1J1DB

Crystal structure of the 46kda domain of human cardiac troponin in the ca2+ saturated form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
70
structure length
70
Chain Sequence
QTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQTIYNLEAEKFDLQEKFKQQKYEINVLRNRINDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin C
publication title Structure of the core domain of human cardiac troponin in the Ca2+-saturated form
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 35
structure length 70
sequence length 70
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00992 Troponin Troponin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.350 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1j1dB00
4Y99C 1J1DB 1YTZI 1J1EB 1J1DC 1YTZT 1J1EC 4Y99B
chains in the Genus database with same CATH superfamily
2M3BA 4ASVA 1ZR2A 1PGOA 4ZMDA 4HJGH 2QVAA 1BDDA 2LXBA 1RY3A 3EQ2A 4GIFA 3MTUE 1Q81Q 3L73G 1NTZE 2P1JA 2QJYB 1VQLP 4OWFA 4DOJA 3G3ZA 1RQVA 5CCHD 1Z56A 1P84E 1U7MA 4H0LC 3A0HE 3KPEA 2FYUK 1FOSF 1HVVA 2O01N 3WUUA 3V4WA 3A5TA 2C0XA 3PLNA 1Y9BA 3CC7P 1EDIA 1GK6A 3H1HJ 4N78E 1AQTA 1FDIA 2ITAA 3AE2C 1KV4A 3TNUB 5AW6B 3HD7D 1LTJC 3L75J 3TGUG 1SP4A 2WITA 1GMJA 1N7SA 3NFQA 2OYIC 2Q5UA 2Z5HA 3KQGA 5TJHA 1IJDB 3BCCE 1ZW0A 2WT7A 4RO0A 1X9VA 1GW3A 2B9BA 2ZT9D 3CPWO 2K9YA 1PP9G 1LTBC 4ASWA 3GMAA 3M9QA 2K88A 3AEFC 1EC5A 3RK2B 2Q9IA 1ZRTE 4NPEA 2QG4A 2IYPA 2QJKC 4D6TG 1BCCE 1JMBA 4PD4D 3U1AA 2KIKA 1VQNP 1S5LE 3H1HD 1MFTA 5APTA 2WPVB 3AE3C 2J5UA 2IPPA 3L75D 3CX5I 1FJKA 1NOHA 1N73A 3V2RA 4LLHA 1FDOA 1RE3C 1M90Q 1LTGC 1K04A 3IFMA 1P84I 2QA4P 4GODA 1ZMEC 1HJ0A 3V5BA 4H44B 2FYUE 4DT0A 1NTKK 3P8MC 2WSEJ 1PIXA 2O01J 5AW2B 1H88A 2G3AA 2GM4A 3L4FA 3M9BA 3I5CA 3CXHD 1PPJE 2UWJE 2PRRA 3H1JE 2IBZI 1BGYJ 2ZVOB 4I7ZC 3H1IE 2WTYA 3IAOA 1BSHA 3H1KJ 1SFCC 2GA1A 3PTZA 2M5AB 4YXWH 1QGKB 1FC2C 1JOCA 1VDFA 1IFIA 1PZQA 4A7PA 3L73E 2ZYGA 2O1KA 4HH2A 2FXMA 3VMYA 1KYOD 2E74B 4AYCA 1NHLA 1J1DB 3CCRP 4WVZA 2JP3A 1OVVA 3JSVC 1BSNA 5APXA 2D2CD 3SFDC 1LTAC 3AE5C 1MZ9A 2JWDA 2JO1A 1YIJP 4TLFA 1BGYD 2AEFA 1KQSO 2ZFCA 1S72P 4DCKA 2AXTH 3TF5A 3H1KD 1SQXK 1VF5B 1VQOP 1DEBA 4UB8H 1EZVG 1SQQG 5CCGA 3B5ND 1FU1A 1RF0A 1BE3E 1L4AC 3Q3DA 1LT9A 1OIPA 2PP6A 2BEZF 1LTIC 3AEGC 4BRYA 1S3JA 2NPSD 1L0NG 1FZFA 1URQC 2NPSA 1N86A 1FJPA 4WY4B 5B66H 2J59M 1KILC 2KNCA 1SQVJ 1NTKE 1JMMA 3D6ZA 3LW5H 1URQA 4DZOA 2OYHC 1L0LJ 4D6TE 4I2LC 3L35A 3NXSA 3G71P 2FFDA 3MP7B 3TK1A 3L71E 3L72E 2QM8A 3CMEP 1Y8AA 2KUBA 3KZIH 2KLUA 4C7NA 2CK3H 1NU1K 3CI9A 4U3FJ 1QLED 1HH0A 1NTMG 2B89A 4H0LB 5CBOA 5B5EE 3FWLA 1NTZJ 1OW7A 2V7QJ 5APVA 3F5HA 1J2JB 1FZCA 1H8AA 3GLMA 1GL2C 1SQVD 3L70G 1VQPP 1LTJB 2Y0CA 1G2CA 1L0LD 2OYIB 3PJSK 3HTKA 4I1LA 1Q86Q 4GOEA 4EIJA 3H1LJ 1SQXE 2A45H 4R4LA 1QVFO 4U3FD 1SQBJ 4B86A 3M0DA 2FY8A 4UB8E 2E5TA 2ZXEB 1GD2E 3CCQP 1U57A 4IFDK 3CX5D 3GG2A 1NTZD 3FXDA 3Q5PA 1LP1A 3EWKA 3G4SP 2QJKB 5CHXA 2QJPC 3CCMP 1ZV8A 2KYVA 3MUDC 5GTIE 5AVWB 2Y9ZA 1L0LK 2L5GB 3JC22 3U59A 3M9HA 2I8DA 3D70A 2IX7C 4OVNF 1KMIZ 1SQPK 1RH5B 1JY3O 1JO5A 2K1AA 3WU2H 1NU1E 1SQQE 1LJ2A 3CWBJ 1P84H 2IBZD 3H1LD 3BCCG 1OFCX 1SQBD 3RBZA 2N1TA 4PJ0H 1N2DC 2KS1A 2B87A 3JCUE 1H0TA 1ZXGA 1Q7YQ 4EYYQ 3CCJP 2KLVA 3GF7A 4I7ZB 2R3SA 2RH0A 1T2KC 3G6EP 2YKOA 1KILE 1BCCG 3LIEA 4C46A 1KFMA 3AE1C 2WSFH 1SFCB 4W80A 1K9MQ 2P7JA 1E5WA 2E74D 1M1JA 2XV5A 1S5LX 3H1JJ 1EDJA 3S9OA 3RK3C 1HGVA 1N7LA 4H13C 2IFNA 1FAVA 2OGUA 1J1EC 3U1CA 2L91A 5KLVK 3USSA 2FYNC 2VRSA 5KAFE 1RE4C 3L73J 3HE4A 2A06D 2ZVNB 2Q3IA 3O6QB 2FYUG 3QH9A 5E79E 1HTLC 2Y0EA 3FXEA 1PPJG 1XTGB 5KJ7D 4L76A 3L70E 2OTLP 3VMXA 3AECC 3SWYA 5KJ7A 1YHQP 2R5BA 4O9BA 3ITKA 1GK4A 3H1IG 1VQ4P 2KZJA 1FZEA 3CC4P 3OJAB 2BEQD 2YKQA 1EZVI 1SQPE 3AE8C 3H1JD 4LGDE 1L4AB 3TGUJ 2Q1KA 3CD6P 1CW5A 1YI2P 1W2BO 1EQ7A 3P7KA 2KZIA 1JTHA 2N9YB 3RL0D 3W68A 3WU2E 1URQB 5CCHA 4K35A 3MIWA 2M0BA 3L73D 1KILB 1AVYA 4PJ0E 2OYHB 3L36A 3A0BE 5AVTB 4Y99C 1PP9J 1TU3F 3HD7C 4GDOA 1N7SC 4IL6H 4GT1A 2JWAA 4GOFA 2FXOA 2W90A 5APQA 2E75D 3HD7A 1AV1A 1QX8A 3I56P 5AVUB 2OTJP 4D6TJ 3V2QA 3GW6A 1MFZA 4XFJA 1OX3A 3KHUA 3M91A 3VN0A 2H43A 2HYNA 4U7JA 1Q90D 2ZAEB 1BE3G 2A45I 3TGUD 5KLVE 1DD3A 3CCEP 3V2NA 1IK7A 2IFMA 4OH8B 4HKZH 4JQ0D 5BU5A 1VQ6P 1GL2B 3H32B 3Q5RA 2H8PD 1NTKG 3HTKB 1JUNA 2LXCB 1AVOA 2RMZA 1JM0A 1YBKA 1PP9D 3L37A 1IO4A 1LWUA 1A02J 1NAYA 1N73C 4NPFX 4IOIH 2HODA 3L71G 3L74E 4BWNA 3L72G 1JNMA 1R8EA 4N6JA 4D6TD 1T8ZA 1SLQA 3T97A 5AW1B 1PFIA 2G8YA 3VMZA 2HLOA 3LIDA 3RK3E 3CC2P 2YXRB 1HGZA 1G1JA 5H2FH 1ZR4A 2QJPB 2NRGA 2SPZA 1IC2A 2QEXP 1RQUA 1KN7A 3GHGA 3P8CE 4PV1D 1KB9D 2JKVA 2R5DA 3M06A 2DW3A 1GW4A 3Q5SA 4IL6E 3FGAD 2E76D 4RESB 1NH4A 1CI6B 1MV8A 1OWAA 1SQXG 2W6BA 1DX7A 1ZOYC 5B5EH 2IZ1A 2JEEA 1AQ5A 1JCDA 1G1IA 2LR2A 3B71A 1SQQJ 3E7KA 3MD0A 2D2CC 3HE5B 1K73Q 2HG5D 2CPSA 3CXHH 5AW8B 3VYIA 3IN6A 1EDKA 2WWWA 1L0NJ 2GUSA 2JDIH 2KXPB 2ZXXA 3IR9A 3BASA 3BVHA 3BRVB 3F89A 2HPCA 2C0WA 3RK3B 2PFXA 4H13B 3AE6C 3KXDA 5CCGC 2PAJA 1NWQA 1RF0C 3HUSA 3RGUA 1RF1A 2Q3EA 1J1EB 1LT9C 2KP8A 1NU1G 1QEXA 2O1JA 2FYNB 1SVFA 3A2AA 3B5NA 3R2PA 1W5CE 2IZ0A 1ZLLA 2WPRA 1Y47A 2NPSC 3CLQA 1NTMJ 1EZVD 1SQQD 2OTKE 3MHVA 2WSEH 2O01H 1NO4A 2BCCG 5GTIH 1NAFA 1HJBA 4CPGA 5H2FE 5TISH 2FFDC 3PHLA 1L0ND 1T3UA 1UIXA 1DH3A 3H1HE 1U7JA 4W7YA 1PL5A 1IFPA 5BU8B 1JTHB 3L75E 4XE5B 3ABVC 2AEJA 3JCUH 1FZCC 2W6JH 1YYCA 2A45G 1HF9A 3TNUA 1YQ4C 1OXZA 4BXLA 4Y99B 1NTMD 5APUA 1LNQA 2YMYA 3HD7B 1CSBA 1VQKP 1N7SB 2Z4EA 4NPDA 1K8AQ 3CXHE 2I1JA 2RN0A 2FYZA 1S9KD 5AW0B 1NVOA 1D7MA 2WT7B 2HR3A 3C9IA 3L70D 1SQPG 3M0DC 5KAFH 1HBWA 4JPZB 3KDPB 3RK2D 3B4SA 3UIAA 1KZUB 1KYOE 2LKMA 4EOTA 2C9LY 2K9JA 2E43A 1OW6A 1MUUA 5E79H 3BCCJ 2HFED 2W27A 2FKWB 3N4XA 3TSIA 5M1BA 1OVUA 1SQVK 2YIUC 1P84D 3MGNA 3OA7A 1N73B 4YXDC 3BRTB 2WSCH 3PH0A 5TISE 1PV3A 1BGYE 2P2UA 1USDA 3SWFA 1BCCJ 4WB4A 5KAIH 3AE7C 1KQLA 4H44D 5KKZC 3M0AA 4N78D 3H1KE 1R5SA 2MJZA 2N1TC 5APWA 2XDJA 4I6MC 5KLVG 1KC8Q 2V7QH 3A0BH 1E79H 1NTZK 1DEEG 5K5GB 1Q2NA 2BCCE 3BCCD 3A3YB 4HB1A 3CXHI 2M5AA 4RKUJ 1AJYA 2FYUJ 1M1JC 3HRNA 2K37A 3N7NA 2WVRA 3L74G 1ZRTD 2E5YA 4R4MA 1PGJA 1DIPA 3H1IJ 1FS0E 1S2EA 1BCCD 2H7HA 1CZQA 1M7LA 3A7OA 3OAKA 2AXCA 3Q1MA 1KYOI 3MZWB 3L74D 2E42A 2BASA 1SQBK 1YJNP 3CWBG 1VQ9P 2D2CB 5AVQB 4MN4C 3WUVA 4UB6E 1WMKA 1GU5A 1WT6A 4Z1MH 4AQRD 4OGQC 2Z5IA 4H13D 5KJ7C 1HWTC 1VF5D 2R32A 2C9NY 2XU6A 3SWKA 2FYUD 1VQ7P 1L0LE 1NKNA 3CCLP 1AFOA 1NJIQ 1LTSC 1Q82Q 2P67A 1LT9B 1PPJD 1PGPA 2QM7A 3S4RA 4BRYB 4IL6X 1JY2N 3H1ID 4WY4D 3RL0C 4WY4A 2NPSB 3EFFK 5CCHC 1LT1A 5KAIE 4U3FE 2KNCB 2YO3A 5GTHH 5AW3B 1NKZB 5AVSB 1BE3J 3CX5E 2OYOA 2FFDB 2CPBA 4JYCA 1HUCA 3BATA 2JR8A 3TDKA 4JYBA 2E75C 3RL0g 4C7NB 5DJUB 2RKLA 3CCSP 1NTKJ 4H0LD 5APYA 2I1KA 5KTBA 2FBWC 4ZKUA 1KTMA 1X22A 2OQQA 3L71J 3L72J 3VTPC 3AE9C 1FZCB 2IBZE 2ZYDA 1N7SD 2ZT9C 2QRXA 3H1LE 2B88A 1SQBE 3CCUP 1LTJA 1SS1A 2OYIA 1G2CB 1BE3D 5AW9B 2P10A 5CBNA 2OARA 1LWUC 2W83C 3SFEC 2YKPA 3IF4A 5AVYB 1UIIA 2O3JA 1VQ5P 1K05A 1ZN5A 5BVZA 3H1HG 1NTKD 1GDTA 5AW4B 3L75G 1X8YA 2K9JB 4W7ZA 3L71D 2YNYA 3L72D 1LP1B 3KYQA 3CWBE 5EFWB 1QL2A 1SQXJ 1WRGA 2WZ7A 2A06E 1FDMA 2FXPA 1JY3N 4WBAA 1VQ8P 5GTHE 3GHGC 1M57D 2YIUB 3WMM0 3FWNA 4PD4H 1RE3A 1YTZT 4PV1C 2QIWA 1M56D 1T3JA 2YMKA 3ZDMA 3AEAC 3O8ZA 1YJ9P 3R4YA 1KD1Q 4ZKPA 2M8RA 2E76C 4RJTA 2KSEA 5KKZB 4HYTB 5AVRB 2N1TB 3CMAP 2XKMA 3LW5J 3QWOC 3VP9A 2KS1B 1IFNA 2B87B 4Y28J 1H0TB 1PGQA 2J58A 1QVGO 5KLIC 3AEBC 5DJTB 2Y9YA 1NU1J 3V6IA 1OMIA 2JJLA 5CJ4A 3G9RA 1SQXD 1SFCD 3E1RA 3D6YA 4KJMA 1SFCA 3V2PA 1FE6A 3WUTA 1KQFB 2Y0DA 4JF7A 4M3LA 2MKVA 4DJGA 3H25A 1M1JB 1KB9H 1MKMA 3W67A 2BCCJ 4XA4A 2XNDH 3SSUA 1JB0J 1OZHA 4YPCA 1AA0A 3HUSC 1RF1C 1BGYG 1OVRA 1LGHB 3OW2O 1IFDA 2V4HA 1X79B 3E1IA 3B5NC 3HE4B 3H1KG 3O6QA 1KYOH 2ZJSE 1KORA 2AEMA 4WWIA 1BDCA 3TGUE 4K3AA 4L75A 4C7RA 4OGQB 1NU1D 1IFJA 5CCGD 3NMDA 1FZGA 1L2PA 1FBMA 1EXJA 1NGMB 2QJYC 5C39A 1L4AD 3Q2YA 1L4AA 1PP9E 3AE4C 3PP5A 4PD4E 2BCCD 2IDBA 3AEEC 2P58A 3L70J 2PGDA 1DD4A 3GF3A 3P32A 3RBXA 1JY2O 1URQD 1KQGB 3RL0B 5CMZA 3II6A 3C1LA 1KILD 3B8EB 1LTTC 4ZNCA 1KILA 3V4QA 2OYHA 3S1KA 2WSCJ 1SQPJ 2H88C 3VP8A 1X0TA 1SQQK 1KFNA 2E75B 2R3CA 2KOGA 2KK7A 1L0NK 1SQVG 1N8RQ 1H89A 1VL2A 2YO2A 1IK9A 1L0LG 4IFFA 1KB9E 2POHA 2WQYC 4KT0J 5L8RJ 3D71A 3RK2C 1GL2D 2KI7B 1ZP0C 4L73A 1GL2A 2ZT9B 1VQMP 4UB6H 2WSFJ 3H32A 4U3FG 2KB7P 1T6AA 1SQPD 2M3EA 1YQ3C 3PRJA 1OW8A 2K3RA 4AUWA 1NTMK 1LWUB 5KLVJ 2H89C 1NTZG 2AXTE 1W2EA 1JCCA 4TT3H 2HODB 1JY2P 2Q7CA 4PD4I 1EXIA 4EDFA 4L74A 3T97B 5APSA 4N3YB 4H44C 1FZBA 2KSJA 3CCVP 1S4XA 3CL3D 3C8VA 3NTNA 1EDLA 2W8ZA 5B66E 2N9BA 3L74J 1YITP 5AW7B 1GZLA 5CJ0A 2IBZG 2YXQB 4QMAA 3MUDA 3CX5H 3H1LG 1SQBG 1USEA 2WPQA 3GHGB 4IFMA 2WMMA 1EZVE 1RHZB 5AVZB 4JBZA 3KZIE 4PV1B 1FZAA 1FOSE 3A0HH 5KLVD 1IFMA 2N1TD 4LC1A 1CI6A 2E74C 1KB9I 2E76B 1J1DC 1L0NE 4YTPC 2Q6QA 4EI2A 3TYYA 5AVVB 2IYOA 4KHXA 2GUVA 2R44A 1IZNB 3AEDC 5AW5B 1VPCA 1YTZI 3HE5A 5KLIB 1M1KQ 3FX0A 2WPSA 1A02F 1T2KD 3H6PA 2WSSH 1XTCC 2XZRA 1M8OB 2W6AA 1YJWP 5AVXB 2QSIA 2A06G 1VF5C 3RK3D 2HPCB 1NTME 3CWBD 1R5LA 1JEKA 1NYHA 3I55P 1SQVE 3HUSB 2ZYAA 3K5BA 1RF1B 3VMAA 3VOPA 3EFGA 1RE4A 1S9KE 1S1CX 3B5NB 1QL1A 4OGQD 1S5LH 4WY4C 1JY3P 1GU4A 2NZ2A 4GKGA 3P8CD 1GTWA 3H1JG 2XNXA 2QE7H
chains in the Genus database with same CATH topology
2KYVA 2M3BA 1NAFA 2WZ7A 5AVWB 1L0LK 2L5GB 3U59A 1ZR2A 1HJBA 1FDMA 3M9HA 1JY3N 4WBAA 2FFDC 3GHGC 2IX7C 1RY3A 3WMM0 3EQ2A 1SQPK 1T3UA 4GIFA 3MTUE 1RE3A 1JY3O 1YTZT 1JO5A 1DH3A 2P1JA 1T3JA 3O8ZA 4W7YA 4DOJA 3G3ZA 5BU8B 1JTHB 4ZKPA 2M8RA 5CCHD 1Z56A 3KPEA 2FYUK 1FOSF 4XE5B 1HVVA 4HYTB 2N1TA 5AVRB 2N1TB 2XKMA 3V4WA 3A5TA 2C0XA 1N2DC 3VP9A 1FZCC 1YYCA 1IFNA 2A45G 2J58A 1GK6A 2KLVA 4N78E 3TNUA 1OXZA 2JJLA 4Y99B 5CJ4A 3TNUB 5APUA 3HD7D 1LTJC 5AW6B 1T2KC 2YKOA 1SP4A 2WITA 2YMYA 1SFCD 3LIEA 3HD7B 1CSBA 4C46A 1N7SA 1KFMA 3NFQA 2OYIC 1SFCA 1N7SB 2WSFH 2Z4EA 3V2PA 1SFCB 4W80A 2P7JA 1E5WA 2Q5UA 2Z5HA 4JF7A 4M3LA 2I1JA 1M1JA 2XV5A 3KQGA 1M1JB 2FYZA 1S9KD 5AW0B 3RK3C 1HGVA 1N7LA 1IJDB 2WT7A 4XA4A 2WT7B 2IFNA 1X9VA 3C9IA 1FAVA 1J1EC 3HUSC 1GW3A 3U1CA 1RF1C 5KLVK 1LGHB 3M0DC 1IFDA 1HBWA 2VRSA 1LTBC 1X79B 3E1IA 3KDPB 1RE4C 3RK2D 3B5NC 3M9QA 3HE4A 3UIAA 3HE4B 3RK2B 2Q9IA 2Q3IA 1KZUB 2LKMA 4EOTA 2C9LY 2E43A 1MUUA 2HFED 3U1AA 1HTLC 2FKWB 2W27A 3N4XA 3TSIA 4C7RA 1XTGB 5KJ7D 3VMXA 5APTA 3SWYA 5KJ7A 2R5BA 4O9BA 1IFJA 1GK4A 5CCGD 2IPPA 1FJKA 1SQVK 3NMDA 1NOHA 1FZEA 1FZGA 3OJAB 3MGNA 1N73A 3V2RA 3OA7A 1N73B 4LLHA 1FBMA 3BRTB 2YKQA 1RE3C 2WSCH 1LTGC 1L4AD 3IFMA 2P2UA 1L4AA 4LGDE 3SWFA 3PP5A 1L4AB 1CW5A 4WB4A 1KQLA 3V5BA 3M0AA 1EQ7A 3P7KA 4N78D 1JTHA 3P32A 1JY2O 2MJZA 1URQD 2N1TC 3RL0D 5APWA 1URQB 3RL0B 5CCHA 1NTKK 3P8MC 5CMZA 3II6A 2XDJA 1KILD 4I6MC 3MIWA 3B8EB 5AW2B 1H88A 2GM4A 1LTTC 1KILA 3L4FA 3M9BA 1KILB 3V4QA 3I5CA 2OYHA 2OYHB 3L36A 1NTZK 5AVTB 4Y99C 3VP8A 3A3YB 2WTYA 3HD7C 1SQQK 1N7SC 4GT1A 1SFCC 5APQA 1KFNA 3HD7A 1M1JC 2R3CA 1JOCA 1VDFA 5AVUB 1IFIA 2KOGA 3HRNA 3V2QA 2O1KA 4HH2A 3N7NA 1L0NK 2FXMA 1MFZA 3VMYA 1H89A 3M91A 3VN0A 2YO2A 4AYCA 1IK9A 2H43A 1NHLA 2HYNA 1J1DB 4IFFA 2A45I 2POHA 2H7HA 1CZQA 1M7LA 3A7OA 3V2NA 3OAKA 2IFMA 4OH8B 3RK2C 2E42A 2BASA 5APXA 1SQBK 1GL2D 1LTAC 5BU5A 1GL2A 1GL2B 5AVQB 1MZ9A 3H32A 2KB7P 3H32B 1GU5A 2H8PD 1WT6A 4AQRD 3HTKB 2Z5IA 1JUNA 2ZFCA 5KJ7C 3L37A 1HWTC 1IO4A 4AUWA 1LWUA 1NTMK 2R32A 1LWUB 1A02J 2C9NY 1N73C 2HODA 1W2EA 1JCCA 1SQXK 2HODB 1JNMA 1DEBA 2XU6A 1JY2P 2Q7CA 5CCGA 3B5ND 4N6JA 1FU1A 1RF0A 1NKNA 1AFOA 1LTSC 1L4AC 1T8ZA 1SLQA 2P67A 3T97A 1LT9A 5AW1B 1PFIA 3VMZA 2HLOA 1LT9B 2PP6A 2QM7A 5APSA 1LTIC 3LIDA 4N3YB 1FZBA 2KSJA 2NPSD 1JY2N 4WY4D 1FZFA 1URQC 2NPSA 3RL0C 1HGZA 4WY4A 1N86A 2NPSB 3CL3D 5CCHC 1G1JA 1FJPA 3NTNA 4WY4B 2J59M 1KILC 2N9BA 5AW7B 1JMMA 1GZLA 5CJ0A 2YO3A 3LW5H 1ZR4A 1URQA 4DZOA 2OYHC 5AW3B 1NKZB 5AVSB 1IC2A 3MUDA 4I2LC 3L35A 3NXSA 2FFDA 2FFDB 3TK1A 3GHGA 2WPQA 2QM8A 3GHGB 3P8CE 4IFMA 2CPBA 4JYCA 1HUCA 5AVZB 3BATA 4JYBA 4C7NA 1NU1K 2R5DA 3M06A 1FZAA 3CI9A 4C7NB 1FOSE 1GW4A 1IFMA 2N1TD 1HH0A 4LC1A 1CI6A 4RESB 1NH4A 1CI6B 5APYA 1MV8A 1OWAA 1J1DC 2W6BA 1DX7A 2JEEA 2I1KA 5KTBA 4ZKUA 3TYYA 5AVVB 1AQ5A 1JCDA 1G1IA 5APVA 4KHXA 1J2JB 2GUVA 1FZCA 3VTPC 1H8AA 1FZCB 5AW5B 1VPCA 1YTZI 3HE5A 1N7SD 3MD0A 3HE5B 1GL2C 2HG5D 2CPSA 2WPSA 1A02F 1T2KD 5AW8B 3H6PA 1LTJA 3VYIA 1LTJB 1XTCC 2XZRA 1G2CA 2W6AA 2WWWA 2OYIA 1G2CB 2GUSA 5AW9B 2OYIB 5AVXB 3IR9A 3BASA 2OARA 3BVHA 3HTKA 4I1LA 1LWUC 3BRVB 2HPCA 2C0WA 3RK3D 2HPCB 4EIJA 3RK3B 2YKPA 5AVYB 2A45H 5CCGC 2PAJA 1NWQA 1ZN5A 1RF0C 5BVZA 3HUSA 1RF1A 1J1EB 3HUSB 4B86A 1LT9C 1RF1B 2KP8A 3M0DA 3VOPA 1GDTA 5AW4B 2O1JA 2ZXEB 3EFGA 1GD2E 1SVFA 1RE4A 3A2AA 3B5NA 3R2PA 1S9KE 3B5NB 4IFDK 1X8YA 1ZLLA 1QL1A 2WPRA 2NPSC 3CLQA 4W7ZA 4WY4C 1JY3P 1GU4A 2YNYA 4GKGA 3P8CD 1GTWA 3KYQA 5CHXA 2XNXA 1ZV8A 2WSEH 1QL2A 1WRGA 2O01H 1NO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y99 C;  1J1D B;  1YTZ I;  1J1E B;  1J1D C;  1YTZ T;  1J1E C;  4Y99 B; 
#chains in the Genus database with same CATH topology
 2M3B A;  4ASV A;  1ZR2 A;  1PGO A;  4ZMD A;  4HJG H;  2QVA A;  1BDD A;  2LXB A;  1RY3 A;  3EQ2 A;  4GIF A;  3MTU E;  1Q81 Q;  3L73 G;  1NTZ E;  2P1J A;  2QJY B;  1VQL P;  4OWF A;  4DOJ A;  3G3Z A;  1RQV A;  5CCH D;  1Z56 A;  1P84 E;  1U7M A;  4H0L C;  3A0H E;  3KPE A;  2FYU K;  1FOS F;  1HVV A;  2O01 N;  3WUU A;  3V4W A;  3A5T A;  2C0X A;  3PLN A;  1Y9B A;  3CC7 P;  1EDI A;  1GK6 A;  3H1H J;  4N78 E;  1AQT A;  1FDI A;  2ITA A;  3AE2 C;  1KV4 A;  3TNU B;  5AW6 B;  3HD7 D;  1LTJ C;  3L75 J;  3TGU G;  1SP4 A;  2WIT A;  1GMJ A;  1N7S A;  3NFQ A;  2OYI C;  2Q5U A;  2Z5H A;  3KQG A;  5TJH A;  1IJD B;  3BCC E;  1ZW0 A;  2WT7 A;  4RO0 A;  1X9V A;  1GW3 A;  2B9B A;  2ZT9 D;  3CPW O;  2K9Y A;  1PP9 G;  1LTB C;  4ASW A;  3GMA A;  3M9Q A;  2K88 A;  3AEF C;  1EC5 A;  3RK2 B;  2Q9I A;  1ZRT E;  4NPE A;  2QG4 A;  2IYP A;  2QJK C;  4D6T G;  1BCC E;  1JMB A;  4PD4 D;  3U1A A;  2KIK A;  1VQN P;  1S5L E;  3H1H D;  1MFT A;  5APT A;  2WPV B;  3AE3 C;  2J5U A;  2IPP A;  3L75 D;  3CX5 I;  1FJK A;  1NOH A;  1N73 A;  3V2R A;  4LLH A;  1FDO A;  1RE3 C;  1M90 Q;  1LTG C;  1K04 A;  3IFM A;  1P84 I;  2QA4 P;  4GOD A;  1ZME C;  1HJ0 A;  3V5B A;  4H44 B;  2FYU E;  4DT0 A;  1NTK K;  3P8M C;  2WSE J;  1PIX A;  2O01 J;  5AW2 B;  1H88 A;  2G3A A;  2GM4 A;  3L4F A;  3M9B A;  3I5C A;  3CXH D;  1PPJ E;  2UWJ E;  2PRR A;  3H1J E;  2IBZ I;  1BGY J;  2ZVO B;  4I7Z C;  3H1I E;  2WTY A;  3IAO A;  1BSH A;  3H1K J;  1SFC C;  2GA1 A;  3PTZ A;  2M5A B;  4YXW H;  1QGK B;  1FC2 C;  1JOC A;  1VDF A;  1IFI A;  1PZQ A;  4A7P A;  3L73 E;  2ZYG A;  2O1K A;  4HH2 A;  2FXM A;  3VMY A;  1KYO D;  2E74 B;  4AYC A;  1NHL A;  1J1D B;  3CCR P;  4WVZ A;  2JP3 A;  1OVV A;  3JSV C;  1BSN A;  5APX A;  2D2C D;  3SFD C;  1LTA C;  3AE5 C;  1MZ9 A;  2JWD A;  2JO1 A;  1YIJ P;  4TLF A;  1BGY D;  2AEF A;  1KQS O;  2ZFC A;  1S72 P;  4DCK A;  2AXT H;  3TF5 A;  3H1K D;  1SQX K;  1VF5 B;  1VQO P;  1DEB A;  4UB8 H;  1EZV G;  1SQQ G;  5CCG A;  3B5N D;  1FU1 A;  1RF0 A;  1BE3 E;  1L4A C;  3Q3D A;  1LT9 A;  1OIP A;  2PP6 A;  2BEZ F;  1LTI C;  3AEG C;  4BRY A;  1S3J A;  2NPS D;  1L0N G;  1FZF A;  1URQ C;  2NPS A;  1N86 A;  1FJP A;  4WY4 B;  5B66 H;  2J59 M;  1KIL C;  2KNC A;  1SQV J;  1NTK E;  1JMM A;  3D6Z A;  3LW5 H;  1URQ A;  4DZO A;  2OYH C;  1L0L J;  4D6T E;  4I2L C;  3L35 A;  3NXS A;  3G71 P;  2FFD A;  3MP7 B;  3TK1 A;  3L71 E;  3L72 E;  2QM8 A;  3CME P;  1Y8A A;  2KUB A;  3KZI H;  2KLU A;  4C7N A;  2CK3 H;  1NU1 K;  3CI9 A;  4U3F J;  1QLE D;  1HH0 A;  1NTM G;  2B89 A;  4H0L B;  5CBO A;  5B5E E;  3FWL A;  1NTZ J;  1OW7 A;  2V7Q J;  5APV A;  3F5H A;  1J2J B;  1FZC A;  1H8A A;  3GLM A;  1GL2 C;  1SQV D;  3L70 G;  1VQP P;  1LTJ B;  2Y0C A;  1G2C A;  1L0L D;  2OYI B;  3PJS K;  3HTK A;  4I1L A;  1Q86 Q;  4GOE A;  4EIJ A;  3H1L J;  1SQX E;  2A45 H;  4R4L A;  1QVF O;  4U3F D;  1SQB J;  4B86 A;  3M0D A;  2FY8 A;  4UB8 E;  2E5T A;  2ZXE B;  1GD2 E;  3CCQ P;  1U57 A;  4IFD K;  3CX5 D;  3GG2 A;  1NTZ D;  3FXD A;  3Q5P A;  1LP1 A;  3EWK A;  3G4S P;  2QJK B;  5CHX A;  2QJP C;  3CCM P;  1ZV8 A;  2KYV A;  3MUD C;  5GTI E;  5AVW B;  2Y9Z A;  1L0L K;  2L5G B;  3JC2 2;  3U59 A;  3M9H A;  2I8D A;  3D70 A;  2IX7 C;  4OVN F;  1KMI Z;  1SQP K;  1RH5 B;  1JY3 O;  1JO5 A;  2K1A A;  3WU2 H;  1NU1 E;  1SQQ E;  1LJ2 A;  3CWB J;  1P84 H;  2IBZ D;  3H1L D;  3BCC G;  1OFC X;  1SQB D;  3RBZ A;  2N1T A;  4PJ0 H;  1N2D C;  2KS1 A;  2B87 A;  3JCU E;  1H0T A;  1ZXG A;  1Q7Y Q;  4EYY Q;  3CCJ P;  2KLV A;  3GF7 A;  4I7Z B;  2R3S A;  2RH0 A;  1T2K C;  3G6E P;  2YKO A;  1KIL E;  1BCC G;  3LIE A;  4C46 A;  1KFM A;  3AE1 C;  2WSF H;  1SFC B;  4W80 A;  1K9M Q;  2P7J A;  1E5W A;  2E74 D;  1M1J A;  2XV5 A;  1S5L X;  3H1J J;  1EDJ A;  3S9O A;  3RK3 C;  1HGV A;  1N7L A;  4H13 C;  2IFN A;  1FAV A;  2OGU A;  1J1E C;  3U1C A;  2L91 A;  5KLV K;  3USS A;  2FYN C;  2VRS A;  5KAF E;  1RE4 C;  3L73 J;  3HE4 A;  2A06 D;  2ZVN B;  2Q3I A;  3O6Q B;  2FYU G;  3QH9 A;  5E79 E;  1HTL C;  2Y0E A;  3FXE A;  1PPJ G;  1XTG B;  5KJ7 D;  4L76 A;  3L70 E;  2OTL P;  3VMX A;  3AEC C;  3SWY A;  5KJ7 A;  1YHQ P;  2R5B A;  4O9B A;  3ITK A;  1GK4 A;  3H1I G;  1VQ4 P;  2KZJ A;  1FZE A;  3CC4 P;  3OJA B;  2BEQ D;  2YKQ A;  1EZV I;  1SQP E;  3AE8 C;  3H1J D;  4LGD E;  1L4A B;  3TGU J;  2Q1K A;  3CD6 P;  1CW5 A;  1YI2 P;  1W2B O;  1EQ7 A;  3P7K A;  2KZI A;  1JTH A;  2N9Y B;  3RL0 D;  3W68 A;  3WU2 E;  1URQ B;  5CCH A;  4K35 A;  3MIW A;  2M0B A;  3L73 D;  1KIL B;  1AVY A;  4PJ0 E;  2OYH B;  3L36 A;  3A0B E;  5AVT B;  4Y99 C;  1PP9 J;  1TU3 F;  3HD7 C;  4GDO A;  1N7S C;  4IL6 H;  4GT1 A;  2JWA A;  4GOF A;  2FXO A;  2W90 A;  5APQ A;  2E75 D;  3HD7 A;  1AV1 A;  1QX8 A;  3I56 P;  5AVU B;  2OTJ P;  4D6T J;  3V2Q A;  3GW6 A;  1MFZ A;  4XFJ A;  1OX3 A;  3KHU A;  3M91 A;  3VN0 A;  2H43 A;  2HYN A;  4U7J A;  1Q90 D;  2ZAE B;  1BE3 G;  2A45 I;  3TGU D;  5KLV E;  1DD3 A;  3CCE P;  3V2N A;  1IK7 A;  2IFM A;  4OH8 B;  4HKZ H;  4JQ0 D;  5BU5 A;  1VQ6 P;  1GL2 B;  3H32 B;  3Q5R A;  2H8P D;  1NTK G;  3HTK B;  1JUN A;  2LXC B;  1AVO A;  2RMZ A;  1JM0 A;  1YBK A;  1PP9 D;  3L37 A;  1IO4 A;  1LWU A;  1A02 J;  1NAY A;  1N73 C;  4NPF X;  4IOI H;  2HOD A;  3L71 G;  3L74 E;  4BWN A;  3L72 G;  1JNM A;  1R8E A;  4N6J A;  4D6T D;  1T8Z A;  1SLQ A;  3T97 A;  5AW1 B;  1PFI A;  2G8Y A;  3VMZ A;  2HLO A;  3LID A;  3RK3 E;  3CC2 P;  2YXR B;  1HGZ A;  1G1J A;  5H2F H;  1ZR4 A;  2QJP B;  2NRG A;  2SPZ A;  1IC2 A;  2QEX P;  1RQU A;  1KN7 A;  3GHG A;  3P8C E;  4PV1 D;  1KB9 D;  2JKV A;  2R5D A;  3M06 A;  2DW3 A;  1GW4 A;  3Q5S A;  4IL6 E;  3FGA D;  2E76 D;  4RES B;  1NH4 A;  1CI6 B;  1MV8 A;  1OWA A;  1SQX G;  2W6B A;  1DX7 A;  1ZOY C;  5B5E H;  2IZ1 A;  2JEE A;  1AQ5 A;  1JCD A;  1G1I A;  2LR2 A;  3B71 A;  1SQQ J;  3E7K A;  3MD0 A;  2D2C C;  3HE5 B;  1K73 Q;  2HG5 D;  2CPS A;  3CXH H;  5AW8 B;  3VYI A;  3IN6 A;  1EDK A;  2WWW A;  1L0N J;  2GUS A;  2JDI H;  2KXP B;  2ZXX A;  3IR9 A;  3BAS A;  3BVH A;  3BRV B;  3F89 A;  2HPC A;  2C0W A;  3RK3 B;  2PFX A;  4H13 B;  3AE6 C;  3KXD A;  5CCG C;  2PAJ A;  1NWQ A;  1RF0 C;  3HUS A;  3RGU A;  1RF1 A;  2Q3E A;  1J1E B;  1LT9 C;  2KP8 A;  1NU1 G;  1QEX A;  2O1J A;  2FYN B;  1SVF A;  3A2A A;  3B5N A;  3R2P A;  1W5C E;  2IZ0 A;  1ZLL A;  2WPR A;  1Y47 A;  2NPS C;  3CLQ A;  1NTM J;  1EZV D;  1SQQ D;  2OTK E;  3MHV A;  2WSE H;  2O01 H;  1NO4 A;  2BCC G;  5GTI H;  1NAF A;  1HJB A;  4CPG A;  5H2F E;  5TIS H;  2FFD C;  3PHL A;  1L0N D;  1T3U A;  1UIX A;  1DH3 A;  3H1H E;  1U7J A;  4W7Y A;  1PL5 A;  1IFP A;  5BU8 B;  1JTH B;  3L75 E;  4XE5 B;  3ABV C;  2AEJ A;  3JCU H;  1FZC C;  2W6J H;  1YYC A;  2A45 G;  1HF9 A;  3TNU A;  1YQ4 C;  1OXZ A;  4BXL A;  4Y99 B;  1NTM D;  5APU A;  1LNQ A;  2YMY A;  3HD7 B;  1CSB A;  1VQK P;  1N7S B;  2Z4E A;  4NPD A;  1K8A Q;  3CXH E;  2I1J A;  2RN0 A;  2FYZ A;  1S9K D;  5AW0 B;  1NVO A;  1D7M A;  2WT7 B;  2HR3 A;  3C9I A;  3L70 D;  1SQP G;  3M0D C;  5KAF H;  1HBW A;  4JPZ B;  3KDP B;  3RK2 D;  3B4S A;  3UIA A;  1KZU B;  1KYO E;  2LKM A;  4EOT A;  2C9L Y;  2K9J A;  2E43 A;  1OW6 A;  1MUU A;  5E79 H;  3BCC J;  2HFE D;  2W27 A;  2FKW B;  3N4X A;  3TSI A;  5M1B A;  1OVU A;  1SQV K;  2YIU C;  1P84 D;  3MGN A;  3OA7 A;  1N73 B;  4YXD C;  3BRT B;  2WSC H;  3PH0 A;  5TIS E;  1PV3 A;  1BGY E;  2P2U A;  1USD A;  3SWF A;  1BCC J;  4WB4 A;  5KAI H;  3AE7 C;  1KQL A;  4H44 D;  5KKZ C;  3M0A A;  4N78 D;  3H1K E;  1R5S A;  2MJZ A;  2N1T C;  5APW A;  2XDJ A;  4I6M C;  5KLV G;  1KC8 Q;  2V7Q H;  3A0B H;  1E79 H;  1NTZ K;  1DEE G;  5K5G B;  1Q2N A;  2BCC E;  3BCC D;  3A3Y B;  4HB1 A;  3CXH I;  2M5A A;  4RKU J;  1AJY A;  2FYU J;  1M1J C;  3HRN A;  2K37 A;  3N7N A;  2WVR A;  3L74 G;  1ZRT D;  2E5Y A;  4R4M A;  1PGJ A;  1DIP A;  3H1I J;  1FS0 E;  1S2E A;  1BCC D;  2H7H A;  1CZQ A;  1M7L A;  3A7O A;  3OAK A;  2AXC A;  3Q1M A;  1KYO I;  3MZW B;  3L74 D;  2E42 A;  2BAS A;  1SQB K;  1YJN P;  3CWB G;  1VQ9 P;  2D2C B;  5AVQ B;  4MN4 C;  3WUV A;  4UB6 E;  1WMK A;  1GU5 A;  1WT6 A;  4Z1M H;  4AQR D;  4OGQ C;  2Z5I A;  4H13 D;  5KJ7 C;  1HWT C;  1VF5 D;  2R32 A;  2C9N Y;  2XU6 A;  3SWK A;  2FYU D;  1VQ7 P;  1L0L E;  1NKN A;  3CCL P;  1AFO A;  1NJI Q;  1LTS C;  1Q82 Q;  2P67 A;  1LT9 B;  1PPJ D;  1PGP A;  2QM7 A;  3S4R A;  4BRY B;  4IL6 X;  1JY2 N;  3H1I D;  4WY4 D;  3RL0 C;  4WY4 A;  2NPS B;  3EFF K;  5CCH C;  1LT1 A;  5KAI E;  4U3F E;  2KNC B;  2YO3 A;  5GTH H;  5AW3 B;  1NKZ B;  5AVS B;  1BE3 J;  3CX5 E;  2OYO A;  2FFD B;  2CPB A;  4JYC A;  1HUC A;  3BAT A;  2JR8 A;  3TDK A;  4JYB A;  2E75 C;  3RL0 g;  4C7N B;  5DJU B;  2RKL A;  3CCS P;  1NTK J;  4H0L D;  5APY A;  2I1K A;  5KTB A;  2FBW C;  4ZKU A;  1KTM A;  1X22 A;  2OQQ A;  3L71 J;  3L72 J;  3VTP C;  3AE9 C;  1FZC B;  2IBZ E;  2ZYD A;  1N7S D;  2ZT9 C;  2QRX A;  3H1L E;  2B88 A;  1SQB E;  3CCU P;  1LTJ A;  1SS1 A;  2OYI A;  1G2C B;  1BE3 D;  5AW9 B;  2P10 A;  5CBN A;  2OAR A;  1LWU C;  2W83 C;  3SFE C;  2YKP A;  3IF4 A;  5AVY B;  1UII A;  2O3J A;  1VQ5 P;  1K05 A;  1ZN5 A;  5BVZ A;  3H1H G;  1NTK D;  1GDT A;  5AW4 B;  3L75 G;  1X8Y A;  2K9J B;  4W7Z A;  3L71 D;  2YNY A;  3L72 D;  1LP1 B;  3KYQ A;  3CWB E;  5EFW B;  1QL2 A;  1SQX J;  1WRG A;  2WZ7 A;  2A06 E;  1FDM A;  2FXP A;  1JY3 N;  4WBA A;  1VQ8 P;  5GTH E;  3GHG C;  1M57 D;  2YIU B;  3WMM 0;  3FWN A;  4PD4 H;  1RE3 A;  1YTZ T;  4PV1 C;  2QIW A;  1M56 D;  1T3J A;  2YMK A;  3ZDM A;  3AEA C;  3O8Z A;  1YJ9 P;  3R4Y A;  1KD1 Q;  4ZKP A;  2M8R A;  2E76 C;  4RJT A;  2KSE A;  5KKZ B;  4HYT B;  5AVR B;  2N1T B;  3CMA P;  2XKM A;  3LW5 J;  3QWO C;  3VP9 A;  2KS1 B;  1IFN A;  2B87 B;  4Y28 J;  1H0T B;  1PGQ A;  2J58 A;  1QVG O;  5KLI C;  3AEB C;  5DJT B;  2Y9Y A;  1NU1 J;  3V6I A;  1OMI A;  2JJL A;  5CJ4 A;  3G9R A;  1SQX D;  1SFC D;  3E1R A;  3D6Y A;  4KJM A;  1SFC A;  3V2P A;  1FE6 A;  3WUT A;  1KQF B;  2Y0D A;  4JF7 A;  4M3L A;  2MKV A;  4DJG A;  3H25 A;  1M1J B;  1KB9 H;  1MKM A;  3W67 A;  2BCC J;  4XA4 A;  2XND H;  3SSU A;  1JB0 J;  1OZH A;  4YPC A;  1AA0 A;  3HUS C;  1RF1 C;  1BGY G;  1OVR A;  1LGH B;  3OW2 O;  1IFD A;  2V4H A;  1X79 B;  3E1I A;  3B5N C;  3HE4 B;  3H1K G;  3O6Q A;  1KYO H;  2ZJS E;  1KOR A;  2AEM A;  4WWI A;  1BDC A;  3TGU E;  4K3A A;  4L75 A;  4C7R A;  4OGQ B;  1NU1 D;  1IFJ A;  5CCG D;  3NMD A;  1FZG A;  1L2P A;  1FBM A;  1EXJ A;  1NGM B;  2QJY C;  5C39 A;  1L4A D;  3Q2Y A;  1L4A A;  1PP9 E;  3AE4 C;  3PP5 A;  4PD4 E;  2BCC D;  2IDB A;  3AEE C;  2P58 A;  3L70 J;  2PGD A;  1DD4 A;  3GF3 A;  3P32 A;  3RBX A;  1JY2 O;  1URQ D;  1KQG B;  3RL0 B;  5CMZ A;  3II6 A;  3C1L A;  1KIL D;  3B8E B;  1LTT C;  4ZNC A;  1KIL A;  3V4Q A;  2OYH A;  3S1K A;  2WSC J;  1SQP J;  2H88 C;  3VP8 A;  1X0T A;  1SQQ K;  1KFN A;  2E75 B;  2R3C A;  2KOG A;  2KK7 A;  1L0N K;  1SQV G;  1N8R Q;  1H89 A;  1VL2 A;  2YO2 A;  1IK9 A;  1L0L G;  4IFF A;  1KB9 E;  2POH A;  2WQY C;  4KT0 J;  5L8R J;  3D71 A;  3RK2 C;  1GL2 D;  2KI7 B;  1ZP0 C;  4L73 A;  1GL2 A;  2ZT9 B;  1VQM P;  4UB6 H;  2WSF J;  3H32 A;  4U3F G;  2KB7 P;  1T6A A;  1SQP D;  2M3E A;  1YQ3 C;  3PRJ A;  1OW8 A;  2K3R A;  4AUW A;  1NTM K;  1LWU B;  5KLV J;  2H89 C;  1NTZ G;  2AXT E;  1W2E A;  1JCC A;  4TT3 H;  2HOD B;  1JY2 P;  2Q7C A;  4PD4 I;  1EXI A;  4EDF A;  4L74 A;  3T97 B;  5APS A;  4N3Y B;  4H44 C;  1FZB A;  2KSJ A;  3CCV P;  1S4X A;  3CL3 D;  3C8V A;  3NTN A;  1EDL A;  2W8Z A;  5B66 E;  2N9B A;  3L74 J;  1YIT P;  5AW7 B;  1GZL A;  5CJ0 A;  2IBZ G;  2YXQ B;  4QMA A;  3MUD A;  3CX5 H;  3H1L G;  1SQB G;  1USE A;  2WPQ A;  3GHG B;  4IFM A;  2WMM A;  1EZV E;  1RHZ B;  5AVZ B;  4JBZ A;  3KZI E;  4PV1 B;  1FZA A;  1FOS E;  3A0H H;  5KLV D;  1IFM A;  2N1T D;  4LC1 A;  1CI6 A;  2E74 C;  1KB9 I;  2E76 B;  1J1D C;  1L0N E;  4YTP C;  2Q6Q A;  4EI2 A;  3TYY A;  5AVV B;  2IYO A;  4KHX A;  2GUV A;  2R44 A;  1IZN B;  3AED C;  5AW5 B;  1VPC A;  1YTZ I;  3HE5 A;  5KLI B;  1M1K Q;  3FX0 A;  2WPS A;  1A02 F;  1T2K D;  3H6P A;  2WSS H;  1XTC C;  2XZR A;  1M8O B;  2W6A A;  1YJW P;  5AVX B;  2QSI A;  2A06 G;  1VF5 C;  3RK3 D;  2HPC B;  1NTM E;  3CWB D;  1R5L A;  1JEK A;  1NYH A;  3I55 P;  1SQV E;  3HUS B;  2ZYA A;  3K5B A;  1RF1 B;  3VMA A;  3VOP A;  3EFG A;  1RE4 A;  1S9K E;  1S1C X;  3B5N B;  1QL1 A;  4OGQ D;  1S5L H;  4WY4 C;  1JY3 P;  1GU4 A;  2NZ2 A;  4GKG A;  3P8C D;  1GTW A;  3H1J G;  2XNX A;  2QE7 H; 
#chains in the Genus database with same CATH homology
 2KYV A;  2M3B A;  1NAF A;  2WZ7 A;  5AVW B;  1L0L K;  2L5G B;  3U59 A;  1ZR2 A;  1HJB A;  1FDM A;  3M9H A;  1JY3 N;  4WBA A;  2FFD C;  3GHG C;  2IX7 C;  1RY3 A;  3WMM 0;  3EQ2 A;  1SQP K;  1T3U A;  4GIF A;  3MTU E;  1RE3 A;  1JY3 O;  1YTZ T;  1JO5 A;  1DH3 A;  2P1J A;  1T3J A;  3O8Z A;  4W7Y A;  4DOJ A;  3G3Z A;  5BU8 B;  1JTH B;  4ZKP A;  2M8R A;  5CCH D;  1Z56 A;  3KPE A;  2FYU K;  1FOS F;  4XE5 B;  1HVV A;  4HYT B;  2N1T A;  5AVR B;  2N1T B;  2XKM A;  3V4W A;  3A5T A;  2C0X A;  1N2D C;  3VP9 A;  1FZC C;  1YYC A;  1IFN A;  2A45 G;  2J58 A;  1GK6 A;  2KLV A;  4N78 E;  3TNU A;  1OXZ A;  2JJL A;  4Y99 B;  5CJ4 A;  3TNU B;  5APU A;  3HD7 D;  1LTJ C;  5AW6 B;  1T2K C;  2YKO A;  1SP4 A;  2WIT A;  2YMY A;  1SFC D;  3LIE A;  3HD7 B;  1CSB A;  4C46 A;  1N7S A;  1KFM A;  3NFQ A;  2OYI C;  1SFC A;  1N7S B;  2WSF H;  2Z4E A;  3V2P A;  1SFC B;  4W80 A;  2P7J A;  1E5W A;  2Q5U A;  2Z5H A;  4JF7 A;  4M3L A;  2I1J A;  1M1J A;  2XV5 A;  3KQG A;  1M1J B;  2FYZ A;  1S9K D;  5AW0 B;  3RK3 C;  1HGV A;  1N7L A;  1IJD B;  2WT7 A;  4XA4 A;  2WT7 B;  2IFN A;  1X9V A;  3C9I A;  1FAV A;  1J1E C;  3HUS C;  1GW3 A;  3U1C A;  1RF1 C;  5KLV K;  1LGH B;  3M0D C;  1IFD A;  1HBW A;  2VRS A;  1LTB C;  1X79 B;  3E1I A;  3KDP B;  1RE4 C;  3RK2 D;  3B5N C;  3M9Q A;  3HE4 A;  3UIA A;  3HE4 B;  3RK2 B;  2Q9I A;  2Q3I A;  1KZU B;  2LKM A;  4EOT A;  2C9L Y;  2E43 A;  1MUU A;  2HFE D;  3U1A A;  1HTL C;  2FKW B;  2W27 A;  3N4X A;  3TSI A;  4C7R A;  1XTG B;  5KJ7 D;  3VMX A;  5APT A;  3SWY A;  5KJ7 A;  2R5B A;  4O9B A;  1IFJ A;  1GK4 A;  5CCG D;  2IPP A;  1FJK A;  1SQV K;  3NMD A;  1NOH A;  1FZE A;  1FZG A;  3OJA B;  3MGN A;  1N73 A;  3V2R A;  3OA7 A;  1N73 B;  4LLH A;  1FBM A;  3BRT B;  2YKQ A;  1RE3 C;  2WSC H;  1LTG C;  1L4A D;  3IFM A;  2P2U A;  1L4A A;  4LGD E;  3SWF A;  3PP5 A;  1L4A B;  1CW5 A;  4WB4 A;  1KQL A;  3V5B A;  3M0A A;  1EQ7 A;  3P7K A;  4N78 D;  1JTH A;  3P32 A;  1JY2 O;  2MJZ A;  1URQ D;  2N1T C;  3RL0 D;  5APW A;  1URQ B;  3RL0 B;  5CCH A;  1NTK K;  3P8M C;  5CMZ A;  3II6 A;  2XDJ A;  1KIL D;  4I6M C;  3MIW A;  3B8E B;  5AW2 B;  1H88 A;  2GM4 A;  1LTT C;  1KIL A;  3L4F A;  3M9B A;  1KIL B;  3V4Q A;  3I5C A;  2OYH A;  2OYH B;  3L36 A;  1NTZ K;  5AVT B;  4Y99 C;  3VP8 A;  3A3Y B;  2WTY A;  3HD7 C;  1SQQ K;  1N7S C;  4GT1 A;  1SFC C;  5APQ A;  1KFN A;  3HD7 A;  1M1J C;  2R3C A;  1JOC A;  1VDF A;  5AVU B;  1IFI A;  2KOG A;  3HRN A;  3V2Q A;  2O1K A;  4HH2 A;  3N7N A;  1L0N K;  2FXM A;  1MFZ A;  3VMY A;  1H89 A;  3M91 A;  3VN0 A;  2YO2 A;  4AYC A;  1IK9 A;  2H43 A;  1NHL A;  2HYN A;  1J1D B;  4IFF A;  2A45 I;  2POH A;  2H7H A;  1CZQ A;  1M7L A;  3A7O A;  3V2N A;  3OAK A;  2IFM A;  4OH8 B;  3RK2 C;  2E42 A;  2BAS A;  5APX A;  1SQB K;  1GL2 D;  1LTA C;  5BU5 A;  1GL2 A;  1GL2 B;  5AVQ B;  1MZ9 A;  3H32 A;  2KB7 P;  3H32 B;  1GU5 A;  2H8P D;  1WT6 A;  4AQR D;  3HTK B;  2Z5I A;  1JUN A;  2ZFC A;  5KJ7 C;  3L37 A;  1HWT C;  1IO4 A;  4AUW A;  1LWU A;  1NTM K;  2R32 A;  1LWU B;  1A02 J;  2C9N Y;  1N73 C;  2HOD A;  1W2E A;  1JCC A;  1SQX K;  2HOD B;  1JNM A;  1DEB A;  2XU6 A;  1JY2 P;  2Q7C A;  5CCG A;  3B5N D;  4N6J A;  1FU1 A;  1RF0 A;  1NKN A;  1AFO A;  1LTS C;  1L4A C;  1T8Z A;  1SLQ A;  2P67 A;  3T97 A;  1LT9 A;  5AW1 B;  1PFI A;  3VMZ A;  2HLO A;  1LT9 B;  2PP6 A;  2QM7 A;  5APS A;  1LTI C;  3LID A;  4N3Y B;  1FZB A;  2KSJ A;  2NPS D;  1JY2 N;  4WY4 D;  1FZF A;  1URQ C;  2NPS A;  3RL0 C;  1HGZ A;  4WY4 A;  1N86 A;  2NPS B;  3CL3 D;  5CCH C;  1G1J A;  1FJP A;  3NTN A;  4WY4 B;  2J59 M;  1KIL C;  2N9B A;  5AW7 B;  1JMM A;  1GZL A;  5CJ0 A;  2YO3 A;  3LW5 H;  1ZR4 A;  1URQ A;  4DZO A;  2OYH C;  5AW3 B;  1NKZ B;  5AVS B;  1IC2 A;  3MUD A;  4I2L C;  3L35 A;  3NXS A;  2FFD A;  2FFD B;  3TK1 A;  3GHG A;  2WPQ A;  2QM8 A;  3GHG B;  3P8C E;  4IFM A;  2CPB A;  4JYC A;  1HUC A;  5AVZ B;  3BAT A;  4JYB A;  4C7N A;  1NU1 K;  2R5D A;  3M06 A;  1FZA A;  3CI9 A;  4C7N B;  1FOS E;  1GW4 A;  1IFM A;  2N1T D;  1HH0 A;  4LC1 A;  1CI6 A;  4RES B;  1NH4 A;  1CI6 B;  5APY A;  1MV8 A;  1OWA A;  1J1D C;  2W6B A;  1DX7 A;  2JEE A;  2I1K A;  5KTB A;  4ZKU A;  3TYY A;  5AVV B;  1AQ5 A;  1JCD A;  1G1I A;  5APV A;  4KHX A;  1J2J B;  2GUV A;  1FZC A;  3VTP C;  1H8A A;  1FZC B;  5AW5 B;  1VPC A;  1YTZ I;  3HE5 A;  1N7S D;  3MD0 A;  3HE5 B;  1GL2 C;  2HG5 D;  2CPS A;  2WPS A;  1A02 F;  1T2K D;  5AW8 B;  3H6P A;  1LTJ A;  3VYI A;  1LTJ B;  1XTC C;  2XZR A;  1G2C A;  2W6A A;  2WWW A;  2OYI A;  1G2C B;  2GUS A;  5AW9 B;  2OYI B;  5AVX B;  3IR9 A;  3BAS A;  2OAR A;  3BVH A;  3HTK A;  4I1L A;  1LWU C;  3BRV B;  2HPC A;  2C0W A;  3RK3 D;  2HPC B;  4EIJ A;  3RK3 B;  2YKP A;  5AVY B;  2A45 H;  5CCG C;  2PAJ A;  1NWQ A;  1ZN5 A;  1RF0 C;  5BVZ A;  3HUS A;  1RF1 A;  1J1E B;  3HUS B;  4B86 A;  1LT9 C;  1RF1 B;  2KP8 A;  3M0D A;  3VOP A;  1GDT A;  5AW4 B;  2O1J A;  2ZXE B;  3EFG A;  1GD2 E;  1SVF A;  1RE4 A;  3A2A A;  3B5N A;  3R2P A;  1S9K E;  3B5N B;  4IFD K;  1X8Y A;  1ZLL A;  1QL1 A;  2WPR A;  2NPS C;  3CLQ A;  4W7Z A;  4WY4 C;  1JY3 P;  1GU4 A;  2YNY A;  4GKG A;  3P8C D;  1GTW A;  3KYQ A;  5CHX A;  2XNX A;  1ZV8 A;  2WSE H;  1QL2 A;  1WRG A;  2O01 H;  1NO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...