1W5CE

Photosystem ii from thermosynechococcus elongatus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
77
structure length
76
Chain Sequence
RPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM Q(B) PROTEIN 1
publication title Crystal Structure of Cyanobacterial Photosystem II at 3.2 A Resolution: A Closer Look at the Mn- Cluster
rcsb
molecule tags Photosynthesis
total genus 14
structure length 76
sequence length 77
chains with identical sequence K
ec nomenclature
pdb deposition date 2004-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 1w5cE00
5GTHE 5KAFE 1S5LE 3A0HE 4UB8E 2AXTE 5TISE 5KAIE 3WU2E 5B5EE 5E79E 3KZIE 3JCUE 1W5CE 5GTIE 4UB6E 3A0BE 4IL6E 5H2FE 5B66E 4PJ0E
chains in the Genus database with same CATH superfamily
3HE5B 4OWFA 1VPCA 1NJIQ 1BE3E 1YTZT 2WMMA 1P84H 1Q82Q 1FZBA 1EQ7A 2QA4P 2Q5UA 1BGYD 1R8EA 3HE5A 1Q90D 4R4LA 1RQVA 2K1AA 4C46A 5TISH 1FE6A 1L0NG 5B5EH 4U3FJ 3H1KE 3CCVP 3O8ZA 1T2KD 3BVHA 1OFCX 3SSUA 3CCLP 1FZEA 1JEKA 4JPZB 3HTKB 3F89A 1AFOA 2W83C 2ZVOB 3VN0A 1NHLA 1RHZB 1SQPE 3M9HA 2R5BA 2CK3H 1URQD 3CX5I 1X0TA 3Q5RA 1JM0A 4EDFA 2PAJA 5M1BA 3B71A 2KZIA 1Q81Q 4BRYA 3SWKA 2QJYC 1DEEG 1ZP0C 1AVOA 1BGYE 1W2BO 2R3CA 3TGUJ 1KILC 3RK2C 1NTKG 2JP3A 1L0NJ 3TF5A 1SQBJ 3JC22 4HKZH 3L73E 2QM7A 5K5GB 3TDKA 1OXZA 1EXJA 5KAIE 3RK3C 3E7KA 1CSBA 2P67A 1YI2P 1NTKD 2OTKE 2I1KA 5AW0B 1JCCA 1A02F 1GK4A 4UB8H 1EDIA 2H7HA 5AW9B 5GTHE 2ZAEB 2QVAA 1YQ4C 4GT1A 1EDJA 2H88C 1FZFA 1NTMG 2IZ1A 1QEXA 1FBMA 5CCGC 1IZNB 3P7KA 1SQQK 1VF5B 1M1KQ 1DD4A 3PTZA 1S2EA 1NTZE 1VQLP 1NTMD 3BATA 2ZVNB 2Y0DA 2W8ZA 2YKPA 4GIFA 1HH0A 4W80A 2QE7H 1BDDA 4ZKUA 1TU3F 2PFXA 3FXDA 2HFED 4OH8B 2FYZA 4DZOA 3PH0A 3JSVC 1RF1C 1FJKA 1VQKP 2NPSD 2D2CC 1RF0A 3AE7C 1GD2E 1SVFA 5KJ7A 1QL2A 4UB8E 1OMIA 1GU5A 1SP4A 1N73A 2FYUD 3W67A 4LC1A 1PGPA 4GDOA 2FBWC 3KXDA 5APXA 4DOJA 3WMM0 1EZVG 1KB9D 3IR9A 3MP7B 1YQ3C 4OGQD 1ZR2A 2Z4EA 2IZ0A 1W5CE 3GHGC 2QJYB 2C9NY 3V5BA 1EZVD 2J59M 3IFMA 2K37A 3ZDMA 2E75C 2B88A 2YO3A 3RK2B 1NTZK 1SFCC 5DJTB 1H89A 5KTBA 4CPGA 1BCCD 3WU2H 2WSFJ 3CCSP 2QG4A 2FYUE 1L0LK 2KS1A 5AVSB 1LTAC 3MTUE 5AVWB 1JNMA 1M57D 2ZT9B 2WQYC 1XTGB 2FYNC 3MIWA 1KB9E 1M1JB 1RE3A 2WSCJ 3LIDA 1XTCC 3E1IA 1JMBA 5KLVG 1M1JA 2BCCD 1NKNA 1MZ9A 3AE5C 4I7ZC 1S5LX 1LNQA 3I5CA 2DW3A 3PRJA 1FDIA 3EFFK 3M0DC 1IJDB 5B66E 3VOPA 3NTNA 4I6MC 2Y0EA 2FXMA 1NAYA 1OVVA 1SQVG 3WUVA 4DT0A 4NPDA 3IAOA 2WSEH 3VMXA 2IBZI 1Q86Q 1BCCE 1UIIA 5AVUB 2RH0A 3H1HD 4IOIH 1VQPP 2AXTH 4YPCA 5APWA 3O6QB 4IFMA 1SQVD 1MFZA 1FOSE 4UB6H 1YJWP 1CI6B 3CWBJ 1OIPA 1KFMA 2E43A 3L71J 4PD4D 1LTSC 1JB0J 1R5LA 3Q5PA 3BCCD 1ZR4A 1ZLLA 4N78D 1CI6A 2J58A 2JDIH 2BCCE 4H0LD 1USDA 3GF7A 2FYUK 3H1LE 2FFDB 3AE2C 3L70D 1ZMEC 2KP8A 2E74D 3VMZA 2WZ7A 3CMAP 3A0HH 1Q7YQ 5APYA 1YYCA 3H6PA 1GL2B 4H44B 1QX8A 3H1HE 4BXLA 3L72E 1FJPA 1GDTA 2ZYGA 1GL2A 1OWAA 1KMIZ 1NU1D 2GUVA 2P2UA 3V4QA 2XNXA 1PL5A 2AEFA 4PD4E 1GU4A 1T3UA 3CI9A 5GTIH 4Y28J 3BCCE 4DJGA 5H2FH 4HJGH 3CXHH 1S5LH 3M9QA 2M3EA 3AE8C 3L70E 3RL0B 3NFQA 4K35A 4K3AA 1DIPA 4W7YA 1LTJB 1IFPA 2J5UA 4R4MA 1YBKA 2ZJSE 1KYOD 3L74E 1PP9E 5AVRB 2IPPA 2Y0CA 1LTJA 1KV4A 2A06D 4H13D 3L75E 3A0HE 4U3FG 1EXIA 2PGDA 3AEFC 5CHXA 1DX7A 3L4FA 1NU1E 1HGVA 1L2PA 4XE5B 1PFIA 2A45G 3PJSK 4U3FD 1H88A 2A45H 3JCUH 3HUSB 2YKOA 3L36A 1KFNA 3LIEA 1VF5C 1SQXD 1MFTA 3TSIA 1URQB 2K3RA 5BU5A 1DEBA 1N7LA 1VQMP 3USSA 4TLFA 1PV3A 4XA4A 1URQA 3I56P 2WPVB 1KYOE 1W2EA 3M9BA 4JQ0D 3I55P 3D6ZA 1NWQA 3KHUA 1VDFA 1BE3J 1A02J 4C7NB 3TGUG 2OARA 1RF0C 2A06E 2QRXA 3ITKA 3H1JJ 3WUUA 5KJ7C 1IK7A 3CCUP 3A5TA 2ITAA 4C7NA 2V7QH 2BEQD 1SQBG 1P84D 3H1KJ 1LT9A 1HUCA 1IFNA 1LT1A 3N7NA 2M8RA 1N73C 1KZUB 1BDCA 2KI7B 2XV5A 3TGUD 2B89A 2IDBA 2KK7A 1VQ8P 1PGOA 3AECC 3BASA 1VQ4P 1L0ND 3AEGC 1USEA 1R5SA 3M91A 5C39A 1SQBD 1SQXE 1SQQJ 2BEZF 3KYQA 3CCQP 3NXSA 4IL6X 4NPEA 4BRYB 2H8PD 2PP6A 5CCHD 2BASA 1EDLA 1JTHB 2RMZA 3VMAA 4EYYQ 1MKMA 3KDPB 5APUA 3U1CA 1JTHA 1AQTA 2N1TD 2ZYAA 2QM8A 1JY3O 1LWUB 1P84E 2V7QJ 3K5BA 1AJYA 2E5TA 2OYOA 2R3SA 1X22A 4JF7A 5TISE 3L73J 4ASWA 3E1RA 5B5EE 1YJ9P 1LWUA 3EQ2A 1L0NE 1PZQA 1RE3C 2O3JA 3AEDC 2OQQA 1E5WA 2N9BA 2KNCB 1QVGO 1ZN5A 2ZT9C 1UIXA 2Z5IA 2JR8A 3MUDA 3AE3C 1KQFB 1M1JC 1N7SD 4KHXA 2NPSB 1OW8A 2KNCA 4RKUJ 1VL2A 2FXPA 1Z56A 3CX5H 3SFDC 2NPSA 3IN6A 1VQNP 3A2AA 3RBXA 1KB9I 5E79H 1X9VA 3B5NA 3CL3D 4M3LA 1AV1A 1G1JA 3L35A 2E42A 1SQXK 3Q2YA 1SQPK 2P58A 3CX5D 1ZV8A 2YKQA 2E74C 4O9BA 1NTZJ 3LW5J 4OGQB 1AQ5A 1L4AD 1FU1A 1AVYA 1IFDA 1JY2N 2JEEA 1HF9A 3GG2A 3U1AA 1NTKE 3B4SA 1AA0A 1L0LJ 3V2NA 2KB7P 3VMYA 4IL6H 3BRVB 2HLOA 1LP1B 5KAFH 2YXQB 4JYCA 3VP9A 2IYOA 1N73B 5AW3B 3B5ND 1LP1A 1J1DB 1EDKA 2L91A 1GTWA 2JKVA 2WSFH 1VQ6P 1CZQA 1NO4A 1FZGA 1Y9BA 1WRGA 4JYBA 4PV1C 2FFDC 4WY4D 4D6TJ 3PHLA 2QJPB 3RL0g 1M8OB 1NTME 2SPZA 2WSCH 5AW5B 4DCKA 1FZCB 1S1CX 3MD0A 5AW7B 3OA7A 1M7LA 1GL2C 1OZHA 3H1IJ 4H44C 3D6YA 4AYCA 2C0WA 4H13C 1FZCA 2W27A 3AEBC 1HJBA 2Z5HA 3NMDA 2W90A 3HD7A 3KQGA 2KS1B 4IL6E 3N4XA 1GW3A 4EIJA 2WITA 2IX7C 1NTKK 2AXCA 2FYUJ 4YXWH 4GKGA 4PD4I 3RL0C 5AVTB 1HWTC 3CWBG 2OGUA 4Z1MH 2YNYA 3L71G 2N9YB 1LTJC 2LXCB 1HBWA 4B86A 2OYHB 4JBZA 3A0BH 1JY3P 4LLHA 4H0LB 3CWBD 1EZVE 1N8RQ 3PP5A 2OYHA 3HD7D 4ZMDA 3L71D 2WT7A 1T2KC 2LR2A 5APQA 5KLVD 2E74B 3CC2P 5APSA 2V4HA 3KZIH 3PLNA 2P1JA 1NTMK 5CJ0A 4L73A 1FDOA 5EFWB 2E76D 3AE6C 3FWNA 1NKZB 1BCCJ 1PIXA 1KILD 3HUSC 2OTLP 3RK2D 2GA1A 1S72P 1URQC 3EFGA 1KC8Q 2WVRA 3WU2E 3RK3D 4XFJA 5L8RJ 4WBAA 1OVUA 3OJAB 1MV8A 3CD6P 2R5DA 3M0AA 1J1EB 2B9BA 3CWBE 1YTZI 1LT9C 1ZRTD 2BCCJ 2PRRA 1K05A 1OX3A 2HODB 5KKZB 1HGZA 1NYHA 2AEJA 4PV1B 1KD1Q 3C9IA 4EOTA 3H1LJ 1WT6A 5KLVE 2ZXXA 1KYOI 4N6JA 3VTPC 5AW1B 2HODA 4ZKPA 5CCGD 1K8AQ 1S3JA 1KTMA 5CBNA 1KORA 4Y99B 2YMYA 4H13B 1JO5A 4AUWA 3P8MC 3H1HJ 3KZIE 1NH4A 1GZLA 1S4XA 2GUSA 3W68A 2IBZG 5AVXB 3L72J 1SQVE 1MUUA 3S1KA 2JO1A 2Y9ZA 1YJNP 1Y8AA 2AXTE 2Q6QA 4RJTA 4A7PA 2IBZD 4N78E 4UB6E 4YTPC 2FY8A 1ZRTE 3CC7P 1WMKA 4C7RA 5CMZA 2D2CD 1U57A 1FC2C 2K88A 4OVNF 1LWUC 1GK6A 2NRGA 5DJUB 1T6AA 2ZFCA 2KXPB 1T3JA 2Q7CA 3CXHD 4PJ0H 2JJLA 1FOSF 4HB1A 1BE3G 3MUDC 3L74J 4BWNA 3H1JG 5KLIB 2WPRA 1PP9J 1P84I 3B8EB 2Q3IA 3L75J 3H1KG 2RN0A 2NPSC 2MJZA 1LTGC 3S9OA 1BE3D 3TNUB 1IFIA 3FX0A 4GOEA 5KLVK 2NZ2A 1LTIC 3H1JD 3B5NC 1E79H 2XKMA 2LKMA 3TNUA 1YITP 2E75D 3H1KD 2OYIA 1SQQG 1RE4A 4W7ZA 2FKWB 2XZRA 5GTIE 3HE4B 1SFCD 2KSJA 1HJ0A 3G71P 3C8VA 3P8CD 5H2FE 1SQVK 2YMKA 4OGQC 4IFFA 3Q3DA 1S5LE 3CXHE 2JWDA 3HE4A 1SQQD 2Q9IA 4HH2A 3GLMA 3FGAD 2E5YA 3D70A 1RQUA 3A3YB 5CCHA 3G3ZA 1LT9B 3VYIA 1BSNA 1DH3A 2N1TB 1KQSO 2P7JA 1GMJA 2K9YA 1S9KD 1K04A 5AW4B 3AEAC 2IYPA 3RGUA 2N1TA 3H1JE 3L73G 1J1DC 4U3FE 3BRTB 3T97B 1DD3A 5KAIH 1IK9A 3SWYA 3T97A 1SQXJ 3L73D 4NPFX 2QJPC 1SQPJ 3P8CE 5AVZB 1N7SB 1JUNA 3JCUE 2K9JB 2KLUA 5GTHH 1KQLA 2M0BA 1FZCC 1NU1K 1N2DC 1SQQE 3AEEC 3HTKA 2GM4A 1N7SA 4WVZA 2K9JA 4EI2A 4GOFA 3HD7C 2QEXP 3G4SP 4ZNCA 1U7JA 1BGYJ 1D7MA 3ABVC 1S9KE 1NTZG 3OAKA 5AW8B 3R2PA 4ASVA 3LW5H 1IO4A 2E76C 1L4AB 3TGUE 1VQ9P 5AVQB 3H32B 3AE1C 1L0LG 1GW4A 3AE9C 1L4AA 1NTZD 2KZJA 1SQBE 2YIUB 4GODA 2KYVA 2YO2A 3H32A 3A7OA 1L0LD 5AW2B 1LGHB 2OYHC 3B5NB 1T8ZA 4H0LC 3FXEA 2QSIA 2M5AB 4D6TG 4WY4B 2KLVA 3GF3A 3G6EP 2M5AA 2XNDH 4WY4A 3P32A 4YXDC 1EZVI 2QJKB 3V2QA 3H1IG 4D6TD 1PGQA 1VQOP 4TT3H 1NTKJ 1ZXGA 4HYTB 3C1LA 1QL1A 1CW5A 2Q3EA 1RY3A 3II6A 1PGJA 3H1ID 3RBZA 3UIAA 2VRSA 1L0LE 2O01H 1HVVA 2KSEA 3QH9A 4RESB 3QWOC 1J1EC 1G2CB 3SFEC 2M3BA 1L0NK 2FYUG 2YXRB 5KKZC 1SQBK 1G2CA 2W6BA 4U7JA 3CX5E 1PPJG 1KB9H 1NTMJ 2O1KA 3CPWO 5E79E 1HTLC 1EC5A 2R44A 4D6TE 2WSSH 2IFMA 1VF5D 1JMMA 2I1JA 4Y99C 3TK1A 3HD7B 2AEMA 2POHA 1PPJD 4L75A 1OW7A 3H1IE 5B66H 1SS1A 3CMEP 2E76B 1N86A 2O01J 1LTTC 1BCCG 1JY2O 3AE4C 5KJ7D 1KILB 5KAFE 4KT0J 3V2RA 4L76A 1J2JB 1JOCA 1KILA 3CCJP 3OW2O 5APTA 2R32A 3R4YA 2CPBA 3RK3B 2KIKA 2HR3A 3MHVA 1FDMA 1OVRA 1QVFO 2WT7B 3KPEA 1QGKB 1KQGB 2BCCG 5KLIC 2G3AA 3CCEP 1JCDA 1PPJE 3CLQA 2Q1KA 3H1LG 3Q5SA 2LXBA 1YIJP 3F5HA 2O01N 2OYIC 2KUBA 2C0XA 2W6JH 1RE4C 4I2LC 3TYYA 5CBOA 2O1JA 3H1LD 2B87B 2L5GB 2HYNA 2JWAA 1X79B 3H1HG 1M90Q 3CC4P 3L72G 5CCGA 4I1LA 2KOGA 4N3YB 2WPSA 1YHQP 1Y47A 1ZOYC 2B87A 1U7MA 1Q2NA 2I8DA 2WTYA 1FZAA 2CPSA 1VQ7P 5CCHC 1IFMA 5BU8B 5BVZA 3G9RA 1FAVA 3BCCG 4PD4H 2C9LY 3L72D 3MZWB 3D71A 2IFNA 1RF1B 2FXOA 2ZYDA 2ZT9D 1IC2A 3L71E 2N1TC 2D2CB 3CXHI 3O6QA 3U59A 1RF1A 3L70G 1H0TB 1LJ2A 3A0BE 2ZXEB 1H8AA 3GW6A 5KLVJ 4IFDK 3V4WA 2G8YA 3M06A 1H0TA 3L74G 1OW6A 1PP9G 2HPCB 1KILE 1K9MQ 5AVYB 2WPQA 5APVA 3L75G 1K73Q 2FFDA 5AVVB 2XDJA 1N7SC 2HPCA 3GMAA 3SWFA 1SQVJ 5TJHA 2WSEJ 3L74D 1NU1G 3RK3E 1PP9D 3GHGB 3VP8A 5CJ4A 3L75D 3BCCJ 2H43A 2E75B 3FWLA 2A45I 3GHGA 4WWIA 2XU6A 1SFCB 4WB4A 2HG5D 3L70J 3IF4A 3WUTA 1L4AC 1KN7A 2RKLA 1SFCA 1X8YA 2WWWA 3V2PA 1G1IA 4PV1D 1KYOH 1SLQA 2FYNB 4KJMA 2YIUC 2A06G 2P10A 3S4RA 3Q1MA 2H89C 1JY2P 4AQRD 1QLED 2OTJP 2OYIB 1GL2D 4H44D 4QMAA 1IFJA 1NU1J 4MN4C 1RH5B 3H25A 3MGNA 2IBZE 4I7ZB 3CCMP 4RO0A 1VQ5P 1NOHA 3L37A 4WY4C 2W6AA 1NAFA 1SQXG 1SQPG 2Y9YA 1BSHA 2QIWA 3V6IA 3M0DA 3EWKA 5AW6B 1ZW0A 2MKVA 1FS0E 2QJKC 1M56D 3HRNA 1SQPD 1JY3N 1NGMB 1NVOA 1LTBC 2UWJE 4LGDE 3CCRP 3RL0D 4L74A 1BGYG 3HUSA 4PJ0E
chains in the Genus database with same CATH topology
5GTHE 5KAFE 1S5LE 3A0HE 4UB8E 2AXTE 5TISE 5KAIE 3WU2E 5B5EE 5E79E 3KZIE 3JCUE 1W5CE 5GTIE 4UB6E 3A0BE 4IL6E 5H2FE 5B66E 4PJ0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTH E;  5KAF E;  1S5L E;  3A0H E;  4UB8 E;  2AXT E;  5TIS E;  5KAI E;  3WU2 E;  5B5E E;  5E79 E;  3KZI E;  3JCU E;  1W5C E;  5GTI E;  4UB6 E;  3A0B E;  4IL6 E;  5H2F E;  5B66 E;  4PJ0 E; 
#chains in the Genus database with same CATH topology
 3HE5 B;  4OWF A;  1VPC A;  1NJI Q;  1BE3 E;  1YTZ T;  2WMM A;  1P84 H;  1Q82 Q;  1FZB A;  1EQ7 A;  2QA4 P;  2Q5U A;  1BGY D;  1R8E A;  3HE5 A;  1Q90 D;  4R4L A;  1RQV A;  2K1A A;  4C46 A;  5TIS H;  1FE6 A;  1L0N G;  5B5E H;  4U3F J;  3H1K E;  3CCV P;  3O8Z A;  1T2K D;  3BVH A;  1OFC X;  3SSU A;  3CCL P;  1FZE A;  1JEK A;  4JPZ B;  3HTK B;  3F89 A;  1AFO A;  2W83 C;  2ZVO B;  3VN0 A;  1NHL A;  1RHZ B;  1SQP E;  3M9H A;  2R5B A;  2CK3 H;  1URQ D;  3CX5 I;  1X0T A;  3Q5R A;  1JM0 A;  4EDF A;  2PAJ A;  5M1B A;  3B71 A;  2KZI A;  1Q81 Q;  4BRY A;  3SWK A;  2QJY C;  1DEE G;  1ZP0 C;  1AVO A;  1BGY E;  1W2B O;  2R3C A;  3TGU J;  1KIL C;  3RK2 C;  1NTK G;  2JP3 A;  1L0N J;  3TF5 A;  1SQB J;  3JC2 2;  4HKZ H;  3L73 E;  2QM7 A;  5K5G B;  3TDK A;  1OXZ A;  1EXJ A;  5KAI E;  3RK3 C;  3E7K A;  1CSB A;  2P67 A;  1YI2 P;  1NTK D;  2OTK E;  2I1K A;  5AW0 B;  1JCC A;  1A02 F;  1GK4 A;  4UB8 H;  1EDI A;  2H7H A;  5AW9 B;  5GTH E;  2ZAE B;  2QVA A;  1YQ4 C;  4GT1 A;  1EDJ A;  2H88 C;  1FZF A;  1NTM G;  2IZ1 A;  1QEX A;  1FBM A;  5CCG C;  1IZN B;  3P7K A;  1SQQ K;  1VF5 B;  1M1K Q;  1DD4 A;  3PTZ A;  1S2E A;  1NTZ E;  1VQL P;  1NTM D;  3BAT A;  2ZVN B;  2Y0D A;  2W8Z A;  2YKP A;  4GIF A;  1HH0 A;  4W80 A;  2QE7 H;  1BDD A;  4ZKU A;  1TU3 F;  2PFX A;  3FXD A;  2HFE D;  4OH8 B;  2FYZ A;  4DZO A;  3PH0 A;  3JSV C;  1RF1 C;  1FJK A;  1VQK P;  2NPS D;  2D2C C;  1RF0 A;  3AE7 C;  1GD2 E;  1SVF A;  5KJ7 A;  1QL2 A;  4UB8 E;  1OMI A;  1GU5 A;  1SP4 A;  1N73 A;  2FYU D;  3W67 A;  4LC1 A;  1PGP A;  4GDO A;  2FBW C;  3KXD A;  5APX A;  4DOJ A;  3WMM 0;  1EZV G;  1KB9 D;  3IR9 A;  3MP7 B;  1YQ3 C;  4OGQ D;  1ZR2 A;  2Z4E A;  2IZ0 A;  1W5C E;  3GHG C;  2QJY B;  2C9N Y;  3V5B A;  1EZV D;  2J59 M;  3IFM A;  2K37 A;  3ZDM A;  2E75 C;  2B88 A;  2YO3 A;  3RK2 B;  1NTZ K;  1SFC C;  5DJT B;  1H89 A;  5KTB A;  4CPG A;  1BCC D;  3WU2 H;  2WSF J;  3CCS P;  2QG4 A;  2FYU E;  1L0L K;  2KS1 A;  5AVS B;  1LTA C;  3MTU E;  5AVW B;  1JNM A;  1M57 D;  2ZT9 B;  2WQY C;  1XTG B;  2FYN C;  3MIW A;  1KB9 E;  1M1J B;  1RE3 A;  2WSC J;  3LID A;  1XTC C;  3E1I A;  1JMB A;  5KLV G;  1M1J A;  2BCC D;  1NKN A;  1MZ9 A;  3AE5 C;  4I7Z C;  1S5L X;  1LNQ A;  3I5C A;  2DW3 A;  3PRJ A;  1FDI A;  3EFF K;  3M0D C;  1IJD B;  5B66 E;  3VOP A;  3NTN A;  4I6M C;  2Y0E A;  2FXM A;  1NAY A;  1OVV A;  1SQV G;  3WUV A;  4DT0 A;  4NPD A;  3IAO A;  2WSE H;  3VMX A;  2IBZ I;  1Q86 Q;  1BCC E;  1UII A;  5AVU B;  2RH0 A;  3H1H D;  4IOI H;  1VQP P;  2AXT H;  4YPC A;  5APW A;  3O6Q B;  4IFM A;  1SQV D;  1MFZ A;  1FOS E;  4UB6 H;  1YJW P;  1CI6 B;  3CWB J;  1OIP A;  1KFM A;  2E43 A;  3L71 J;  4PD4 D;  1LTS C;  1JB0 J;  1R5L A;  3Q5P A;  3BCC D;  1ZR4 A;  1ZLL A;  4N78 D;  1CI6 A;  2J58 A;  2JDI H;  2BCC E;  4H0L D;  1USD A;  3GF7 A;  2FYU K;  3H1L E;  2FFD B;  3AE2 C;  3L70 D;  1ZME C;  2KP8 A;  2E74 D;  3VMZ A;  2WZ7 A;  3CMA P;  3A0H H;  1Q7Y Q;  5APY A;  1YYC A;  3H6P A;  1GL2 B;  4H44 B;  1QX8 A;  3H1H E;  4BXL A;  3L72 E;  1FJP A;  1GDT A;  2ZYG A;  1GL2 A;  1OWA A;  1KMI Z;  1NU1 D;  2GUV A;  2P2U A;  3V4Q A;  2XNX A;  1PL5 A;  2AEF A;  4PD4 E;  1GU4 A;  1T3U A;  3CI9 A;  5GTI H;  4Y28 J;  3BCC E;  4DJG A;  5H2F H;  4HJG H;  3CXH H;  1S5L H;  3M9Q A;  2M3E A;  3AE8 C;  3L70 E;  3RL0 B;  3NFQ A;  4K35 A;  4K3A A;  1DIP A;  4W7Y A;  1LTJ B;  1IFP A;  2J5U A;  4R4M A;  1YBK A;  2ZJS E;  1KYO D;  3L74 E;  1PP9 E;  5AVR B;  2IPP A;  2Y0C A;  1LTJ A;  1KV4 A;  2A06 D;  4H13 D;  3L75 E;  3A0H E;  4U3F G;  1EXI A;  2PGD A;  3AEF C;  5CHX A;  1DX7 A;  3L4F A;  1NU1 E;  1HGV A;  1L2P A;  4XE5 B;  1PFI A;  2A45 G;  3PJS K;  4U3F D;  1H88 A;  2A45 H;  3JCU H;  3HUS B;  2YKO A;  3L36 A;  1KFN A;  3LIE A;  1VF5 C;  1SQX D;  1MFT A;  3TSI A;  1URQ B;  2K3R A;  5BU5 A;  1DEB A;  1N7L A;  1VQM P;  3USS A;  4TLF A;  1PV3 A;  4XA4 A;  1URQ A;  3I56 P;  2WPV B;  1KYO E;  1W2E A;  3M9B A;  4JQ0 D;  3I55 P;  3D6Z A;  1NWQ A;  3KHU A;  1VDF A;  1BE3 J;  1A02 J;  4C7N B;  3TGU G;  2OAR A;  1RF0 C;  2A06 E;  2QRX A;  3ITK A;  3H1J J;  3WUU A;  5KJ7 C;  1IK7 A;  3CCU P;  3A5T A;  2ITA A;  4C7N A;  2V7Q H;  2BEQ D;  1SQB G;  1P84 D;  3H1K J;  1LT9 A;  1HUC A;  1IFN A;  1LT1 A;  3N7N A;  2M8R A;  1N73 C;  1KZU B;  1BDC A;  2KI7 B;  2XV5 A;  3TGU D;  2B89 A;  2IDB A;  2KK7 A;  1VQ8 P;  1PGO A;  3AEC C;  3BAS A;  1VQ4 P;  1L0N D;  3AEG C;  1USE A;  1R5S A;  3M91 A;  5C39 A;  1SQB D;  1SQX E;  1SQQ J;  2BEZ F;  3KYQ A;  3CCQ P;  3NXS A;  4IL6 X;  4NPE A;  4BRY B;  2H8P D;  2PP6 A;  5CCH D;  2BAS A;  1EDL A;  1JTH B;  2RMZ A;  3VMA A;  4EYY Q;  1MKM A;  3KDP B;  5APU A;  3U1C A;  1JTH A;  1AQT A;  2N1T D;  2ZYA A;  2QM8 A;  1JY3 O;  1LWU B;  1P84 E;  2V7Q J;  3K5B A;  1AJY A;  2E5T A;  2OYO A;  2R3S A;  1X22 A;  4JF7 A;  5TIS E;  3L73 J;  4ASW A;  3E1R A;  5B5E E;  1YJ9 P;  1LWU A;  3EQ2 A;  1L0N E;  1PZQ A;  1RE3 C;  2O3J A;  3AED C;  2OQQ A;  1E5W A;  2N9B A;  2KNC B;  1QVG O;  1ZN5 A;  2ZT9 C;  1UIX A;  2Z5I A;  2JR8 A;  3MUD A;  3AE3 C;  1KQF B;  1M1J C;  1N7S D;  4KHX A;  2NPS B;  1OW8 A;  2KNC A;  4RKU J;  1VL2 A;  2FXP A;  1Z56 A;  3CX5 H;  3SFD C;  2NPS A;  3IN6 A;  1VQN P;  3A2A A;  3RBX A;  1KB9 I;  5E79 H;  1X9V A;  3B5N A;  3CL3 D;  4M3L A;  1AV1 A;  1G1J A;  3L35 A;  2E42 A;  1SQX K;  3Q2Y A;  1SQP K;  2P58 A;  3CX5 D;  1ZV8 A;  2YKQ A;  2E74 C;  4O9B A;  1NTZ J;  3LW5 J;  4OGQ B;  1AQ5 A;  1L4A D;  1FU1 A;  1AVY A;  1IFD A;  1JY2 N;  2JEE A;  1HF9 A;  3GG2 A;  3U1A A;  1NTK E;  3B4S A;  1AA0 A;  1L0L J;  3V2N A;  2KB7 P;  3VMY A;  4IL6 H;  3BRV B;  2HLO A;  1LP1 B;  5KAF H;  2YXQ B;  4JYC A;  3VP9 A;  2IYO A;  1N73 B;  5AW3 B;  3B5N D;  1LP1 A;  1J1D B;  1EDK A;  2L91 A;  1GTW A;  2JKV A;  2WSF H;  1VQ6 P;  1CZQ A;  1NO4 A;  1FZG A;  1Y9B A;  1WRG A;  4JYB A;  4PV1 C;  2FFD C;  4WY4 D;  4D6T J;  3PHL A;  2QJP B;  3RL0 g;  1M8O B;  1NTM E;  2SPZ A;  2WSC H;  5AW5 B;  4DCK A;  1FZC B;  1S1C X;  3MD0 A;  5AW7 B;  3OA7 A;  1M7L A;  1GL2 C;  1OZH A;  3H1I J;  4H44 C;  3D6Y A;  4AYC A;  2C0W A;  4H13 C;  1FZC A;  2W27 A;  3AEB C;  1HJB A;  2Z5H A;  3NMD A;  2W90 A;  3HD7 A;  3KQG A;  2KS1 B;  4IL6 E;  3N4X A;  1GW3 A;  4EIJ A;  2WIT A;  2IX7 C;  1NTK K;  2AXC A;  2FYU J;  4YXW H;  4GKG A;  4PD4 I;  3RL0 C;  5AVT B;  1HWT C;  3CWB G;  2OGU A;  4Z1M H;  2YNY A;  3L71 G;  2N9Y B;  1LTJ C;  2LXC B;  1HBW A;  4B86 A;  2OYH B;  4JBZ A;  3A0B H;  1JY3 P;  4LLH A;  4H0L B;  3CWB D;  1EZV E;  1N8R Q;  3PP5 A;  2OYH A;  3HD7 D;  4ZMD A;  3L71 D;  2WT7 A;  1T2K C;  2LR2 A;  5APQ A;  5KLV D;  2E74 B;  3CC2 P;  5APS A;  2V4H A;  3KZI H;  3PLN A;  2P1J A;  1NTM K;  5CJ0 A;  4L73 A;  1FDO A;  5EFW B;  2E76 D;  3AE6 C;  3FWN A;  1NKZ B;  1BCC J;  1PIX A;  1KIL D;  3HUS C;  2OTL P;  3RK2 D;  2GA1 A;  1S72 P;  1URQ C;  3EFG A;  1KC8 Q;  2WVR A;  3WU2 E;  3RK3 D;  4XFJ A;  5L8R J;  4WBA A;  1OVU A;  3OJA B;  1MV8 A;  3CD6 P;  2R5D A;  3M0A A;  1J1E B;  2B9B A;  3CWB E;  1YTZ I;  1LT9 C;  1ZRT D;  2BCC J;  2PRR A;  1K05 A;  1OX3 A;  2HOD B;  5KKZ B;  1HGZ A;  1NYH A;  2AEJ A;  4PV1 B;  1KD1 Q;  3C9I A;  4EOT A;  3H1L J;  1WT6 A;  5KLV E;  2ZXX A;  1KYO I;  4N6J A;  3VTP C;  5AW1 B;  2HOD A;  4ZKP A;  5CCG D;  1K8A Q;  1S3J A;  1KTM A;  5CBN A;  1KOR A;  4Y99 B;  2YMY A;  4H13 B;  1JO5 A;  4AUW A;  3P8M C;  3H1H J;  3KZI E;  1NH4 A;  1GZL A;  1S4X A;  2GUS A;  3W68 A;  2IBZ G;  5AVX B;  3L72 J;  1SQV E;  1MUU A;  3S1K A;  2JO1 A;  2Y9Z A;  1YJN P;  1Y8A A;  2AXT E;  2Q6Q A;  4RJT A;  4A7P A;  2IBZ D;  4N78 E;  4UB6 E;  4YTP C;  2FY8 A;  1ZRT E;  3CC7 P;  1WMK A;  4C7R A;  5CMZ A;  2D2C D;  1U57 A;  1FC2 C;  2K88 A;  4OVN F;  1LWU C;  1GK6 A;  2NRG A;  5DJU B;  1T6A A;  2ZFC A;  2KXP B;  1T3J A;  2Q7C A;  3CXH D;  4PJ0 H;  2JJL A;  1FOS F;  4HB1 A;  1BE3 G;  3MUD C;  3L74 J;  4BWN A;  3H1J G;  5KLI B;  2WPR A;  1PP9 J;  1P84 I;  3B8E B;  2Q3I A;  3L75 J;  3H1K G;  2RN0 A;  2NPS C;  2MJZ A;  1LTG C;  3S9O A;  1BE3 D;  3TNU B;  1IFI A;  3FX0 A;  4GOE A;  5KLV K;  2NZ2 A;  1LTI C;  3H1J D;  3B5N C;  1E79 H;  2XKM A;  2LKM A;  3TNU A;  1YIT P;  2E75 D;  3H1K D;  2OYI A;  1SQQ G;  1RE4 A;  4W7Z A;  2FKW B;  2XZR A;  5GTI E;  3HE4 B;  1SFC D;  2KSJ A;  1HJ0 A;  3G71 P;  3C8V A;  3P8C D;  5H2F E;  1SQV K;  2YMK A;  4OGQ C;  4IFF A;  3Q3D A;  1S5L E;  3CXH E;  2JWD A;  3HE4 A;  1SQQ D;  2Q9I A;  4HH2 A;  3GLM A;  3FGA D;  2E5Y A;  3D70 A;  1RQU A;  3A3Y B;  5CCH A;  3G3Z A;  1LT9 B;  3VYI A;  1BSN A;  1DH3 A;  2N1T B;  1KQS O;  2P7J A;  1GMJ A;  2K9Y A;  1S9K D;  1K04 A;  5AW4 B;  3AEA C;  2IYP A;  3RGU A;  2N1T A;  3H1J E;  3L73 G;  1J1D C;  4U3F E;  3BRT B;  3T97 B;  1DD3 A;  5KAI H;  1IK9 A;  3SWY A;  3T97 A;  1SQX J;  3L73 D;  4NPF X;  2QJP C;  1SQP J;  3P8C E;  5AVZ B;  1N7S B;  1JUN A;  3JCU E;  2K9J B;  2KLU A;  5GTH H;  1KQL A;  2M0B A;  1FZC C;  1NU1 K;  1N2D C;  1SQQ E;  3AEE C;  3HTK A;  2GM4 A;  1N7S A;  4WVZ A;  2K9J A;  4EI2 A;  4GOF A;  3HD7 C;  2QEX P;  3G4S P;  4ZNC A;  1U7J A;  1BGY J;  1D7M A;  3ABV C;  1S9K E;  1NTZ G;  3OAK A;  5AW8 B;  3R2P A;  4ASV A;  3LW5 H;  1IO4 A;  2E76 C;  1L4A B;  3TGU E;  1VQ9 P;  5AVQ B;  3H32 B;  3AE1 C;  1L0L G;  1GW4 A;  3AE9 C;  1L4A A;  1NTZ D;  2KZJ A;  1SQB E;  2YIU B;  4GOD A;  2KYV A;  2YO2 A;  3H32 A;  3A7O A;  1L0L D;  5AW2 B;  1LGH B;  2OYH C;  3B5N B;  1T8Z A;  4H0L C;  3FXE A;  2QSI A;  2M5A B;  4D6T G;  4WY4 B;  2KLV A;  3GF3 A;  3G6E P;  2M5A A;  2XND H;  4WY4 A;  3P32 A;  4YXD C;  1EZV I;  2QJK B;  3V2Q A;  3H1I G;  4D6T D;  1PGQ A;  1VQO P;  4TT3 H;  1NTK J;  1ZXG A;  4HYT B;  3C1L A;  1QL1 A;  1CW5 A;  2Q3E A;  1RY3 A;  3II6 A;  1PGJ A;  3H1I D;  3RBZ A;  3UIA A;  2VRS A;  1L0L E;  2O01 H;  1HVV A;  2KSE A;  3QH9 A;  4RES B;  3QWO C;  1J1E C;  1G2C B;  3SFE C;  2M3B A;  1L0N K;  2FYU G;  2YXR B;  5KKZ C;  1SQB K;  1G2C A;  2W6B A;  4U7J A;  3CX5 E;  1PPJ G;  1KB9 H;  1NTM J;  2O1K A;  3CPW O;  5E79 E;  1HTL C;  1EC5 A;  2R44 A;  4D6T E;  2WSS H;  2IFM A;  1VF5 D;  1JMM A;  2I1J A;  4Y99 C;  3TK1 A;  3HD7 B;  2AEM A;  2POH A;  1PPJ D;  4L75 A;  1OW7 A;  3H1I E;  5B66 H;  1SS1 A;  3CME P;  2E76 B;  1N86 A;  2O01 J;  1LTT C;  1BCC G;  1JY2 O;  3AE4 C;  5KJ7 D;  1KIL B;  5KAF E;  4KT0 J;  3V2R A;  4L76 A;  1J2J B;  1JOC A;  1KIL A;  3CCJ P;  3OW2 O;  5APT A;  2R32 A;  3R4Y A;  2CPB A;  3RK3 B;  2KIK A;  2HR3 A;  3MHV A;  1FDM A;  1OVR A;  1QVF O;  2WT7 B;  3KPE A;  1QGK B;  1KQG B;  2BCC G;  5KLI C;  2G3A A;  3CCE P;  1JCD A;  1PPJ E;  3CLQ A;  2Q1K A;  3H1L G;  3Q5S A;  2LXB A;  1YIJ P;  3F5H A;  2O01 N;  2OYI C;  2KUB A;  2C0X A;  2W6J H;  1RE4 C;  4I2L C;  3TYY A;  5CBO A;  2O1J A;  3H1L D;  2B87 B;  2L5G B;  2HYN A;  2JWA A;  1X79 B;  3H1H G;  1M90 Q;  3CC4 P;  3L72 G;  5CCG A;  4I1L A;  2KOG A;  4N3Y B;  2WPS A;  1YHQ P;  1Y47 A;  1ZOY C;  2B87 A;  1U7M A;  1Q2N A;  2I8D A;  2WTY A;  1FZA A;  2CPS A;  1VQ7 P;  5CCH C;  1IFM A;  5BU8 B;  5BVZ A;  3G9R A;  1FAV A;  3BCC G;  4PD4 H;  2C9L Y;  3L72 D;  3MZW B;  3D71 A;  2IFN A;  1RF1 B;  2FXO A;  2ZYD A;  2ZT9 D;  1IC2 A;  3L71 E;  2N1T C;  2D2C B;  3CXH I;  3O6Q A;  3U59 A;  1RF1 A;  3L70 G;  1H0T B;  1LJ2 A;  3A0B E;  2ZXE B;  1H8A A;  3GW6 A;  5KLV J;  4IFD K;  3V4W A;  2G8Y A;  3M06 A;  1H0T A;  3L74 G;  1OW6 A;  1PP9 G;  2HPC B;  1KIL E;  1K9M Q;  5AVY B;  2WPQ A;  5APV A;  3L75 G;  1K73 Q;  2FFD A;  5AVV B;  2XDJ A;  1N7S C;  2HPC A;  3GMA A;  3SWF A;  1SQV J;  5TJH A;  2WSE J;  3L74 D;  1NU1 G;  3RK3 E;  1PP9 D;  3GHG B;  3VP8 A;  5CJ4 A;  3L75 D;  3BCC J;  2H43 A;  2E75 B;  3FWL A;  2A45 I;  3GHG A;  4WWI A;  2XU6 A;  1SFC B;  4WB4 A;  2HG5 D;  3L70 J;  3IF4 A;  3WUT A;  1L4A C;  1KN7 A;  2RKL A;  1SFC A;  1X8Y A;  2WWW A;  3V2P A;  1G1I A;  4PV1 D;  1KYO H;  1SLQ A;  2FYN B;  4KJM A;  2YIU C;  2A06 G;  2P10 A;  3S4R A;  3Q1M A;  2H89 C;  1JY2 P;  4AQR D;  1QLE D;  2OTJ P;  2OYI B;  1GL2 D;  4H44 D;  4QMA A;  1IFJ A;  1NU1 J;  4MN4 C;  1RH5 B;  3H25 A;  3MGN A;  2IBZ E;  4I7Z B;  3CCM P;  4RO0 A;  1VQ5 P;  1NOH A;  3L37 A;  4WY4 C;  2W6A A;  1NAF A;  1SQX G;  1SQP G;  2Y9Y A;  1BSH A;  2QIW A;  3V6I A;  3M0D A;  3EWK A;  5AW6 B;  1ZW0 A;  2MKV A;  1FS0 E;  2QJK C;  1M56 D;  3HRN A;  1SQP D;  1JY3 N;  1NGM B;  1NVO A;  1LTB C;  2UWJ E;  4LGD E;  3CCR P;  3RL0 D;  4L74 A;  1BGY G;  3HUS A;  4PJ0 E; 
#chains in the Genus database with same CATH homology
 5GTH E;  5KAF E;  1S5L E;  3A0H E;  4UB8 E;  2AXT E;  5TIS E;  5KAI E;  3WU2 E;  5B5E E;  5E79 E;  3KZI E;  3JCU E;  1W5C E;  5GTI E;  4UB6 E;  3A0B E;  4IL6 E;  5H2F E;  5B66 E;  4PJ0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...