4XE5B

Crystal structure of the na,k-atpase from bovine
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
281
structure length
281
Chain Sequence
SEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEIAFRPNDPKSYMTYVDNIDNFLKKYRDSAQKDDMIFEDCGNVPSELKDRGELNNEQGERKVCRFKLEWLGNCSGINDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVQCTGKRDEDKEKVGSIEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
publication title Isolation, crystallization and crystal structure determination of bovine kidney Na(+),K(+)-ATPase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 42
structure length 281
sequence length 281
ec nomenclature
pdb deposition date 2014-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4xe5B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 4xe5B02
3NMDA 1T2KC 5APQA 1CZQA 3V4WA 3O8ZA 3HE4A 3T97A 2N9BA 1GZLA 4DZOA 2YO3A 1FOSE 1T2KD 3KQGA 3P8MC 3M91A 2E43A 3VYIA 1DH3A 2C9NY 5AW5B 1IO4A 1JNMA 2W6AA 3TK1A 1JUNA 4GKGA 3B8EB 2P67A 2R3CA 2WPRA 4I2LC 4GT1A 4RETB 2ZFCA 5AVVB 5AVYB 4HYTB 3KDPB 5AW3B 1S9KD 5APYA 5AW6B 2R5BA 2H7HA 2WT7A 2XU6A 2WPQA 2Z5HA 4JYBA 3OAKA 3L36A 3A3YB 2WPSA 1J2JB 2E42A 3A2AA 3MD0A 1OXZA 2BASA 2P7JA 1G2CB 3UIAA 4B86A 2QM8A 3NTNA 2W27A 3M06A 3MGNA 3IR9A 4C46A 3M0AA 3HE5A 1MFZA 2WT7B 2XV5A 3M9HA 1H8AA 2R32A 1GU5A 1HBWA 4M3LA 1OWAA 4XE5B 5APSA 3V5BA 1NWQA 3HE4B 3A5TA 2YO2A 3NXSA 5AW9B 3VMYA 1X8YA 3I5CA 3TYYA 3HTKA 1GK4A 1NAFA 4RESB 4LC1A 5AW1B 4AYCA 5AVXB 3LIEA 5APUA 5AVQB 1CSBA 1YYCA 5APXA 3P32A 5AVUB 5AW4B 1H89A 5AVRB 2ZXEB 4I6MC 3VTPC 1S9KE 1GK6A 1GTWA 5APTA 5CMZA 3TNUA 1HWTC 1H88A 2P2UA 5APWA 1HJBA 2IPPA 4KHXA 2VRSA 5AW2B 2C9LY 4AUWA 3WGUB 3SWFA 3LIDA 2Z5IA 1CI6A 1KQLA 5AVTB 3WGVB 2JJLA 3VMZA 3M9BA 1HUCA 4AQRD 4C7NA 3TNUB 4EOTA 3M0DA 2Q7CA 1FOSF 3VMXA 5APVA 2YNYA 3VN0A 3HE5B 5AW0B 3P7KA 1SP4A 1A02F 5AVWB 2WWWA 5AW8B 2Q5UA 1GD2E 3V4QA 5AW7B 4JYCA 1MUUA 2Q3IA 1GU4A 1CI6B 1FAVA 2QM7A 1SLQA 2XZRA 4C7NB 2KP8A 3L37A 5AVSB 5AVZB 3L35A 1MV8A 2WTYA 3A7OA 3NFQA 1A02J 2R5DA
chains in the Genus database with same CATH superfamily
3DUUA 2AJYL 3J07A 5KVDE 2W92A 2GK0A 1SMDA 1ML0A 5C86A 1M05B 3MLTB 5ILTL 4PJ5A 1NM4A 3UYPB 3WUZA 3BUDA 2Q8BL 4RDQF 5FUOL 3MUY1 2ORBH 2XFXA 2M83A 2YIUB 2Y1YA 3FT3A 4G42B 5E6IC 3VQMA 2F54B 1IFJA 4M1DL 4EIUA 2W6AA 4W9FC 1FFTB 1ZS8B 5HGAB 3VXRB 3A0BH 1BE3E 1U8OA 2B9BA 2WTOA 3K8LA 3TJHD 3CQPA 1U95A 4AJWA 3ECWA 1KZUB 2ED6A 3L36A 4F57L 2OMYB 4KDTA 3BAXA 2E27L 4NCC2 4ZMAT 2KUTA 4J6RL 3VQLA 3DJSA 1R19A 1GYUA 4HWEL 4RCAA 3JWDH 3AECC 4M5ZL 4BE5A 5K1NA 5L2KA 2OI9B 5GGSY 1BX2A 1Z6JT 4BH7A 3IFMA 3RKDD 3BRDA 1X5ZA 1A9EA 1EDQA 2PTUA 2H1LM 4BKLA 3L3JA 4TVPL 2FQFA 3IXAA 1IBGL 5ID0B 3PP3H 2DM3A 3FOMB 5DQJB 3RWIB 3QS3A 2M3EA 5C07A 5IUSA 1UYWH 3PDOA 3QJZA 2A9MH 4HZLB 4M61A 5KBDA 4QJ4B 4H25A 1XV8A 1YYMH 4TT3H 2OMZA 1SQPG 5ANMB 3TWCH 4D3CL 3B2UC 4UM9B 4J4PD 2OTJP 43CAA 1P4IH 3MTUE 2B2XH 1KB3A 1X7SA 5AAMC 3C6EA 4UIMB 3FQYA 3CWBE 2MCG1 4X98B 3IJ7A 3V0VA 4FQLL 3ARGC 1OV8A 2R2CA 4Q74A 4WWKD 5SWSD 2IPPA 2YAEA 2KXPB 4ZFQA 3F64A 4WW1B 4XVUC 5DJYA 3ROLB 3U36B 1OGTA 5MP6L 3ILPB 5EC1A 3B3IA 2PXYD 1W72B 3RX5A 2PYED 3V4PL 1UCBH 3F58H 4I3RL 1FI8C 3DVIA 4Z0BL 3E1RA 1FSKC 1OQXA 3DX9B 1IFGA 1UH2A 1LK3H 3BWSA 4GINA 2ZUQC 2AXCA 4CSTA 4ZX5A 2ROXA 2XXCB 3IMSA 3RL2A 4UV4L 3CLEL 4DT2A 2B8OT 4IOFD 4TUOA 3ZU8A 2LFEA 4MNHB 2RR3A 2IMMA 4KH2A 4X6DB 4A7GF 4B9PA 2C3GA 4PG9B 1J5CA 4IRZL 2CQVA 4G59C 4ENEC 1ZEAH 2J8UB 2PPCA 1HCVA 4N78D 1WS7A 1ZHKB 3VI3E 1MELA 5HHQA 4X8JB 2BHYA 4M9OA 3O8XB 2J6EL 4U3SB 4CN6A 3NGBC 4ELMB 1NTMG 1IC1A 3D08A 4JB9L 1FLRL 5MEOA 2HX8A 4HPYH 4TNVK 1JY3N 2VZ3A 2V17H 1C5DA 4MAZA 4MDIB 3JZ7A 3G6AB 3MRHB 1A6TB 3NABH 4YIQB 4YBLC 4DTGH 4GP4B 2MOVA 2XTSA 4LEOA 1LE5B 1MHCB 4UT9L 4H40A 5ESVB 3MBEA 4I13B 2W60A 3PF2A 3QQ9D 4ISVB 1MCCA 4F58L 3WFEH 1QKZH 1P6FA 4NUQA 1KILD 1WFIA 2HJFA 4Z7NE 2FXMA 1OM3H 2Q6QA 2JXMA 3HG1D 4HPOL 4OLZH 2BMKB 2NY2C 4U1LA 4KRPC 2HVJA 1YQ4C 1U8NA 2AJUH 4PIBA 2YAQA 4OZGA 1SBSL 4R96A 4APQD 5J6HA 2V6HA 3H1LG 2NSXA 3LEXA 3LS5L 2IBBA 3ZKMD 2H0EA 3GXTA 3U2IA 1WFTA 1OOAA 5JXEC 4F3FB 4GKZA 4PGJA 1MREL 5CZRA 3ETBF 3BE1L 4LLMA 1A6ZA 1DVSA 4R7DB 3L3GB 4L4TB 3L5WB 3H54A 3KPPB 2BC4B 2R59A 3I5CA 2I9LB 2WYHA 4IRSD 4PGDB 4TVPE 2X4NB 2QGCA 4NRYA 4RESB 2ARWA 4OCRL 3A4AA 1HGZA 4ORGB 3BAWA 3MV7D 5IBUG 5KLVE 4H0IA 5EZIH 4U1KB 1AXTL 1T1XB 4XP1L 5GTIE 4XP4H 4N8VA 4JFFD 1DD4A 3WL9B 2Q86B 3LHPL 5JPNA 1HYSC 1CLZH 4QYOA 3HE7B 2P2UA 3EJYC 3VI3F 1PAMA 4AI7A 1BV8A 3BKML 3M1BB 4EI5D 4L8SB 1FFOB 1MCKA 2WXMA 5TDPB 1DUZB 5IBLD 3Q9PA 5D71H 3PRZA 4MJ4A 1B4JL 1SY6L 4X7TA 1NCJA 3OKOB 5EZOL 2ILLA 1A1NB 1FWXA 1E43A 4HXAL 4W81A 3VFGL 1DYZA 3BD5A 3V9FA 6FABH 1UM4L 3OAWA 4PD4J 1D9KD 3CFEB 2JLLA 4R5TA 3MX0A 3RB5A 5KG9A 4AK1A 4XWOD 3KHUA 2YKLH 3MA9H 1D6EB 3G5ZA 5E9DB 3RK2B 1UA6H 3RNKA 4U3HA 1BBJA 2ZG1A 4KU1A 4XHJD 1URQB 2XPGB 3ABMB 3BAYA 3WELA 3FQTB 1BCCG 4Y0GA 4Z7NF 5KAIE 3I75A 5E8OA 3STBA 3EYOB 2G5BB 3CHRA 4XN9A 5D5MA 1HXKA 1OGAE 2F5BH 3SKOB 1WHOA 1AKJD 3L3HA 5DD3H 2JVUA 1T2KD 2IAMC 3BWUF 1J05A 2XKMA 3F6LA 1NFIA 1NJ9A 2YEQA 4KTDL 3VWKC 5J56B 3TYGH 3IDJB 4H1LG 3WSQL 3N85L 1PG7X 4IJ3C 1AHKA 3PL6C 2WBWB 4FQHA 2HG0A 3O3DB 1WEJL 2IXQB 1PBYA 3QXDB 4L1HA 3DOSA 1OP9A 5C0CA 3KLKA 4QY8A 1KJ3H 1JPFA 4NOFA 5IQOA 1G7IB 3RWEA 1VA9A 1BZ9B 3EYVA 3FFCA 3D2UD 3V52L 1SRDA 4JFDE 1DJZA 3BJLA 1U3HC 2YUZA 2IBZG 3KPSD 3KVDD 3MDJA 2Y9ZA 5EU6E 1HXMA 2GEEA 2N1TC 4X7EC 3MNDA 1QTSA 1WD8A 1M7DB 3L4VA 4B86A 3TO4B 3T2NH 4RRPA 4GXUN 1DVFA 4XPHL 3TASA 1AHWA 4PBDA 4WFEE 4OJCA 4R3SA 2DOCA 2X1XR 4HIXH 1MI5D 1O9ZA 2MPVA 4JFEB 3MPCA 3GSXB 2X9ZA 1AXIB 5L2JA 1JK8B 1OAYH 4FLQA 1X6LA 4IS6B 3E0GA 4I3SL 4L4VE 1D5XA 3IU3B 3MREA 3WJLA 1J5IA 1YMHA 4F7MB 4K7FA 1CZ8L 1IC4L 2ZZUT 1KYDA 3UGUA 3ME0B 4M6NL 3X1BA 3PIQA 2B1AL 3QWRD 3MNZA 4JQ0D 5KS9E 4TNWK 2PWDA 2FCBA 5DJ2B 1NU1D 3TV3L 1E4HA 3RRQA 1R3JB 3TEUA 3WFDL 4N25A 1C7SA 1J1OL 1SEQL 2JNZA 3QWOA 3WHXA 2WNKA 3MRLB 2FXOA 2XN9B 2R69H 4ASVA 3KPLB 4KV5E 3B71A 1A7RH 2X6AA 4BE6A 1XHHA 1WZ1L 4G9FE 3KWWB 5JO5A 2Z31D 3QUYD 2WANA 4OUOA 1AC6A 4FKKA 3SY0B 3DUSB 4KX8A 4X6CE 5GZND 4MMYA 3UBXG 1HQRA 2PCFB 4Y5VC 1NAKL 2XT1B 3FSOA 4GBXB 1CLOH 5BV7H 4WF7A 3TO2A 3H1HE 2ZTBA 1GD2E 1WAAA 1JNLL 1S3RA 1X7QB 3H85A 3WDHA 3WY4A 5KYUB 4XAWL 2D8KA 5C7XH 1SUHA 1ORQB 4AYEC 1Q0EA 4GSXA 4KBPA 2O01N 4XBGB 3HI5L 5EZLB 2E74D 5BW7C 3D25B 3G9VA 1FC1A 1GGCL 5CINL 2RQ8A 4OM1H 4Z7WE 1TNMA 2W80C 4FXGC 5DHXB 3GJFH 1PKQE 3HFMH 1QHPA 4Z77B 3AACA 2ZNXA 5ERWA 3LPPA 1I7TB 4R0LC 2F5AH 3O8ZA 3C5ZA 4WO4B 3JWNC 4KOBA 4H0GA 4UDTB 2IBZY 2ZXQA 3NJVA 3F2LA 1BGYG 1F8TH 1N64H 4JUSA 4N2IA 4BZ2L 2C0WA 1FZEA 5TFSL 1UB6B 3WS3A 4DN4L 4P2OA 1OK8A 1M71A 3AREA 2P8MA 1IKNA 1E3ZA 3G6JB 1RU9L 1M6OB 3VGDA 2C4FT 1NFKA 2EYRB 1N2RB 4AZUA 5T5NG 1OE3A 1CFNB 1YEGL 1EWHA 1ONQB 3D09A 3KVPA 4OB5H 3QUKB 1U8IB 3LN5B 1FL5B 3QXAB 5DZ9A 3OA7A 2YD0A 4U1SA 5LWYL 3RL0C 1B3JA 2YGQA 1XGUB 4LAQL 1KB9K 1AH1A 4FQJL 3HAEA 1Q9KB 3O9WB 5JIMA 2OXGB 4LQ1A 3QIWD 4KQ3H 5J89A 5IB2A 5KS9F 1WC7B 2XJLA 1J8SA 2FYUJ 4OCXH 2NNAB 5HSFA 3N41F 1ZV2A 1QAWA 1VF5B 4KNUA 5FX3A 2NY6D 2P52A 4I0PA 5HI3D 2ISDA 1T2QL 4J3TA 1P84I 4KV5F 4OBSA 2HPTA 5AZ2H 2OMWB 4I8DA 3HMWH 1AP2B 2BCCJ 3I9GH 4U1GB 1P5VB 4LVOB 1B9ZA 2C34A 3WUUA 3OW2O 2SODB 4OJFL 4U3FG 5FGBA 3AAZA 4O2FB 5ADPL 1GSMA 5DVOA 4X6CF 3CXHI 4JM2D 4JPVH 1T89A 4PJIE 2VQ1A 1CTOA 4KKQA 3SCMD 3TH2T 3ARTA 4XNZB 2WBKA 4RX4A 1XH1A 5BZDA 4AENB 5AVXB 3FO0L 4JMNA 1LT1A 3KJ4C 2J56A 1NOFA 1BYNA 2WZPD 5TQ2H 3W2DH 2EKJA 3B34A 2ZOWA 2J21A 1NUDA 5AAWA 3FQNB 5BVPL 1N67A 5J9PA 2X12A 4X50A 5E2UH 4W7YA 2DYRB 5EN2A 1ZANH 4C4UA 5AZEH 3X17A 5ITFB 2G2PA 4Z7WF 2VH5L 2Y0SA 4MCYB 4XPBL 4JAMB 4YOKA 3ESNA 4U33A 4GAGH 2MKWA 4AQ8A 3B8SA 2AGJL 2CHNA 5ISZE 3CXDH 3N43B 5EO1A 1ZVHA 1USQA 1XCTB 2OPCA 4ZX3A 2O1JA 4J3OC 3CN4A 3IMVA 3E6FB 2FWOA 1FO0B 1LYQA 3CFBA 3FW6A 3GPEA 4MAYD 3SE9H 5IHLB 4ZNCD 3ZDYE 3C9NB 3IFOA 3K4ZA 1ICTA 2YBRB 3L72E 4YHZL 2ADYA 1FFRA 2E7HA 1L0LE 1EXJA 1ZIAA 1HCZA 9CGTA 3QIBD 2DLEA 3OKKA 4HALA 2G5UA 3BCCE 4DGIH 3T4AB 3KPTA 5KSVA 3KYKH 4GKOA 1Q94B 3CCVP 3OJDA 2IGFL 3D3VE 1PP9G 4MVBD 3IGFA 3NFQA 3FAXA 1QWNA 3UC2A 3VQ2C 4KVNH 3BUBA 5JW4N 5KBPA 3GRWH 2AXFA 5APQA 3D7PA 1KBVA 3IGAA 1UVQA 1IVLA 4GI6A 4OGQB 2BNQD 4JQVA 4EKXA 1N7LA 5E8EA 1PYWB 3CC1A 4H13C 3F00A 3O3BB 3KGSA 1R8EA 4N0RA 5GZOC 1BF2A 4R4MA 4DP8X 2YOAA 1Z5HA 4I1LA 2QJDA 2WXJA 4JMXA 5DYFA 2JKIS 1M1XB 1QI3A 4PJIF 2G3MA 3DX0A 2IIJA 5C7ZA 1KYOI 1OW6A 2VDRL 2FQGA 4J3VA 4Y2LA 3RZWA 4MJIB 3PGFL 3V5HB 2MJZA 3ZDMA 5AKVA 1ZWIA 2E6QA 3HC3L 3MV9A 4HXBH 4PLKC 2NW3A 4LLDB 4OD3H 4GSRA 4RZKA 1XF2A 3CX5I 4TLSA 4KTGA 1E40A 2H2PC 4BA0A 5J11C 2E4FA 3L1FA 3L13A 4NGHH 1ZLVH 2ARJQ 1BXXA 3HLAB 4WI3A 1HT6A 4Y4KA 5EPMA 5CGTA 2IH3A 4NM8L 2WNGA 1CXLA 4LLWA 5FYKL 3JTSA 3V8CA 1GZHC 4NQCD 5ICZB 1S7XA 5E1HB 2XRAL 5FW7A 2VLKA 2FIKB 3Q2WA 4K3EL 4IFMA 1XL4A 2N7BA 3EOAA 4NO5A 4L3EB 3Q06A 1CK0H 5B7MA 5GS1A 5I1AB 4HC1L 3ZDYF 3SGJA 4AVHA 5B4MD 1MCPH 2NYKA 2EDJA 3QZNA 1RIVL 3KWTA 1XCWA 2ZUXA 4NIKB 2CBQA 3KDMB 3KYOB 3MBWA 3NH7L 1FE8H 1JHTB 3KL0A 1KSRA 5BV7B 5CCGE 2YD2A 4L5FL 1VQ6P 1IAKA 3SQOH 2K9JA 4AQ1A 4N5UA 4BZ1A 4JL2A 4XZUA 1Q81Q 1AG6A 2O5YH 4M48H 2NSMA 5KSBA 4KKCD 3I6LD 1KPRB 3KCWA 2BZDA 4MZIA 1GGIH 2C9SA 4XXWA 1OANA 1DE4B 1KZQA 5AWNH 4NIYE 4XNXL 1E65A 4M7JL 2R9HC 5CJ8A 2F68X 1T1WB 4UB0H 3II1A 4Q6IA 1YEDB 2DMCA 5C08B 3FGAD 3ATEA 1O7DC 2ADJB 3GJFB 4ZRGA 5C71A 1AQHA 1IVTA 4HCRA 2F1AA 3MUDC 3QGVA 5EIVA 3ZSSA 4FABH 5KTEH 3N42B 1Y6MR 5I5MA 5B7EA 3H6AA 2I32A 2CO3A 3PWPD 4I7ZC 3V4VH 1YY8A 1AYOA 2K1AA 3AT0A 3OSVA 3PWNA 2W65A 4R4FL 4XCNA 5F93C 5D1QE 3ISWA 1JF1B 4EN3C 4IKIA 3WKML 4Y19A 2PR4L 1O6VA 4E41E 2BW5A 3QDMA 5DVKA 1CD1B 3ARDB 2DWSA 2RB8A 4MQ7B 5JA8B 4LLYA 4WNQA 3QS2A 1EAQA 2XKNB 1NH4A 2D9QB 3CPLA 4NP4L 4Y4HB 1AA0A 1JCVA 3JQOB 4P5TC 4WTZG 2IDUA 3RY5A 5CR1A 2DDQL 2E9WA 3H0TB 5CEXA 5BUAA 4O58H 3KGRA 1DDHA 2OLDA 3MR9A 1GOFA 3T08A 2JP3A 2GUOA 3BPNB 1LGHB 4Z0XA 1F6AA 1TZGH 2GIMA 1EO5A 4RETB 1PSKH 1N7ML 4HGWA 1I8KB 3RL1A 4BGDA 1AD9A 1A6AB 1P2CA 2YBGA 3PAVA 3T77A 3AY4C 2QADC 2XQBH 3V4UH 2F53D 5FUCE 2LLNA 2DWDA 5BRZD 1KB9J 3ZTJH 35C8H 1J2JB 4Q52A 3GJEA 2OYHC 4L9LC 3GEWB 1JGDA 4LPXA 1J8HA 3OGCB 4K7PX 4ZKUA 1UA7A 2EC9T 3FOLB 4R5VA 4NBYB 1G9NH 3GSNH 5D4JA 1D5BA 2XZQH 4UU9A 2YD1A 5DD0L 3Q9QA 3MJ7A 4JNXA 3BT2H 2YMYA 1ADWA 43C9B 3R0NA 2FGWH 1DEEG 3HD7C 3JV0A 2VR6A 4R4BB 5LBSA 4AQZA 4E5XA 5B38B 3AQDA 3BLBA 4GAYA 3DMMA 4PJEE 1TZ8A 3F83A 1ILSA 2CO6B 2EXWC 2NR6A 5CD5D 1BIIB 1HH6A 1ORSB 2KZJA 5TJHA 3MV8B 5GGVL 2WGNB 1QBML 4HWBL 3GQFA 5DR5H 2OR9H 5HDQH 1SQBE 4YK4C 3A4EA 1OAQL 5E9NA 3WUWA 1DQQB 3BZEB 4LU5L 2P80D 1TYEB 1SQMA 3MLSH 2DTSA 4OCWL 1E5AA 3E80A 1XD1A 4ELKB 2GTZA 3GBMH 3KYAA 5DQ9A 4B60A 3VFNA 5F7DA 1DBJH 3WTTA 4MA7H 4EZJA 4L5FE 3QRGH 3Q48A 2Y25A 1FZOA 2EDQA 2ZF9A 3QG7H 4XPAL 3RGVB 1FP5A 1S7VB 2J8HA 4WU7B 1Z3RA 1YTZT 2VLJD 3RHWK 2YUWA 3V2PA 4FQCH 3V6BR 3SPHA 2WXGA 1FZCA 1N7SD 4Y5YA 2O61A 1KJ2H 1QX1A 4ZI8A 3L4TA 3C5SA 1U8MB 4HJEA 5HBBA 1MLBA 4TQIA 4A7GA 3C6LB 3VFVB 1MG3C 1IZKA 2J5WA 3ULAB 2WYIA 3PGCB 3G04B 4HJGH 4PV1C 3Q13A 3H1JJ 1Q0YH 4CBZA 1N8OE 2BH0A 2EDDA 3Q0HA 3ZIYA 4S1RL 2VR3A 2VN7A 2ZWZA 3WBDA 4NRXB 2PCPB 4I5BB 3NMDA 1MSPA 4KROB 2ZKHL 1F1AA 5IROC 5TISE 4O9BA 1QTPA 4OFPA 2COQA 4ECNA 3HUSB 4FHKA 2DLHA 4AM0Q 3EBGA 1SN2A 5HHMB 4UIKH 1OB1B 2EINB 3OLIA 5J57B 2YRPA 1E7VA 3L08A 2Q3EA 3RFZB 3KZIH 5EU7E 4NQXA 2WPRA 4C4KO 5FO8A 1F02I 4YTPC 2Z8WC 2VRKA 1ZA3B 3EDJA 4PJEF 5H94B 5IVOA 4URKA 5E2VL 2GY5A 3O4LD 3TURA 4JFOA 4Z3IA 1SOKA 1Q9WB 3BAEH 4OLXL 2QRXA 1OSEA 4GT7A 2BFVH 1CW5A 4YVUA 1JZ7A 3AE6C 4J27A 3MOQA 1BQUA 5T3ZE 2YUXA 5C0EA 3IGKA 3FPXA 4ZO9A 2P7JA 1OAXH 1DBAH 1J5OL 5K39B 1OK0A 2Z4QA 4GAAA 4YDZA 4DP6X 1YAIA 4CN4A 1LP1B 1QNIA 3V4LA 5FIEA 4UBDC 1LO5A 2CRMA 4R83A 5DS1A 2HVKA 3VXUB 1GHFH 3L71D 1IGFH 2R56H 1OWAA 4XN7A 5C0DB 1UWXH 4K2UH 4C56B 2ARJA 4KXCA 1SOQA 4KQ4H 3SE8H 3WN5B 1AMXA 4Q6KA 5E24E 1IU1A 1P0SE 4E0RA 2IDSA 4R2GD 1JYXA 2WXLA 2ZVOB 1PNDA 2WXPA 1MWAB 4CNIA 3VXMD 2B4CH 1A4AA 2HJKA 1OFCX 5DLMH 5APXA 1U93A 1IGYA 1XD0A 1MJ8L 4XVJL 1NC2B 4HEPG 5CSZB 2M2DA 2R8SL 1DBBH 1OAKH 3UO1L 3VI3A 4NZUH 3QNXA 1MCLA 4X0KA 1R3HB 1IC7H 1JYNA 1OE1A 3P40A 2QELA 4P59L 3QZWA 4C7RA 1KMIZ 2QQNL 4H8WL 4LSQL 4OM0H 4U1MB 5C3TA 5IVXB 1JFQH 2X87A 1JNJA 3QFGA 4PJ7E 1A9BA 3WLBB 3QORC 2A45H 1LDSA 4N6JA 3N0PB 1XSKA 3GHEL 4RGND 1VCAA 2JKXA 3LRHA 4HF5H 4EOTA 5CXPA 1HE8A 4ONHB 5AD0A 1OP3H 1JRHL 2EACA 2FJUB 3EO1A 4ZQKA 5HDRA 1W0VB 4L8BB 3AQZA 5DCCA 2QVFB 5CEYA 3FT1A 1HQ4B 1ACZA 5KAFH 4PJXE 1XFPA 5D1XE 5AL0A 2BXZA 1HKLL 1MFBH 3PAYA 2V5MA 2HLFC 4TV3A 1WFUA 1ADQH 1L9PA 3PP4H 4XB3A 3DWTA 1G84A 3CUPA 1BQKA 5I0VA 3D07A 3THMH 3GPSA 1DVZA 4B53A 1LT9A 5KVFL 4NKDA 5K5GB 3KGTA 3T3PB 4Y1TA 3REVB 1YVLA 1YCSA 1CZQA 2VQUA 4X4KA 2JF1A 5D2NB 4C59B 4YHOH 2B5IC 2CBTA 4HK0B 3KLAB 2QJYB 1B6DA 1GZQA 2FBOJ 2RCSL 3EO9H 4PJHE 5EU3B 1J18A 3RTQA 2AJ3A 1MQKH 1F6FB 4LF3A 2DKSA 4JLRA 3NSDA 5F7HA 1UA3A 1BM7A 4ONFH 1SJXA 4ZOBA 4H7VA 5KANI 2FRGP 3H1KG 4DFIA 2R0ZL 1NVOA 1KLUB 4W6WB 2VM4A 3LV3A 3GSNB 2ZWYA 4BJLA 5CZVL 1CUOA 2O30A 1WWCA 4ZBJA 2YWZA 1VESA 1DQKA 2NQCA 4HV8B 4MAUL 4MCMA 4WFHE 3VU2A 2GT9B 2AEWA 4M93B 5DMGD 3H32B 1N6QL 2AK4E 3NG5A 2IX7C 3VVWA 1NMAH 2X1OA 2QHRL 4M3JA 2W1NA 2V7HB 4KKLC 1NFDB 1WZKA 4HS6A 3WLWC 4WRLA 2HWZH 3BPCA 4ZFGH 5KSUB 3S1KA 2OYIA 1AR1B 5I1JL 3CVDA 1M57D 5JNYA 3HG0A 3FL7A 2EUZA 4GOEA 2CALA 3V95A 2XWBA 3HBPA 4YHKL 2EYTB 4Y99C 1X3DA 4NQVB 4PJ7F 4J3SA 1XT5A 3ZDXB 4Q9QL 4WUUE 1CTNA 2W59A 1SFCB 3LS4L 3LPFA 2HT3C 3V4PA 1L0YA 1RZKC 2L7QA 5E7BA 3RFRA 3GB7A 4PBWD 4MRCA 4HKZA 4PJXF 1XTLA 1F13A 1GTWA 3ESMA 4OLYL 3WEAA 4D7BA 5FYLD 2L7UA 1QFHA 4MXWH 1TQTA 1XGRA 4WKZA 3VSVA 5KVEL 5KYXA 3ARFC 2VGLM 3GLEA 4DK6A 3GBLA 4ZMXA 1I3GL 3Q6GH 4IRZA 1LNUA 1NCTA 1KJ2B 3V5DA 4DZBA 3BVNA 3CLQA 3AB0C 5DHYA 2R2HA 3CFDA 1EFXD 4P46C 4QOKB 2EC8A 4MNGA 2R8SH 4HU8A 1HSAB 1IFDA 1MFCH 1WK0A 3K74B 4PJHF 1FAIL 1FNSH 4HJGB 3Q05A 1KT2A 5H8DA 2PYFB 2VR5A 3DX6B 1TQCB 4KXAA 4MXQC 3EXJA 3H1LD 3PDGA 4BKLB 1P9MA 2COVD 2JJUA 2VMDA 3QT2A 3W9DA 1EEYB 3RA7L 2GJ6B 2TRHA 1R33A 3QH9A 2HFGL 2O6DA 4LK4A 2BFGA 1HX0A 3O11B 4ANVA 2E7DA 3IYLW 1DZ0A 2OMZB 3FT4A 4JFDA 2DM4A 3A7OA 43CAB 1AGFA 2C9AA 4Z95H 5EU6A 3IKCA 3OJMB 4AEIH 2WQXA 3CFJB 2F9BT 1I9JL 4WJ5A 2VDKH 3ULVH 3ARQA 3TBTB 4KPHH 1A3LH 1OALA 1CD0A 4XX1E 4KJYA 1RMFL 3P73A 2AK1L 3NMEA 4HMDA 1IJ9A 1SQQK 4L4VA 5A1AA 2Y5QA 2Y72A 5CJ4A 1AZBA 2GAZB 3KMDA 1NTZG 4AM0A 3L5XH 5B66E 4KT0J 4XI5C 5A6IA 4YZFE 3MA7B 1LWHA 1J0IA 1Z3GL 1IEAB 3EH4B 1HL9A 3QEUA 5KS9A 2VUYA 5GQBA 4TRPL 2A73B 1JZ6A 2E8YA 5DJ6A 3M9QA 2Y7OA 2YPLD 2V5SA 3H9YA 4IKNA 4GKNA 1UJ3A 5F8RC 2DIBA 3OMIB 1S7UA 3T2LA 4P3CH 3LZPA 1JXGA 5EFIA 2E7LC 3QUML 3MGNA 4WTWA 1YPZB 3GMAA 1IAIL 3MLXL 4G9FA 4JE4B 2ZXBA 3FONA 5HHQB 4ZAKD 3NDZE 3SGEI 2A83A 4X6CA 3I02A 3IU4L 1C16A 4NAJA 2P8LB 3C75A 4NKOB 1JYWA 3C08H 3P4OA 1BCCD 2DQUH 4XCEB 3KBPA 3QQDB 4PUBH 4MA1C 1YRKA 4LQFH 3SJVE 5AW4B 4XNQB 3BXNB 1XIWD 3ROOB 1RIHL 3WS6A 1RLBA 3UPRB 1NGYA 4FFZH 4ERSL 2P46B 2B59A 2E6PA 3MBEB 4KJQC 3QHTC 2KBGA 4LFHD 4Z7WA 5FYKU 5JQHC 2YARA 3FU3A 2A4CA 1PKQA 3BAJA 3NP4A 3MZWB 1E28A 2YSSA 5KVEE 2HH0H 3HUJB 3ZUCA 1DLHA 3OLEA 1RHHB 4NO3A 4D2NA 4JZNB 5B39B 5J6HB 4OZGB 2DQTL 1TQUA 3NQKA 5IMOB 3BN3B 4GMTL 5B5EE 1PGJA 1WCBA 1F11A 3FQWB 2IBZD 5FM5O 1NO4A 4XFJA 2K3TA 3P4LA 4NZRH 2FEEI 2VXSH 2IFMA 4WJKB 2ZYDA 4PRHE 1EJ8A 2DW3A 5EIIA 4LLMB 2Q3IA 3VFRB 1CFTA 1TQVA 3TYFA 3VD4A 2Q76B 4H26A 1KCUH 2BPBA 3OBAA 4PJDE 3L3OA 4Y16B 1VCBC 3SDYL 1KIPB 2E46A 2YJQA 4P4KD 1CVSC 1U41A 4YZFF 5FC9A 3K6OA 1CFVL 5EUKA 3NEOA 1QSFB 4LVHC 5FHAL 3U2SA 2TSBA 2GCYA 2X6MA 4FAAB 5C0ND 2QSCH 4PBXA 3ATDA 2I8DA 4HX1B 3PWJB 3X3GH 1A3QA 1BFSA 4P23C 1E50A 3IF4A 2VXUL 4HEMA 4P49A 3SDCA 1BVLB 3L4XA 3O6FD 4BFIB 5F7EL 2BNUB 2D7TL 1E4KC 5E8NB 1FS0E 3KQGA 1DEDA 1GGBH 2OTKE 1D6VH 1HWHB 1V7NL 3GUFA 5CBNA 1I1CA 2QL1A 1SQVK 3SKMA 1ZT7B 4ALAH 4YXLH 4JQIH 3DVGA 1AFVL 4PJIA 4X8GA 3P54A 4PLOB 4YSAA 5E70A 3O2WL 2O1AA 2Q8AH 3G4SP 3F05A 1AO7E 1T3UA 4X7TB 2XNXA 3UTZB 2R15A 5FO9B 4HKBB 1RULH 3IAOA 1ZVNA 4FMFA 3QRBA 3TZVD 2P5PA 1P5UC 5DU7A 1T6WA 3DPBA 1FNAA 1SQPJ 3IFLH 2V3DA 4YBHA 5HI5C 4LBEA 2FX8L 1G7JB 2WXFA 3L70G 3G5ZB 5IV2B 1I1AD 4U1IA 4UQDA 4Y5XA 1BZ7B 1A14H 3RNKB 3IR9A 1X5XA 1YEHL 5FHBL 3H42H 5DHVH 4MNQE 4ZMZA 5ISZA 2EIZA 4B41A 5TDNA 2MMXA 4ZW8A 3ABLB 3QCVL 4WEBL 2KS1A 1U92B 2O5ZL 3P2BA 4FA6A 4U6YA 2ADIA 2NPSD 4JJOA 5F7MC 2NY3C 3TYYA 4JFSA 4LB8A 4M3HA 4OGYL 1S9VA 2NNRA 3G6DH 1QR1A 4A7VA 1JV2B 1FNGB 2RFXA 1KACB 5ESAB 4O9HL 3OJAB 4PJDF 4LCCA 2W95A 1IC0A 2BVYA 4BUGA 4WNJA 5A16B 3GRBA 5I9QB 3D3VA 2PETA 2J43A 3DYMA 5F6IC 3FFCB 3NSCA 4BWNA 3GSWB 3HRNA 2E75D 4FCHA 4TYUA 1HXMB 1QUPA 3DIVA 1JZDC 4H8UA 5IGXL 2HJLA 2FBJL 3VI4B 1PZ5A 4UQEA 3KPRB 1AHWB 1EGJH 1FRGH 1NEZA 1KTKE 1PX3A 1NTMJ 3DHPA 1WA2X 4N28A 1YN6B 2P7TA 3E6HA 5C9KA 5DRZB 1TCRA 3MBXH 4BZ2A 2P5EB 2BNRB 2VDKB 4YO0B 5DMYA 5F3BA 4HIPA 3VWJD 4XNUH 5CEZH 1IE4A 3X1NA 5CGYC 2NMSA 3V7AG 1MFAL 4OIBA 4PD4E 2WBJC 3MNZB 5HYSA 1A7PL 1R3LB 1EO7A 2CHDA 2DYPD 5FYJD 4KKAC 2IQAA 1N73A 4EQ3A 4NSKA 3T71A 1DO6A 4CA4A 2WQUA 4K55A 4Q8BA 4EXPX 8FABA 2PFXA 3WHXB 1FJKA 3MN8A 1CFSA 4UQ3A 3S9OA 4L8DA 5CNHA 1MJ7H 4DSYA 4EO5A 5JO5B 1GYVA 1IAIM 3ARBC 4NQEE 3WFCH 1GL2C 5F9OH 4BELD 1Q7YQ 1HEJC 2VO8A 2JWDA 1F3JA 1F45A 3I6GA 4X7SH 5E00B 3TO2B 4MA8H 2MRYA 1E5BA 4BZ1H 1K72A 2WVTA 2YGVA 5JDSB 4AQAA 5F1NB 1KCKA 2J1WA 4PJBE 3ZDZE 1F3DJ 2GG1A 1E4JA 1OXZA 4UT6H 1MVUA 1Z0MA 2BRRL 4FTVD 5KEZA 5CCGA 3HCVB 2OJ1A 4WAFA 5F7YC 1MRCH 4UT7H 2OL3L 3PPEA 3LH2H 4XAKE 3SGDI 4NRZA 4GI8A 1A64A 4ZTOH 1TJIL 3RI5K 1ZLUK 4LL4A 1HBWA 9PCYA 5GRXG 2BY3A 2L04A 4XE5B 2BWDA 4FC3E 3Q43A 5DK0A 1VENA 1XSJA 3C5ZB 3TVMA 1GMJA 3O6MH 5HI4D 3CG8A 2G2RB 5B8CC 1X9QA 2R4SL 1S9WB 1TETL 4MMXC 4JPZB 5J0BA 4S1DC 3KLDA 4GW1B 3TTSA 4UV7L 1KB5H 3WS3B 5LCVL 2LU4A 2XWDA 4P2OB 4A38A 1RV6X 2P8MB 3AREB 1KIQB 1G9ML 3CDZA 4WW2B 1EV2E 3HC2A 1IX2A 1IKFH 2HZHA 3K1DA 2QGEA 3SPIA 4DPAX 4GUQA 1CICA 2POHA 1N68A 5D7JB 1HTYA 1L4AA 3TNUA 3JXAA 5ACZB 2PO6A 1S9XA 4U1SB 1E3XA 3PHSA 2DTMH 5D1QA 3TPUB 2Z34A 5EB9A 1KLGB 1G6VK 4N3UA 3WIHA 4TOYL 4W9IC 1KGCD 1I1YB 2WLYA 1RZ8A 3G3LA 1K73Q 2VJXA 2BVPA 1R3IL 4M4PA 3B9KA 2JJLA 4YAQB 2CRYA 3EZJB 4C7NA 1OL0A 1U2YA 4I0PB 4OLEA 2YA2A 1T21A 2E9BA 4K71C 3NCXA 1J11A 1SP4A 3FO1B 1B4TA 2QVTA 1TJGH 1XBDA 1I1RA 2AJVH 1OVZA 5HHVL 4BK8A 4PRIB 2JR8A 1GU4A 1URIA 3D0VB 3AAZB 3QUXA 2A74A 2EDWA 1NBYB 1U91A 1AQ5A 4I1NB 5TE4L 4MLSA 4KHXL 3SDDD 4Q4IA 1BGXL 1FFQA 2C7UB 5D96C 1EZUA 5DEJA 4ZSOE 2JK5B 2XWCA 4N4YB 2EDMA 4G6AC 4PJBF 3ZDZF 5LBSH 2H3NB 1SXAA 4MX7B 1F3RB 1BFTA 2D31A 3OR6B 5I6OA 4KX9A 2B14A 1WGOA 5MHSD 1ZHBB 1UEMA 3I3BA 2C9XA 5EN2B 3L73J 5SWSE 3RWDB 1SVCP 4WV1A 4P5RA 3CIQA 3TA3D 5CIPH 1QRND 3KZ8A 5I8CB 1BAFL 3Q3DA 3VFWA 4I48B 1KN4L 1CO1A 4PJEA 1H6EA 5F2FA 5EO1B 1SYVA 1CGXA 5I18H 2OARA 2FWOB 5DJUB 3GI8H 5F0PB 3CFBB 3L54A 1IQWH 4YHPB 1WG3A 2CPBA 3RK3B 3KLLA 5DHVB 3VFSB 1KEML 2RTTA 3IFOB 4IEFB 3P77B 3WJMA 4P9ML 2H32H 1FZJA 5AQ0A 3AM8C 4XPFL 4QRPA 2CLVB 1AXSB 5D7SH 5C09E 4RA3A 3Q5PA 4N78E 3OKKB 3U4BH 3EIFA 5B1BB 2XNAB 1OSZA 1UATA 1OPOA 5KSVB 4JHWH 2FYUE 4PV9B 3S4SA 4L76A 3Q5SA 1S3KH 5KANG 2Z35B 4LSDA 2QFPA 2XV2A 1CGYA 3W5NA 4ZZKA 5IM7B 3IGAB 2CLZB 4NHCH 4UM8A 2WQAA 3D2TA 5FK9B 3QG6B 1PW3A 3FFDA 3QNYA 3D50A 3C2AH 4YDKH 3TNNB 4ONOA 4LASH 1PZQA 2PTTB 2EVFA 1DVXA 2UWEB 3HJEA 1KTDB 2B20A 3FTVA 2HVBA 4IBYA 4ANKA 3GEFA 1XVSA 2FYVA 3NZSA 4Y9EA 5I1HH 1J1EC 5F3HA 1H0TA 3TN0A 3GI9L 4PRBA 3UCRA 1P4LB 5T3XL 3UXFA 3UJIH 3LB6C 1M7UA 1WFNA 4GSDH 3ULUH 3EOTH 3G5VB 5K9QG 1ZWIB 1FIEA 3HG1E 3RDTC 3I55P 1XF2B 4F9LA 4Y9FA 5F96H 2VDLL 1R5LA 3HPJB 4X5XA 1VZHA 1LMKA 3B9EA 2OYMA 3LSOA 4GRLD 2KNCB 3H7LA 4RIRA 5HD8D 3MNVB 5C0IB 4HHAB 2IPKA 4M7LT 4S1QL 4NNPL 4XTRD 3JTSB 4RGOL 2IANA 3EAKA 2YR3A 3LOWA 2IOIA 3JV4B 1JWMA 2VR9A 2ZCHH 3B2XA 5TGBA 2DY2A 4NBZB 2VLKB 3N1QC 3PXLA 1SGKA 4EZLA 4Z7QE 4LCUA 1DP0A 1T6AA 2KZIA 5GS1B 1NCCH 2DQGH 3C2SA 1JDCA 2WAHA 3O8XC 2BS8A 1QSEB 4OLUH 4OJAA 2GIXA 3JUYA 3OJ2C 4FQPA 4ODXB 3QDGE 5E51A 4BK5C 1W6WA 2X4QB 4LHJB 1S5HA 2WW8A 3TBYA 3R1GH 1QQDA 1IFHL 2IPUG 4Q0XL 3WU2H 1FOSE 1HVXA 2APVA 1EAOA 4GW4B 4Y4FA 3RVTC 1AQTA 4A2LA 5CCKH 1R17A 5K5YA 3T0VA 2B77A 2VDQL 4XODA 5CILH 5AW5B 2X7LA 4U2YA 3MJGX 4MJ5A 4D0CA 4XRCA 1LVEA 1S78C 4U3FJ 5GGRA 3H1IG 4X2UA 3W39A 3OB0H 3SFEC 3BRTB 3U7YL 1J8KA 4HJ0D 2WPSA 3A0OA 3WY3A 2B0SH 4LPWA 4N8CL 2F6AA 4J2QA 2LU5A 1N8ZA 1UD5A 2FHFA 1GKOA 3C60A 2AJYH 3D8MA 3FXIC 3EJPA 4HWBA 5E6ZA 3T65B 1KC8Q 4PCYA 1L4IA 4KOCA 4WGWB 3CV5A 2R51A 1AHMA 1G43A 3HI6H 5ILTH 4OQ1A 2Q8BH 1J1PL 5FUOH 3RZCD 4HH9B 2ITCB 1XR9A 1LE9B 1EDIA 1KB5B 4Y19B 2D3LA 3TT3H 1A25A 2P24B 3QDMB 2X70A 1ANUA 2YUVA 3KXFE 2OYLA 3GMLB 1JNNL 4X0NA 2X3BA 2CU9A 2ZYHA 4Y2DB 1JGLH 5IHWA 1NSNL 1JZEA 1QA9A 3LRGA 4A68A 4Z1PA 1PZ2A 5IQ7L 1L9TA 3QARA 2VOTA 2K8MA 3L3DB 1SFHA 1EH9A 3CFUA 3D0LA 3PE9A 4PJXA 2E9IA 3H3BC 3K6SA 4F57H 3PQYD 4RMRA 4Z0XB 2IADA 3VRJA 5SWZB 2E27H 4GIFA 2A9NH 2RKLA 1QVFO 3MRBA 3T77B 3HE7C 4Z7QF 2CE6A 3LRKA 4HWEH 1J10A 4M5ZH 1XCQA 2XFGB 2P4AB 3KPSE 4L8SC 1V5JA 2GITA 4ZMQA 5T3XE 1NLBL 3ENEA 2EH8L 4LPYA 4RISL 4TVPH 1PP9J 2CUIA 2X40A 3FO9A 4HJIA 5B38G 1WISA 2Y7NA 1DBML 1HAWA 4H20L 3JCUE 3M0DA 1FOSF 1KJVA 2VWEC 4IBZA 4PJHA 5K1JA 2CMRH 4TS6A 4XPGL 4MA3A 3O3EB 2CHXA 4KKBC 3OF6A 4WY4B 5GS2H 1ES0B 4HJSA 2IC2A 4WI2A 3EYUH 2HFEA 1KBBA 1G6RB 1T4KA 3PJSB 5LQBH 3CFMA 3RK2C 4HAGA 4HOWA 3VQ1C 1MKMA 4KO7A 5PCYA 3ZQXA 4M03A 2P5WB 2CXKA 4IMKC 1PD0A 1JY2O 2CK2A 3GBDA 4NNYA 4BUQA 2BIMA 1URQC 1K4CB 3FUIA 4LNRA 5D1ZA 5HY9A 5DURD 1YEEL 3CZUB 5CIPB 1L5GB 2AV7A 3LNHA 1NU1E 4KK8C 1E9OB 2V2TA 1Z9SA 2AK4A 4NI6A 3EHBD 1JTPA 3FU7B 3TGUG 2EO9A 4S1SL 4UAHA 4YPGB 2ZUTA 5I1CL 2D03L 1LWUA 3H2PA 3WNJA 5DDHA 3V4PH 2GTZB 3U9PL 5KG9B 5DQ9B 1NTKK 3VFNB 4U4IA 2JKLA 3MRCA 5F7DB 1H3VA 5K93A 5I6NA 5HYQA 3BQUD 1HILB 2G75B 5ETUA 3UAAA 2H32B 1RUQL 4NZ8A 4UV4H 4WUUA 3DSNB 3CLEH 3UTTD 4POZC 5GS0D 2R0WL 3UAEA 5LNGA 1RUMH 3VGGA 4HYTB 3HZVA 3I85A 1I8MB 4S10A 4YL4A 1D7DA 2J2ZA 2K9UA 3WFHA 2Q0ZX 4IRZH 3D39A 1BLNA 4O5LL 3ZT5A 3B2VL 4IHOB 1IARB 1VFUA 3C5SB 1BSIA 3G5YA 5KSAD 1HI6B 3TO4C 1UWEL 3ZOAA 3E2HB 2J6EH 3DMMC 2V9TA 1F90L 3GMMA 4G5ZL 2VDOH 3RWCA 5IKCB 5IT2H 4HETA 1CTMA 1URZA 3EUDA 1MDAA 1FLRH 3G7TA 4JBSA 1TR7A 3UEQA 1D7MA 4KTEH 3US1A 5C0AA 4QXUH 2GEQA 1DQLL 3USSA 4L2LA 1A65A 1JL8A 3O0RL 2Z64C 3WTVA 4NNXB 1OCZB 5B1KA 1SJVA 3JYBA 4KO6A 2WITA 2ETWA 1J5DA 5LGJA 2MCMA 1HN1A 2JSFA 1SJEB 1KB9D 4GSQA 4UT9H 3AG3B 4LSTL 2ZYAA 4WIQA 1VSCA 4FD0A 3B7RL 4F58H 5APUA 3ZMNA 3QZPA 3TONA 4FG4A 4DERA 5I1DB 4IKKA 1GTFA 2D7OA 1HH0A 1JWUB 2R1XB 1NCDL 1KCVL 1N5AB 1R5SA 2K4WA 1NKNA 1H3GA 3ECBA 3PHOB 2XLLA 1D5MA 1SBSH 4UQAA 3NN8B 4XVTL 3LS5H 1FZCC 2P1YA 4PP2B 2WAQA 2Y06L 3H9SD 2PXYB 2AEPL 4ZQTA 3MAWA 5KBKA 2PYEB 5DMKB 2IZ1A 1MREH 1ETZB 3AQYA 3EJZC 3BE1H 3HS9A 4BSJA 3ISRA 3T4YA 1U9KA 4XVOA 3T0ED 4GBXC 3EH2A 2HT2C 1NHLA 4NHUA 3WMQA 4GRMB 1J0JA 2VSDA 4QO1B 4Y7MA 5E6YA 4FERA 4IGBA 4KI5D 2HVKB 3D69B 1B3IA 3QC6X 4PRPD 4KNQA 4NI3A 2EVIA 4XP1H 2LOEA 2BVUA 4F7TA 5JW3H 4IU2B 3T8VA 2XCMC 4NPYB 3ZHNA 3ERXA 3ZKND 4CGUB 4NO2B 4E42B 2QPUA 4YLBA 3RWGA 5D93C 4HUXB 2JIXA 1U93B 1PGOA 1I1FB 1IGYB 1YUKB 2KLVA 2I24N 4WO4C 5EA0L 2ICEA 5IHZA 3HE6A 5H4ZA 1WCQA 3BKMH 4B7IA 3V0DA 4BFRA 1EMTL 2ZCKL 3UJJL 3RPBA 2FDBP 1OB0A 2WINB 4PJ9D 5IQLA 5KJ4A 3W3BA 4X0KB 1B4JH 1SY6H 2V7NA 1L9QA 3GZOA 5J1SC 2M5AA 3IXTB 5EZOH 5F7WC 3BKJL 1DH3A 1H5BB 3X1EA 3VFGH 4GOFA 2DAVA 3MODL 5E56A 3QSKB 3CVBA 3EO0B 1A9BB 1UM4H 2X4RA 5A2AA 4IL6E 3REWB 3WXWH 1Z66A 3IMUA 4RFEA 3S35L 1AGDA 4AGNA 1SHMA 1QL1A 2DF3A 2WTRB 2WQ8A 3QJFB 5ANHA 3EO1B 3O9WC 4ZQKB 3VXTA 1KILB 3SJVA 3W68A 1BFVL 3DYPA 4AIZA 4F7EB 4PJ8C 3MLYL 4QJ3B 3MRGB 1ZMEC 4P57A 4APQB 3IDNA 1KF9B 4ZTEA 5LO7A 5FFOA 4H88H 5FLVA 2KH2B 3ES6B 2D0GA 1JTHB 3QXWA 3U0PB 4KZDL 4UM9D 1SMOA 3WKYA 5HJDA 3MLUL 1OEZW 3L3KA 2DQDL 4ODUA 1LT9B 1MF2L 1ZRUA 2YEZA 4U1GC 4NKDB 4LVOC 3W9EA 5KW9L 3TESA 3L5IA 5T1LD 3ZTJG 4K7PY 4JN2A 4KTDH 4BQ8A 1A8ZA 3O4OB 4YSSA 2CM6A 1I8AA 1GS7A 1SDAB 3IDUA 3PGDA 3WSQH 5TQ0H 4IRSB 3GF8A 3N85H 5IQNA 4XNZC 1NDTA 1MWOA 3MV7B 1WEJH 3RTQB 4FNTA 2R29L 4PRHA 3CCJP 3T6QC 4LF3B 2I27N 2A0LC 3JYCA 3FRUB 4JFFB 4JLRB 1YI2P 1INQA 1OF0A 4PJDA 1YEFL 5IVNA 2YAFA 3V52H 2NZIA 2ZOKA 1VAHA 4BINA 1TUPA 3BOVA 3KYNA 4KC3B 1OF2B 3RUGE 3RYMA 5TE6L 4XPHH 5IVXE 1MCEA 4EI5B 3NIGE 1MW2A 5GSVB 2XVLA 5I0WA 2DQFB 5D6CA 3EJRA 1A3RH 1CI6A 4OGAC 1E5CA 1XTMA 7TAAA 2WSDA 4P2QD 2WSCH 1KEGH 4O51B 4DKDC 4ODTH 4DVRL 5G4NA 3VVVA 1OAZH 3EBAA 3KCPA 4BQ9A 1XTCC 1OKEA 3CCQP 1ZE3H 2X6VA 2R3SA 4MN4C 2CUHA 3T1WA 1I7ZA 1D7FA 1IC4H 3MOAL 3Q6FB 1Y7VA 2AP2A 4K4KA 3ZL4L 2B1AH 4KK5D 3U7AA 4X42A 3T9WA 3L2NA 1OCWL 2C4FU 5AOMA 3WNOA 2MNWA 3WFDH 1ZP0C 2EDKA 3T4AC 1OQOA 4WNSA 3V4PB 1SEQH 1J1OH 3I9PA 2CPSA 4OCSH 4JGMA 5BUGA 2Y1VA 4OV6F 1R24B 3CGTA 3QHZL 2V7QJ 4QXVA 4NZFA 4YXHL 3FO2A 1YITP 1WZ1H 4OF0A 5KJ7C 5D70H 5HHPB 4RMQA 3K5BA 3J8F7 1AKJB 4OGQC 4UZSA 5KLIB 4WKZB 5KYXB 3MNMA 3AEFC 3L2LA 1HCFX 1CFMA 3F7QA 1LNUB 3QUMA 3V5DB 2WXHA 4YR6A 3GD1C 3U4EB 1W0WB 4PVNA 2AV1A 2VXTL 3FTSA 3CFDB 1N26A 2E9JA 2UZXA 5FW8A 3CC4P 1NKOA 3M6DA 3QISA 4MNGB 1TTAA 5MERB 2YAPA 4CADA 2H2SD 2VDOB 4AIXA 4BCZA 4DAGL 3CLFL 3VE0B 1IL1A 1FZKB 1KYOK 3OZKA 3PV7A 1HXYA 2AMGA 4AGOA 4CRPA 1X5FA 1GGCH 2JCCB 2PLTA 1FYHB 4PV8A 1RF1A 4JZOA 1KTLA 1LTJA 3W9DB 2C1PB 1N2DC 1FG2A 2YPKB 4YLQT 2BCMA 3PWPE 1X79B 4NFCA 3R06A 1T1ZA 3EYQD 3MRMB 3RUGF 1PJ9A 2W27A 1MI5B 2WQWA 5D2LB 4E9LA 4KXZH 3L7EA 1CXIA 1HNYA 4ZPVA 5IVXF 2P8PA 2FD6L 3NIGF 4G3YL 2YWYA 2ICWB 3GXIA 1AGFB 5B7FA 4BZ2H 1J0KA 5TFSH 3U0TA 4DN4H 1VQPP 3NK4A 4X9IA 1VFOA 5I76A 2OTWB 5FV2A 3QO0B 3GTVA 2Q87A 3CCHB 5I73B 1RU9H 3BT0A 3PCYA 1NOHA 1XQ4A 3JWOC 1RJYA 3MC0A 4KJYB 2CA4A 3MXVH 3P73B 5LWYH 3UG4A 4AYCA 1ED3B 3D85A 4FQJH 2OMTB 4RAUA 3QJSB 2ZSVA 2KHAA 3B7SA 4QTHA 3VFPB 3UYRH 4A6YA 1JPST 4NUJB 4FLOA 3QFDB 4AM0B 5BV7C 4KMLB 1JUFA 1A1MB 4N5ED 1I53A 3HC0B 5BRZE 3E38A 3QEUB 4R84A 1BSHA 4GKSB 5CGMA 3CSBA 1MHHA 1T2QH 1PMYA 2EAEA 3QUYB 3TNMA 1RK1B 5AYTA 5DJ6B 2AQ1A 3NZHL 3OKLA 5KVGL 2EADA 1TTUA 4A2FA 2XQ0A 5CHNB 2GPZA 4OJFH 3DETD 5ADPH 3MRQB 3B5NA 1XGQA 2Q9OA 5K1VA 5E1QA 2B1HL 5DS8A 1PG7L 1FCCA 1S5IL 3U9WA 4NQEA 4ZXBA 4ZODA 3FONB 4D6TG 3L70D 3VM5A 5BVJB 2JQMA 3BZFA 4GMSL 4YWGH 3V4QA 4UCFA 3M8OL 2WQVA 1EHAA 4CMMA 2DD8H 4HH8A 4WI0B 3EGDA 4YNYB 1C16B 2E74B 3TH4T 3P4OB 1QG3A 2AQTA 5DI8B 2A45G 3EOBB 3NIFB 4JPWL 3FTXA 2XYBA 3K81A 3H1KJ 5BVPH 2QEXP 5HVHB 1E90A 3BISA 4FFYA 1QWUA 3CZNA 3S34L 3SBPA 1JERA 5SX5K 3AWGA 4K07A 3K46A 1PD1A 5BPPA 3ARDC 3HPLA 3RPKA 2FJSA 3QO1A 3NUKA 1NIBA 3BFQG 5BS0D 2X4OB 4PFEA 4PREA 4JHVA 2AGJH 2XN0A 3K6DA 2B59B 5B39G 5ABZA 5JHAA 3KH4A 3UAJA 4KKRA 2EP6A 1SDDA 3MNWB 3ZE0E 4J39A 1RURL 3BPNC 1EJ6A 2B87A 5ICXA 3TF7C 3ZR6A 4HJJH 1R5VB 4NO3B 1T66D 3I3DA 3VFOA 4K23L 4YHZH 3KJ6L 2O01J 3QEQD 3CMAP 4RDBA 4P2RE 2CAKA 2V2XA 2H1PL 3LX9A 3PHQA 3JWNE 5I15L 5EEXA 2XIBA 2V4HA 4DO4A 1PTZA 4UILL 5MENE 4WTQA 2QE7H 3EFOA 3SKJH 1LO3L 1V3JA 2BVEA 4ZFZB 2NY6B 5IESH 1CQKA 2J4WL 4KJWC 3MD0A 4N8VG 2PW2A 5GHWL 3C8VA 5J6SA 1L7TL 1KTMA 4WK2B 1GH7A 5DZAA 1A8JH 3GF7A 3FF8A 3T0DA 1V3KA 4U31A 1A22B 4JM2B 1D7CA 1ZSDB 2OMVB 3SCMB 3QUZA 3VTMA 4XH2A 1T4WA 2ATPB 3QAQA 1S7QA 2ALAA 1PLGL 3CXHJ 2JJSA 2Y23A 4J3UA 3EGSA 5DA0B 2VKWA 3S5LB 3IJYB 2VDRH 1NWOA 1MCOL 5E4IA 1FORL 3PGFH 1T6BX 2NOYA 3W56A 3VCLA 5E99H 3H9HA 4MJ6B 2CIKB 4PS4L 3P4MB 2ICCA 1UENA 3BDBA 4ZSOA 2MCAA 5B3SB 3DO4A 7PAZA 2AEQH 3HJ0A 3QFJD 1JM0A 3DPBB 3UZVB 3GSRA 1LEIA 1YNKL 4LCWD 4NM8H 2J1YA 3MV01 4PQXA 5DUJA 3RGVC 5FYKH 1PPIA 2BO0A 2OZ4L 1TENA 3MQIA 3N44F 4NC0B 5F70A 4YE0A 3CC5A 4GG6E 1K8DA 3NJNA 3TA4D 2GKIA 3PWLA 5KVGE 2XRAH 4HUVA 3EH3B 4HMEA 5AW0B 3GSQA 3ZHLA 4HQQL 3ZE0F 1U8HB 3QJOA 5C9JA 1WMKA 4TMPA 4YDLB 3Q2YA 3V0AC 4LRIA 4WENB 3NFNA 1G4MA 4HC1H 5TDNB 3C6LC 1FVDB 1LP9A 1CU4L 3ZZ1A 5KJRL 5T1JA 3QIBB 1CJYA 3U7WL 4HS8L 4U6YB 1QBLL 3SE3C 1RIVH 2ADIB 5KBNC 2DYSB 2YGNA 1IEHA 4O02B 2FX7L 1G2CA 4ZDHA 1S9VB 2ZG2A 4S0SD 1NTZJ 3RWHB 4XNMA 4L5FH 5H37H 2G60L 4FI7A 3Q3GB 2ZAHA 4KROC 1G1IA 4ZFOL 1EC5A 5CP3A 5E23A 1K5NA 4QRQB 4LCCB 5C09A 5I8OL 3HUSC 2BNQB 2GSGA 3F7PC 3QCUL 2XA8L 2EC9U 3QCTH 3T6VA 4LHQB 2ITDA 1E9QB 1FFNB 1Z9LA 2YAMA 2Q3AA 4RRPG 3HNSH 5DQDH 3PUCA 1VACB 4M7JH 4PG2C 5I71B 1VF5D 1YN7B 2OL3A 5D7HA 4RGNE 5AENA 1JUNA 3RG1C 2EH7H 2O26U 4UAOB 3H4FA 3S37X 3FTZA 2PTVA 1ERNA 5FEBA 2A6IA 1Q9LA 2IVFC 3T97B 1G7PA 4QKTA 4DW2L 3SPCA 2XTJD 1HOCB 4IIQB 5DO2C 4CGTA 3PY9A 1JZ2A 1J1XL 4FLRA 2WMMA 1KYOJ 1QNZL 2P7TB 2WTPA 1F1GA 3E8VA 3ECVA 1RZFL 3QI9D 4GOSA 4B9JA 3JSVC 1BG9A 3NDYE 1TCRB 2WSSH 4R4FH 1BDCA 3HVNA 4OCNC 3WKMH 2WQSA 3FQXB 5LCVA 4DUVA 1NKRA 4I18C 1KXHA 4X6FB 3CX5J 4IRJD 4HLZH 4HZ1A 4JRXE 1NDGA 3AEBC 4TUJA 4JHZA 3L48A 4A2GA 1ASQA 5H2BA 4P5KA 2IQAB 4JRLA 1SQPE 4NQCB 5D7KD 4OZ4B 1B4LA 2DDQH 4NSKB 5E8DL 4A37A 2HTLC 4UQ2A 4BM7A 2D2OA 2JTYA 2FSEB 2WB1A 4G80A 4W9EC 4UQ3B 5EG6C 4GG6F 3L45A 5IW1A 1JPTL 4U4BA 1SJHB 1JVOA 3VXPB 4JRYD 1JCCA 5FO7B 5E08L 2VSCA 3W67A 1LTBC 2WV3A 4HLEA 5BU5A 1J7VR 4NLAA 1B2YA 1JB0J 4C47A 1F3JB 2XBTA 4Z8FL 1VQMP 1FHGA 3BP6A 2ZPKL 4QF1B 3CVHA 1P7QA 2D7PA 4HLJA 4AQAB 3MRDA 4P3DA 1OP5H 3FB8A 4QRUB 2J20A 5I0DA 4KHXA 1MUJB 1JN6A 2JE8A 2XWTA 4J3OF 5CUSH 3QDGA 4LRNH 2ZUWA 5KYNA 2Y5TB 5T1MB 2NZ9D 3GSOB 4X99A 5HYIA 5DD1H 5CCHD 1YA5A 5JLZA 3JV6A 5DD6B 5EEVA 4NRZB 1M3IA 2BIHA 1BD2E 2Y6TE 3QIUD 4HSQA 1NGXA 2P48B 3OZLA 5GGVH 4JYCA 5IB4A 1QBMH 2YXMA 3TBSA 5DK0B 3TVMB 1RJZA 2CGRH 4Q4EA 2B88A 4WFGD 1PZUB 3FUHA 3S48A 3N1PC 4G7YL 4XCFL 4K9EC 1D5IL 1ZXGA 4LU5H 1NTME 4Q97A 2WOBA 2DLGA 1JZIA 3HZMB 4OCWH 4IOSD 1GDTA 2ED7A 3HAEG 1VADB 1N59A 1F4HA 1ULVA 4LPVA 1Q38A 2FO4B 2NY7H 2FFDA 2YC1B 2JQZA 5D2NC 2NT0A 4NZDA 4WQOA 4ADJA 5I16B 1S6NA 3HR6A 4MJID 2PO6B 2QJYC 1O7DE 3BGAA 4XPAH 2AFNA 3UL4A 2YFOA 5I74C 1XH3B 3M91A 2OQJA 3KXFA 1W2EA 4IOIB 1RZ8B 5ALCL 3L95B 3CCLP 3DGGA 3SDAA 1P1VA 2NXYC 3US9A 3ZKQD 1G9NC 3AROA 3H8NA 3MHVA 5KLVK 2F53B 4I3GA 3SHSA 1ETA1 1X5KA 1CYGA 1P53A 4M1CC 1YECL 4ANUA 4KUCD 3BP4A 3RIAF 1H6TA 2Y6SC 2DLFH 3DIFA 3BASA 1G7QA 3OKDA 3MRFB 4AUYA 4M93C 1CGWA 1SXCA 1KXTB 4C54A 5F7FA 2FJGB 1VEOA 5J8OA 3CHSA 4MD0B 2ZKHH 1FYTE 5E79E 4HUKB 4LCIL 4Z3JA 2HT4D 5KAQG 1AR1C 4FNUA 1JZ3A 3NSJA 3TV8A 3HE5A 4OI8A 3BEVA 1SQQD 2NX5E 5DJZA 3TF4A 4FE9A 5IB5A 1NGWA 2ICWI 4NWTL 1U36A 2MNUA 2VZOA 1G1CA 2APTA 4R8WH 2DWYA 1S8DB 4UQBA 4YSEA 4NAMA 2FJFB 2XBDA 2NCEA 5E2VH 5GRZA 1BAGA 3HN5A 1YMMD 3LKQA 4ZD3H 1LQSR 5F1IA 4U6HB 4AZ8A 3BGFB 3D71A 4DUXA 1A7NL 1K5WA 4H44C 4YDJA 1SYVB 4Z7AA 1EANA 4IJTA 3ZYJA 4OFIA 2YKOA 3N44B 1JY3O 5C08D 4I2XA 2DQEL 1AV1A 1CE1L 3OSKA 3WI9A 3LKNA 3OKEB 1XF5B 2A6DA 3ZE0B 2TSAA 1JTOA 3QW9A 4NQDE 4N26A 3QYCA 2VERA 2ZIDA 5L6YL 1FBMA 3GBNL 1A02N 5FYLH 4QRPB 3RVXD 4YSQA 2A74C 2GM4A 2DIEA 4I77L 2VLJB 4AYMC 1SLUA 2PNDA 4AQRD 2IFFL 2IH9A 5DJDB 4U49A 4M3KB 1OSZB 3RVWD 3SYCA 4AK2A 3D0AA 1N7SB 3T8XB 2FR4A 5I1LA 3TBCA 1KNOA 1TQCC 2FZ3B 4UU9B 2HKFH 3FB7B 3KBHE 3LYRA 4XNAA 5DTFA 2UZYB 1RE3C 4GODA 2YGPA 4M43L 5DFVD 4WI9A 4Y4HD 5A2LH 3LRSA 3S97C 5IR1B 1EZLA 3CVIL 4FFVC 4W9CC 4WDIA 4NWUL 3JZYA 1FNLA 1MJ8H 2AKRA 2KZWA 4XVJH 3NESA 4NS0A 3BZ4B 4DVBB 3VNZA 4PTUA 1UT2A 1K8IB 4JFWA 4BD4A 2DIJA 1R4XA 2FBRA 4LPTA 5E6IA 1TTRA 2CJUL 3Q7JA 5DZLA 1HEZA 4FL4B 4P59H 2P3YA 1H6UA 4LSQH 4H8WH 2FECI 2QQNH 4DO6A 4UYPA 3TN0B 5GGSB 4KY1L 1YZZA 3MCYA 5IIEA 3BO8B 4QEGA 1JRHH 5LAXB 4ZKPA 3HS0B 4JHAL 3QA3A 1URLA 2RH0A 1A2YA 3SBQA 2WXKA 5HHOA 4BWWA 3L73E 2IBZE 3MLZL 2WUCL 3O4LB 4NKMB 4X5XB 3VFUA 2HMIC 4W9ZA 1JI1A 4M1GL 1PVHA 1HKLH 1ZA6A 2MPAL 2QBWA 2UX7A 3DRTB 3D51A 2YRZA 4C83A 1RVFH 1AIFA 3BUQA 1RPKA 3L16A 3F7YB 4U6VL 4DN3H 4BFKA 4P4RB 3CWBJ 1N12A 2IANB 5KVFH 3DX3A 1MHPL 4M6AA 3HRZB 5JHDD 1FA4A 4HKJA 1WPCA 1JWMB 3MGOA 1AVAA 3SPVB 4AV0A 1OWWA 2AHIA 4M7LL 2FK9A 1A5FH 2CO7B 2Q7YA 1DSYA 3VXSD 4LCUB 4H0LC 2APXA 2I07A 3LZQA 4XVSL 2Q6WA 2R2EA 1SQVD 2RCSH 2ZSWB 4B3VA 2JWYA 2IDBA 3BW9B 4LOUC 1W8NA 2XTLA 1U8CB 1RQUA 4HGKC 2IWKA 5A3IC 5H35A 2W6JH 4LHUA 2WKOF 3EH1A 4IBQA 5AW9B 3TGUD 3VXMB 5AAMA 32C2B 2AJZA 2H1XA 2DEXX 1TVHB 5CZVH 4HDIB 4RLDA 3H9ZA 1JEKA 3ARGA 3CFTA 2W9DH 1S7RB 4PP1D 2Q5BA 4FYTA 2Z4TA 4Y1AE 5IJDC 4D0CB 3KPQA 1NPNA 2FBWC 3QPQD 1KTRL 2LR4A 4Q9CA 4JANA 1N6QH 2P58A 3MRNA 3WE6A 5MEPB 3FTGB 5C3IA 1UH4A 4HA1A 1J9RA 5EU7C 4MD4A 1SXNA 5AW2B 2DRUA 3CH1A 4TVSa 3GHBL 4WCYL 4YSPA 5I1JH 4UQ9A 1CL7I 4MYPA 2VISB 4YHKH 4Z9KB 2FLBT 1OT1A 1QSVA 1RHZB 2FE0A 4K8RD 5C0BD 1XMEB 3HZKA 5IUCA 4Q9QH 5JPMA 5FF6A 4OFYD 2B9AA 3VFMB 3EW3B 3M1OA 3FWNA 1HH9A 4AXWB 4AITA 1A7QH 1FZBA 2ADFL 4Y16C 3RL0g 3GKZA 2ZOLA 1JMMA 1GGUA 4ZOCA 4QTIL 1T5KA 3UTSD 1M1JA 5E2JA 4OLYH 4W4OC 5F88A 4S2SA 1LD9B 4ODWA 4AOFA 4OIIL 2EDTA 1LTXA 2PCXA 5E94B 1BGYE 2IG2L 4YX2L 4AKQA 2D0HA 1I3GH 3MOBH 4B0MM 4CJ0A 4M7KL 2X9WA 3VRJB 3K8MA 1RZ7L 3CQFA 3QHFL 1MPAL 5INCB 1BDYA 5I66B 3QEHB 2OV0A 2YIHA 1OGPA 3K6IA 3CSFA 3MRBB 1R9FA 1XF4B 5GIRA 3QDJD 1NANI 4F8TA 5BXFB 1NUNB 3G9AB 4FYRA 3K71B 4XO4A 1AYRA 1JGEA 1FAIH 4GAJL 1PFCA 1X5AA 4I4WA 4ZUSB 4BFEA 2F0CA 1BW8A 3V0EA 3GMOA 1EZVG 4M4RA 1FVEA 1XAUA 4NPFX 2XXMB 4KGLA 3FN9A 3RA7H 5KLVJ 3VXUD 2LU7A 2Y07H 2ERJB 4WO0A 1JCKA 2FXPA 2QLVB 3DJTA 5TE7H 2HFGH 4L2YA 5D7LA 2WWKO 3NFSL 1KTBA 4LT7A 3ZR5A 2KYVA 4C56D 2Z5HA 2UX6A 2G2NA 1CYXA 3WKQA 5SWQA 3HC4H 3K7UA 4QRRE 5JXEA 4CSZA 3V79C 5TH2A 4U3FE 3RUGA 1I9JH 5J13B 2KLRA 2F61A 4FZEL 4ZT1A 4XN4A 2JO1A 1OY3B 3NEXA 3TBVA 4JFYA 5AOLA 3STLA 3HNTL 1MZYA 4LNRB 4J3XA 3M9HA 5EBWA 5FECA 1U3NA 3WNLA 4KZCA 3M07A 1RMFH 2AK1H 5D1XC 3RURA 3AITA 3B7UX 1LWUB 1G0DA 2A9CA 2D4FA 3GKWH 4FKEA 1JHKL 1QRKA 1SEBB 3IRZA 1F56A 1BFOB 2CNYA 3DO7A 4V1DE 1L0LK 1T03H 2H8PD 1VDFA 2BK8A 5IB3B 3ABKB 3QJXA 4GLRH 4UTAH 4MLIA 2GJZB 2HKHL 1NIEA 2WGXA 4D7PA 1B0IA 4ZFFA 3SBRA 1KGXA 5HYFA 4AW7A 4ZX6A 4OZIB 4PN6A 5I9QC 1B0GA 1AE6L 4ZMTA 3D39B 3L7FA 3L9YA 2N4IA 1F4WL 3QUMH 5LDSA 1IAIH 2XWXA 1EFXB 3MLXH 3PFQA 4QRTB 3G5YB 7FABH 7CGTA 1Z5YD 1H15A 5T33L 1QYGH 5HJ3B 1NCWH 2DJSA 4BWUA 1CG9A 3IU4H 4HT1L 5T5NF 4JY6B 3I9IA 3BRGC 4GIPD 1PLBA 4GRWE 2NY0D 2NNXA 4HUUA 4NPEA 2H43A 4G8GE 5C0AB 5GJSL 3ULVC 4KJPD 2YSTA 1PP9E 1GW3A 3KEDA 4G9DA 3K80A 1YEKL 5LGJB 3UABA 4PJ0E 1EZVY 3BDYH 2Y3NA 4ERSH 4XZ4A 3MJWA 2DKMA 1AS8A 3DJ9A 5ENWB 2RJMA 3D06A 2IAMA 2R5DA 2J88L 3VWKA 4U1NA 1WHPA 1B0RB 1T0OA 3FC8A 3HE4A 5ID1B 2ZCLH 4FQXD 2DQTH 1DQML 2Q10A 1CR9L 3LD8B 3PL6A 4ODSL 5GRUL 4NQSB 1EAPA 2OTLP 4QMEA 2VN4A 1A4BA 2AQPA 5F6HI 3PNWB 4PJCB 3T4YB 2GFBA 3FUMA 4G2AA 1WITA 3QRLA 4HMCA 1U3HA 5AVVB 4PD4H 5CF3A 2N1TA 1LWRA 3SDYH 1EQ7A 1C08B 2RGSA 2XIDA 2YPLB 3GGWA 1PQZA 4PJ5D 1GYWA 5L0QB 4PW3A 1UUSA 1UGNA 3IB4A 3ZK0A 1CT8B 3GHGB 1OX3A 1WUNT 4JBZA 2R29A 2ZONA 3OZ9L 1WF5A 2P44B 2ZNWA 4WTXA 4ODVH 4F2EA 1RUAH 4I88A 1NOLA 4OZHB 2JJTC 3N40F 4Y9GA 3NPSB 2TAAA 1DQDL 3PABB 4ZAKB 2DPKA 4DJMA 3GO1L 4QWWD 4JDTL 4JPQA 4RFNB 4R90L 2NDGA 3MROA 5F7EH 2D7TH 3S36H 1T5WA 2CIIA 4LKXA 5BRPA 3HE6B 1QEWA 1DL7L 5DVLA 3FN0L 1E4WL 1AFVH 2UZPA 4NEHB 1VJSA 2BEQD 5F7AA 5LNEA 3AE3C 2R44A 3CZSA 4MFHA 5DYOB 1KDIA 3GSUA 4GRWF 2K88A 1QRNE 4YMPA 2VR7A 2YA0A 1VQ9P 1XIWB 3B7TA 3LIZL 3CN1A 4WW2C 3Q5RA 4QHPA 1YO4A 1RQVA 2QFRA 5L2KD 5EFWB 3TFKD 5FLUA 4F1ZA 2ZUUA 4H1LB 4RFEB 2W0FA 4JDVB 2VLMD 4AJVA 2MEJB 1Z9PA 3B4SA 3DTXA 1GAFL 4EI2A 2XY1A 3AG2B 3ESUF 1JF6A 5EZJB 1NFAA 3IKKA 4UYQA 4PJFA 2MJWA 1FH5L 4Y5VA 4F33B 5C07D 1YEHH 1TVBA 5FHBH 3IJEA 5GGQL 5ICYB 5EF2A 3UMNA 1CCZA 4HH2A 1RK0A 3QCVH 4WEBH 1T7YA 2O5ZH 2UZIL 2R7EB 2UWJE 1G7LA 5GRJL 3QNZB 3VN0A 2J5UA 2WWOA 4K3GA 5BW7A 4TPRL 4OGYH 2X41A 4TKWA 3X13A 3GK8L 4JN2B 2F2HA 2OMBA 2QSTA 5HJGA 2NW2A 4FXGA 4P4KB 4XB8A 2YXRB 4P2RA 3U6RB 3KR3L 3F04A 1RPUA 1UXSB 1CDYA 4R0LA 2CJSA 2JI1A 1J9TA 3F7VA 3CSYA 1Q2NA 4RAVA 5MENA 1OW0C 1FGNL 2JI2A 5DC2A 2OA9A 4Y88A 1WV7T 2EEBA 5K69A 3FU6A 5FOBB 1C9SA 2KQNA 3O6FB 2BP8A 5I28A 5IGXH 3R4DA 4FJYA 5TJWK 1T3FA 2EDLA 4PY7B 1ROWA 2O5XH 2IH1B 2OSWA 5AKRA 3RGHA 2GTWA 1AZUA 3V10A 3A4FA 5D6CB 3TH3T 1KGWA 4EIBA 4HP5A 5D7IE 2WLKA 3WTWA 1DD3A 1JAEA 1EXGA 3U82B 1YEJL 3IMRA 3KCPB 4QKXB 1SQBK 4PYGA 4AKOA 2X28A 4N24A 2C9VA 2HYNA 3M86A 3QH3B 4Z7OE 3DVNA 5F8QC 1UT1A 2I5YH 4OZFA 5I1KL 5KBLA 4P06A 2AXTE 3PWUB 2WIIA 1EDYA 4XMLL 1I1AB 5DD5H 5EF1A 5GPRA 1QO3A 1AQDB 4KK9C 1C5CL 5FGCE 1YJWP 2OMUA 3ABZA 4N68A 4UF7C 1A9VA 2VLRE 5BQ7B 2QGBA 3BVTA 2FO8A 4LLQB 2V2WA 5JYLA 5EUOA 4QI3A 1CDCA 4AH2B 1LTIC 5GGTH 3GZKA 5FKAB 5E95B 3MBED 4IFDK 5IFAH 4GXVL 3ZE2B 2NPSB 4JFPB 4GG6A 5IVZA 4K15A 3UTOA 2WNWA 1AZNA 2OSYA 1KFAH 3CMOL 5JZ7D 3AGVA 3QUMB 1C7TA 2PW1A 1QUNB 4N0UB 2UZXB 4XGZB 1IUZA 2EE2A 1DDTA 3PDDA 4AE1A 1TEGA 1DLFL 1AY1L 2ZJSE 1BVKA 2BRRH 1DUYA 3S4RA 1HXYB 2O72A 1RQ5A 2E75B 2OL3H 2XZCL 4TTDC 3V6ZB 4DPRA 1LTJB 1R5WA 1MHEA 1J9CT 4YHNB 1UM5L 1FG2B 1P6WA 2D73A 3X11A 1QABA 4HK3N 2C1OA 5BZWA 4DZ8A 5B3NA 1M1SA 4W70A 3FBKA 8CGTA 1T1ZB 2GBTA 4MD5A 5GTHH 5IMMA 1VFBB 3QXTA 2R83A 4QCIA 2P8PB 2ODHA 1I8IB 4JGUA 2R4SH 3EDEA 1TETH 5FA4B 1H0DA 3HB3B 3DI2B 3IDGB 1AANA 5D7IF 5LCVH 2PP6A 2KERA 3BRVB 3AU1A 3VWJB 1GIGL 2VSMB 3BVUA 1ODAA 4DCQA 1DQVA 1G9MH 3P9LB 3CDGA 5JIKA 1U8PB 3H4HA 4JVUA 5I8EB 4ZNEE 4PLJC 1RP9A 3SDXB 1QLFB 1IGIH 4FNSA 4Z7OF 5DJAB 1Y18B 3F12B 3KW8A 2XVKA 3OMZA 4FLHA 5FHAH 4WHTB 1GYAA 5DJXA 4M8UA 5GZOA 1R3IH 4HIJB 4TQ8A 4KK6D 4JX0A 4JRXA 1C5BL 5E8PA 3LZLA 3NCFB 3IGLA 5C0FA 1MHHB 4H8QA 1JPSL 4AE0A 2N01B 1U8LA 3N3EA 3WN6A 2C9PA 2EDNA 3OKLB 4XOBA 4ZUVB 2H47C 2LTQB 3DDFA 1UWGH 2LR2A 4MQTB 3VMOA 1QFWH 1XGQB 5JOPD 5T8IA 2BOCA 2WY3B 4HFUL 4AG4L 3KNBA 1OMIA 4NJ9L 4HKXB 2UY6B 3FU9A 1NGQL 3BZFB 4KHXH 1BGXH 3F65A 4J1UB 4OFQA 5AL8A 5EULV 4YHML 3DHJA 2EE0A 2FYYB 4FTVB 2XXFA 3CZFB 4X7DC 4MMZB 1NTKD 1RD6A 4FNLL 3UFIA 3B5GA 1GZHA 3FT2B 3FTUA 1SXSA 4AYDC 4JPSA 4D0BA 1LXMA 3UH8A 3RPIB 1HWGB 1KY7A 2HLOA 3MYJA 3HPLB 4POYA 3BIAX 1RAMA 3DV6A 1QTYT 3QJUB 3R8BB 4Y2DC 4QT5A 5C0CD 1LTSC 1BAFH 1NWQA 2WLLB 4UNUA 4DEPB 2D3JA 1KN4H 4ENZA 2OTPA 3LW5H 2AITA 4OAWA 1IM9A 4R7NA 4BHUI 3FFCD 4ETQA 1BD2A 3OHXC 5JA9A 2OZ4A 1SQXJ 4FXLA 2H88C 1IGML 4RGMB 4B5EA 2WSEJ 1KFNA 2B87B 4M8QB 1FZMB 3NEEA 4N0CC 4PJAB 4MWFB 3UTTE 1I8UA 1DVFD 1TXKA 1FIGL 4GUOA 1KEMH 3N1GC 5A2JH 4XPFH 3KPNA 3H55A 1FL6A 1G1YA 4DFHA 2F7PA 4PWGA 1S7WA 2DWTA 4F7KA 2Y5EA 3HVDA 2BZ7A 3UBFA 3U1PA 4ZG1A 3ZSTA 1H9VA 3QPXL 5I2IB 4N2MA 4JKKA 3KHOA 2ZXAA 5AUMB 1I9IL 4WY4C 3MUDA 3D6YA 1KQFB 1AQKL 3KHQA 2WWWA 1SBBA 1YG9A 3A0HH 1D5ZB 4EN3A 2B3IA 4WVRA 2IYPA 3WEXA 2ZT9C 3E7KA 3L74G 1O7SA 1QFUH 3U2JA 1X4ZA 4JJ5B 3SDDB 1V7ML 3CC7P 2KLSA 3UROR 4QAMB 5T3XH 3DBXB 2KP8A 3L75D 4X8XA 1Q82Q 1OM9A 2Q3XA 3TCLB 1TNNA 4P5TA 4NN6B 5CJBA 5ACLA 1EXUB 1FYTA 5I1IH 4WFFE 3NRQA 3H1KE 3S8FB 3TA3B 5IQMA 3D48R 1WZLA 1HHJB 3H9SE 4N85A 4LCYA 2NX5A 1FL3A 3IVKB 3AY4A 3P8MC 2DM2A 2G4EA 3TJHC 2P47B 3GSRB 1JK9A 1XZ0B 4S1QH 3X14A 3AE4C 4HJ1A 1HTLC 2FY8A 5EEUA 4L9LA 2OYHA 1UKSA 4RGOH 5BQDA 4LP4A 4CJ1A 3FUFA 5AVYB 3CXFA 2C0XA 1K8DB 5CJXC 4HUVB 3BMVA 2HRPL 3GSQB 5A2KH 2WT7A 2ATKB 2BVTA 2X42A 3C5ZD 3NFNB 3L72G 5GS0H 1X5LA 3CD6P 2F54E 1LP9B 3QAZB 3E2HC 2E42A 1R0AL 4JQXC 4CN1A 1IB5A 3HD7A 1FJ1A 1SHSA 1G2CB 3VXRE 3RKDC 1EEUA 4P2OD 3ARED 4Q0XH 3CDFA 4NQDA 5DWUL 4TQHA 5IHUL 4RNRB 1NBVH 3SKNB 2GSIA 1NBZA 2VDQH 4XXDA 5LDUA 2E86A 4GXUM 5BZZA 3VX0A 1PG7W 4FS0A 2GSGB 3P69A 2WKOA 3CTTA 1NAMA 4ODHL 1ZVSA 3OXRB 2X3AA 5T1KA 3TIEA 2QQKL 4J4PC 4LIQL 3U9UB 3GLZA 4G7RB 3KYMA 1P84E 1GK4A 4GP5B 4QD2E 2XC8A 3VMNA 4E9YA 2YD5A 3E9UA 5JOFB 4I0PD 1MIML 2A77L 2VITB 3TSIA 4D6TJ 4B5ZA 3L9RB 2R23A 2A6IB 1KB9H 3CXHE 4WWKC 2A06D 3U4KA 1PZAA 3I50L 3GLDA 3FQRA 4RKUJ 2CPUA 2X4UA 3B1UA 1RH8A 4PR5B 3IJSA 3HTKB 2PXYC 2WLHA 4AVIA 4BKSC 1J1PH 1W5CE 1AJ7H 3AT8A 5FB8A 5HYSG 4NCC1 2W0KA 4YHIA 3A21A 5ANME 1BEXA 4UZGA 1RZIB 4RX4D 3VP9A 1JWSA 2X44D 1VFAA 1S5LE 1JNNH 1YEIH 4GRLB 2WLZA 2GBUA 4XMZA 4BH8B 3GIVB 4AIOA 1U3JA 1KDJA 1NSNH 5IQ7H 2IBZI 3FB5A 5CAYB 5BOPA 2HTKD 2CK3H 1AZRA 2KT6A 1DFBL 4IOFC 5FFGA 5DRWB 2L91A 3D4YA 4HCRL 4UQ2B 4YSOA 1I7UB 3RIFF 4GEJA 4TLTA 4HIQA 2G4GA 1AOZA 4V2BA 5IW1B 4PTTB 5IROA 4H5SA 4HVBA 1PZDA 3NFPB 4F80A 1A66A 1JDDA 2OP4H 4Q14A 1KWGA 2PMZA 2YRBA 2AS5M 4PY8I 4Y8DC 1XR8A 4OJDH 3C09C 3VH8B 2FX9L 1NLBH 3IFPA 4N8PA 5IMLA 2EH8H 3RK3D 3JVGC 2EDXA 2ORBL 3BP5B 4RISH 2C3VA 1P7QB 1NTZE 2LXBA 4H20H 1TITA 4X6DE 2BP3A 3GMPA 2XWTB 4P5MA 2J8UE 2PAJA 4FMKA 3PHAA 3V0WL 3EYFA 1PGQA 4X5WA 3QQ9C 1TSRA 1C8PA 1I9RL 4OY9A 1NC4A 1RY7B 4M8VA 3ZO0A 2APBA 4ELME 1KILC 1DJSA 3CCRP 4QYAA 4BSWB 3D18A 1KPVB 2B39A 1HSBA 4TVUA 4HAKA 3UBXI 2GIYA 4ODBD 5IB4B 2GI7A 4GG8A 1F1DA 4I0KA 4APQC 1XO8A 4Y1AA 1U8KA 3HBGA 4OF7A 2AANA 3KS0H 1IGTA 3ZKMC 4S1SH 4JKPH 3RZCB 3BN9D 3WO3B 4PRNA 1ZLSL 1BMWA 2HFTA 3QC5X 2AJXH 5E4AA 4LEXH 3HIZA 1VDGA 3U9PH 1N59B 1EDJA 4Z7VB 1H8AA 5KTBA 1YJ9P 1U4EA 5DJ0B 1MY7A 3WNNA 3IDMB 4HULB 4IRSC 5DSCB 3CX5E 5H2FE 1RUQH 1J1DB 2G8YA 1KG0A 5HGBB 3MV9D 2IO5A 2R0WH 2YO2A 4N3TA 4PSPA 1Y9BA 3TWCL 3STZB 2PPFA 1EZSA 1Z9MA 1CVRA 2OQJB 3PQYB 4FG6D 4O5LH 4WWNA 4LIQE 2WCSA 1P4IL 1SOXA 5CWSA 3DGGB 4HIHA 3HKFA 3LKPB 2E6JA 4Y4KD 3G08A 2EKSB 1UWEH 3MUGB 1PDKA 4G5ZH 1L0NG 3QORA 4JG9A 4L4TE 4EI5C 2Z1KA 3TT1H 1FN4B 4LSVL 3SB3A 1WA1X 3DIFB 2YZ8A 2FB4L 4D94A 3L1EA 2VLKD 3MO1A 3VRIA 1EJFA 2HLEB 3WAKA 1QPPA 1DQLH 1UCBL 1U57A 1ZHNA 3IS1X 3O0RH 1E4XI 1BEYL 3FSAA 4WU5A 2QVIA 1LK3L 5JR1H 1IKOP 1D9KC 2H9GA 4NM4L 2GC7C 3KWUA 2IZ0A 4X6DF 3HE5B 5HPMA 2C9UA 5HPOA