1J1DB

Crystal structure of the 46kda domain of human cardiac troponin in the ca2+ saturated form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
70
structure length
70
Chain Sequence
QTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQTIYNLEAEKFDLQEKFKQQKYEINVLRNRINDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Contractile protein
molecule keywords Troponin C
publication title Structure of the core domain of human cardiac troponin in the Ca2+-saturated form
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 70
sequence length 70
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00992 Troponin Troponin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.350 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1j1dB00
4Y99B 1YTZI 1J1EB 4Y99C 1J1DB 1YTZT 1J1EC 1J1DC
chains in the Genus database with same CATH superfamily
3BCCE 3V5BA 3L36A 5KLVD 1HF9A 3MUDC 1SQPE 1P84I 2M0BA 4WWIA 1SQXJ 4OGQD 1URQB 2W90A 1LTJA 4U7JA 4UB8H 1JY2O 3L75E 4HYTB 1S5LE 3D71A 4XE5B 2JKVA 2FYNC 3C9IA 2QJYC 1NGMB 1KYOE 2O3JA 3CWBJ 1MUUA 1SQVE 1T3UA 4EYYQ 2NRGA 4OH8B 2YKPA 1G1JA 1S3JA 1GL2B 1M1JC 4ZMDA 1LTTC 4W7YA 3RK3E 1JOCA 2FFDC 1VPCA 5AVRB 4ASVA 1Y47A 1SQBG 1IO4A 5C39A 1VQ4P 3L72D 1VF5B 3BRTB 1SVFA 1GTWA 2YIUB 1X0TA 1KQGB 1SQQK 1J1EB 3HD7B 5CMZA 4YXWH 5AVUB 3GF7A 4UB6E 4EDFA 1LT9C 2WVRA 2E75B 2N1TC 1Q82Q 3GLMA 3JSVC 1MV8A 3I55P 1LWUA 5CCGC 5KLIC 2ZXEB 2Z5IA 3P7KA 2R44A 3O8ZA 2O01H 1KFMA 1FDOA 4Y99B 3PH0A 3CCEP 4WY4B 3OJAB 1X9VA 1FJPA 3AE6C 1RQUA 2OYHB 3CCMP 3L72E 3M9BA 1YJWP 1BCCE 1RF1C 5AVSB 1LGHB 2KZIA 2A45I 3VP8A 1GL2D 2ZFCA 3L70J 3KHUA 2PFXA 1NU1E 3VMAA 3Q5RA 1SQQG 1KFNA 2RMZA 2N9BA 3E1IA 5CBNA 1VF5D 1JB0J 3H32B 5APUA 5APQA 3U1CA 3H1HG 1MFTA 4IL6E 1M90Q 3HD7D 3IN6A 4WY4A 3RK2B 4K35A 1Q86Q 1VL2A 2MKVA 3C1LA 4CPGA 1M7LA 3H1LG 3NXSA 5TISH 1OW6A 3CC2P 2D2CC 4XA4A 2MJZA 4I1LA 1H88A 2KLVA 2B9BA 2UWJE 2Q7CA 4PJ0H 4D6TG 2IZ0A 2K9JA 2IBZE 2YO3A 1JTHB 2C0XA 4IFFA 1SS1A 5GTIE 2ZT9C 1JCCA 4WY4D 3HTKB 5APYA 2FY8A 1AV1A 1PIXA 3S9OA 4BRYB 3CCUP 3IR9A 1FZGA 5CCHD 2KK7A 1NTMD 4H13B 2A06G 2WWWA 1FAVA 3W67A 3SWYA 4PV1B 3SFDC 3PLNA 1SQPK 1EDLA 1VDFA 2QM8A 3AE3C 4UB8E 5KAFH 2E76B 4OVNF 1E79H 2JP3A 2O1JA 4N78D 1L4AA 2H7HA 2BCCD 1KMIZ 4H0LC 1BE3J 2OYOA 2WSFJ 1CI6A 2IFMA 1W5CE 2B88A 2FXOA 3RK2D 3JC22 2CPSA 2Y9YA 1SQXK 3USSA 1SQBE 3W68A 5KAIH 1YITP 4MN4C 1NTZJ 2FXMA 3V6IA 3AEDC 3KPEA 1GU5A 1L4AD 2HFED 1PPJD 3M91A 3GG2A 3CD6P 1ZRTE 1SQQD 1L0NJ 2Z4EA 2XDJA 1AA0A 3AE1C 1LTSC 1H0TB 4N78E 2GUSA 2WSCJ 1N7SC 1S2EA 3H1HD 1NVOA 2AXCA 4H13D 2KNCB 3H1JD 3FX0A 2IZ1A 1IFIA 1UIIA 3B71A 3HE4B 3CX5H 3O6QB 2E76D 4C7NB 1OIPA 1GD2E 3V2QA 2FYUK 3CXHI 1KYOH 2Q1KA 2QEXP 5AW4B 3SWKA 1SQXG 2FXPA 2W83C 2BASA 3B5NC 2P7JA 3L74J 2M5AA 4W7ZA 1KB9E 4IFDK 1NU1K 4IOIH 3CWBG 2QRXA 2W8ZA 2YXQB 1VQ5P 1A02F 5BU5A 2K37A 4U3FJ 1Q81Q 2A06D 1L2PA 3H1HE 4BWNA 2RN0A 4JQ0D 1BDCA 5AVWB 3RGUA 1KORA 4UB6H 2WSEJ 2KS1B 3RL0C 1NJIQ 2OYIB 3H1LE 2KZJA 3S4RA 2JDIH 3MIWA 2QM7A 3CC4P 4PJ0E 1PP9D 5GTHH 2NPSA 3GHGC 2R3CA 4D6TE 1EXIA 2FYUG 1T8ZA 2AXTH 4O9BA 1FZCC 3H1KJ 2KB7P 4EI2A 3TYYA 1LTGC 1GK4A 3D70A 1W2BO 1HGZA 3WMM0 3V4WA 4I7ZB 1NAFA 5KJ7D 1SLQA 5AW7B 4EOTA 1KILB 2H89C 1X22A 5KAFE 2E5TA 1J1DC 3L73J 2KSEA 2P58A 2DW3A 4H44C 2AEFA 1G1IA 1SQPD 1FOSE 3WUUA 1FDMA 5DJUB 1Z56A 3L70G 3TGUJ 3L75D 3CX5D 2JEEA 1OWAA 3PHLA 3Q3DA 1FZFA 1SP4A 3HRNA 2V4HA 2OQQA 1SFCB 3LIEA 1KYOD 2ZAEB 1DIPA 4OGQC 5KAIE 1SQBK 2FKWB 1SQXD 3JCUH 2XKMA 4NPEA 1ZR4A 1ZR2A 1MZ9A 2HODB 2Q3IA 2E42A 5GTIH 1M56D 2E74D 4JYBA 5APSA 3TF5A 3CWBD 2WT7A 2FYNB 4RJTA 1P84H 2M8RA 2QJYB 4EIJA 1FS0E 2IDBA 2I1JA 1G2CB 1M1JB 1LTJC 1M1KQ 2KUBA 1KQFB 2QJPC 3H1IJ 3CX5E 2FFDB 4HKZH 2KIKA 1XTGB 1AQ5A 1WT6A 2OTKE 2H88C 5B5EH 2YNYA 3A0HE 2K3RA 3QWOC 3FWLA 5KKZC 2HPCB 3V2RA 2GM4A 2Y0EA 1SQXE 1PGJA 1N73A 1JY3N 2FYUD 1X79B 1SFCD 3QH9A 1YI2P 4HJGH 3MHVA 1LT9B 1BE3G 5KLVJ 1VQMP 1BCCD 2PGDA 2Q9IA 3CWBE 2N1TB 1URQA 1JY3O 1AVYA 2GA1A 3PJSK 1T2KD 1RE3A 2WSFH 3A7OA 5KLIB 1OMIA 4B86A 3VMXA 2Q5UA 1NU1D 2KYVA 3AECC 3OW2O 2R32A 1MFZA 3LW5J 3A2AA 3LIDA 3MZWB 1DEBA 1KILE 2V7QH 2WTYA 5AW6B 1Q7YQ 1X8YA 1RH5B 3VMYA 1U57A 5CJ4A 1GZLA 1GL2A 4C46A 1RY3A 2WSSH 1LWUC 1QVGO 1RF1B 5GTHE 3E7KA 2P10A 1URQD 3WU2H 2JWDA 1L0NG 1WMKA 2AXTE 3CI9A 2HR3A 2FYUE 2A45G 3CCLP 1IK7A 5BVZA 2G3AA 3HD7A 4AQRD 2I1KA 2IBZD 3K5BA 3BVHA 2Y9ZA 1YQ3C 4GT1A 2W6BA 1FZAA 1KB9H 1AQTA 1LNQA 4GIFA 1P84D 1JMBA 1GU4A 2D2CB 1OXZA 1FBMA 1HUCA 2B87B 3L74G 5CCGD 1N8RQ 4WY4C 3L37A 3L70E 3OAKA 3VOPA 1JO5A 2OYHA 4GKGA 3G71P 3M0DA 2ZT9B 1S5LX 5APWA 3SWFA 2GUVA 3A3YB 1NOHA 4LLHA 3OA7A 3T97B 5CCHA 1ZW0A 2E75D 4K3AA 1RHZB 1FE6A 1VQ9P 4U3FG 2C9LY 3M9QA 2YKQA 3JCUE 4XFJA 1LP1B 5K5GB 1FC2C 1OVVA 1E5WA 2XU6A 4HH2A 3H32A 2J58A 2E43A 2WSEH 1SQBD 4W80A 3N4XA 5E79H 1M57D 1P84E 1T6AA 3L35A 3KZIE 1PV3A 1BDDA 1PZQA 1QLED 4H0LB 4DZOA 1ZRTD 3U59A 5AVTB 3H25A 3H1KG 1AVOA 4JYCA 1IFMA 3B4SA 5B5EE 2YKOA 4NPFX 1L4AC 2D2CD 2H8PD 2B89A 1USDA 3D6ZA 4L74A 1JTHA 1K05A 2ZVOB 2JWAA 2QG4A 2BEQD 3HTKA 1LT1A 3PP5A 2AEMA 1VQKP 2W6JH 4BRYA 3L73G 2ZT9D 3HE5B 1RF0A 4L75A 1OFCX 3D6YA 2W6AA 1NTMJ 1IFDA 3F89A 3TGUG 3AEAC 1BE3E 4ASWA 1N7SB 3CCVP 1RE4A 1IFNA 1KB9D 1JNMA 2BCCJ 1HH0A 1PGPA 3IFMA 1QL2A 4ZNCA 1NTZE 3AE4C 4GDOA 2IYPA 1QEXA 4IL6X 3B5NB 2POHA 4YXDC 3V2NA 4PV1D 4YTPC 2KI7B 3WU2E 1LTBC 5H2FH 3FWNA 2JO1A 1L0NE 3ITKA 3H1LD 3I5CA 3A0HH 1KV4A 1NHLA 1A02J 4AYCA 4U3FD 3CMEP 1VQNP 5EFWB 1ZN5A 4D6TD 4PD4H 3H1IG 4JPZB 1SQQJ 1HGVA 2KSJA 3CX5I 3NFQA 1W2EA 1H0TA 4RKUJ 1QX8A 3RL0B 1DD3A 3Q2YA 1HBWA 1NO4A 5AVXB 1KYOI 1XTCC 3Q5PA 2KNCA 1NYHA 2ZVNB 3H1JJ 3HE4A 3O6QA 4L76A 4C7NA 2XZRA 3L74E 2M3BA 3GHGB 3HUSB 3KQGA 1BGYJ 2IYOA 5AW3B 2HYNA 4BXLA 3VN0A 5KLVG 3CCJP 1FZCB 1NKZB 5KJ7A 4IFMA 1DX7A 1L0LJ 2KP8A 2O01N 4U3FE 1PL5A 2NPSC 2QA4P 2IFNA 4M3LA 3I56P 3L73D 4C7RA 3NMDA 3AEFC 1J1DB 1JY2P 3TSIA 5AW1B 5E79E 1R5LA 3RBXA 1S72P 2WZ7A 3L71J 3P8CD 4H44B 2KXPB 1EZVG 3M0AA 2JJLA 1VQ8P 2K88A 2KS1A 5AW0B 4Y28J 2Q6QA 1K8AQ 3G3ZA 2OYIA 3AE8C 3GMAA 1Y9BA 4DOJA 2FYZA 3MTUE 3RL0D 3H1KE 1OVUA 1HTLC 3RK3C 1PP9J 4OGQB 1R5SA 3TNUB 2Y0DA 1N7LA 2WPVB 1JCDA 2E74C 4QMAA 1GW3A 1S4XA 3A5TA 1NTKJ 1YQ4C 2LXBA 1FOSF 3L73E 4WB4A 1IFPA 2QJKC 4PD4D 3U1AA 3M9HA 2L5GB 2YXRB 1KILA 3P8CE 3TGUE 2WPQA 1FZBA 4LGDE 1KN7A 2Z5HA 2HG5D 1N86A 1LTJB 2QJPB 3BCCJ 1Q2NA 1KTMA 2OTJP 3TNUA 2OARA 1SQPJ 2WQYC 3ABVC 4A7PA 3CCSP 4H44D 3A0BH 4KT0J 3KZIH 5KKZB 1HJ0A 3L75J 2IBZI 1SFCC 1NTZK 1H89A 1SFCA 1KILD 5H2FE 1QVFO 1KZUB 2C0WA 3AE9C 1PFIA 1SQVJ 3C8VA 1YJNP 4RO0A 1T2KC 1JEKA 2R3SA 1L0NK 3MUDA 2JR8A 1WRGA 5B66H 1S9KE 2HODA 3MP7B 3M06A 2FBWC 4PD4E 3Q5SA 2Q3EA 1N73C 3Q1MA 2QIWA 2YMKA 3H1IE 3L4FA 3VMZA 4TT3H 1G2CA 1URQC 2OTLP 1M1JA 1LWUB 1K9MQ 1RE3C 5AVYB 1EZVD 2FFDA 3VYIA 1VQ7P 1IK9A 2CPBA 3TK1A 4N6JA 2P2UA 1LTIC 1NTMG 4JF7A 2HPCA 5AVZB 1GL2C 1NTZG 2IX7C 5KLVE 3P8MC 5CBOA 4GODA 2SPZA 2P67A 1FZEA 3L70D 1ZOYC 1YJ9P 2LR2A 2FYUJ 1ZV8A 2YO2A 1VF5C 1LT9A 2VRSA 2YIUC 3FXDA 3L72J 2BCCG 1J1EC 2N1TA 3IAOA 5M1BA 1YHQP 1BCCJ 4DJGA 1RQVA 3E1RA 2ITAA 5CCGA 3HD7C 2A45H 1K73Q 2WITA 4YPCA 5BU8B 1TU3F 2WSCH 1NU1J 5CJ0A 1EDJA 3BRVB 1EZVE 1L0LK 1EQ7A 4OWFA 2E75C 4TLFA 3VP9A 5APXA 3CLQA 1GMJA 3SSUA 2M3EA 5TJHA 1RF1A 3KDPB 1PPJG 2N1TD 3CCRP 1VQOP 1PGQA 1YYCA 4Y99C 2K9JB 3AE7C 3V2PA 5DJTB 3G9RA 2OYHC 5KTBA 3M0DC 4HB1A 1KB9I 1DEEG 2K9YA 5CCHC 1QL1A 4AUWA 3H1JG 3PTZA 1NH4A 3UIAA 3G6EP 1BGYG 1CZQA 5APVA 1D7MA 3P32A 1OZHA 1GDTA 4RESB 3R2PA 3WUTA 1NTKK 2RH0A 2B87A 1CSBA 1BE3D 1VQPP 3GF3A 3TDKA 1L4AB 1L0LG 4R4MA 3RK2C 1PGOA 1CW5A 2N9YB 3A0BE 5AVVB 1CI6B 2QE7H 3AEBC 1N2DC 3T97A 1ZLLA 3AEGC 4L73A 3CPWO 1U7JA 3L71G 3KYQA 1LP1A 1NTZD 2AEJA 5B66E 1OX3A 1USEA 1YTZI 2OGUA 2QSIA 1ZMEC 1IFJA 3CL3D 1VQ6P 1SQBJ 1L0ND 4NPDA 1RF0C 2ZYDA 5AW9B 1PP9G 4H13C 1SQVK 2ZYGA 4PV1C 3F5HA 1NTKG 2K1AA 1ZP0C 2E76C 3G4SP 1RE4C 3WUVA 2V7QJ 1YBKA 1Q90D 2PP6A 2NZ2A 2R5BA 2Y0CA 5AW5B 3IF4A 2QVAA 2WPRA 1IZNB 3BATA 1NTME 2HLOA 4JBZA 1KD1Q 2O01J 4H0LD 5L8RJ 5KLVK 1OW8A 3L74D 1IJDB 1U7MA 1GW4A 3HE5A 3BCCG 4DCKA 1DD4A 2M5AB 3FGAD 3CXHH 4DT0A 3RBZA 1SQPG 1JUNA 3AE2C 2BCCE 1N7SA 2W27A 2CK3H 3L75G 3RL0g 1J2JB 3KXDA 1BGYD 1S5LH 1QGKB 1SQVG 3B8EB 1ZXGA 5AW2B 1Y8AA 3II6A 3H6PA 1S1CX 1OW7A 3CC7P 4ZKUA 3B5NA 3H1HJ 3V4QA 1L0LD 1K04A 1KC8Q 2P1JA 1EDKA 2H43A 1N7SD 1PPJE 4PD4I 3MD0A 2NPSB 2XNXA 4WVZA 2BEZF 3ZDMA 1SQQE 1YTZT 3EWKA 1LTAC 2LKMA 3H1LJ 2E5YA 2PAJA 3H1KD 2O1KA 4I6MC 3CCQP 3CMAP 3L71D 2YMYA 5KJ7C 1KQLA 2L91A 4D6TJ 1BSNA 1HWTC 3H1JE 1MKMA 4LC1A 3B5ND 2XNDH 1M8OB 2R5DA 3EQ2A 5TISE 1BGYE 2ZJSE 3LW5H 1BSHA 1NAYA 5APTA 5AVQB 3RK3B 3HUSC 1OVRA 3GHGA 3TGUD 3HUSA 1EXJA 1JY2N 1L0LE 4WBAA 1NTKD 1YIJP 1NKNA 1KQSO 2E74B 1EDIA 1FJKA 3L72G 5AW8B 2OYIC 1FZCA 2C9NY 3NTNA 1BCCG 4KHXA 3EFFK 1LJ2A 1UIXA 3SFEC 1FU1A 2ZYAA 4R4LA 2LXCB 2ZXXA 1IC2A 1NU1G 1FDIA 2IPPA 1HVVA 3L71E 2G8YA 2QJKB 4N3YB 2A06E 3N7NA 1VQLP 1JY3P 1AJYA 2NPSD 1EZVI 1JMMA 3CXHD 1H8AA 3EFGA 2WMMA 3BCCD 4I2LC 3AE5C 3GW6A 4KJMA 4IL6H 4Z1MH 2WPSA 1S9KD 2WT7B 4I7ZC 3VTPC 1PP9E 1HJBA 1T3JA 1KILC 2KOGA 1GK6A 1AFOA 3H1ID 1NTKE 2I8DA 3R4YA 1SQVD 2KLUA 2XV5A 3BASA 3S1KA 3AEEC 1JM0A 3FXEA 2IBZG 2J5UA 2PRRA 1DH3A 1EC5A 3RK3D 3PRJA 1R8EA 3MGNA 1NTMK 4GOFA 1N73B 4GOEA 4ZKPA 1NWQA 2RKLA 3CXHE 2J59M 5CHXA
chains in the Genus database with same CATH topology
3V5BA 2W6AA 2OYIB 3L36A 1RF1A 3MIWA 1IFDA 3KDPB 2QM7A 2N1TD 1N7SB 1YYCA 1URQB 2NPSA 3GHGC 2R3CA 4Y99C 1LTJA 1RE4A 3V2PA 1JY2O 1IFNA 4HYTB 1T8ZA 4XE5B 4O9BA 2OYHC 5KTBA 3M0DC 1JNMA 1FZCC 2KB7P 3C9IA 1MUUA 1HH0A 1T3UA 5CCHC 1QL1A 3TYYA 3IFMA 1LTGC 4OH8B 2YKPA 1GK4A 1G1JA 1QL2A 4AUWA 1GL2B 1HGZA 3WMM0 1M1JC 1LTTC 3V4WA 1NH4A 3UIAA 1NAFA 3B5NB 2POHA 1SLQA 5KJ7D 4W7YA 3V2NA 1JOCA 1CZQA 5APVA 2FFDC 5AW7B 4EOTA 1VPCA 1KILB 5AVRB 1LTBC 3P32A 1GDTA 1IO4A 1J1DC 4RESB 3R2PA 3BRTB 1NTKK 1SVFA 1GTWA 3I5CA 1CSBA 1SQQK 1J1EB 1G1IA 1FOSE 1NHLA 1A02J 1FDMA 1Z56A 1L4AB 3RK2C 4AYCA 3HD7B 1CW5A 5CMZA 1ZN5A 5AVVB 1CI6B 5AVUB 2JEEA 1OWAA 1N2DC 1FZFA 1HGVA 1SP4A 3HRNA 3T97A 2KSJA 3NFQA 1LT9C 1SFCB 3LIEA 1W2EA 1ZLLA 2N1TC 3RL0B 1HBWA 1MV8A 1NO4A 5AVXB 1LWUA 1XTCC 5CCGC 1SQBK 3KYQA 2FKWB 2ZXEB 2Z5IA 3P7KA 2XKMA 1ZR4A 1YTZI 1ZR2A 3HE4A 1MZ9A 3O8ZA 2O01H 4C7NA 2XZRA 1KFMA 2M3BA 2HODB 2Q3IA 3GHGB 1IFJA 3HUSB 3CL3D 3KQGA 4Y99B 2E42A 5AW3B 2HYNA 4WY4B 4JYBA 5APSA 3OJAB 1X9VA 1FJPA 2OYHB 1RF0C 3VN0A 3M9BA 2WT7A 5AW9B 1FZCB 2M8RA 4EIJA 1SQVK 1RF1C 5AVSB 1LGHB 1NKZB 5KJ7A 2A45I 3VP8A 4IFMA 1GL2D 2ZFCA 1DX7A 2I1JA 2KP8A 1G2CB 2NPSC 1M1JB 1LTJC 1RE4C 2IFNA 1KFNA 2PP6A 4M3LA 2FFDB 2R5BA 2N9BA 3E1IA 1XTGB 1AQ5A 4C7RA 1WT6A 3NMDA 5AW5B 2YNYA 1J1DB 1JY2P 3TSIA 3H32B 5AW1B 2WPRA 5APUA 5APQA 3U1CA 3BATA 2WZ7A 3P8CD 2HPCB 3V2RA 2HLOA 3HD7D 4WY4A 2GM4A 3RK2B 5KLVK 3M0AA 2JJLA 1IJDB 1N73A 1JY3N 1GW4A 3HE5A 5AW0B 1X79B 1M7LA 2OYIA 3G3ZA 1SFCD 3NXSA 4XA4A 4DOJA 2MJZA 4I1LA 1LT9B 2FYZA 2KLVA 1H88A 3MTUE 3RL0D 1JUNA 1HTLC 2Q9IA 2N1TB 1N7SA 2W27A 2Q7CA 3RK3C 1URQA 1JY3O 3TNUB 1T2KD 1RE3A 2WSFH 3A7OA 4B86A 2YO3A 1JTHB 2Q5UA 1N7LA 3VMXA 1JCDA 2C0XA 1J2JB 1GW3A 4IFFA 2KYVA 3A5TA 2R32A 1MFZA 1JCCA 3A2AA 3LIDA 4WY4D 1DEBA 3HTKB 5APYA 3B8EB 2WTYA 5AW6B 1X8YA 5AW2B 3II6A 3VMYA 1FOSF 3IR9A 5CJ4A 1GZLA 1GL2A 4WB4A 4C46A 1RY3A 3H6PA 1FZGA 1LWUC 5CCHD 4ZKUA 3B5NA 2WWWA 1FAVA 3U1AA 1RF1B 3M9HA 2L5GB 3V4QA 3SWYA 2P1JA 1KILA 3P8CE 2H43A 1N7SD 1SQPK 2WPQA 1VDFA 1URQD 2QM8A 1FZBA 4LGDE 3MD0A 2Z5HA 2HG5D 2NPSB 1N86A 2XNXA 1LTJB 3CI9A 1YTZT 2A45G 1LTAC 2LKMA 2O1JA 2PAJA 4N78D 2O1KA 3TNUA 5BVZA 1L4AA 2OARA 4I6MC 2H7HA 3HD7A 4AQRD 2I1KA 2YMYA 1CI6A 5KJ7C 1KQLA 2IFMA 1HWTC 3RK2D 3BVHA 1SFCC 4GT1A 1NTZK 4LC1A 1H89A 2W6BA 3B5ND 1SFCA 2CPSA 1SQXK 2R5DA 1FZAA 1KILD 1KZUB 3EQ2A 2C0WA 1PFIA 3LW5H 4GIFA 1T2KC 1GU4A 5APTA 1OXZA 1L0NK 3MUDA 1FBMA 2FXMA 1HUCA 1WRGA 1S9KE 3KPEA 5AVQB 3RK3B 5CCGD 1GU5A 3HUSC 1L4AD 2HFED 2HODA 3GHGA 3HUSA 3M06A 3M91A 4WY4C 3L37A 3OAKA 4WBAA 1N73C 3VOPA 1NKNA 1JO5A 2OYHA 1FJKA 4GKGA 3M0DA 2Z4EA 5APWA 5AW8B 3SWFA 2XDJA 3L4FA 1FZCA 2OYIC 2C9NY 2GUVA 3NTNA 3A3YB 1NOHA 4KHXA 4LLHA 3OA7A 3VMZA 5CCHA 1FU1A 1LTSC 4N78E 2GUSA 1N7SC 1IC2A 2C9LY 1G2CA 1URQC 2IPPA 1HVVA 1LWUB 1M1JA 3M9QA 2YKQA 1RE3C 4N3YB 5AVYB 2FFDA 1IFIA 3N7NA 1JY3P 2NPSD 3VYIA 3HE4B 1E5WA 2XU6A 4HH2A 1JMMA 4C7NB 1H8AA 3EFGA 3H32A 2J58A 1GD2E 2E43A 1IK9A 2WSEH 4W80A 4I2LC 2CPBA 3V2QA 3TK1A 3N4XA 4N6JA 2FYUK 2P2UA 1LTIC 4JF7A 2HPCA 5AVZB 1GL2C 5AW4B 2IX7C 3P8MC 2WPSA 1S9KD 2WT7B 3L35A 2BASA 3B5NC 3VTPC 2P67A 2P7JA 1HJBA 1FZEA 1T3JA 1KILC 2KOGA 4DZOA 1ZV8A 1GK6A 2YO2A 4W7ZA 1AFOA 3U59A 4IFDK 5AVTB 1NU1K 1LT9A 2VRSA 4JYCA 2XV5A 3BASA 1J1EC 2N1TA 1IFMA 2YKOA 1L4AC 2H8PD 5CCGA 3HD7C 1A02F 2A45H 5BU5A 1DH3A 2WITA 1JTHA 5BU8B 3RK3D 2WSCH 5CJ0A 3MGNA 3HTKA 1NTMK 3PP5A 5AVWB 3BRVB 1L0LK 1EQ7A 1N73B 3VP9A 5APXA 3CLQA 3HE5B 4ZKPA 3RL0C 1NWQA 1RF0A 1JY2N 2J59M 5CHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y99 B;  1YTZ I;  1J1E B;  4Y99 C;  1J1D B;  1YTZ T;  1J1E C;  1J1D C; 
#chains in the Genus database with same CATH topology
 3BCC E;  3V5B A;  3L36 A;  5KLV D;  1HF9 A;  3MUD C;  1SQP E;  1P84 I;  2M0B A;  4WWI A;  1SQX J;  4OGQ D;  1URQ B;  2W90 A;  1LTJ A;  4U7J A;  4UB8 H;  1JY2 O;  3L75 E;  4HYT B;  1S5L E;  3D71 A;  4XE5 B;  2JKV A;  2FYN C;  3C9I A;  2QJY C;  1NGM B;  1KYO E;  2O3J A;  3CWB J;  1MUU A;  1SQV E;  1T3U A;  4EYY Q;  2NRG A;  4OH8 B;  2YKP A;  1G1J A;  1S3J A;  1GL2 B;  1M1J C;  4ZMD A;  1LTT C;  4W7Y A;  3RK3 E;  1JOC A;  2FFD C;  1VPC A;  5AVR B;  4ASV A;  1Y47 A;  1SQB G;  1IO4 A;  5C39 A;  1VQ4 P;  3L72 D;  1VF5 B;  3BRT B;  1SVF A;  1GTW A;  2YIU B;  1X0T A;  1KQG B;  1SQQ K;  1J1E B;  3HD7 B;  5CMZ A;  4YXW H;  5AVU B;  3GF7 A;  4UB6 E;  4EDF A;  1LT9 C;  2WVR A;  2E75 B;  2N1T C;  1Q82 Q;  3GLM A;  3JSV C;  1MV8 A;  3I55 P;  1LWU A;  5CCG C;  5KLI C;  2ZXE B;  2Z5I A;  3P7K A;  2R44 A;  3O8Z A;  2O01 H;  1KFM A;  1FDO A;  4Y99 B;  3PH0 A;  3CCE P;  4WY4 B;  3OJA B;  1X9V A;  1FJP A;  3AE6 C;  1RQU A;  2OYH B;  3CCM P;  3L72 E;  3M9B A;  1YJW P;  1BCC E;  1RF1 C;  5AVS B;  1LGH B;  2KZI A;  2A45 I;  3VP8 A;  1GL2 D;  2ZFC A;  3L70 J;  3KHU A;  2PFX A;  1NU1 E;  3VMA A;  3Q5R A;  1SQQ G;  1KFN A;  2RMZ A;  2N9B A;  3E1I A;  5CBN A;  1VF5 D;  1JB0 J;  3H32 B;  5APU A;  5APQ A;  3U1C A;  3H1H G;  1MFT A;  4IL6 E;  1M90 Q;  3HD7 D;  3IN6 A;  4WY4 A;  3RK2 B;  4K35 A;  1Q86 Q;  1VL2 A;  2MKV A;  3C1L A;  4CPG A;  1M7L A;  3H1L G;  3NXS A;  5TIS H;  1OW6 A;  3CC2 P;  2D2C C;  4XA4 A;  2MJZ A;  4I1L A;  1H88 A;  2KLV A;  2B9B A;  2UWJ E;  2Q7C A;  4PJ0 H;  4D6T G;  2IZ0 A;  2K9J A;  2IBZ E;  2YO3 A;  1JTH B;  2C0X A;  4IFF A;  1SS1 A;  5GTI E;  2ZT9 C;  1JCC A;  4WY4 D;  3HTK B;  5APY A;  2FY8 A;  1AV1 A;  1PIX A;  3S9O A;  4BRY B;  3CCU P;  3IR9 A;  1FZG A;  5CCH D;  2KK7 A;  1NTM D;  4H13 B;  2A06 G;  2WWW A;  1FAV A;  3W67 A;  3SWY A;  4PV1 B;  3SFD C;  3PLN A;  1SQP K;  1EDL A;  1VDF A;  2QM8 A;  3AE3 C;  4UB8 E;  5KAF H;  2E76 B;  4OVN F;  1E79 H;  2JP3 A;  2O1J A;  4N78 D;  1L4A A;  2H7H A;  2BCC D;  1KMI Z;  4H0L C;  1BE3 J;  2OYO A;  2WSF J;  1CI6 A;  2IFM A;  1W5C E;  2B88 A;  2FXO A;  3RK2 D;  3JC2 2;  2CPS A;  2Y9Y A;  1SQX K;  3USS A;  1SQB E;  3W68 A;  5KAI H;  1YIT P;  4MN4 C;  1NTZ J;  2FXM A;  3V6I A;  3AED C;  3KPE A;  1GU5 A;  1L4A D;  2HFE D;  1PPJ D;  3M91 A;  3GG2 A;  3CD6 P;  1ZRT E;  1SQQ D;  1L0N J;  2Z4E A;  2XDJ A;  1AA0 A;  3AE1 C;  1LTS C;  1H0T B;  4N78 E;  2GUS A;  2WSC J;  1N7S C;  1S2E A;  3H1H D;  1NVO A;  2AXC A;  4H13 D;  2KNC B;  3H1J D;  3FX0 A;  2IZ1 A;  1IFI A;  1UII A;  3B71 A;  3HE4 B;  3CX5 H;  3O6Q B;  2E76 D;  4C7N B;  1OIP A;  1GD2 E;  3V2Q A;  2FYU K;  3CXH I;  1KYO H;  2Q1K A;  2QEX P;  5AW4 B;  3SWK A;  1SQX G;  2FXP A;  2W83 C;  2BAS A;  3B5N C;  2P7J A;  3L74 J;  2M5A A;  4W7Z A;  1KB9 E;  4IFD K;  1NU1 K;  4IOI H;  3CWB G;  2QRX A;  2W8Z A;  2YXQ B;  1VQ5 P;  1A02 F;  5BU5 A;  2K37 A;  4U3F J;  1Q81 Q;  2A06 D;  1L2P A;  3H1H E;  4BWN A;  2RN0 A;  4JQ0 D;  1BDC A;  5AVW B;  3RGU A;  1KOR A;  4UB6 H;  2WSE J;  2KS1 B;  3RL0 C;  1NJI Q;  2OYI B;  3H1L E;  2KZJ A;  3S4R A;  2JDI H;  3MIW A;  2QM7 A;  3CC4 P;  4PJ0 E;  1PP9 D;  5GTH H;  2NPS A;  3GHG C;  2R3C A;  4D6T E;  1EXI A;  2FYU G;  1T8Z A;  2AXT H;  4O9B A;  1FZC C;  3H1K J;  2KB7 P;  4EI2 A;  3TYY A;  1LTG C;  1GK4 A;  3D70 A;  1W2B O;  1HGZ A;  3WMM 0;  3V4W A;  4I7Z B;  1NAF A;  5KJ7 D;  1SLQ A;  5AW7 B;  4EOT A;  1KIL B;  2H89 C;  1X22 A;  5KAF E;  2E5T A;  1J1D C;  3L73 J;  2KSE A;  2P58 A;  2DW3 A;  4H44 C;  2AEF A;  1G1I A;  1SQP D;  1FOS E;  3WUU A;  1FDM A;  5DJU B;  1Z56 A;  3L70 G;  3TGU J;  3L75 D;  3CX5 D;  2JEE A;  1OWA A;  3PHL A;  3Q3D A;  1FZF A;  1SP4 A;  3HRN A;  2V4H A;  2OQQ A;  1SFC B;  3LIE A;  1KYO D;  2ZAE B;  1DIP A;  4OGQ C;  5KAI E;  1SQB K;  2FKW B;  1SQX D;  3JCU H;  2XKM A;  4NPE A;  1ZR4 A;  1ZR2 A;  1MZ9 A;  2HOD B;  2Q3I A;  2E42 A;  5GTI H;  1M56 D;  2E74 D;  4JYB A;  5APS A;  3TF5 A;  3CWB D;  2WT7 A;  2FYN B;  4RJT A;  1P84 H;  2M8R A;  2QJY B;  4EIJ A;  1FS0 E;  2IDB A;  2I1J A;  1G2C B;  1M1J B;  1LTJ C;  1M1K Q;  2KUB A;  1KQF B;  2QJP C;  3H1I J;  3CX5 E;  2FFD B;  4HKZ H;  2KIK A;  1XTG B;  1AQ5 A;  1WT6 A;  2OTK E;  2H88 C;  5B5E H;  2YNY A;  3A0H E;  2K3R A;  3QWO C;  3FWL A;  5KKZ C;  2HPC B;  3V2R A;  2GM4 A;  2Y0E A;  1SQX E;  1PGJ A;  1N73 A;  1JY3 N;  2FYU D;  1X79 B;  1SFC D;  3QH9 A;  1YI2 P;  4HJG H;  3MHV A;  1LT9 B;  1BE3 G;  5KLV J;  1VQM P;  1BCC D;  2PGD A;  2Q9I A;  3CWB E;  2N1T B;  1URQ A;  1JY3 O;  1AVY A;  2GA1 A;  3PJS K;  1T2K D;  1RE3 A;  2WSF H;  3A7O A;  5KLI B;  1OMI A;  4B86 A;  3VMX A;  2Q5U A;  1NU1 D;  2KYV A;  3AEC C;  3OW2 O;  2R32 A;  1MFZ A;  3LW5 J;  3A2A A;  3LID A;  3MZW B;  1DEB A;  1KIL E;  2V7Q H;  2WTY A;  5AW6 B;  1Q7Y Q;  1X8Y A;  1RH5 B;  3VMY A;  1U57 A;  5CJ4 A;  1GZL A;  1GL2 A;  4C46 A;  1RY3 A;  2WSS H;  1LWU C;  1QVG O;  1RF1 B;  5GTH E;  3E7K A;  2P10 A;  1URQ D;  3WU2 H;  2JWD A;  1L0N G;  1WMK A;  2AXT E;  3CI9 A;  2HR3 A;  2FYU E;  2A45 G;  3CCL P;  1IK7 A;  5BVZ A;  2G3A A;  3HD7 A;  4AQR D;  2I1K A;  2IBZ D;  3K5B A;  3BVH A;  2Y9Z A;  1YQ3 C;  4GT1 A;  2W6B A;  1FZA A;  1KB9 H;  1AQT A;  1LNQ A;  4GIF A;  1P84 D;  1JMB A;  1GU4 A;  2D2C B;  1OXZ A;  1FBM A;  1HUC A;  2B87 B;  3L74 G;  5CCG D;  1N8R Q;  4WY4 C;  3L37 A;  3L70 E;  3OAK A;  3VOP A;  1JO5 A;  2OYH A;  4GKG A;  3G71 P;  3M0D A;  2ZT9 B;  1S5L X;  5APW A;  3SWF A;  2GUV A;  3A3Y B;  1NOH A;  4LLH A;  3OA7 A;  3T97 B;  5CCH A;  1ZW0 A;  2E75 D;  4K3A A;  1RHZ B;  1FE6 A;  1VQ9 P;  4U3F G;  2C9L Y;  3M9Q A;  2YKQ A;  3JCU E;  4XFJ A;  1LP1 B;  5K5G B;  1FC2 C;  1OVV A;  1E5W A;  2XU6 A;  4HH2 A;  3H32 A;  2J58 A;  2E43 A;  2WSE H;  1SQB D;  4W80 A;  3N4X A;  5E79 H;  1M57 D;  1P84 E;  1T6A A;  3L35 A;  3KZI E;  1PV3 A;  1BDD A;  1PZQ A;  1QLE D;  4H0L B;  4DZO A;  1ZRT D;  3U59 A;  5AVT B;  3H25 A;  3H1K G;  1AVO A;  4JYC A;  1IFM A;  3B4S A;  5B5E E;  2YKO A;  4NPF X;  1L4A C;  2D2C D;  2H8P D;  2B89 A;  1USD A;  3D6Z A;  4L74 A;  1JTH A;  1K05 A;  2ZVO B;  2JWA A;  2QG4 A;  2BEQ D;  3HTK A;  1LT1 A;  3PP5 A;  2AEM A;  1VQK P;  2W6J H;  4BRY A;  3L73 G;  2ZT9 D;  3HE5 B;  1RF0 A;  4L75 A;  1OFC X;  3D6Y A;  2W6A A;  1NTM J;  1IFD A;  3F89 A;  3TGU G;  3AEA C;  1BE3 E;  4ASW A;  1N7S B;  3CCV P;  1RE4 A;  1IFN A;  1KB9 D;  1JNM A;  2BCC J;  1HH0 A;  1PGP A;  3IFM A;  1QL2 A;  4ZNC A;  1NTZ E;  3AE4 C;  4GDO A;  2IYP A;  1QEX A;  4IL6 X;  3B5N B;  2POH A;  4YXD C;  3V2N A;  4PV1 D;  4YTP C;  2KI7 B;  3WU2 E;  1LTB C;  5H2F H;  3FWN A;  2JO1 A;  1L0N E;  3ITK A;  3H1L D;  3I5C A;  3A0H H;  1KV4 A;  1NHL A;  1A02 J;  4AYC A;  4U3F D;  3CME P;  1VQN P;  5EFW B;  1ZN5 A;  4D6T D;  4PD4 H;  3H1I G;  4JPZ B;  1SQQ J;  1HGV A;  2KSJ A;  3CX5 I;  3NFQ A;  1W2E A;  1H0T A;  4RKU J;  1QX8 A;  3RL0 B;  1DD3 A;  3Q2Y A;  1HBW A;  1NO4 A;  5AVX B;  1KYO I;  1XTC C;  3Q5P A;  2KNC A;  1NYH A;  2ZVN B;  3H1J J;  3HE4 A;  3O6Q A;  4L76 A;  4C7N A;  2XZR A;  3L74 E;  2M3B A;  3GHG B;  3HUS B;  3KQG A;  1BGY J;  2IYO A;  5AW3 B;  2HYN A;  4BXL A;  3VN0 A;  5KLV G;  3CCJ P;  1FZC B;  1NKZ B;  5KJ7 A;  4IFM A;  1DX7 A;  1L0L J;  2KP8 A;  2O01 N;  4U3F E;  1PL5 A;  2NPS C;  2QA4 P;  2IFN A;  4M3L A;  3I56 P;  3L73 D;  4C7R A;  3NMD A;  3AEF C;  1J1D B;  1JY2 P;  3TSI A;  5AW1 B;  5E79 E;  1R5L A;  3RBX A;  1S72 P;  2WZ7 A;  3L71 J;  3P8C D;  4H44 B;  2KXP B;  1EZV G;  3M0A A;  2JJL A;  1VQ8 P;  2K88 A;  2KS1 A;  5AW0 B;  4Y28 J;  2Q6Q A;  1K8A Q;  3G3Z A;  2OYI A;  3AE8 C;  3GMA A;  1Y9B A;  4DOJ A;  2FYZ A;  3MTU E;  3RL0 D;  3H1K E;  1OVU A;  1HTL C;  3RK3 C;  1PP9 J;  4OGQ B;  1R5S A;  3TNU B;  2Y0D A;  1N7L A;  2WPV B;  1JCD A;  2E74 C;  4QMA A;  1GW3 A;  1S4X A;  3A5T A;  1NTK J;  1YQ4 C;  2LXB A;  1FOS F;  3L73 E;  4WB4 A;  1IFP A;  2QJK C;  4PD4 D;  3U1A A;  3M9H A;  2L5G B;  2YXR B;  1KIL A;  3P8C E;  3TGU E;  2WPQ A;  1FZB A;  4LGD E;  1KN7 A;  2Z5H A;  2HG5 D;  1N86 A;  1LTJ B;  2QJP B;  3BCC J;  1Q2N A;  1KTM A;  2OTJ P;  3TNU A;  2OAR A;  1SQP J;  2WQY C;  3ABV C;  4A7P A;  3CCS P;  4H44 D;  3A0B H;  4KT0 J;  3KZI H;  5KKZ B;  1HJ0 A;  3L75 J;  2IBZ I;  1SFC C;  1NTZ K;  1H89 A;  1SFC A;  1KIL D;  5H2F E;  1QVF O;  1KZU B;  2C0W A;  3AE9 C;  1PFI A;  1SQV J;  3C8V A;  1YJN P;  4RO0 A;  1T2K C;  1JEK A;  2R3S A;  1L0N K;  3MUD A;  2JR8 A;  1WRG A;  5B66 H;  1S9K E;  2HOD A;  3MP7 B;  3M06 A;  2FBW C;  4PD4 E;  3Q5S A;  2Q3E A;  1N73 C;  3Q1M A;  2QIW A;  2YMK A;  3H1I E;  3L4F A;  3VMZ A;  4TT3 H;  1G2C A;  1URQ C;  2OTL P;  1M1J A;  1LWU B;  1K9M Q;  1RE3 C;  5AVY B;  1EZV D;  2FFD A;  3VYI A;  1VQ7 P;  1IK9 A;  2CPB A;  3TK1 A;  4N6J A;  2P2U A;  1LTI C;  1NTM G;  4JF7 A;  2HPC A;  5AVZ B;  1GL2 C;  1NTZ G;  2IX7 C;  5KLV E;  3P8M C;  5CBO A;  4GOD A;  2SPZ A;  2P67 A;  1FZE A;  3L70 D;  1ZOY C;  1YJ9 P;  2LR2 A;  2FYU J;  1ZV8 A;  2YO2 A;  1VF5 C;  1LT9 A;  2VRS A;  2YIU C;  3FXD A;  3L72 J;  2BCC G;  1J1E C;  2N1T A;  3IAO A;  5M1B A;  1YHQ P;  1BCC J;  4DJG A;  1RQV A;  3E1R A;  2ITA A;  5CCG A;  3HD7 C;  2A45 H;  1K73 Q;  2WIT A;  4YPC A;  5BU8 B;  1TU3 F;  2WSC H;  1NU1 J;  5CJ0 A;  1EDJ A;  3BRV B;  1EZV E;  1L0L K;  1EQ7 A;  4OWF A;  2E75 C;  4TLF A;  3VP9 A;  5APX A;  3CLQ A;  1GMJ A;  3SSU A;  2M3E A;  5TJH A;  1RF1 A;  3KDP B;  1PPJ G;  2N1T D;  3CCR P;  1VQO P;  1PGQ A;  1YYC A;  4Y99 C;  2K9J B;  3AE7 C;  3V2P A;  5DJT B;  3G9R A;  2OYH C;  5KTB A;  3M0D C;  4HB1 A;  1KB9 I;  1DEE G;  2K9Y A;  5CCH C;  1QL1 A;  4AUW A;  3H1J G;  3PTZ A;  1NH4 A;  3UIA A;  3G6E P;  1BGY G;  1CZQ A;  5APV A;  1D7M A;  3P32 A;  1OZH A;  1GDT A;  4RES B;  3R2P A;  3WUT A;  1NTK K;  2RH0 A;  2B87 A;  1CSB A;  1BE3 D;  1VQP P;  3GF3 A;  3TDK A;  1L4A B;  1L0L G;  4R4M A;  3RK2 C;  1PGO A;  1CW5 A;  2N9Y B;  3A0B E;  5AVV B;  1CI6 B;  2QE7 H;  3AEB C;  1N2D C;  3T97 A;  1ZLL A;  3AEG C;  4L73 A;  3CPW O;  1U7J A;  3L71 G;  3KYQ A;  1LP1 A;  1NTZ D;  2AEJ A;  5B66 E;  1OX3 A;  1USE A;  1YTZ I;  2OGU A;  2QSI A;  1ZME C;  1IFJ A;  3CL3 D;  1VQ6 P;  1SQB J;  1L0N D;  4NPD A;  1RF0 C;  2ZYD A;  5AW9 B;  1PP9 G;  4H13 C;  1SQV K;  2ZYG A;  4PV1 C;  3F5H A;  1NTK G;  2K1A A;  1ZP0 C;  2E76 C;  3G4S P;  1RE4 C;  3WUV A;  2V7Q J;  1YBK A;  1Q90 D;  2PP6 A;  2NZ2 A;  2R5B A;  2Y0C A;  5AW5 B;  3IF4 A;  2QVA A;  2WPR A;  1IZN B;  3BAT A;  1NTM E;  2HLO A;  4JBZ A;  1KD1 Q;  2O01 J;  4H0L D;  5L8R J;  5KLV K;  1OW8 A;  3L74 D;  1IJD B;  1U7M A;  1GW4 A;  3HE5 A;  3BCC G;  4DCK A;  1DD4 A;  2M5A B;  3FGA D;  3CXH H;  4DT0 A;  3RBZ A;  1SQP G;  1JUN A;  3AE2 C;  2BCC E;  1N7S A;  2W27 A;  2CK3 H;  3L75 G;  3RL0 g;  1J2J B;  3KXD A;  1BGY D;  1S5L H;  1QGK B;  1SQV G;  3B8E B;  1ZXG A;  5AW2 B;  1Y8A A;  3II6 A;  3H6P A;  1S1C X;  1OW7 A;  3CC7 P;  4ZKU A;  3B5N A;  3H1H J;  3V4Q A;  1L0L D;  1K04 A;  1KC8 Q;  2P1J A;  1EDK A;  2H43 A;  1N7S D;  1PPJ E;  4PD4 I;  3MD0 A;  2NPS B;  2XNX A;  4WVZ A;  2BEZ F;  3ZDM A;  1SQQ E;  1YTZ T;  3EWK A;  1LTA C;  2LKM A;  3H1L J;  2E5Y A;  2PAJ A;  3H1K D;  2O1K A;  4I6M C;  3CCQ P;  3CMA P;  3L71 D;  2YMY A;  5KJ7 C;  1KQL A;  2L91 A;  4D6T J;  1BSN A;  1HWT C;  3H1J E;  1MKM A;  4LC1 A;  3B5N D;  2XND H;  1M8O B;  2R5D A;  3EQ2 A;  5TIS E;  1BGY E;  2ZJS E;  3LW5 H;  1BSH A;  1NAY A;  5APT A;  5AVQ B;  3RK3 B;  3HUS C;  1OVR A;  3GHG A;  3TGU D;  3HUS A;  1EXJ A;  1JY2 N;  1L0L E;  4WBA A;  1NTK D;  1YIJ P;  1NKN A;  1KQS O;  2E74 B;  1EDI A;  1FJK A;  3L72 G;  5AW8 B;  2OYI C;  1FZC A;  2C9N Y;  3NTN A;  1BCC G;  4KHX A;  3EFF K;  1LJ2 A;  1UIX A;  3SFE C;  1FU1 A;  2ZYA A;  4R4L A;  2LXC B;  2ZXX A;  1IC2 A;  1NU1 G;  1FDI A;  2IPP A;  1HVV A;  3L71 E;  2G8Y A;  2QJK B;  4N3Y B;  2A06 E;  3N7N A;  1VQL P;  1JY3 P;  1AJY A;  2NPS D;  1EZV I;  1JMM A;  3CXH D;  1H8A A;  3EFG A;  2WMM A;  3BCC D;  4I2L C;  3AE5 C;  3GW6 A;  4KJM A;  4IL6 H;  4Z1M H;  2WPS A;  1S9K D;  2WT7 B;  4I7Z C;  3VTP C;  1PP9 E;  1HJB A;  1T3J A;  1KIL C;  2KOG A;  1GK6 A;  1AFO A;  3H1I D;  1NTK E;  2I8D A;  3R4Y A;  1SQV D;  2KLU A;  2XV5 A;  3BAS A;  3S1K A;  3AEE C;  1JM0 A;  3FXE A;  2IBZ G;  2J5U A;  2PRR A;  1DH3 A;  1EC5 A;  3RK3 D;  3PRJ A;  1R8E A;  3MGN A;  1NTM K;  4GOF A;  1N73 B;  4GOE A;  4ZKP A;  1NWQ A;  2RKL A;  3CXH E;  2J59 M;  5CHX A; 
#chains in the Genus database with same CATH homology
 3V5B A;  2W6A A;  2OYI B;  3L36 A;  1RF1 A;  3MIW A;  1IFD A;  3KDP B;  2QM7 A;  2N1T D;  1N7S B;  1YYC A;  1URQ B;  2NPS A;  3GHG C;  2R3C A;  4Y99 C;  1LTJ A;  1RE4 A;  3V2P A;  1JY2 O;  1IFN A;  4HYT B;  1T8Z A;  4XE5 B;  4O9B A;  2OYH C;  5KTB A;  3M0D C;  1JNM A;  1FZC C;  2KB7 P;  3C9I A;  1MUU A;  1HH0 A;  1T3U A;  5CCH C;  1QL1 A;  3TYY A;  3IFM A;  1LTG C;  4OH8 B;  2YKP A;  1GK4 A;  1G1J A;  1QL2 A;  4AUW A;  1GL2 B;  1HGZ A;  3WMM 0;  1M1J C;  1LTT C;  3V4W A;  1NH4 A;  3UIA A;  1NAF A;  3B5N B;  2POH A;  1SLQ A;  5KJ7 D;  4W7Y A;  3V2N A;  1JOC A;  1CZQ A;  5APV A;  2FFD C;  5AW7 B;  4EOT A;  1VPC A;  1KIL B;  5AVR B;  1LTB C;  3P32 A;  1GDT A;  1IO4 A;  1J1D C;  4RES B;  3R2P A;  3BRT B;  1NTK K;  1SVF A;  1GTW A;  3I5C A;  1CSB A;  1SQQ K;  1J1E B;  1G1I A;  1FOS E;  1NHL A;  1A02 J;  1FDM A;  1Z56 A;  1L4A B;  3RK2 C;  4AYC A;  3HD7 B;  1CW5 A;  5CMZ A;  1ZN5 A;  5AVV B;  1CI6 B;  5AVU B;  2JEE A;  1OWA A;  1N2D C;  1FZF A;  1HGV A;  1SP4 A;  3HRN A;  3T97 A;  2KSJ A;  3NFQ A;  1LT9 C;  1SFC B;  3LIE A;  1W2E A;  1ZLL A;  2N1T C;  3RL0 B;  1HBW A;  1MV8 A;  1NO4 A;  5AVX B;  1LWU A;  1XTC C;  5CCG C;  1SQB K;  3KYQ A;  2FKW B;  2ZXE B;  2Z5I A;  3P7K A;  2XKM A;  1ZR4 A;  1YTZ I;  1ZR2 A;  3HE4 A;  1MZ9 A;  3O8Z A;  2O01 H;  4C7N A;  2XZR A;  1KFM A;  2M3B A;  2HOD B;  2Q3I A;  3GHG B;  1IFJ A;  3HUS B;  3CL3 D;  3KQG A;  4Y99 B;  2E42 A;  5AW3 B;  2HYN A;  4WY4 B;  4JYB A;  5APS A;  3OJA B;  1X9V A;  1FJP A;  2OYH B;  1RF0 C;  3VN0 A;  3M9B A;  2WT7 A;  5AW9 B;  1FZC B;  2M8R A;  4EIJ A;  1SQV K;  1RF1 C;  5AVS B;  1LGH B;  1NKZ B;  5KJ7 A;  2A45 I;  3VP8 A;  4IFM A;  1GL2 D;  2ZFC A;  1DX7 A;  2I1J A;  2KP8 A;  1G2C B;  2NPS C;  1M1J B;  1LTJ C;  1RE4 C;  2IFN A;  1KFN A;  2PP6 A;  4M3L A;  2FFD B;  2R5B A;  2N9B A;  3E1I A;  1XTG B;  1AQ5 A;  4C7R A;  1WT6 A;  3NMD A;  5AW5 B;  2YNY A;  1J1D B;  1JY2 P;  3TSI A;  3H32 B;  5AW1 B;  2WPR A;  5APU A;  5APQ A;  3U1C A;  3BAT A;  2WZ7 A;  3P8C D;  2HPC B;  3V2R A;  2HLO A;  3HD7 D;  4WY4 A;  2GM4 A;  3RK2 B;  5KLV K;  3M0A A;  2JJL A;  1IJD B;  1N73 A;  1JY3 N;  1GW4 A;  3HE5 A;  5AW0 B;  1X79 B;  1M7L A;  2OYI A;  3G3Z A;  1SFC D;  3NXS A;  4XA4 A;  4DOJ A;  2MJZ A;  4I1L A;  1LT9 B;  2FYZ A;  2KLV A;  1H88 A;  3MTU E;  3RL0 D;  1JUN A;  1HTL C;  2Q9I A;  2N1T B;  1N7S A;  2W27 A;  2Q7C A;  3RK3 C;  1URQ A;  1JY3 O;  3TNU B;  1T2K D;  1RE3 A;  2WSF H;  3A7O A;  4B86 A;  2YO3 A;  1JTH B;  2Q5U A;  1N7L A;  3VMX A;  1JCD A;  2C0X A;  1J2J B;  1GW3 A;  4IFF A;  2KYV A;  3A5T A;  2R32 A;  1MFZ A;  1JCC A;  3A2A A;  3LID A;  4WY4 D;  1DEB A;  3HTK B;  5APY A;  3B8E B;  2WTY A;  5AW6 B;  1X8Y A;  5AW2 B;  3II6 A;  3VMY A;  1FOS F;  3IR9 A;  5CJ4 A;  1GZL A;  1GL2 A;  4WB4 A;  4C46 A;  1RY3 A;  3H6P A;  1FZG A;  1LWU C;  5CCH D;  4ZKU A;  3B5N A;  2WWW A;  1FAV A;  3U1A A;  1RF1 B;  3M9H A;  2L5G B;  3V4Q A;  3SWY A;  2P1J A;  1KIL A;  3P8C E;  2H43 A;  1N7S D;  1SQP K;  2WPQ A;  1VDF A;  1URQ D;  2QM8 A;  1FZB A;  4LGD E;  3MD0 A;  2Z5H A;  2HG5 D;  2NPS B;  1N86 A;  2XNX A;  1LTJ B;  3CI9 A;  1YTZ T;  2A45 G;  1LTA C;  2LKM A;  2O1J A;  2PAJ A;  4N78 D;  2O1K A;  3TNU A;  5BVZ A;  1L4A A;  2OAR A;  4I6M C;  2H7H A;  3HD7 A;  4AQR D;  2I1K A;  2YMY A;  1CI6 A;  5KJ7 C;  1KQL A;  2IFM A;  1HWT C;  3RK2 D;  3BVH A;  1SFC C;  4GT1 A;  1NTZ K;  4LC1 A;  1H89 A;  2W6B A;  3B5N D;  1SFC A;  2CPS A;  1SQX K;  2R5D A;  1FZA A;  1KIL D;  1KZU B;  3EQ2 A;  2C0W A;  1PFI A;  3LW5 H;  4GIF A;  1T2K C;  1GU4 A;  5APT A;  1OXZ A;  1L0N K;  3MUD A;  1FBM A;  2FXM A;  1HUC A;  1WRG A;  1S9K E;  3KPE A;  5AVQ B;  3RK3 B;  5CCG D;  1GU5 A;  3HUS C;  1L4A D;  2HFE D;  2HOD A;  3GHG A;  3HUS A;  3M06 A;  3M91 A;  4WY4 C;  3L37 A;  3OAK A;  4WBA A;  1N73 C;  3VOP A;  1NKN A;  1JO5 A;  2OYH A;  1FJK A;  4GKG A;  3M0D A;  2Z4E A;  5APW A;  5AW8 B;  3SWF A;  2XDJ A;  3L4F A;  1FZC A;  2OYI C;  2C9N Y;  2GUV A;  3NTN A;  3A3Y B;  1NOH A;  4KHX A;  4LLH A;  3OA7 A;  3VMZ A;  5CCH A;  1FU1 A;  1LTS C;  4N78 E;  2GUS A;  1N7S C;  1IC2 A;  2C9L Y;  1G2C A;  1URQ C;  2IPP A;  1HVV A;  1LWU B;  1M1J A;  3M9Q A;  2YKQ A;  1RE3 C;  4N3Y B;  5AVY B;  2FFD A;  1IFI A;  3N7N A;  1JY3 P;  2NPS D;  3VYI A;  3HE4 B;  1E5W A;  2XU6 A;  4HH2 A;  1JMM A;  4C7N B;  1H8A A;  3EFG A;  3H32 A;  2J58 A;  1GD2 E;  2E43 A;  1IK9 A;  2WSE H;  4W80 A;  4I2L C;  2CPB A;  3V2Q A;  3TK1 A;  3N4X A;  4N6J A;  2FYU K;  2P2U A;  1LTI C;  4JF7 A;  2HPC A;  5AVZ B;  1GL2 C;  5AW4 B;  2IX7 C;  3P8M C;  2WPS A;  1S9K D;  2WT7 B;  3L35 A;  2BAS A;  3B5N C;  3VTP C;  2P67 A;  2P7J A;  1HJB A;  1FZE A;  1T3J A;  1KIL C;  2KOG A;  4DZO A;  1ZV8 A;  1GK6 A;  2YO2 A;  4W7Z A;  1AFO A;  3U59 A;  4IFD K;  5AVT B;  1NU1 K;  1LT9 A;  2VRS A;  4JYC A;  2XV5 A;  3BAS A;  1J1E C;  2N1T A;  1IFM A;  2YKO A;  1L4A C;  2H8P D;  5CCG A;  3HD7 C;  1A02 F;  2A45 H;  5BU5 A;  1DH3 A;  2WIT A;  1JTH A;  5BU8 B;  3RK3 D;  2WSC H;  5CJ0 A;  3MGN A;  3HTK A;  1NTM K;  3PP5 A;  5AVW B;  3BRV B;  1L0L K;  1EQ7 A;  1N73 B;  3VP9 A;  5APX A;  3CLQ A;  3HE5 B;  4ZKP A;  3RL0 C;  1NWQ A;  1RF0 A;  1JY2 N;  2J59 M;  5CHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...