4XE5B

Crystal structure of the na,k-atpase from bovine
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
281
structure length
281
Chain Sequence
SEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEIAFRPNDPKSYMTYVDNIDNFLKKYRDSAQKDDMIFEDCGNVPSELKDRGELNNEQGERKVCRFKLEWLGNCSGINDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVQCTGKRDEDKEKVGSIEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
publication title Isolation, crystallization and crystal structure determination of bovine kidney Na(+),K(+)-ATPase.
pubmed doi rcsb
total genus 42
structure length 281
sequence length 281
ec nomenclature
pdb deposition date 2014-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4xe5B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 4xe5B02
1GU5A 4C7NB 2E43A 3V4QA 2Z5HA 3M0AA 4GKGA 1T2KD 3A7OA 3HE5A 4LC1A 4AUWA 3A3YB 2XU6A 5AW7B 1H88A 1GU4A 3P7KA 1HJBA 4B86A 1CI6A 2BASA 4JYCA 2XV5A 3LIDA 4C46A 3B8EB 1MUUA 2YO3A 4AYCA 3HE4A 5APQA 5AVYB 5AW2B 1FOSF 1JUNA 2QM8A 1FAVA 1G2CB 3V4WA 3LIEA 5AVZB 5AVVB 1IO4A 1KQLA 3O8ZA 3TK1A 1HUCA 3NXSA 1H8AA 2XZRA 4M3LA 5AW0B 1NAFA 1CZQA 2C9NY 3HTKA 3NTNA 2IPPA 4GT1A 3VN0A 3UIAA 5APYA 1GTWA 3L35A 2P2UA 4AQRD 2R5DA 3M91A 2WPRA 2WPQA 2WPSA 2WT7A 1SP4A 5AW8B 2R5BA 5AW1B 4C7NA 5AVUB 3L36A 4I6MC 5AVRB 5APWA 3KQGA 4XE5B 2R3CA 1J2JB 1T2KC 3M06A 5APXA 2WT7B 1GK6A 3A5TA 1FOSE 3VMZA 1OXZA 3P8MC 2P67A 3TYYA 4KHXA 2QM7A 5AW4B 1GZLA 2E42A 3MD0A 5AVWB 1A02F 4RETB 2W27A 1SLQA 2WWWA 4HYTB 1H89A 5APVA 1OWAA 4JYBA 3T97A 4EOTA 5AVSB 3I5CA 1S9KD 2C9LY 2YO2A 3NMDA 3M0DA 3V5BA 2R32A 3P32A 1JNMA 2JJLA 3VMYA 2KP8A 4DZOA 5AVXB 3HE5B 2VRSA 1GD2E 1A02J 3TNUB 1CI6B 2P7JA 3VTPC 5APUA 3VYIA 3MGNA 2YNYA 1X8YA 1NWQA 3L37A 3NFQA 3HE4B 3KDPB 3OAKA 4RESB 5CMZA 5APSA 3TNUA 1HWTC 5AW9B 3IR9A 5AW3B 1GK4A 2N9BA 2ZXEB 2ZFCA 3M9BA 2Q3IA 2Q5UA 2W6AA 2WTYA 1YYCA 1CSBA 5AVTB 3WGVB 5AVQB 1S9KE 2Q7CA 1MV8A 2H7HA 1HBWA 5APTA 2Z5IA 3M9HA 3SWFA 3WGUB 4I2LC 3A2AA 1DH3A 5AW5B 5AW6B 1MFZA 3VMXA
chains in the Genus database with same CATH superfamily
4UYQA 2G8YA 4GG6A 4W4NA 2H6OA 4HU2A 1MJUL 3FTZA 1KTKE 4XH2A 4HQQL 1H15B 4L8BA 4FKHA 4FFZA 5ADPH 5C97A 3A7OA 1NMCB 3S7GA 4E41A 3D71A 4QRAA 2Z8SA 3BW9B 4TSCL 4YMPA 4NEHB 1GKEA 3O45A 4WCYL 2F5BH 2WYZA 3LIDA 1KJMB 5IBUB 3RWDB 1AKPA 4PI2A 5D71H 1QSFA 2IAAC 4EBQL 1IEBB 2VN7A 2AJUL 2WP3T 4KK6D 2NXZB 1U2YA 3TCLA 5BJTA 1CLZH 1YJDH 2J4WH 1QFWL 1TFPA 3G4SP 2C1OA 2J1ZA 3BFQG 2UYLA 3IJSB 3EHBB 5G4OA 1BOGA 3QR2A 2W94A 4F7TA 4AIXA 1HSAB 2D4DA 3HMXH 4P2RE 4WW2B 1L7IL 5E79E 2ICWA 2YEZA 3E7KA 4Y4KC 4G6ML 3O6MH 4OGQC 2F2HA 2EIDA 3I6LE 2BSBA 3OM3B 5DFWH 3T71A 5KYYB 4LP4A 3H1KJ 2P8LB 2H0EA 4UMGA 4P5TA 5FXCH 4E9RA 3B71A 1BFTA 1PGOA 1KYDA 2UZYB 5JR1H 1G7MA 4HG4K 3WFZA 3CC4P 5E8EB 1ZT4B 3TZVB 4TLTA 1IFPA 5D7IB 3MRJB 4KMTH 4MZ2A 3WXVL 1ML0A 3MSPA 2YQBA 5CEXB 3BSGA 2Q8AH 1A3RL 1BXUA 1J88A 1EEZB 2XNXA 4JY5H 1BG1A 2VR8A 2ZYHA 1JOCA 4EVNB 1W5CE 1JGEA 3CXHD 4NLHA 4YSAA 1SY6A 1E3ZA 3KPOA 4IKNA 4PRIA 5T1KA 2WWWA 3RA7H 3VXUA 2X44D 4QRBA 1P7BA 4YX2L 5CCHA 5DJ6A 2AK4A 1KIPA 3BKJH 4KGLA 3STLB 1RIVL 2DLFL 5IQMA 4MCZB 5E08L 1FNEB 4U1SB 4YWGL 3LS5H 4H0LB 1FI8C 4GBXA 2JJTC 1PLCA 4AM0Q 5CJ8A 1S9WA 2H0PA 2VW7A 2KIKA 3CVHH 2Z1KA 5KBMA 1WC7A 4ZUUA 5FUOL 2V7QJ 4ZNCA 1I1AB 2A4ZA 1KJ2H 2IADB 4K71B 2EXSA 4MKMA 2HN7A 2YIHA 3TA3B 4U1JB 3MGNA 5F7NC 4YLQT 1YUHB 3QP3A 2F53D 2W9LA 3EJSA 4NOBA 5DHMC 4JBSA 3V7AG 2GI0A 1U91A 2ZUWA 4LVOB 3IJHA 3WIHH 1BMWA 5CLZA 3VP8A 3RWJA 3O2WL 3K5SA 5FC9A 4L3CA 1W72A 4ODHL 1RJZA 4D9QE 2Q3EA 4OJAA 1VEOA 5ETUA 3NA9H 3A6BL 3NFSL 5F71A 4JPZB 3MUDA 3B3IB 3BPOB 3CFJB 1I8IA 3D0LA 3H4FA 4QR7A 5E6ZA 3HLAB 3M7FB 4QO1B 3RIAK 5JA9A 1KLGB 5JHDD 3ZZLA 1J1PH 4OLEA 1CLOH 2X89D 2YGPA 4MD4B 3BIAX 1EANA 2B2XL 2R39A 2CLVB 1WE5A 1BGXL 1SBBA 3KBHE 2WSSH 4O2EB 4WUKH 3TT1L 2EIZA 2PWFA 1AO7E 1O6SB 2K6ZA 3JC22 2YD0A 1PTZA 4J27A 4NZRL 1XF5A 1AZRA 1LEKB 4KJWD 4CC4A 1VEMA 2YBRA 5KAFH 1T5WB 4C56B 3JYCA 2ZE0A 4Z76B 5I0WA 4XPBH 1BZ9B 1QNZH 1MNNA 3MLVH 5ISZB 2RMNA 4GH7B 4HF5L 3SDXE 2N9YB 3P8CE 4YAQB 3S5LA 2FLRT 2YRZA 5E8DL 1NLDL 1SJXA 3CNKA 4ALAH 3IU4H 5EZPA 2Z91B 2D2CC 3BVNB 2WWKO 1NH4A 1URIA 2NUPB 3W56A 3CLFL 4Y5YA 4JFQB 4LBAA 1YEDA 4PLKD 5D2LE 5EN2A 2Q1KA 1A7QL 2CJSA 2QHRH 1KILD 3CVDA 5KBNC 4JZJC 5APWA 2W0KA 3ESUF 1SEBA 3MXVL 2PPFA 2ZVNB 2AZUA 2DW5A 5CFAA 2EYTB 2PN5A 1QR4A 4H8HA 4N2AA 5APXA 1QATA 3BVXA 1OP9A 1UGNA 3MCYA 4X7TB 3P0YL 3ZL2A 4HWBA 5GRJH 3VH8B 3GHBL 3OQRA 1FNFA 4U0RC 4FULA 4WHTB 3OR6B 4HIHB 1M57B 1UM5H 1UWEH 1KB3A 1VFUA 1A64A 2CHWA 2G9KA 1RK0B 2V4LA 4AGMA 3EDDA 2EAEA 5B39A 3FYEB 5EBMB 3UTPE 3HHRB 4XBEH 3GMPB 5ANMB 2J71A 2CHDA 2G3AA 1E3XA 1HDMA 3CSYA 3BEVB 3Q6FB 1IFHL 3L3DA 1UACH 2L7EA 4TUOA 1LILA 4N0UA 2LU3A 2ZCKH 4NQED 2GKIA 3F83A 3UTTD 2EVIA 3SDDA 2VIRA 4MBRA 1BVNP 3X1EA 2JXMA 1VGEH 2IWGA 3BQUA 3TJEL 1NTZJ 1OSZA 1RJYA 4GP8B 5J8OA 5EPMA 3FTGB 3GGWA 5F70A 4XP4H 5KUMA 3RY4A 2EADA 1QFOA 4RGMB 1BZ8A 5DURD 3SE9H 1IBGH 5G4MA 4YHYC 4P05A 5IVOA 5I5RA 1BJ1H 4Z0BL 5DLML 1AE6L 2CPCA 4MDJB 1HIML 1QGKB 3S2CA 2JJVA 4Y16B 5E6UB 3VGAC 3PP4H 4M61B 1DQDH 1K5NA 4PJCA 5CO1A 4PGDA 4AM0B 1L7TL 2C0WA 3T6XA 3S9OA 2G9HB 3MN8A 5LQBL 3SQOH 5BCAA 1KCRL 3IWUA 1MAML 2YKPA 4ZPTB 2R3SA 3VP9A 5LGYA 1ZPUA 4YHPB 1MHPH 2A9DA 2Y5TB 3QIUA 5AL0A 3DJZA 4JKKA 2Z5HA 3M0AA 1KG0B 4K9EH 4TRPH 2ZXBA 3C2AH 4S11A 5GSVB 3PWLA 4M6NH 5SWZE 1JFQL 2BHYA 4HJJH 4A63A 1G6RA 2XU6A 4DN3L 1PPIA 4YOKA 3ZQXA 1W6LA 5L6YH 2Q8BH 4I18A 1N59B 3EDFA 1QO3A 4MNGE 5I1DB 1T3UA 1MWAH 1XGPB 3KPSA 1HINH 2PW1B 1A02N 2HLFC 1QSEE 2E86A 5DMKB 4LDEB 4YVUA 2N4IA 1HYSC 1EZVE 3IF4A 5TE7H 4G9FA 3A24A 1DVFB 3LRSA 4EIBA 4Z0XB 3U7YL 3WJJC 4L3FA 1UM4H 2DJUA 4ZOCA 4G7VL 4GO8A 1JF1B 4H2CA 2EUZA 2IBZI 4MXVE 5DC4B 1MW3A 3GSVB 4JE4B 3WO4C 2IPUK 4UDUB 3ZMRA 4JHZA 3CHQA 4N9GA 1AXIB 5J5EA 4LK4A 4JM4L 5FEBA 1XGQA 3G6EP 3U4BH 5EEYA 2E7HA 1WJ3A 2W60A 3UAEA 3UJIL 2HJLB 1MIEH 4RFNC 1RZPA 3SBWA 3T9WA 3QUYD 5A2CA 5KSAA 1MNUH 2VW6A 1H6EA 3HC2A 1FGNL 3MQIA 4PVNA 5IWLA 4LL9A 1IVTA 5CZXC 2FY8A 4JFFE 1YNKL 3P8MC 1AHKA 1IUZA 2QZ5A 1CB4A 1HE7A 3DHJA 3GXFA 4DGUA 1AGFB 4KHXA 5FDYA 4IMKA 3FBKA 3TPKA 1P5UB 4F9LA 3WU2E 2FEEL 2JCCA 2PXYB 4JNXA 1INDH 4Q9BA 3GMOB 5F3FA 2JB5H 5FDWB 3VFPA 3C6SA 3BD5A 4X6EB 2XBTA 5D4IA 4LLAA 3WKMH 2BOBB 4KJPD 3SE4C 5AVSB 3RTQD 4D0DA 5KN5B 4ZOEA 5JIHA 2I69A 3IRPX 4N6RB 4U1GC 5CN1A 3QXTA 3R06A 1P7QB 2YUXA 2IDFA 3Q44A 4XOBA 3MRDA 1TTAA 4JG0H 2A74A 1QL2A 4TNWF 1KFAL 1X5GA 5E1GA 4KNTA 3WFBH 4OAWA 3SO3C 3L74D 4NXSA 3BAWA 2CKNA 4QD2E 1FFOB 5AB0A 4TOYL 4G8IB 2Y7QB 3X2QB 1HT6A 3APCA 3LV3A 5FM5O 4FQIH 2OW6A 4G70B 4N8CH 3T65B 3C6LA 1PFIA 4PJEE 4FQ1L 4XB8A 3LHPL 2CM5A 4O02L 3LW5J 2PO6B 2VR9A 1GAFL 1OALA 3F00A 4PRAA 2Y06H 4AW4A 5HDBB 2DMKA 3OKMB 2EACA 4NC0B 2FCBA 3K2KA 5D7IE 1NTKD 5E8NB 3VE0A 1MPAL 3RAJL 3KZIE 2NSMA 1XF4B 1XL6A 4NERA 1RSYA 3CG8A 4RWYL 1OOAA 4BUQA 4ZUWB 4R7NB 3MOBH 1MHEA 3FSWA 2NPLX 1NANI 2D31B 4AIOA 3HE7D 4KJYA 4M1DL 4F58H 1CD9B 1PEZA 3HE6C 3PAVA 4MA3B 4PTTA 1QLFA 5GGTL 4H44D 1R34A 3EJCA 2AQSA 3NH7H 3UACA 3S1KA 3LRMA 3V8CA 2JWDA 4OLZH 5ESAB 2DDQL 5JOPD 2IMNA 1GGUA 1LK3L 5FGSA 1AZBA 1EDJA 1W8OA 2CXKA 5D6CB 3DSFH 5FYLH 4RDBA 3D18A 4AMWA 5C92A 3RZCD 4NPKA 3RGUA 5DJZB 3PE9A 4FG6C 1AA0A 1V05A 2APTA 4FFWD 3MLUH 4EZMA 5E2UL 3L71E 4MCYB 3NCBB 5DRWB 4WK0B 1JRHI 5JPMA 4NQCB 4JQIA 2Z7UA 1H8LA 2WSFJ 5KJ7D 1DANU 1FO0H 1OAQH 1F00I 1VCBC 4HLJA 1FZAA 1P6FA 4S1RH 1NL0H 3VFWB 2V2XA 2JKXA 2OSLA 1NCDL 1UJTA 3VMOA 4RMWA 3QPQD 4POYA 5IMMB 3MX0A 3IPFA 1N7SD 3ARBA 4IU3A 1PG7L 2CR0A 1FCCA 4U6HB 3DJRA 4ODTL 4S2SA 3KYMB 3VWJA 6FABH 1RPQA 5J6HB 3WS6A 4PPTA 1PSKH 2QR0B 4P4KA 4Z7VB 2QM7A 1R3KA 4Q6YA 1C8QA 1HN1A 5FUCC 1SXNA 2AJVH 2W88A 3VG9B 2XFXA 2AEJA 4MN4C 1YI2P 2E7LA 1UH3A 2C3GA 1E9PB 3W9DA 3FQNB 1Y0LB 3JTTA 4KY1H 5FV1L 2EDWA 1G0DA 2EDEA 4C56E 2UXGA 4KO9A 2WZ7A 4ODSL 1ZANL 3K0YA 4JDVA 5ISZE 4N2NA 3GJEA 1ZVSA 3GS7A 1VQ9P 1E4WH 2BFVL 4JN2A 2F5AL 3CZFB 4Y4HA 2BOCB 4ZMTA 1FL5A 1FFNB 2YAMA 1HF9A 1JPGA 3AUVA 2CBPA 1J9CT 2Q2LA 5KSUA 3D0VB 3VTPC 3REVB 4DH2A 3PREA 3R1GL 4GLRI 4U2ZA 3DUUA 3ZUNC 3LKRB 1HGVA 1LL1A 3OXSB 4LCYB 5HHME 3WMSA 3N7NA 1FGVH 2XKNB 5F9OH 4OD1L 5CCGA 3E9TA 4P9HC 3SPVA 2OAAA 2QELA 3LKNA 3D6YA 5D6DC 2K6WA 1E5AA 3LKPB 5DO8A 3V0JA 4N4YB 4FQ2H 5CD5C 4YXLL 2EZ0D 1E4XL 1NKGA 2HFFA 1BEYH 4Q4IA 1MCKA 5ACZA 4HUMB 2FGZA 4NQQA 1NC4A 4YXKL 1BQLH 3KZIH 1JYVA 3WFDH 3TS8A 3MRPA 4EDXB 5TH2A 2BCCD 3PTZA 1T03H 4HC1H 3A3YB 3FXEA 2VLJB 4PB0H 3PJNA 1LDPH 1URQB 4ZD3L 3L7EB 4ZPVA 3SBQA 4X6CB 1L9PA 2H6PA 4I1PA 3IDNA 5IUSA 1D5ZA 4KAQL 3S34L 2PMZA 3MV9A 2NPSD 4JFUA 4XCYB 1UIIA 5AVZB 4LRIC 5CZVH 1I75A 1H6UA 2B77A 4H40A 4TUJA 4UINL 1E5ZA 3HMWH 3QQXA 1VB9A 4TLSA 4U6YB 5LAXB 4LGRB 4JVPA 5E2TH 3WFHB 1D5IH 4TQEL 5MERB 2W07B 4D9RE 3K6DA 4HK3N 4YNYB 1PV3A 3CZJA 4OFQA 4QHNA 2EDDA 3OWEA 3GMQB 5I16B 2GM4A 1NAML 1NPJA 5MHSD 2X0UA 2HMID 3W0WD 4JG5A 4RFOH 2LHAA 2IANA 3SGJA 5DUMH 5I76B 2A73A 3V4LA 2R27A 2X9ZA 3ETTA 3P4LA 5C0FB 2G3MA 1NCUA 2F18A 1OAYH 2DQTH 1DANT 5F96H 1R5VA 4PG2A 4WUUD 3EOAB 4IM8A 5T8IA 3QFJB 3V6BR 3CWBE 1UATA 1WV7T 1YEKH 3TJHD 2F8XC 3EZ8A 3OLDA 3BLPX 1NDTA 4QI3A 3QUXC 2VSDA 3HOGA 5AOJA 2YN5A 3N1PC 4R7DB 1I53A 2EO1A 3FU7A 4AH2B 1U8PA 1F41A 4S1QH 4JFXB 5DRXB 3Q3GA 3QXWA 3PQYE 1ORSA 3X12B 2ARWA 4R96B 4WHDA 2BEZF 2ERJB 2WWKT 5I1JH 1YEHL 3IT8D 1GOFA 1MF2H 3QEGH 1A9VA 2C9LY 4YHZL 1HGZA 2ARJQ 2YA1A 4RGNC 5CUSL 2GA1A 2C1PA 3VRJB 1TNMA 3M45A 1HKFA 4BKLB 3EO9H 1K4DB 1U7JA 5C3LD 2D0FA 3T0DA 3FS9A 4HX1A 1S7UA 2AMUA 1LO5A 3E6FB 1DSYA 2H2PD 4N2KA 4GG6F 4NNXB 4EE2A 3LNEA 3WFEH 4JKLA 3CVBA 4I9WD 4FQLL 4Z5RA 1T4KB 4TQPA 3D25A 2A45I 3VXOA 5AVTB 1YRKA 6TAAA 4R4FH 3ARRA 1RZKH 3D50A 2QJDA 2C9RA 3KPQA 4HUVA 1U8HB 4IBWA 2VMJA 1D5XA 1G9MC 4K8RH 4B9ZA 3RVVC 4EN3A 4MMZA 5EDXA 4G42A 2O01N 5KJ4A 3UEQA 5DO2D 1RHZB 3L3KB 4FGMA 2AGJH 1ADWA 1DVZA 3FT2A 5HVFB 4TS6A 4B86A 3LKSB 3OHXA 4UM9B 4KO7A 3H9YA 3P0VH 3C75A 5DGQA 3GSXA 2J2ZA 1KN4L 2KLSA 4P46D 4Y5VC 5D1ZA 1IAOB 2AQPA 4A04A 5IFJB 5APQA 3W82A 3WXWH 2ED9A 2ZCLH 4IGBB 3AY2A 3GI8H 1ZOXA 3FO0H 3OD3A 1HK6A 1HUCA 3PFUA 3L6FB 3C60B 3LSOA 3FTYA 4DEWA 4CL7A 1WA0X 4LSPH 4MZ3A 3II2A 1JK8B 3H56A 4F2FA 2B1HH 3GRBA 3KZ8A 1XSIA 3H4HA 3IDMA 3V5DA 3ZYOA 4F8LA 4BSVB 2WPRA 5HDBE 2Y0DA 5IQ9A 1EXGA 1S1CX 3QJTB 3FUHA 4OTXL 4EPSA 1AZZC 1TZIA 3HNTH 1KENH 1KBBA 4MA1B 2BNRE 5JORA 1EHNA 3KJ4C 3WJLA 3ZJAA 2Q86B 3S3SA 2Z34A 3FH8A 1WA2X 4JQVA 4ZO6A 1FZMB 4YHLH 1MVFA 3QORD 1JHLL 2PP7A 4KVPA 4HEMA 4EZKA 4QUOA 5IMLB 4BCYA 5FFOA 1LEGB 2WITA 2W6BA 4Y1AB 3VFRB 3FUIA 4TM9A 3DMMD 4JFYB 1VPOL 2ZG3A 2OMZB 3ARDB 1QVFO 1T1XA 4MWFA 2YWYA 4C83B 3OKYA 3WFCH 3EDEA 4G43B 4IKLA 4MHHG 1LE5B 3UADA 3P3YA 1CF8H 1VQ4P 4X5WB 4XN4A 1MZYA 3RFZC 2YXRB 3BPLC 4JCWA 2GSGB 1ZMYA 3D30A 1NGYB 3N50A 2FB4L 3H42H 4KJMA 2A1WH 2FFDC 3GLZA 1BZQK 3IE9A 4ETQB 1IKOP 1QFWM 4NQCE 2DH2A 3QS2A 5KJRL 3G5YB 1FZKA 1UCBL 2BRRL 1PEWA 3EJYC 4MD0A 3UBXA 4B9CA 3VD2A 4L8DB 1MFBL 3CHRA 3SPGA 3PWJB 2XWTB 4X5XB 1T66C 1P69B 1QLRA 2N9BA 4GUPA 4FCHA 2PR9A 1HAWA 2VDQB 2DRUA 4K5LA 1WQVT 1BLNA 1QBAA 4KUZL 4LOEA 4PGCB 4WEUD 1SQXK 2HTLC 1XL4A 5HPMB 5HYIA 9CGTA 2ARJB 3N43B 1NCBH 1EJOH 1SM3L 3GXDA 5HDRA 7CGTA 4KK5D 2DQUL 3HZ3A 2E9JA 4PV8A 2F1EA 3V4PB 4QMEA 4Z7VE 3LIZH 5H94B 3UO8B 3WIFA 1K05A 4XPGL 4GOFA 5TISH 1EVUA 5EBGA 1LO4H 5EDSA 2ED6A 4Q52A 4WWID 2XUWA 1MCHA 1VQ7P 2NX5B 2EDXA 4QHLA 4L76A 1GY1A 2PPEA 3QFDB 1JNNH 4PY7A 4HP5A 2YD9A 4XR8C 3BZEA 4MBOA 5D8JL 4AYCA 2C4FU 4X99A 4G5ZL 1JN6B 4XMWA 2GBVA 1T1YB 3E3QC 5DI8B 2K37A 3CD4A 1UASA 4OF8A 1OCCB 1K4CA 1KYAA 1S46A 3CFKB 3NTCL 1H8AA 5J1AA 4JPQA 2BP0A 2O6CA 4EF3A 2HPCB 1Y9BA 2XIBA 3CH1B 3C9NB 3BKCH 3UTSB 2A7BA 3UTQA 2W81C 4GT1A 1F3JB 3ZE2F 3H1LJ 2ITFA 5E56A 4U1HB 1HH6A 1BVKB 4CA4A 2R5DA 3LN5A 2CIIA 3PHOA 2YR3A 1XGTA 2HLAB 4ZW3A 5EEUA 1JJUA 2SEBB 4WI2A 5AL8A 3V6OC 3SDAA 1PG7X 1I9IH 4GAFB 4KK8D 4LPTA 3KR3H 2DB8A 2BO0A 1U8CA 4JDTL 5IB1B 3PHLA 3DHUA 5IP4A 1LYQA 5AYQA 2AXFA 5F3BB 1UC6A 3T6QC 1IQDB 1WIUA 4NWTH 1RV6X 1OSPL 2R2BB 5DD1H 4HAGA 4XRCA 3GG2A 4OZHE 5JW4R 3KLHD 2J55A 1HH9B 3MRLA 5EF2A 2OMVA 5E4EC 2BX5A 1X3DA 2VQUA 4ALAC 3EH5B 1XIWA 2Z9TA 3L5WA 3GFUA 4AXWB 3L54A 1RUML 1O6TA 1JZIA 3QHZL 3MR9B 4BFGA 5IMKA 3CCLP 5KLIB 12E8H 3CPLA 4WFFE 4EN2A 3RK2D 5KANI 5I8KL 4S0SD 4X6FA 2A6IA 5A2AA 1WUNT 1S7RA 5TE4L 5GRYA 3MNZB 3S36H 2EC9T 5L2KA 2WPGA 5E9DD 4PJCF 4F93B 5HYSG 4N78D 4PBXA 1ZLEA 2ZG1A 3FTSA 1TZ8A 3H2WA 4A7UA 1MAKA 5EZOL 2X87A 1NBCA 5E6IB 4MJIA 2NY4D 4JO2H 5B1JA 1HAUA 3MLWL 2F7IA 3HS8A 2X0WA 1KXQE 2EDQA 3L73E 4HGKC 2V33A 1NTMG 3CSTA 2KH2B 2H0JA 3W68A 3M8OL 4CPGA 5DDHA 4GIPD 4OZIE 4W6YB 3B2MA 3QFJE 4HKXB 4IBZA 1FC2C 3C5ZC 1R19A 2HT4C 3AEDC 1YEEH 3ZDXB 1J48A 4YEFA 1L9NA 5LDUA 1JXFA 2HVJA 3CQPA 1U8IA 4LSTH 4YSUA 4ZX6A 4B95C 2GUVA 1HU8A 1MW0A 3T3PE 3EIFA 5EF1A 2FWOB 5DJDB 3VRIB 4AQ1B 4EI0A 3CZKA 2JNZA 4M62H 1HYSD 2Y1ZA 4LL4A 3DO3A 4LC1A 4EKJA 3B1TA 4MX7A 4V2CB 5D7LD 3NSXA 4YSDA 1OPGL 2C3WA 2VNCA 2CR6A 2ZUQB 3GMMA 1H15A 1I8KA 3ZLQC 2OJZH 1M6UA 5ERWA 5B1BB 4HT1L 5KZCD 1PZQA 2A6KB 4MA7L 3FUKA 1KJMA 3RWDA 1UZ8B 1WHOA 4BINA 3CMGA 4P3DA 1IEBA 1YYMH 3S4SA 3SY0B 2YHGA 3NCCB 2V6HA 5DQJA 1SQPG 3B9KA 2BW4A 3BP5A 1SDDB 3VXPA 2C4FT 2OYKA 5JW3L 2R0LH 2YC1A 3IJSA 4GQQA 4K73A 4K9EC 4Q8BA 2NY5C 1OT1A 3U0PA 2ZKHH 3QJUB 1HSAA 4A68A 3W5NA 5FV2A 4L5FH 3F64A 3HG1E 3VB8A 4BWUA 3BPCB 1JY3N 3FSVA 1WIOA 4OSUL 3D6GA 4N0RA 1T2KC 5LBGA 1H3PH 3LZFH 1S9VA 2VDLH 5C0EB 2P8LA 1FL3A 1TVBA 3S37L 2VN5A 4GXVL 2UZYA 3WV0A 4MXWH 5DCCA 4AQ8A 4RZCB 5L7XL 1ZT4A 2AQRA 4TSAH 4K3EH 4L8SC 5AVWB 1A02F 2HRGA 1VIWA 5CEXA 4KMLB 3V4VB 3CXHK 1FPTH 1XR8A 2Q3XA 5T5FH 4IMLB 1IGMH 1WYJA 2H2SD 3IMBA 1I4FB 4RBPH 4AKOA 1EBAA 2V5YA 1CFNB 3O8XD 2F53B 4F9PC 4U1NB 2PYFB 2H8PD 2A2QT 4HAKA 4KVCH 5AOIA 3V2QA 2X4QB 5LNEA 1LHZA 2PWGA 3Q3DA 1YG9A 2OMUA 4WU5B 1CFVH 1PP9D 4KI5F 3KPNA 3ZIYA 2Y1YA 4MCZA 1FNEA 4U1SA 1NSNL 2BZCA 2PTVA 1KTRL 5J06A 5CJXC 1V7NL 4W7YA 1VPCA 2H6UA 2W91A 3DUSA 3BP7A 5APUA 3EJPA 4R4ND 3MKGA 5JHDB 2ADJB 4Y28J 4MAYA 1EDLA 1T83A 3NYKA 2BSTB 2FJGA 1EZVI 2VDNH 4UB0L 3ZKXC 1S3KH 3OKEB 1I1AA 1BQHB 7FABL 5D55A 5F9JA 4AQEB 1A7RH 4CILA 3T4AC 1OW0C 2PR4H 4D6TG 1PLGL 2H5UA 1DBBH 3LH2L 5DJTB 3D2UD 2NZ9D 4PRPD 4XCEB 3ARSA 1BOYA 4KTDL 1IGYB 1E9OB 2R1YA 1ETZB 3L3HA 4EIZC 3N04A 1ASQA 4LLDB 1VQ6P 1I3GL 3B3IA 3CFJA 3ILEA 1KZYA 2JJSC 3QEQA 3ZTJG 4HCIA 4QO1A 3H1HJ 1KLGA 4OBRA 5H2FE 3B9DA 3DLQR 4QRFA 3PGFL 2GUYA 2ZKMX 4X9BA 3WY4A 4LSRH 5AG9A 4WF7A 2Z4QB 5IJDC 2CLVA 3SKMA 3VRLE 4O2EA 4Z7UA 1KTLB 1IC4L 5HJ3A 1YN7A 1K3ZA 3REWA 1LEKA 4PR5B 4WW1A 3JWNG 4PGEB 1FA4A 4R0LC 1BZ9A 4O02A 1DTUA 2ZAGA 4JRLA 4LZKA 4YAQA 1JFHA 1VCAA 4PGJA 4ODVH 1SLWA 1T2JA 3K7UA 3WBDA 4XPTH 4ZUSB 1CF1A 2MTPA 1BJMA 2ADYA 2Z91A 5DD5L 5SX4H 3BVNA 3BDYL 3SPCA 3P9MB 1A1NB 2FX8L 1NAYA 4OH2A 4UU9A 1T89A 4DN4L 3JWOH 5ESVA 2CRZA 3O11A 1RL1A 1VERA 4WJ5A 3SHSA 2XWRA 3BCFA 4QXGH 5GGTA 4NQEB 3MLXL 4AEFA 3UTTB 2F15A 2F7OA 1JWSB 2PNDA 3EO0A 2NW3A 3TFBA 2IBZY 3IDIA 1S8DB 4X4ME 3UX9B 5HVGB 5A2LH 3O4LD 3RL2B 2RCSH 4N2BA 5APVA 1UKTA 1UD6A 1TZHA 3OR6A 4KDVA 4PYGA 4XVJL 1ZJAA 1JZFA 1JGVH 4HIHA 5DURB 2Q6WB 5TFSH 4IOIH 4U3XA 4BZ2L 3B5NC 1KYOE 1TU3F 2K4AA 1RK0A 2FDBP 2OX5A 3CBKB 4PTUB 2YMXL 3TVMD 1GL2A 3GMPA 5ANMA 4A6YH 5ID0A 1IFIA 1D9KC 2TSAA 1KACB 3BEVA 5ADPL 3QJSB 2R0WH 5BOPA 3UTSE 3Q01A 4GUOA 1N10A 2WVVB 2F5BL 1ID2A 2XN9A 3VJ6B 4M7KH 5D71L 1FZOA 1SXZA 4CDHA 1RUAH 3I2CH 3TGUG 4JFHD 1PPJD 1JY3P 1T80A 5KLVG 1U6AH 3C2SA 4WFED 5EU6A 4LIQH 4OZFA 5CGBA 3WL9B 4ZNEE 1CLZL 2JKRM 1DZBA 2BCKA 1YJDL 2J4WL 1GSMA 2B20A 3NACH 4ACTA 1JPST 4CVXA 1TJHH 3UDWC 1NMCC 4B9YA 5HDWA 2CNZA 2ADFH 3QARA 3LPFA 1HOCB 2YQGA 3WE6B 3HMXL 1OCWH 1E4KC 2H7HA 4AW7A 4MDJA 5CIPB 1QVGO 3QQDA 3O6ML 3H1IG 4Y16A 4HJEA 5EUOA 2BJMH 2NXZC 5FHAH 1M7XA 4GQZA 2YD5A 5TQ2H 1JYNA 2OL3H 5JZ7D 2ZWNA 5JR1L 2G9HA 3BSHA 3L70G 5HHNA 1MVUA 4ODWB 5KG9B 4A2LA 1O7DE 5TD4A 1LWUB 1FDMA 2LLGA 1UHVA 4ZPTA 5J4MA 1H88A 1TJMA 4KMTL 3KLAB 3GYRA 4WW2C 4NNPH 4X83A 4Z7AA 5GS0H 1QLEH 2Q8AL 4NKQB 3N42F 4JY5L 4OUOA 5ICYB 3RIFF 1SUHA 3SCMB 2OYIB 4Z3HA 2QJPC 1VDGA 2QSVA 2N7SA 3RRQA 4ABUA 4DKFH 3S35H 3ZDYB 4FDWA 1F11B 1LP1A 2B7DT 1ZSDB 3HZKB 1RZGA 1XGPA 2JKLA 3FSAA 3AB0C 1A9BA 3QUYB 3BKJL 3WNJA 4F5CA 1O5DT 4QAMB 5A40E 3BX7C 3GS4A 1SF5A 3IDYC 4HA1A 4WFHE 5DJAB 4F7KA 2BWIA 1Q9WB 5F2FA 1PZCA 4LBEB 3AMKA 4GSRA 4AV0A 1CYGA 1BF8A 3LCYA 1I1YB 4U3SB 4AQRD 4WWKD 5D7KD 4Z0XA 5T5NG 3V9CA 3ISRA 2P8MA 5KBKA 1YEJH 3CVHL 2IC2A 5FHBH 1DN2A 4H1LA 2OYLA 1JF1A 3SSGA 5C07D 2RB8A 3GSVA 1LNUB 5TK4A 1UURA 2B5IC 4UDUA 3SE3A 3ZDXE 1MFDH 4Z3FA 3LZQA 2VKWA 3RDTD 3U4KA 4U3HA 3GMNB 4H0LC 1PDKB 3JZYA 3KYOA 4U1KA 3WIHL 1DYZA 4N8VA 1SHSA 1TOXA 1GJIA 4ZMVA 4AZ8A 3AABA 3SJVA 3NA9L 2Q5BA 1T2QH 4OD2A 4BA0A 3TA3C 4NKIH 3RKPA 4FP8H 4X0KB 4TT3H 3GB7B 1PGQA 3HRZB 3FUNA 3MUY1 3U59A 1J1PL 5ALCL 3SKNB 4LT7A 4YEEA 3GMOA 1CLOL 3P69A 1BJ1J 4LCCC 3LEYH 1JNHA 5CZKA 3GSNH 4LVOC 5FDWA 4X6EA 1NUNB 2BSCA 4WO4D 1LT9C 2BOBA 4XTRC 3OW2O 1KYOH 2HVBA 5KN5A 1MCSA 1QA9B 1BX2B 4WUKL 4N6RA 5EIIB 1YY9D 2V5MA 3BPOC 3L9EA 4WJG3 3G04A 2AJ3A 5KVEH 2G4GA 5ACMA 5FK9B 2KUBA 1NAMA 4PJIE 1G43A 3EDKA 2YNYA 3EO1B 3P11H 5FIEA 4JGNA 4Z7OF 1JGDA 2YAOA 3HE4B 3S8FB 1JBJA 3FQUB 4H88H 4XPBL 1QNZL 2QV2A 4Y1TA 3CXHE 1RXLA 1HHKA 2DEYX 3MLVL 3M86A 4PV9A 1U41A 4U1MB 2ZXGA 5INDB 3HE7B 3TCXA 1FFOA 3A0BE 2Q3AA 4O58H 1KGIA 4H44B 2G5BB 1J0KA 4JGJA 2B59B 3FF7A 3IU4L 3O6QB 1NTKK 2ITDB 1U3HD 1N73B 2C7UA 5HHXH 3ILQC 3OKMA 4JZNB 5CGYD 1D5MA 2ENPA 3VFVB 3RZCB 2VDOH 2XQ0A 4PJFA 4BZYA 3QAQA 3VXNB 2QHRL 1BXVA 1MEXH 1XF4A 2DLHA 2Y5EA 3RK3D 4KROD 3VMNA 4ZUWA 4QLRA 1JZEA 2I32A 3WI9A 3OJVC 2B8OT 2F53E 5I73C 5GRJL 5B3NA 1DDHA 5B8CC 5I0VA 2W9EL 4MA3A 5DR5H 4N0FB 1WBZB 4LLUB 1E9QB 1IIKA 1SJHB 1AR1D 1NCIA 4Y19E 3GTNA 1SLUA 1UM5L 1NIBA 2JI2A 1UWEL 4FQQA 4JJOA 1EXJA 5D7JA 3H32B 1ND0B 5JUEL 5B3SB 1OZHA 1GGIH 2FHCA 1Y1DA 1N7SB 4HSCX 5D6CA 3QJFA 5MI0B 4XBEL 5C0BA 3CZGA 3RGVD 3UMNA 1QEWA 1NC2D 1RZKC 5JHDE 3MIWA 4DK6A 1DLHB 2JP3A 3WHE1 3X13B 2Z93B 1T6BX 3JQOB 4HJGH 1UACL 2XQYK 3P2BA 4W9EC 4BQCA 2X1XR 2VQ1B 3FAWA 4LCIL 4YDIL 5GRWA 5FAAA 4CKVX 4F57H 2ZCKL 1OMIA 5EHFA 5DRWA 4ODXB 2F0CA 1QFPA 1RF0A 1KZUB 5IKCB 4NHUA 5I19H 1UOWA 3K46A 5I6KA 3F12A 3VFTB 3KPMB 2AEFA 2AXJA 1SRDA 4IBSA 5E1AB 5E2WH 3W39B 4YDMA 3IXAA 2WOBA 3SE9L 1IBGL 2OJ1A 4ZDHB 3OF6D 3BRTB 1N6UA 4GT7A 4GW4B 1VFAA 3S37X 3P02A 4FNTA 3PF2A 2V8LA 3MJ9H 3OKKB 4WDIB 4QXUH 4I89A 5AW4B 3KYMA 4K3JL 5JOFB 2XBZA 5IBLD 5IHZB 4U3CA 4HZLB 4R97C 3HZMB 3SDCA 3SE3C 2FL5B 2W6JH 4JO1H 2M3EA 2QR0A 3PP4L 3VM5A 3J7HA 4N2FA 1IFGA 3WKNA 3VQ1C 2YEVB 5HJDA 2WSCH 3NT0A 1X7TA 3QWRA 4JL2A 2CK2A 4P4RB 5IGXH 1A4KB 3II3A 3VVWA 1WAAE 2YAPA 2QPFA 4AG4L 4ZS6C 4XVSH 1E9PA 1KILE 2R32A 3FQNA 5C0CD 1TYJA 3ABZA 4TRPL 1LTXA 2QE7H 5SX5K 3F6LA 5E5UB 4PJ5D 2O5XH 4M6NL 2YLKA 3L3OA 5DHDA 1KIRB 5LUMA 4R2GC 5DJ2A 4K5OA 1S4XA 2Q8BL 1XV8A 4NCDA 5IJKC 1VGKA 5KVMC 4PBDA 4EIJA 1MWAL 1HINL 2R0KH 4ELMB 3OAKA 4Z7WF 4HKJA 4DCQA 1IGCH 5DRZB 3REVA 4PLOB 5TE7L 3V2AR 1R5SA 5K33A 5K9OB 5CU9A 3LKRA 1OX3A 3N44F 3OXSA 4LCYA 1F4XH 4ZFFA 1WISA 4JM2B 1E8ZA 3BI9X 1UM4L 1NEZG 5EO9B 1ZLUH 3L1OH 3FCTB 2APBA 2EO7A 5GSRA 1A1OB 4B60A 1KFNA 2A0LD 2XG5B 2ZF8A 1L0NG 2NPSB 5D1QD 2NXYD 3U4BL 3PLNA 3QA3B 1AQTA 1DVFC 1MIEL 3GRGA 1MNUL 1Q0XH 4L48A 5ITBH 4S1SH 3SGKC 4MZRA 2VM3A 2MCMA 5C0GB 2FNBA 3ZR6A 4G71B 4EDXA 4M7ZB 2JIXD 5GRVK 3QFGA 5DK0B 4B5ZA 2L7UA 2VLJA 5HYJD 3W0WB 1URQA 2WAQA 4NQDA 3R8QA 1RE3C 1INDL 1SOQA 3FQWA 1I8AA 2DEWX 2JB6B 2JB5L 4X6CA 4AT6B 2DTML 1Q94A 4FFYL 5F6HI 3WKML 4WUUB 5GS1C 1ZTXE 2A3TA 2IV8A 3V0AC 5EZJB 5L4IA 4JG0L 2GJZA 1DCLA 1P5UC 4U6YA 5LAXA 4J3OG 2QGEA 3W11C 1Q1JH 4B9IA 3JWNH 4EZJA 1T0OA 2PXYC 3G9AB 1J10A 1E5UI 2W07A 4JDZA 3AG3B 3B43A 5D93C 5FFGA 3WFBL 4B97A 4YNYA 2VDMH 4LHQB 3GMQA 4IFDK 1IGTA 3HKFA 3Q2NA 2XZQH 4CC0A 4FQIL 4U6VH 4XXCC 5I76A 4N8CL 5H37G 3EXLA 3ABLB 5C0FA 3I56P 3TGXA 5F1IA 3HHSB 2X2HA 3PP5A 3TO4D 4BUGA 3FQ4A 1J1EC 1MFCH 4UTAH 4OZGB 4HJIA 4NZTH 3D69B 4L1HA 3QZPA 3M9QA 5KSVB 4WTQA 1N0LA 4NN7B 2JKTM 5GIRA 5IFHH 1IM3D 3MOBL 4R7DA 1DL7H 2IO5A 3ZDYE 1J8KA 3FCUB 1FLRH 4EI5D 3X12A 1GH7A 2EYRB 1DJHA 1RFDL 1UKSA 2NCMA 4R96A 1L0LK 1KNOB 3TN0C 3TYFA 4M7LH 4F58L 5KOVC 3NH7L 4GRWF 4V11A 1IM9A 3LNDA 3OMAB 4OLZL 2F19H 1CJYA 3IAPA 1XH3B 3HD7D 1HHJA 2BSSB 3TBBA 2J5WA 3C1LA 2R9HC 1MY5A 3DSFL 3NZ8B 2JH2A 5FYLL 5E5LA 4BKLA 2N01B 4U7MA 1ZWIA 5GJTH 5HI3D 5IQLA 2H26B 1J0YA 3HJ0A 3MLUL 1UZ6E 3F7YB 1M2OA 2TSBA 2FLBT 3E6FA 1NOAA 1ITBB 1FO0L 1OAQL 1ZVHA 2BHFA 3GJFK 3BN9C 4P46B 4S1RL 1N2RB 1NL0L 1T4KA 1JMZA 2NNAA 1V3JA 3D07A 3UABA 4AUYA 5CEZD 3MV8E 4PJ0E 1R3HB 4G7YH 4XVOA 3L74E 1TXKA 2IG2H 1WVZA 1A65A 3MGTA 2V37A 1F6AA 3LQZB 2FT6A 3WDHA 3VTTA 2CBOA 2FX7H 2XCMC 1U8HA 3L71J 1U8LB 1PSKL 3WNNA 3N06B 4HKBB 4YXWH 1F4AA 2CO6A 1A6TB 3TEWA 1OO2A 3QH9A 2ZUVA 2OBGA 4IHOA 1UTDA 5F21B 1YQVH 2APSA 2AJVL 3DNKA 1NTKE 2UWEE 4PWFA 1IAOA 2G3XA 5L2JB 4WTZA 3H1ID 4UTCA 3NMEA 4KY1L 5I66A 4KKCD 2VH5H 4ZSOE 3OMNB 3AXIA 2WQXA 1KGCD 4X4YB 4IGBA 4ZMYA 5I0ZA 5IFAH 5F9WB 1MIMH 3VN0A 3OB8A 3L6FA 1JD9A 2VISB 3JBG7 1E4WL 4AZUA 5DSCB 4TNFA 5T3ZD 3GXNA 3AFLA 5DMGD 5LJYH 5F7AA 3GWJA 1ID5I 3DMMB 5IBTH 4EOWH 1ONQA 4LPWA 4PY8J 1IBZA 1MJ8H 1IJ9A 4MJJA 4P04A 5JPNC 3MZGB 1IILE 1NH6A 1QBMH 2GSIA 3FXDA 2NNXA 3GHGB 4KKBC 4YDVB 5HHPB 2R23B 1WMKA 1SN5A 2EKSA 2NSQA 1TO4A 3DSNB 3KYKH 4P07A 1QPKA 1ZHBB 1NM9A 1KCSH 2Q3ZA 2PWDA 4Q9QH 3OAUH 3V0WL 4LLQB 1WWWX 1XF3B 1FH2A 1FZMA 1QFUL 4HWZA 4X80H 2WLLB 1COBA 1JP5A 4FQ2L 4ODBD 3KD4A 5IMLA 4RAVA 4GFXA 3OHMB 3UC2A 3HRPA 1BQLL 3POHA 1GHFH 1IGJA 3ARDA 4P2CG 3VWKB 2JKIS 3FU0A 3WFDL 3AC0A 5FOBB 3WDIA 1W80A 4M4RA 1YPZB 5IW1B 3MHVA 4XBGB 4Z7QE 4OZ4A 5AZUA 3F01A 2YAEA 4XMLL 2VC2H 4HC1L 4PB0L 3QUZD 1KT2A 3OG6B 2FYNC 3RKDD 1DJSA 1IBBA 1LDPL 1PKQB 4JPSA 3S6CA 1IFDA 2PGDA 3OC5A 2PCXA 1PF3A 3QWQB 1KIUB 4OFYD 4RESB 1U8KB 2L91A 1K73Q 2DQDH 1BBJB 1OQOA 4B7IA 3F5WB 4P3WA 2A38A 3E8UL 1BYOA 4HALA 3VU2A 4YHNA 2P42B 2M5AB 3IPEA 1M7DA 3HMWL 4E41D 4X5XA 3A0OA 5E2TL 1D5IL 1YMMA 2GSMB 2VZVA 5JHMA 3ITKA 1D6VH 1P0SE 2R7EA 4YK4B 3EJUA 1ZR2A 1J8HA 3M1BA 1YEIH 4Z7UF 5FGBA 5HPMA 2ZJSL 3CSBA 4LRIA 5EC2A 4RFOL 3SYCA 2J8UA 2RA1A 1TQWA 5DUML 3U6XA 2J1WA 1TVHB 4HUXB 4A2GA 1IC7L 4QDGA 5DFTA 5H94A 1OAYL 1XT5A 2DQTL 5F96L 3K74B 1A2YB 1C9SA 3BRDA 2TAAA 2DQCH 1YEKL 3SKUD 4ANVA 2VLRA 1FNHA 2NX5A 1SYVB 1YAIA 3QFDA 3FL7A 5E24E 4CUCA 2R0ZH 1E6JH 1FN4A 4P5TD 1A6UL 1IFMA 4KNQA 4S1QL 1OKEA 3NXSA 5I30H 3KYNA 4JFWA 4ELME 2WBJC 2BNUB 1MF2L 3QEGL 4BWTA 5ABDE 2G75B 2ID5A 3FT3A 4YH6A 4E36A 1FVDB 2QGDA 3INUH 1FDIA 1S5HB 5IB5B 3QUXA 5K5GB 1CG9B 4NQSA 2BCCE 2QQKL 3CH1A 2YGVA 3NPSB 3RLSA 3CWBJ 4KKZA 4ZI8A 3IFPA 4FHBD 4OF6A 5T1KD 3VXUD 3H2PA 3EO9L 1MJJA 3NAAL 1DD3A 1K8IB 1BVKA 4UQ3A 3AY4A 2IQ9H 4LVNC 1WDAA 4QCIA 2HLAA 2LTQB 3S3BB 2BP8B 3BCCG 3KCPB 3NOIA 2D0GA 1EQWA 4K3DH 3SGDH 4R4LA 3RK2B 4P59H 4WI0A 3W38A 4GBXD 2FQGA 3G6AB 3WFEL 3QCVH 2MPVA 1GSKA 2WHVA 4IIQC 5I6XC 1NIEA 3BKYH 5JMRA 1GVIA 2NQCA 2DYSB 4JAMA 4WO0A 5HI5D 4TTGA 1GL4B 1JCDA 2LXCB 3L72E 1IQDA 2KT6A 2Z0UA 3ETBJ 5DVOA 5E9DB 3KYQA 4L0ZA 2J44A 3MRQB 1HH9A 2ZF9A 4LSDA 4HFUH 1RZKL 4YDJB 3ERXA 1DEEB 5MHSE 3RTLA 2NY4B 2ZSWB 1I8LA 4BRYB 4K8RL 1PCXA 4XWGH 4XAWH 2YUZA 3HFFA 2R29A 4GKZB 1PVHA 2F7QA 2K6YA 1BVLA 1ZK5A 2E7BA 3EGDA 4HIEB 4WUUE 4PJ8A 2IAMC 4AYEC 3LJ3A 4I0PC 3FF8A 3P0VL 3MCKA 1MVYA 3OXRB 3GK8H 3S3DB 3MNZA 2ZAIA 3CTTA 3L08A 5EUOF 5CJ5A 4Z1MH 1KDJA 4LSVL 5AKVA 5CLWA 4JFDD 2ICEB 3WXWL 5E7FA 2VR7A 2ZCLL 3ARTA 2YPVL 2N56A 3D7PA 4BJLA 4LMQE 5EWIH 4P2OC 2OPCA 5FA3B 2MHAB 5E6IA 2VXVL 5GJSH 4C4KT 5D7LB 1XQ4A 2CKBH 4LSPL 1OAXH 5DTFA 2GCYB 1G1JA 2IWKA 3VSUA 3GBNH 1AGCB 2VRKA 1G1KA 1U3JA 3CFNA 3DVFA 1AGBB 1XAUA 1VZIA 4C58B 5FYJD 1L0LE 2WMPB 1I9JL 1GMEA 4HS3B 5KZCB 3PWUB 4HKXA 1QW9A 1FZCC 3CFCH 4BQ6A 3MBEA 4DERA 3QQ3B 2C26A 2PTUA 2VCOA 2Z6FA 3MLTB 3C60C 3RL1A 4BZ2A 4FXKC 4I3RH 4FZ8H 3F2LA 3FQRB 2AEMA 5EU4B 1J8SA 2FAUA 3EOBB 4C4UA 3U4AA 2QSTA 3BLKA 2FWOA 4YVNA 4YHLL 3GHEH 4HZAA 4OCSL 3C5JA 4YIQB 4WJKB 3DX1A 4H26B 4I9WE 1VAHA 3TONA 2HODA 2HUHA 4HZ1A 4TL5A 1A7BA 5HYQB 1UUSA 2OI9C 2V5SA 4MA1C 3WFCL 4ZT1A 1PJWA 4HUCA 2K45A 1L0ND 1CF8L 2I7OA 1IFRA 4KQ3L 2R2EA 1UZ8A 5AWNH 4JFZH 3DJ9A 1A4CA 1B0RA 2UUDH 3H42L 2P2UA 2V2TB 2IDSA 2A1WL 3SY0A 3B6SB 3BVHA 5KS9E 3HMXA 5BOJA 5C9KA 1Z5LB 4J5VA 2XT1B 2R3CA 3MMEB 2PPDA 1EEQA 4IDLA 1JDDA 2X9YA 3MRFB 1SFCB 2VDLB 3QG6B 1GC1C 4J3OH 1JOIA 1F3RB 3RB5A 3BESR 1LMKA 3BPCA 3MUZ1 3O8XB 3O41B 3GC3A 3PXLA 4HEPA 2H8PB 3SDDD 3SGEH 4CMHB 1L9MA 2ENSA 3DVNA 5I1CH 1CFSA 1UWGH 3BQUD 5F6HJ 5BV7B 4WSGA 3S2AA 1EAQA 4AYBA 3EG9A 4YL9A 5D7HA 2ADGB 1NCBL 1EJOL 5C0DA 5D5MB 3QGVA 1TENA 5H37H 1CE6B 4RZCA 2D03H 4CDGC 1OW7A 1DQQA 2JI1A 2X1QA 3MRBA 3VGHA 3LIZL 3BT0A 2IBBA 1J0IA 2E4TA 4X6DE 2AQ3A 1GDTA 4FNUA 4HJ0C 3T2PA 3FQXA 5CHNB 2MSPA 3ARPA 3QPKA 4PD4D 4ISVB 1JNNL 3TH2T 3TDKA 4XXDA 4JPIB 4FC3E 3D2UB 3KL0A 3I6GA 4ONHB 1GOGA 4LPCA 1NUGA 1T21A 3MRIA 4PRPB 3D6ZA 2OA9A 3CVHA 3N55A 5C0RH 3QUMB 3NFQA 4NNYB 2IX7C 3OGCA 2EUWA 3QIUD 1DFBH 4PJFF 2GAZB 5AW9B 4QJ5B 3QS3A 2BERA 3E80A 3Q5OA 3RWFA 2QFRA 2ADJA 3EFOA 1TZGL 2VOTA 3FCSB 4QOKA 5DA4A 3OKEA 1BQHA 3BKCL 5BZXA 4AQEA 3WIHA 3QQ4A 1KWKA 3VXME 5C6TL 3L45A 3KPSD 3AS0A 1OM3H 2ESVE 5G55A 1IB5A 1J5OL 3V79C 1JYWA 3ARFC 2ROXA 4FFVD 4QRPA 2FYUK 2BDNH 4G9FD 3WN6A 1I9IL 2WGXA 1IGYA 3CLEH 1T1WB 1ETZA 2Y6TE 3CFBB 1CYXA 3AWEA 3HI5H 3KR3L 3FB8A 1FL6B 1EAOA 1RH8A 3QO0B 2RQEA 3ZKMD 1K72A 2FO4B 3RJOA 4NWTL 4J4PA 5DD1L 2D9CA 3FC8A 4RRPG 1YPZE 2OMTA 3BGFC 3PL6D 5K9JH 2QEXP 1HL8A 3SOTA 3V6OA 3AJ7A 2P7TB 3UG5A 2I60H 1UADC 2KZIA 4OVVA 3GMLB 5KSAD 1KB5B 1LWRA 1KMGA 4W6XB 5MENA 1XAKA 5FKPB 1FDLH 3BVWA 12E8L 4XN2A 4ZAKD 4OLVL 3GJFH 3N40P 4K07A 4KJQD 4WENB 3JCUE 3U4EB 4GB9A 4KU1A 3DX8B 5ANHA 3S36L 3WS3B 3KBPA 3Q2CA 3O4LB 3DX7A 2KQMA 3TBYB 4GAJH 4JLRB 4OQTH 1O7DC 4MD5B 4ZUSA 4MSWB 4U6TA 1A9EA 4JK0D 4A7PA 3CXHI 3LEXB 4JO2L 3O4OB 4HBQA 3WUWG 1M05B 2B89A 1FJKA 4BYHA 3VXSE 4DP6X 4RETB 4MNHA 3OC8A 3L4FA 2GFBB 2HWZH 4LCUA 4PGZA 4QWWC 3AXLA 1P84D 3UTTA 3PYCA 1JWSA 2V9TA 1USQA 1YEEL 1FG2B 1Q0EA 4QRRD 1S9KD 1S8DA 1VDFA 3NJGA 5KVGE 3D0AA 3DX4A 3O6LH 2MQGA 5DJYA 1BCCG 2FIKB 4IEFA 4XGZB 4KI5D 1QG3A 1T04B 4M62L 4NO2A 4O2FB 3PDDA 3H1JG 3DGGB 5E95B 4M8VA 2WOYA 4PTUA 3GS0A 2G30A 3L73J 3QI9B 2OJZL 4Q6IB 1OCZB 4NBYB 5G5DA 2EXWC 3QYMA 4AV4A 3KGRA 2WVVA 4Q9RL 5DRNB 4L1DA 3VJ6A 3AEEC 5D72H 4AQ1C 4DTGH 2B1AH 3K2MC 1YYML 1TEGA 1X44A 1ULVA 3KBFA 3DK2A 4HJUA 2ZUQC 2SPZA 3ZUCA 3WL9A 4HB1A 3H55A 4PVMA 3BH9B 2FYVA 2QVAA 2BZDA 4G1EB 2R0LL 4I0KA 3D9AH 1HOCA 2ZKHL 3WE6A 3MROA 1YTZI 2HVKA 2VZ3A 4HH9A 4L5FL 2GIMA 4X6CF 4N78E 1S9XB 1PJ9A 5DHEA 1E4HA 1PNDA 3O3AA 1H3PL 3LZFL 4WI5A 2VDLL 2ATPB 4UB6E 3MFFA 3G6JA 3IJ7A 4K5MA 2L3BA 5JDJA 4TVPH 3WTVA 5JIDA 4KQ0A 1E90A 1XD0A 2EQDA 3Q5YA 3H1KG 4X4ZA 2J1XA 4WWKB 3F7QA 4K3EL 4KKNA 3ATBA 1I85A 5B21A 1UT9A 4GRMB 3F58H 3J27A 4R7LA 1IVLA 4PJ7B 5C07B 1FPTL 1MWAA 3VWJD 1LTJB 5ICYA 1IGML 3SCMA 5HHQB 1AO7A 1E5BA 1XGRA 4PJ9A 2X6VA 3DX2A 3PJSA 2DI9A 2YIUC 1F11A 1F58H 3RDTB 4KVCL 4P4KD 3VTMA 4Y7MA 1U0QA 3MNMA 4Q9CA 5A2JH 2NY1D 1BMGA 1CFVL 1KEMH 1SHMA 2NLJB 2HRPH 5DJAA 3PIQB 3EBAA 1MCRA 1VADB 2I24N 4X0NA 5D7LE 4ZUTA 4LBEA 1NIFA 1WG3A 2E9BA 3S3PA 1X5KA 1Z9NA 4U3SA 1IAIL 1F1DA 3MA9H 1F02I 3G5XB 5IOPB 1XVSA 3QUML 4NCC2 2VDNL 3A4FA 3OJMB 4ZFZB 3UP6A 5FCSH 1I1CA 1S3KL 2XJLA 3H9SA 5DYFA 1LNUA 5D2NE 5CILH 1KBPA 2BWDA 4Y4HD 4Q0XH 1JNLH 1DBBL 1RVFH 3U1SL 4N87A 4PEEA 2QEJA 1NBZB 1CBJA 1M6OB 3BRFA 3GMNA 2VR3A 1DVUA 1J9SA 2VDRB 3F89A 4GKNB 5AAPA 4KGJA 3U30B 2D3VA 3I5CA 1F0LA 4AYFB 1BBDH 1OGAE 1MRFH 2E74C 3FPXA 4A2FA 3FQTB 2BXYA 3GSNB 5IF0B 4FFYA 4HUUB 5F89B 2ZX6A 4BK4A 1Z9SB 4X0KA 3GB7A 2X4NA 3HRZA 5AVXB 1RLBA 3M1CA 4KRPC 4FL4B 2EDNA 1WFNA 4LSRL 4B53A 1N12A 1U3HB 3IDJB 4LESA 3S4SG 2YARA 1YY8A 3UZVA 1NC4D 4NO5B 1BX2A 2XZCH 4MB3A 4ORGB 5IVXA 2JJSA 2NY2C 4FLSA 1JWUB 1RCYA 1WWCA 4C59B 1BE3D 1I1FB 5IJVB 5CEYB 2X70B 5B5EE 3RK3B 4KROB 5JYMA 2OR7A 5AKTA 3FQUA 1PX4A 4UILH 2E6PA 4U1MA 3VM7A 3L9RB 5INDA 3VDBA 2HB0A 3MO1A 4HJTA 3LRKA 3AE5C 3RU8H 2CG9X 4ODVL 4OCWL 4AL8H 3EJJX 1SQVD 4JY4B 3MV9D 1PP9E 4NQXA 2E5YA 4PLKC 3O6QA 2F1AA 2RBLA 3B5HA 1KILC 3GINA 1N73A 5D5ME 3S8GB 1HVXA 2IEPA 4WEBL 5LLIC 1CXFA 4JZNA 3RGVB 1UQSA 1NC2B 1XZ0B 3CFQA 4NSKA 4L05A 1WTLA 3JWOL 4G11A 1BLIA 1JGLH 1AP2A 1H8SA 4POZD 4OV5A 4QXGL 2NRDA 3U48A 3GPEA 1E8YA 3FSZA 5FCUL 1CFTA 3UO1H 2O61A 1BECA 2YUVA 1G2CB 1P4BH 1OB1B 4NO0A 2CXGA 3VUAA 5KJ7A 4L3ED 2BVQB 3NN8B 2RCSL 4N0FA 1WBZA 3MLYH 1JGUH 5FPIA 4KMQA 3J2PA 1JGVL 4FKEA 2AXTE 1N2DC 4HAFA 1NGPH 4N2GA 5TFSL 4F7CB 5I1LA 4AX3A 2FYUE 1ND0A 4R5XA 2O5NA 4CVWA 2Y7MA 4DP7X 4XHJD 3QPXL 1Z5HA 3GSWB 1DLHA 2R2HA 2NNRA 3X13A 2WK2A 4EZLA 2R0WL 4L4VD 2VQ1A 1FO0A 3DROB 3NJXA 2WB7A 3QCTH 1OP3K 4ODXA 4U7KA 2AJSH 4M7KL 3B5NA 3FW6A 1SXAA 3FYIB 1GGYA 3BLBA 1RUAL 1MCWM 3PGDA 3I2CL 1F13A 4DK5A 2R51A 3X14A 3K6SA 4LO9A 4N0YH 1U6AL 3VFTA 4LIQL 4ODUB 1T6AA 1FNGB 5T1MA 3RX5A 1XGYH 2VM9A 5C0CB 3B7TA 3W39A 1TJHL 4JGUA 1KYOJ 1BFSA 5MEQB 1BYNA 2ADFL 2G0LA 3CFUA 3VXRD 3OKKA 1OCWL 1HH0A 3V0GA 4GRLA 4NJAH 1J7VR 1M53A 2R4SH 1VRSA 4LF3B 1BFOB 4L37B 2CAKA 5JOFA 1HC1A 1UJ3C 5B3JF 4HZLA 3HZMA 2FL5A 2BJML 4Y4FD 4P2YA 4HGWB 3R2PA 2OL3L 2XC8A 3L16A 1N5AB 4PG9B 4YSTA 3S96B 1EMTH 4QRTB 4KKRA 4PLJD 1E79H 4NZDA 4QNPF 3HE5B 4NLAA 2PLTA 1SFHA 2ZX7A 5GS0L 4NUJB 1U4FA 1ED3B 1QLEL 4PCSA 3LKQB 2C8NA 5E03A 1ZDQA 1NU1D 1CXKA 4NKOB 1TO5A 1LWHA 1RJCA 3MUGA 3OWRA 1NTMJ 4DKFL 1XCQB 2J8UF 4FHKA 4NKMA 5D1QB 2NXYB 4EN3D 3O4LE 3VYNA 3I50H 3WLBA 3DIFB 3NSCA 1XMWA 2XY2A 3P1VA 4HFWA 4OIAA 3SDYH 2RH0A 5TF0A 3KPLB 5F88B 3R4DA 5DRZA 4UDTB 4DO6A 1IEHA 1QFHA 5D1ZD 1HS6A 3LPWA 5B5EH 2DI8A 3QDMA 2JIXB 1BD2D 4PJEA 4W1TA 5B7EA 1YAZA 2AK1H 4JM2A 5F3HB 5HYJB 2O6DA 5FHBL 3QDJE 3QXDB 1WPCA 3WEBA 1JMXA 2AERT 3WTXA 2I1JA 3GPSA 5AB1A 3ILDA 1MRCL 4UQCA 2QV4A 4HHAA 3VGFA 3ZRFC 1PPJE 2VO5A 2AEWA 3QA3A 4WFEE 1W0YT 1A7NH 1NBYA 5F6IB 1BF2A 3UTZB 2R56H 4Y5XC 4HC1A 2BIPA 3KEDA 3LXAA 3B83A 5KOMC 5PAZA 1ZLWK 1F1AA 5DZJA 3WJMB 1L0QA 1G4RA 4K2UH 5C0GA 1U8NA 1IC5H 3HB3D 2ZUYA 2I5YH 4BK5C 1FDOA 1T2QL 1AQDB 2MNWA 3TSIA 4Y2LA 2MCG1 4WIQA 5JW5A 1A4AA 5DK0A 4NKIL 1JL8A 4FP8L 4KJPC 4N90D 5AALA 3RTQC 4ZMXA 3W0WA 3GSQA 4U1IB 2N1TA 3TPUB 2E0PA 3LEYL 4AT6A 1SS1A 3GSNL 3LYRA 1HZHH 2DZEA 1ODUA 4L4TA 4YZFE 2AXTH 2Z4TA 4QXTB 3TO4B 3S36X 1H3VA 1Q81Q 3CZSA 3UPAA 5IIEA 4FQPA 3K72A 3BWUC 1HWGB 1LLAA 1M7UA 5IB4B 2EXYC 5KVEL 1KB9K 1ZA3A 5C1MB 4HS6A 2WSCJ 1OVZA 4P48A 3P11L 5HHVH 1F97A 4LCCA 3HC0B 1IM3B 3HBPA 3TNNA 4HOWA 4PS4L 2EVGA 4L73A 1H0TA 3IFMA 4N5ED 2NZ1A 4MS8D 4EI5B 2BCMA 3AT8A 4OW6A 4NP4H 4O58L 2H9GB 2J8HA 2EDKA 4JUTA 2VLKE 1A3LL 2WLNA 4L8CB 4OKVB 3HHSA 1B0GA 1R3LB 3MRRB 3HD7B 2VAAA 2ZXCA 4MJ5B 3ZRSA 2ZKWA 4OZGA 5TTRA 2ZZUT 2VDOL 1YNTA 4PP2A 4NHCH 1YMHA 1SMOA 1MEXL 3HE7C 1JDCA 2B0SH 2MOGA 5EMYA 3MVSA 1FVEB 3EBGA 1DJZA 3S5ZA 4EI6B 3D39A 1UYWL 1R8EA 1H5BC 3F7VB 2P7JA 4FJ6A 1KYUA 1TQCC 2VSMB 3MRGB 4LP5A 4XXWC 4AUUA 1CWVA 2F6AA 3U0TB 1KNOA 1BQ5A 1AANA 3TC9A 4ZQTA 2NY3D 2X38A 5LBSH 2MKVA 4LPXA 4EEEA 4FFWC 4JN1H 2XQBH 4GQ9H 4HPHA 1RK1A 5J13B 5I74B 4XPHH 1GGIL 2WUBH 1VQLP 3WNIA 4FI8A 4OIIH 3ZL4H 3NK4A 3NZ8A 3UROR 4ONOA 3PNWA 3U6RB 1VQ8P 2FJHB 4N85A 3VX1A 3HTKB 2H26A 5B8CA 2PKDA 4OKDA 4PJXE 2ZT9B 1QUNB 3MPCA 5K1JA 5MP6H 5I0XA 4DKEH 5J12C 4NQVB 2R1XB 2AV7B 3QPQC 5I19L 1QSVA 2WWMD 3ULAB 1N7SC 5CJQH 2G2RB 5FO8B 1XCWA 5D4HA 2CO4A 4MCMA 1EEUA 5E2WL 1HHHA 1UA6H 3I75B 1JZ2A 2AQ1A 3BH8B 2QZQA 1LO3H 3CCMP 4UIKH 4QXUL 3LQZA 1XB6A 1GIGH 1KEGH 4Y8DC 2KB7P 1AHWC 2X40A 1U8LA 4JO1L 1MCDA 3SDAD 4AUJA 3EYFA 4H0GA 5DVMA 5FYKH 3B2DC 4HKBA 2D7QA 1RF1C 1CD0A 2GABA 5GTHE 1EUTA 4WSKA 2NR6D 5E2VH 3OLGA 1GYAA 4IQHA 2YPVA 5IGXL 4KZDH 3BGMB 4J6RH 4KITB 2QSIA 1UFGA 4GI8A 5IEKB 2YFNA 3I3DA 2GYSA 5HY9B 1ZKAA 2O5XL 2OJEB 2R5BA 2WVSA 4UAOC 4X4YA 1SVFA 1YEGH 2X4SB 3FO2B 4IS6B 4CC1A 4G83A 3N91A 1T2XA 1D2OA 3JTSA 1AJ7H 3GNMH 4MXQC 3GT6A 3H1KD 5DSCA 2OXHA 1QMUA 2R0KL 4FOMA 2ED7A 5CXPA 1R5WA 5DEFB 1IGCL 2ATAA 2JELL 3VFSB 1JVOA 1KXTB 4YDVA 3G5VB 5IVZB 5L2KD 3BP4B 1Q9OA 4ZXBC 1F4XL 3DSNA 3WD5L 1FBIH 2WC7A 3QUZB 5E8OB 4Y9CA 1ZHBA 4PRBA 5DEJA 3FFCD 3L1OL 4LLQA 1QABA 4MJID 3WUVA 3OA7A 2VDPH 3TL5A 1XF3A 2I25N 1OQXA 1OVRA 4GG6B 1LTBC 2WLLA 2WMMA 3D3VB 1CI5A 3S88H 1N6QH 4XH2B 5DZOA 2B3RA 4L8BB 5ABZA 1EDHA 2VE6A 3PV7A 1Q0XL 3O0RH 3L3IB 4F2MA 3PQYA 3VWKA 4XOEA 3EYQC 3O45B 5KLVJ 4BXSV 5AEAA 4XBGA 4FQJH 2NPSC 1DN0B 3LMJL 1PKQA 3TCLB 1W2EA 1B4JL 4J3UA 1IIIA 4Q58C 1LGHB 1UWFA 2C1OB 3NPZB 5CBEB 2UYLB 1KIUA 3AVEA 2BVPB 1BOGB 1U8KA 2AJXH 4ANKA 3WN5A 1V5JA 4O4YH 1AYOA 4YSOA 2ICWB 2YEZB 4UANA 4WWIA 3TBWB 3WAJA 2Z8VC 3QHFH 5BRZE 1QOKA 2NYYD 3ESOA 1Q1JL 2EDYA 4PJ5E 4QT5A 2PYEE 3L7FB 3B2XA 2FXPA 4OF3A 4P5TB 4KTGA 3L4XA 1JY2O 2GK2A 2VDML 3AG4B 3STBA 3LIZA 2FSDA 1XBRA 4E42B 5GS1A 2XZQL 2FK9A 1ZVYA 4XNDA 2FRGP 2ITCA 2VUOA 3B9KD 2AITA 3VGEA 3GLMA 2GTWB 2VR4A 3KLSA 1X5AA 3ZU8A 1TVHA 4HUXA 2DYPA 3EHBD 2OMNA 2P8PB 4MS6A 2BVOA 5MEPB 3QO1A 1F1GA 4UTAL 1A2YA 4IRJD 2WSKA 32C2B 2I7SA 5T1KB 3VXUB 3MXWH 4R8WH 4JFEB 2WXNA 2VN6A 1URLA 4F20A 1NMAH 2L8AA 1FAIL 5DJ6B 5HDLA 1KIPB 5IFHL 3BVUA 4YDZA 2EP6A 1GJUA 1CK0H 1DL7L 4H20H 4MNQA 2WYHA 5D1QE 3EUDA 5EOCJ 1FLRL 4P23B 4BFJA 4GBXB 5FB8A 3G7TA 1QACA 1S9WB 4H5SB 1WC7B 1G9NC 4ZUUB 1PZDA 4YBQD 1FVDA 1SUJA 2F19L 5GS2H 1OE3A 1S5HA 5IB5A 1UB6A 5F44A 1CDHA 2KKQA 3FRUA 4ZW8A 4HGMA 3HZYA 3RG1C 1E7VA 2HCZX 4WNSA 3AADB 3E1IA 4WGWB 1MSPA 5GJTL 4W81A 3T2LA 4GP5B 2YPLD 4JREB 3EGXA 1QQDA 3E2HB 1ZXKA 2AABL 2VERN 2RTTA 3RWJB 1FRGH 2JI3A 4BDVA 3ULVH 4DVRL 4L3CB 1RJZB 4YHKH 5KKZB 5ETUB 4P9MH 4W4OA 3DO7A 3MA7A 3UPCA 1JXGA 1P6AB 4UT6H 4L29A 4FLQA 4MAYD 4XPAH 4GKLA 4LLYA 1NKZB 5B38G 1I1AD 3NCWA 5E9DA 1NBVH 4JFDB 2KQNA 2IPKA 1JK9B 3LDBB 4NXKA 4G7YL 4M6OH 1KB9E 4R7XA 2EDLA 2IG2L 2NDFA 1AAJA 1CZ8H 1HXKA 1EJFA 5EN3A 1M90Q 3D85A 1ZEAL 2FX7L 1CGYA 2EIZB 2WXQA 2ZSWA 4GG8A 4X98A 1E5WA 4YDKL 1OHZA 4N28A 4YFDB 1XF5B 5BUAA 1NTZD 2X4OA 4P46C 2H1PH 3UMTA 4GKZA 2YBRB 1OZTG 2APVA 3NIFE 3VFOA 3QISA 3QEQD 2KI6A 1YQVL 4L2LA 5HGDA 4Z7NE 3KXFA 1TG8A 4NM4H 4BSJA 3BH4A 1BA9A 4NPJA 1K2DA 4X2UA 2VH5L 3QC5X 2Q7CA 2HPOA 3G6JF 1DO6A 2XPZA 5IFAL 3L74J 3T09A 3EXJA 3A6CL 1HCVA 1MIML 5CZRA 5IROC 2MHAA 1DVSA 1YEDB 1BSNA 5EN2B 2GCYA 2JWYA 1T8ZA 4EOWL 4YL4A 4JPWH 3ZE1F 4F8QA 2IYPA 1MJ8L 1SEBB 5BZZA 1QBML 3SD2A 5I8OH 1MELA 2VERA 1NTKJ 1M1JC 2FWLB 3NFPA 2WXHA 1HILB 3QQ3A 4U3FD 3KYKL 3QORC 2WLKA 3MJ8B 3MLTA 3HR5A 1QI3A 5HDQH 3ZE2B 4WEMB 1KCSL 2VZ1A 5L8LB 4Q9QL 3OAUL 4J2QA 2LE9A 1FYHB 3OB0H 4JUSA 3DOHA 4O5LL 3DMMC 3WDJA 4KZEH 3EOBA 3Q8AA 4HCGA 5JPNA 4ZS7L 5B39B 4X80L 2OQQA 2K78A 2Z35B 3ECVA 3IRZA 5GRUH 3GHGC 5ENWA 2K3TA 4IKKA 2XYCA 3WO3B 3D09A 4BV1A 3FQYA 1DCEA 4TV3A 3L3DB 1LMIA 4OVNF 5HYQA 1F86A 5CEZE 1GHFL 3R4YA 3UIAA 5APYA 3F65A 2F54A 3SDDB 1SBSL 2VIRB 3V6FB 3ZHLA 2E76B 2JXMB 3L75G 3BQUB 2NY0D 1OSZB 1RJYB 3OKOB 2VC2L 3NJJA 3GGWB 4M56A 2VLMD 1A3QA 2CDEA 2IBZG 4AVKA 2DKSA 3BO8B 2DWXA 3A0HE 5J56B 5IZ7A 1R75A 4OFIA 1P7HL 1J87A 1RIHH 5BMFH 1XSJA 4AEHH 2M2DA 1Z5LA 2AF2A 3K6NA 4FTDA 1OP4A 1Q4NX 2DQDL 4J39A 1PX3A 3AZUA 4ONGL 1GL2D 1PG7W 1XFPA 3EJZD 3H3BC 3KGSA 2CRIA 1A1MA 3MRFA 4U6XB 1SFCA 2YD1A 1OT4A 3RX9A 4N6JA 1E28B 2W65A 2BIMA 3MRMA 1K5NB 3MLRH 1KGCE 2H8PA 4PGDB 2E75C 5IG7B 2XN9D 5GXBB 4FYQA 4AENA 2DL9A 5BVJB 1C1EH 2CU9A 2RAMA 2GJJA 1YEIL 4I2XB 2CWRA 4I13B 4JPKH 5IVXF 2XTSA 5EU6D 5T3ZE 5I2IB 2BZ7A 1RHFA 3QDGA 2WNXA 3T0EC 4U0QB 4DSYA 1UM6H 3AWGA 3IJ9A 2R1WB 2ADIA 4NOFA 5EC1A 2EDFA 3PWLB 1E27A 1G6RB 1DVYA 2XI9A 1XMEB 2EIEA 2KC0A 1SQBD 4PD4K 1KB9H 3HI6L 5EOTA 3HAEG 3CDCA 5CHNA 1QO3B 4Y16D 3KPSB 4ISVA 1JM0A 2ZAHA 2C9XA 3UZEC 1DIPA 5F1OB 1WAEA 4JPIA 2R0ZL 1E6JL 2ZFCA 4G9FB 4PRPA 1N8RQ 3LRSB 2G3NA 3QUMA 1CSBA 4A7TA 1IAIM 2GAZA 4F8OA 3FU8A 2COQA 4OGQD 3FFOA 4BIKA 3RI5F 2W95A 5EF3A 3INUL 2V3FA 3FZUC 3PL6B 3IDXH 1XGQB 1P6WA 4WI8A 4WGKA 1CL7L 5HD8D 2W60B 4KK8C 5KSAB 2YMKA 1SQQG 2IQ9L 2WBJA 4K7PL 5AZEH 4C8XA 3H1LG 4GG6E 4K3DL 2XWXA 4LPYA 4G72B 4P59L 4ZAKB 1LJMA 3VSQA 3CFBA 3KLHC 3QCVL 3HZVB 2WKLA 3V2RA 2DL2A 3BKYL 3CFEB 3QW9A 4E41E 5CU5A 2FO4A 2AFNA 1JMBA 3GBDA 1GPOH 2Q76A 3C6SB 2AI0H 2FECI 4LP8A 1QSFE 2MWCA 4HFUL 4XMVA 1WZ1L 3BIKA 5C08A 1R5IA 4AL8C 6PCYA 1EAJA 4MXVF 3RVUC 2NOYA 3R06B 3RK2C 1EPFA 3GMLA 3IGFA 5F0PB 4XWGL 2KNCA 3MRDB 1AVYA 4XAWL 2A74B 3JWDC 3SJVD 3MJWA 4P5KB 4FA6A 2RMZA 5JYLA 3L36A 3NJMA 3FONB 5DD6A 5BXFA 1NDMA 3MCLH 3GK8L 2ROYA 3U4EA 4F7PB 4QRRB 1UWYA 3L72J 1BAFH 1E7UA 3CCEP 2A06D 3A0HH 1THAA 3IJEB 3FMGL 4KV5F 4M7LT 5EBWA 1PS3A 3CIQA 4M03A 3TBYA 5EOQH 1DJGA 2W80C 4PRAB 2MOQA 3H53A 4JVUA 1P2CB 2X4PB 1BQKA 3US1A 3ZKSD 2F58H 2LOEA 3LEXA 3HS0C 4X8CA 4NQUA 2CKBL 1OAXL 4F8NA 3GBNL 4FEIA 1MREH 4O51A 2TRYA 2ZWSA 3ABGA 4KKLD 1A6ZA 2IPTH 3U9PH 1MHEB 3LZNA 2ICEC 1VA9A 2GFBA 3IJ8A 3BEWB 1WF5A 3CFCL 4EQ2A 4S0HA 4PRIE 3VXUE 2YRPA 2IDTA 2WO3B 1FG2A 4IOIA 4LOUD 4Q4EA 1QLFB 4I3RL 5CCHE 1F6LL 5I1KL 2AK4E 4FZ8L 1TUPA 1KCVH 2ZNXA 1OE1A 3LZPA 1BVZA 2FIKA 3GHEL 4NAJA 4FMVA 1MRDH 4KO6A 4XGZA 5CNHA 5TF1H 1Z1WA 3D18B 4OD3H 1CC3A 2GW5A 2IXQA 4PJEF 5T3XH 4JM2F 1I7RA 3BVVA 3DC0A 4N1HB 1RQVA 1Z9OA 3QI9A 2Z31C 2X4RA 5D2NC 1L0LJ 2HTKC 3QNXA 4NRXA 2D2CD 5JPMB 3HNSL 5IW6A 4QKTA 2ORBL 1ERNA 3WGUB 3JV6B 4Y9GA 2EDTA 4X7CC 5AWNL 4JFZL 1X5JA 1PMYA 2V2XB 4GSQA 2X0VA 1DH3A 4E9LA 1ZLVK 1HJCA 1MFZA 1TTRA 5D7JD 3I74A 4W9JC 1YIJP 5CSZB 5DT1L 3BH9A 3QEHA 4IU3B 5C0BD 3DOSA 4S2SB 3F04A 2O72A 5GHWL 1F90H 3ILPA 1OF2A 3ALPA 2OL3A 4ANUA 1GCFA 1EEYA 3CK0H 1KSRA 5TJHA 4OBSA 4A7SA 1WTGT 1S9XA 3N41F 4PHZA 1M2VB 2GT9B 4P4KB 1YC7A 5I1CL 5IY5B 3OLEA 1UWGL 1J0HA 5IESH 4X9IA 3ETSA 3RIAF 2HKFH 5E8PA 2Y7LA 1RPKA 2XFXB 2Z7WA 2IIJA 3EH3B 2ODIA 3AEAC 1B2WH 1A5FH 4HIIB 5DS8A 1HZLA 3JTTB 2H2SC 4DFIA 5HGBB 5EO1A 4KQ4H 1O7VA 5FYJE 3SWYA 4GRMA 4WK2B 3O8XC 5BS0D 4PJ7A 3QWNA 2IFNA 4JDVB 4YHIB 5C07A 5IQOA 3GJEB 3ARGB 3OKNA 5HHQA 4JN2B 4YLBA 5BV7C 4NDMB 3SDCD 4Y4HB 1D7MA 1L0YA 1FL5B 1VZGA 2Q2EB 1JPGB 3D8MA 5DD3H 2VZUA 4H8WC 4QJ3B 3QWRD 4OF0A 5C0AA 3H3PH 2NLJA 2WSPA 4PWHA 3RY6A 5C0RL 2DD8H 1YNTF 3DURA 3Q43A 1OXZA 2ZP9A 2CHNA 3PDOB 4OIFA 2BY3A 4YHNB 3PUUA 2CDGB 2BFGA 5IOPA 3CXDH 1JZHA 4IW4C 3LKNB 5LO7A 4D8OA 4ZFZA 1L0PA 1VHPA 2UY7A 2XV0A 4JQXC 1BFVH 1E3FA 1OM3L 2MQCA 2ALWA 1IX2A 2P1JA 1NC4B 2CPBA 4M93B 3VFGH 4AYMC 1M8OB 4NBXB 2OK0H 4NZ8A 1OM9A 3NMDA 2DBJA 2YZ8A 2BDNL 1QHOA 2VDKB 3EF7A 2O5YH 4FXGC 1A47A 4GKNA 3CLEL 5TH2B 3HI5L 4AYFA 4MMXB 1NCOA 3FQTA 3KWXA 3TF4A 3NCJH 4JKMA 3GSNA 3HJEA 4N0UE 5IF0A 4HUUA 1ZSHA 1UFUA 2HLFD 5GPRA 4APQC 1NWQA 2H6PB 2P5PA 2FIRT 3PY9A 5K9JL 3ECBB 3IDNB 1D5ZB 4PJBB 3DDFA 3PPEA 5BW7A 2I60L 4KVNH 4M8QA 1YYCA 3I02A 4BD4A 4YSEA 5LDSA 3RL0C 3RY5A 4JHBA 4ORGA 1FDLL 1N5YH 4ZMOA 5HYSA 1JWUA 2DM7A 3KAAA 5IJVA 4CSSA 4AMXA 3N42B 1MCOH 2X70A 2ZX9A 4KKAD 3UYOD 2A45G 2VLJD 1XCTA 3UG3A 1URQD 3VMAA 4NQDD 1SQVK 4PD4E 1JO5A 3FN0H 2A73B 4PJCE 3R8BB 4L3EB 4BRVA 3PH0A 2DJ4A 4GAJL 2X3AA 4OQTL 5CZXD 1W72H 3S8WA 3WHXB 1R5VB 3ISWA 4PM1A 5A16A 4NUQA 2XV5A 3ARQA 2UV3A 3MLZH 4IBUA 3OMIB 5DD0H 3VFUA 1PYWA 3RGVA 1HTLC 1NC2A 1RP8A 3ZGHA 1NFDA 1Y6KR 3RIFK 4YFEA 1YCSA 1VQPP 2C3HA 4L4VB 3RWGA 1IO4A 3FU7B 1U8PB 2HWZL 4G6KH 1M7IB 2I85A 2P5ED 3KGUA 1L9RA 1RUPH 4Y9FA 3J07A 1UA7A 1I3RA 3MP7B 3BDXA 2F1BA 3CN2A 1OB1A 8FABA 1NPUA 1IJNA 3SWKA 1W91A 4PBWD 3X1BA 4DP0X 3H8NA 4XBPA 4XN5A 3TVMC 3O6LL 1RUQL 4XAKD 2I27N 4KX8A 4N3YB 1FZFA 4ATTA 2DQFA 2C1PB 3EF4A 4HJGA 3O6FB 4AJWA 4F7CA 3OF6A 3VXRB 4BFBD 1RP9A 2KYIA 4MB1A 1QI5A 4LAJH 3FHQA 5F7FA 1EHLL 2QPDB 3MV01 1LO5B 2WZ0A 3DROA 3B4NA 4JRXA 4Y4FB 1FNLA 3VU1A 5D72L 4G9DA 4DTGL 5CBNA 3MD0A 1M1XA 2B1AL 4WBAA 1IM9D 4XZUB 3VXOB 5CLYA 2RACA 4ABWA 3HG0A 4X7SH 3B2VH 1TVDA 3GLAA 4UF7C 1OWAA 4U49A 4Y2DC 2OS7A 5GQBA 3RVXC 5MEQA 1XBDA 4LNVA 4L18A 2HH0L 2QKIB 3ETBF 4AGPA 4Z7OB 2JCCE 1Z32X 4IOSD 4HUVB 1THCA 1OAKL 3UG4A 2XG4A 3HE6D 4LF3A 2Y7SA 3H7LA 4MAUH 3T5WA 4EN3B 4GXFA 4MMZB 4XP9H 1RERA 2PP8A 4G42B 2JK5A 3V0EA 2AQNA 4E9QA 2ZYGA 1HI6A 4GMTH 3FT2B 4LHUG 3FKUS 1ZXQA 2CGRH 2ZD0A 3OHXB 5IJCC 1RIUH 3DIVA 2IJ0C 1N5AA 3GSXB 4PG9A 3S96A 4TVPL 5D1ZB 1TMCB 4FG6D 3OZLA 4QRTA 3TYGH 3K1KC 1N7MH 1Z56A 43CAA 1NU1K 3GEWB 5T33H 1BD2B 4Z3IA 1YDPA 4DESA 5IK3B 4JEGB 3VO0A 4NGHL 4WRLA 4D3CL 4BGDA 3P4NA 4NUJA 3AU1A 3F58L 1BGYE 3BPNB 4TNVK 1FJ1B 5H2BB 5CCKH 1BZ7B 4NKOA 3IMUA 4AVJA 1KBKA 5LGKA 3LSOB 4M00A 4TUKH 1S9KE 3QZWG 1UEYA 4M5ZH 1F58L 3S97C 2COVD 3ZZSA 4V33A 3IDMB 4HD9A 1NTDA 1TCRB 1R4XA 2X9XA 4WWKC 1QZNA 3T8MA 4HKZH 1KEML 1L4IA 2EH8L 4KI5E 1EWHA 2EEAA 2HRPL 3QH3B 4GW5A 5F88A 3T3ME 4UDTA 5IQ9B 1B2YA 1ZLDA 3BE1L 2WQRA 3HB3B 4GINA 4HCRH 1TZIB 1LTJC 1DBKL 7PAZA 4KI1A 5A2KH 4AUWA 2AV1A 2YFOA 4J8QA 3TBVA 1E67A 3IFOA 3TEYA 3ZIMA 5HYJA 5FO2A 2KMWA 5F0LB 1TTGA 1RAMA 3RDTC 5KVFE 3RBXA 5C0JA 1U8MA 3O2VH 1UG9A 1HYRC 1TJIH 1EAPA 2Y36H 5CILL 3J8F7 1ZRTE 2F08A 4Q0XL 1ZV8A 1JNLL 1RVFL 1NANH 4CGUB 1EHXA 3LPPA 5K39B 4JO8A 2B14A 5DQ9B 2AXCA 4M5TA 3U0WH 1RULH 1BBDL 1K6QH 1MRFL 1ZT7B 5TK2A 1WRGA 3IYLW 2YKOA 1CICB 3NCYP 4DKDC 2VZTA 3B7SA 2FATH 4Y19A 1AQMA 4P9HH 4DP2X 4HUWA 2IWFA 4WO4C 2WQVA 4EKXA 1HJ0A 4CADB 5AW1B 4U1IA 3K71B 4IDJL 4PWJA 4OGAC 4FCAA 5EU5A 1YY9C 1FZKB 4MD0B 4EDFA 5IJBC 2OXGB 5DUBB 3U30C 1GZHC 1L6XA 3JV5A 1JRHH 5LKNA 1GGBH 3DX6A 2XZCL 4QRSB 3ARDD 3O2DH 5DVPA 4XMUA 3GTVA 4PCYA 1IBFA 1OP5H 4FQXC 2XA3A