KP8 A;  2ZAE B;  1M56 D;  1P84 E;  1Y47 A;  1NU1 G;  4D6T E;  1FZC A;  3L70 D;  1K04 A;  1S3J A;  1RE4 A;  1FZF A;  1SQX E;  1J1E B;  1OW7 A;  3VOP A;  2OTL P;  4L75 A;  1Y9B A;  3D6Z A;  4LGD E;  1R5S A;  1FE6 A;  2R5B A;  5AW7 B;  2LXB A;  4KJM A;  1AJY A;  1Q7Y Q;  2FFD C;  1KQG B;  3O6Q A;  1K8A Q;  2RKL A;  3F89 A;  1AV1 A;  2K3R A;  3H1I E;  1SQX D;  3FGA D;  1M1J B;  1VQ9 P;  4OH8 B;  5GTH H;  1LTI C;  1VDF A;  3VTP C;  3A0B H;  5E79 H;  3C8V A;  1PP9 J;  2QA4 P;  1KIL C;  1JTH B;  2H88 C;  5KLV K;  3R2P A;  2O01 J;  3B5N D;  2KZJ A;  1VF5 D;  1SVF A;  2OGU A;  2OAR A;  3NXS A;  1QL2 A;  3TK1 A;  1LT9 C;  4GT1 A;  4JPZ B;  5H2F E;  1PPJ D;  3AEA C;  3B5N A;  1SQB G;  4N3Y B;  1EDJ A;  2Q6Q A;  1H0T A;  1SQP K;  3L73 G;  5GTI H;  1XTG B;  3H1H E;  3T97 A;  1JNM A;  3L75 D;  5KLV E;  3II6 A;  1IK9 A;  1S4X A;  4IFM A;  3QH9 A;  4GKG A;  1FZG A;  2B87 A;  1BE3 E;  4WBA A;  4WWI A;  2XZR A;  3MZW B;  2WPV B;  1DH3 A;  5CBO A;  2O01 N;  2E74 D;  3CCU P;  2Z4E A;  4Y99 B;  3QWO C;  1OMI A;  1SQQ D;  4GOF A;  5KLV D;  1VL2 A;  2B89 A;  2W6B A;  1AQT A;  1Q82 Q;  2OYI A;  2HPC A;  4PD4 H;  2R3S A;  1FAV A;  2CPS A;  1S5L H;  3KPE A;  1BE3 D;  5AW1 B;  2E42 A;  1SQP E;  1L4A D;  1LWU A;  3L70 J;  1FZC B;  3GG2 A;  1PP9 G;  2W27 A;  3H1J E;  3HE5 A;  1GU4 A;  3RBX A;  2FBW C;  1BCC D;  1L4A A;  4NPE A;  5KLI B;  3O6Q B;  3M0D C;  1SQX J;  3TDK A;  1AQ5 A;  4GOD A;  3PRJ A;  1EXJ A;  2KK7 A;  2C9N Y;  3AE1 C;  3CCV P;  5KJ7 C;  3A5T A;  1LGH B;  3AEG C;  4DT0 A;  3G6E P;  1T6A A;  1NTZ K;  3VMA A;  1NAF A;  2SPZ A;  3WU2 H;  3G71 P;  2JWD A;  1EDI A;  2W8Z A;  2DW3 A;  4BRY A;  2ZXE B;  2O01 H;  3EFG A;  1EDL A;  3HTK A;  2AEM A;  3B5N B;  1VF5 B;  1ZW0 A;  3HE4 A;  3H1L E;  3TF5 A;  1OIP A;  2WSC J;  1H0T B;  3IAO A;  3L75 J;  3L70 G;  3T97 B;  4Y99 C;  2WWW A;  3SWK A;  2K9Y A;  1T3J A;  1KN7 A;  5CBN A;  2B87 B;  4NPD A;  3H1L D;  2ITA A;  1FOS E;  3ITK A;  3CCS P;  1LNQ A;  5KAF E;  1T8Z A;  1SQQ J;  5BVZ A;  4TLF A;  1FZC C;  2N9Y B;  5KLV J;  1RE4 C;  3CL3 D;  1SQX G;  1IFJ A;  4W7Y A;  1J2J B;  1NU1 K;  2OYI B;  4TT3 H;  1GK4 A;  2HPC B;  1BE3 J;  2CK3 H;  2QJK B;  4LLH A;  1MFT A;  1G2C A;  4WY4 D;  3V2P A;  2E74 B;  1M57 D;  3MHV A;  2IYO A;  1LWU B;  5KLI C;  1DD4 A;  3A0H E;  1BGY D;  2WSE H;  1FU1 A;  3KXD A;  3JSV C;  4WB4 A;  1K05 A;  2N9B A;  2Y0E A;  1BCC J;  2A45 G;  4WY4 A;  1OXZ A;  2QJY B;  1H88 A;  1IC2 A;  3Q1M A;  2WTY A;  4IL6 H;  1PGJ A;  4U7J A;  1PPJ G;  3GHG A;  2Y0D A;  1NU1 E;  2GA1 A;  4BWN A;  2QSI A;  5BU8 B;  1P84 H;  1WRG A;  2KNC A;  3L75 G;  1RQV A;  1Y8A A;  2L5G B;  3FXE A;  1NU1 D;  1VF5 C;  4ZNC A;  1IFM A;  4C46 A;  3H1K E;  1SQB K;  3PH0 A;  5B5E E;  1SQQ G;  1E79 H;  4BRY B;  2WPR A;  3GLM A;  1CW5 A;  3HTK B;  2QRX A;  2A45 H;  3HE4 B;  1BE3 G;  1G1I A;  2C0X A;  3H1K D;  3PTZ A;  1FZB A;  1NWQ A;  3CI9 A;  2HFE D;  1GW4 A;  5AVS B;  3RK3 E;  2IZ1 A;  3MUD C;  1HJ0 A;  3H1L J;  2E5T A;  2WSC H;  2M3B A;  4YPC A;  1BCC G;  1SQB E;  3FXD A;  2QJK C;  2IFN A;  1FJP A;  3CLQ A;  2E74 C;  1LWU C;  1URQ A;  5H2F H;  1N73 A;  3CX5 I;  1VQK P;  3L73 E;  3IN6 A;  3JCU E;  4Y28 J;  1RF1 A;  2M8R A;  2NPS D;  3RK3 D;  3L71 E;  2QG4 A;  5CJ0 A;  2JEE A;  4IOI H;  3AED C;  2R32 A;  1BGY J;  5L8R J;  5AW5 B;  3L73 D;  2ZYG A;  1OX3 A;  2NPS A;  1DEB A;  2J59 M;  3L71 D;  2BAS A;  1GTW A;  4NPF X;  3BRT B;  4WY4 B;  2WZ7 A;  1IZN B;  2P2U A;  3HUS A;  1ZN5 A;  1RHZ B;  1JY3 P;  4RES B;  3Q5P A;  4ZKP A;  3D71 A;  5EFW B;  2P67 A;  1JOC A;  3CMA P;  1PP9 E;  2KOG A;  3FWL A;  3RGU A;  3MGN A;  1KD1 Q;  1RF0 A;  1NOH A;  1NKN A;  2RMZ A;  3CX5 E;  4EI2 A;  1PFI A;  1HH0 A;  1J1D C;  1WT6 A;  2POH A;  1PGO A;  5B66 E;  2MJZ A;  3H1L G;  3AEE C;  3RL0 D;  1PIX A;  3H25 A;  3NTN A;  3TYY A;  1K9M Q;  2JP3 A;  1JY2 N;  3H1K J;  1H89 A;  1ZP0 C;  1JO5 A;  1LP1 B;  2BEZ F;  2H89 C;  1KB9 I;  4JYB A;  5TJH A;  2AXT E;  4GOE A;  1BGY G;  1Q2N A;  5AVW B;  4UB6 E;  3M9Q A;  2YO3 A;  2YNY A;  1URQ B;  2KSE A;  1N73 B;  1EXI A;  2A45 I;  2OTJ P;  3L70 E;  1RF1 B;  2PAJ A;  1VQ7 P;  2IYP A;  2HLO A;  3CME P;  2L91 A;  2MKV A;  4L76 A;  4OGQ B;  1LTS C;  5AW4 B;  1L0N E;  3L73 J;  1DX7 A;  2NPS B;  3RK3 B;  3I5C A;  4K35 A;  2JWA A;  3L71 J;  1IFD A;  5KAF H;  1KB9 E;  4IFD K;  1T2K D;  3HUS B;  1L0N D;  4AYC A;  1JY2 O;  2N1T D;  1YI2 P;  2GUS A;  1SQV K;  4I6M C;  1VQ4 P;  5APV A;  2NRG A;  3H1K G;  3VP8 A;  1UIX A;  1UII A;  1GL2 B;  1KB9 D;  3V4W A;  3A0H H;  1AVY A;  1JMM A;  2E75 D;  1JCC A;  2WPQ A;  2HOD A;  5CCH C;  2XND H;  1FDI A;  1SQQ K;  1PPJ E;  1N7L A;  4ZMD A;  3AEC C;  4AQR D;  2XU6 A;  3W68 A;  2NZ2 A;  1LTT C;  3U59 A;  3KQG A;  1SQV E;  3L75 E;  1KYO I;  2RN0 A;  1N7S D;  4QMA A;  2XV5 A;  3TNU A;  1URQ C;  1XTC C;  1EQ7 A;  1SQQ E;  1CI6 A;  3P8M C;  1RF1 C;  2Q3E A;  1SQV D;  1KMI Z;  3D70 A;  1FDM A;  3BCC D;  3L71 G;  2GUV A;  3LW5 J;  3C1L A;  1N7S A;  3N4X A;  5B5E H;  1RY3 A;  4OGQ C;  3RK2 D;  2XKM A;  3AE8 C;  3CC2 P;  2NPS C;  3RK3 C;  4DCK A;  4RO0 A;  1J1E C;  1LTB C;  1YQ4 C;  1U57 A;  1NTK K;  1QVG O;  3HUS C;  1BCC E;  2FXO A;  2QJP B;  3WUT A;  2WQY C;  1KYO E;  1CSB A;  2WT7 A;  3A7O A;  4PV1 D;  3VMX A;  1YIT P;  1GL2 C;  1M1J C;  4H13 D;  3JCU H;  1R5L A;  1L0N J;  2Q3I A;  3V6I A;  1KYO D;  3M9H A;  2AEJ A;  5CCG D;  2YXQ B;  5BU5 A;  1NTK E;  1ZR2 A;  1KQS O;  3GMA A;  3V4Q A;  2ZT9 D;  2IBZ D;  1OW6 A;  5KKZ B;  1S2E A;  5CCG A;  5KTB A;  2YMK A;  1S1C X;  2OYO A;  4UB8 H;  2OQQ A;  2HYN A;  1NTK D;  1ZR4 A;  3SFE C;  2P7J A;  1YJN P;  5APX A;  3K5B A;  2AXC A;  4N6J A;  1OVV A;  1W2E A;  2VRS A;  5DJU B;  2JKV A;  3F5H A;  3CX5 H;  2KLV A;  3TNU B;  3BVH A;  2JDI H;  4EIJ A;  4HYT B;  3U1C A;  1OFC X;  5B66 H;  1ZME C;  1M1K Q;  1JCD A;  1CI6 B;  1SQV J;  1FDO A;  2IFM A;  3BCC J;  1YJW P;  5APQ A;  1ZRT D;  2KIK A;  3GF7 A;  3S1K A;  2Y0C A;  2QE7 H;  2QJP C;  1L0N G;  3E1R A;  3P8C E;  3VMZ A;  1BGY E;  3L37 A;  1PL5 A;  1X9V A;  2M5A A;  3CCJ P;  2AXT H;  3O8Z A;  3RK2 B;  2LR2 A;  2E5Y A;  2QM8 A;  1BSN A;  4Z1M H;  4UB6 H;  2WT7 B;  3P8C D;  3IF4 A;  3CPW O;  3ZDM A;  3LIE A;  1KQF B;  3UIA A;  3HE5 B;  1L0L D;  1A02 F;  2JO1 A;  1L4A B;  2WSF J;  1NHL A;  3KZI E;  2ZVN B;  4PV1 B;  2YO2 A;  2FYN B;  5AW2 B;  1HTL C;  4I7Z B;  3CXH I;  3SWY A;  4L74 A;  4H13 B;  1LTG C;  3PP5 A;  1GD2 E;  2PFX A;  2WMM A;  1SQV G;  2Y9Z A;  1BDC A;  3BCC G;  1EDK A;  2YKQ A;  1KB9 H;  2YXR B;  1IK7 A;  2ZYD A;  3B5N C;  3RL0 g;  1KIL E;  2V7Q J;  4EDF A;  4N78 E;  1NTK J;  5AW3 B;  4YXW H;  2ZT9 B;  5AVU B;  3CCR P;  5AVX B;  4ZKU A;  3RBZ A;  2B88 A;  1AA0 A;  4ASV A;  1ZOY C;  4AUW A;  1KIL D;  2BCC D;  4N78 D;  3HD7 D;  3CWB D;  1FC2 C;  3AE5 C;  3WUV A;  3B71 A;  2KSJ A;  3MD0 A;  2KB7 P;  4IFF A;  2QIW A;  3CXH E;  3A3Y B;  3PHL A;  3R4Y A;  2OYI C;  4EYY Q;  1KIL A;  3HD7 A;  1NTM D;  3RK2 C;  2QEX P;  3AEF C;  2P10 A;  4U3F E;  1VQL P;  1DIP A;  5AW9 B;  2OTK E;  1YTZ I;  3CXH D;  2M5A B;  5AVV B;  4O9B A;  1PV3 A;  1YBK A;  2H43 A;  3L72 D;  4HKZ H;  2LXC B;  2IBZ G;  1G2C B;  1L4A C;  2QJY C;  4C7N A;  2K37 A;  1KTM A;  4U3F D;  4PV1 C;  1GDT A;  1ZXG A;  2FYN C;  3AE7 C;  4I7Z C;  4XA4 A;  3Q2Y A;  2FXM A;  3NMD A;  1L0L J;  4H13 C;  1NTK G;  2Q1K A;  1M8O B;  3TGU G;  4UB8 E;  3V5B A;  3L74 G;  4JQ0 D;  1U7J A;  5CCG C;  3GHG B;  1IJD B;  5DJT B;  2BEQ D;  1EZV E;  3SSU A;  4R4M A;  1NO4 A;  2IDB A;  2ZT9 C;  1KYO H;  1QVF O;  2KNC B;  4H0L D;  1GZL A;  1ZLL A;  4W7Z A;  2AEF A;  3OA7 A;  1GU5 A;  2E43 A;  1EZV D;  1X79 B;  5KAI E;  3PJS K;  1Z56 A;  2Z5I A;  5KJ7 D;  3OJA B;  5K5G B;  1S9K D;  3USS A;  2V7Q H;  1G1J A;  3M0D A;  2BCC J;  2V4H A;  3CWB J;  1JTH A;  1MFZ A;  4XE5 B;  4W80 A;  1TU3 F;  2O3J A;  3KDP B;  2PRR A;  4YTP C;  5KJ7 A;  4R4L A;  3S9O A;  1L0N K;  1X0T A;  2P1J A;  2C0W A;  1KIL B;  1L0L G;  1NTM J;  3AEB C;  3HD7 B;  2QM7 A;  1KOR A;  1D7M A;  1KQL A;  3MP7 B;  1CZQ A;  3L72 J;  2O1K A;  4RKU J;  4B86 A;  2K1A A;  3Q5S A;  2YKP A;  1NKZ B;  3AE9 C;  3U1A A;  4HJG H;  4WY4 C;  4C7N B;  4U3F J;  2HR3 A;  1N86 A;  2FYU D;  3L4F A;  3AE3 C;  3GHG C;  3M91 A;  3VP9 A;  1RE3 A;  1USE A;  2LKM A;  1YJ9 P;  4GDO A;  2ZFC A;  2C9L Y;  1QL1 A;  1JB0 J;  2D2C D;  3KYQ A;  4PJ0 E;  5CJ4 A;  3M0A A;  1W5C E;  1SS1 A;  3CCE P;  1AVO A;  1GMJ A;  3D6Y A;  2H8P D;  2BCC G;  1JUN A;  1HGV A;  5TIS E;  2ZJS E;  1BDD A;  3P32 A;  3CWB G;  1VQ5 P;  1VQO P;  4JBZ A;  1P84 D;  2JJL A;  1DD3 A;  2N1T A;  4D6T D;  1JEK A;  1NTM G;  5CMZ A;  3KZI H;  3P7K A;  3CD6 P;  4H0L B;  1HVV A;  3B8E B;  1VQ6 P;  1R8E A;  1KFN A;  3L72 G;  3BCC E;  3RL0 B;  3HD7 C;  3H1I D;  1RH5 B;  2R44 A;  4U3F G;  1FZE A;  1N73 C;  2Q7C A;  1HWT C;  3CCQ P;  2IBZ I;  2E76 D;  1WMK A;  3CC7 P;  2W6A A;  3WMM 0;  2KUB A;  3LID A;  3CCM P;  3AE4 C;  5APU A;  5AVY B;  2R5D A;  1VPC A;  3OAK A;  1LJ2 A;  4HH2 A;  3H6P A;  1VQ8 P;  2G3A A;  1NAY A;  4H44 D;  2FXP A;  2XNX A;  4MN4 C;  4HB1 A;  1X8Y A;  1QLE D;  3VYI A;  1MV8 A;  1N2D C;  1IFP A;  2Q5U A;  4RJT A;  3V2Q A;  3CXH H;  3AE2 C;  3G4S P;  2FYU J;  3S4R A;  2K9J A;  3H32 A;  5APS A;  1PZQ A;  1EZV G;  2JR8 A;  3H1H D;  1YYC A;  2I1K A;  1RF0 C;  3BAT A;  1Q81 Q;  2A06 E;  3MUD A;  2FKW B;  3MTU E;  2WSE J;  1BSH A;  1OWA A;  3E7K A;  2IBZ E;  3Q5R A;  1JY3 N; 
#chains in the Genus database with same CATH homology
 4IL6 E;  4UB6 E;  5GTH E;  5KAF E;  4UB8 E;  5GTI E;  3WU2 E;  5B66 E;  3A0H E;  4PJ0 E;  1W5C E;  5H2F E;  3A0B E;  5E79 E;  5KAI E;  1S5L E;  3JCU E;  5B5E E;  5TIS E;  2AXT E;  3KZI E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...