4XE5B

Crystal structure of the na,k-atpase from bovine
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
281
structure length
281
Chain Sequence
b'SEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEIAFRPNDPKSYMTYVDNIDNFLKKYRDSAQKDDMIFEDCGNVPSELKDRGELNNEQGERKVCRFKLEWLGNCSGINDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVQCTGKRDEDKEKVGSIEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
publication title Isolation, crystallization and crystal structure determination of bovine kidney Na(+),K(+)-ATPase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 42
structure length 281
sequence length 281
ec nomenclature
pdb deposition date 2014-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4xe5B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 4xe5B02
5AW0B 2WWWA 1T2KD 1JNMA 1MFZA 4JYBA 2WTYA 1JUNA 2Q5UA 3V4QA 1HBWA 1CI6B 4I2LC 2R32A 4I6MC 3V5BA 3VMYA 3TNUB 1SP4A 1H8AA 1H89A 5AVUB 5AW5B 1S9KD 1A02F 3M0DA 5APQA 5AW9B 3HE4B 1OWAA 1G2CB 3I5CA 4C46A 2YO2A 1IO4A 3NXSA 3B8EB 3A3YB 5AW1B 1DH3A 3NFQA 3LIDA 5CMZA 3HE5A 1T2KC 4GKGA 2WT7B 5APTA 1HJBA 3M0AA 4AUWA 4RESB 2C9LY 2IPPA 5AW3B 2E43A 4EOTA 3V4WA 4B86A 3M06A 4C7NA 3M9BA 1CZQA 2KP8A 3VMXA 1GU5A 5AW7B 1GD2E 3NMDA 1S9KE 2WPSA 2XV5A 3P8MC 3WGUB 2QM8A 5AVQB 2VRSA 5APXA 2WPQA 1OXZA 2Z5IA 2C9NY 3P32A 3HE5B 3NTNA 1HWTC 1CSBA 2XZRA 3OAKA 1X8YA 3TK1A 3MD0A 3VMZA 1MUUA 2N9BA 4GT1A 1NAFA 3KDPB 1H88A 2P7JA 2W6AA 1GTWA 2W27A 2R5DA 4M3LA 2E42A 2R5BA 2P67A 2YO3A 5AW6B 5AVRB 2YNYA 2JJLA 3IR9A 5AVSB 5AVVB 1A02J 1CI6A 4HYTB 5AVWB 2Q3IA 5AVTB 3A2AA 3TNUA 3HTKA 2Z5HA 4LC1A 1FOSE 3M9HA 3M91A 2ZXEB 1GK4A 2R3CA 3A7OA 3T97A 5AVZB 3O8ZA 3LIEA 1NWQA 3L37A 3P7KA 3TYYA 3VN0A 2XU6A 4AQRD 3L36A 5AW2B 4C7NB 1GZLA 3WGVB 2WT7A 2QM7A 4KHXA 3KQGA 1GK6A 2P2UA 5AVYB 5AW8B 4AYCA 1MV8A 5APUA 4DZOA 1HUCA 4XE5B 2BASA 1SLQA 3SWFA 5APYA 2H7HA 3MGNA 5APVA 5AVXB 1GU4A 3VYIA 1YYCA 4RETB 2WPRA 3VTPC 1J2JB 2Q7CA 5APWA 3HE4A 1FAVA 5APSA 3L35A 4JYCA 3A5TA 5AW4B 1FOSF 1KQLA 3UIAA 2ZFCA
chains in the Genus database with same CATH superfamily
2Y06L 2OSWA 2HYNA 4W4NA 4RA0C 4NKOA 3FUMA 4UQ2B 1U58A 1MCHA 2PTUA 2X05A 1CBVH 5GZNC 5HHPB 1DJXA 1MAML 3E80A 4QTHA 3T4AA 4BK5A 1OWWA 1TXKA 2CH8A 2QSCL 1SJMA 3D69B 4AL8C 1YMME 1MFVA 3NXSA 2FBOJ 3NEXA 1S7TA 3QPXL 1K72A 4NQXB 1HE8A 4NYLB 5HY9A 3NCJH 3B5NC 3T71A 2FYUD 3S98A 3US0A 2OARA 4EOWL 3G6EP 1QFWH 2X88A 3H8NA 4PRDB 3WNIA 3NRFA 1CURA 1WBXB 3TIDA 2IQ9L 4YHOL 5I0ZA 4N85A 1FVCB 2AJ3B 3OHXA 5C08B 4TNEA 3X3GL 1AO7D 4KV5F 4JQIL 4I77L 3VG9C 3N50A 4GIAA 1GU5A 3L73D 3VXTB 1MLBA 3GINA 3E1ZA 4TNWF 3QFGA 2H88C 3DGDA 1YBKA 5C0CE 2UY7B 3B5GA 1GOGA 4PD4D 2V33A 3B5NA 2WOBA 4RGOH 4Z7UE 3MRGB 2ZPKL 4NUGH 5F1KC 3NFSH 1A7NH 5KVFL 5DHVA 3KH3A 3B2MA 2J8UA 3QAZB 3PU7A 4ZW8A 3X1BA 4R4NC 1VPOH 1CDHA 2QJKB 5K59E 3O2DL 4LHUG 2H32B 1J0KA 1HQRA 2YK1H 4OCMC 1HVXA 3BKYL 3FSZA 3OKOA 4ZMYA 1ETA1 3D5OF 4PI0A 2NSXA 2OYHC 2B2XH 1DBAL 4UM9A 3PDOA 3QCVL 5KSBF 4K23H 2XRAH 5H37A 1IC7H 3NN8B 1FRGH 3DETD 1PDKB 2IALA 1AP2B 1GIGH 2CCVA 4HXAH 1SQBE 3QZWA 4MAUL 5FEBA 1QVGO 4IS6B 1E27A 2XHNA 3L1GA 4G80A 4L5FE 5GRYA 1UWGH 4EDWH 3KPLB 3HZKB 2OYHA 2C1OB 2J3SA 4N3TA 3OB8A 3LIEA 3BVWA 3MTUE 4WVRA 2QJYC 1INEL 3ZKQD 2LLLA 1BZ9A 3CBKB 3B5ND 1U92B 3V0FA 3KWXA 3D71A 3K72A 2DI7A 1TITA 4UMSA 2YLKA 1HKFA 1UASA 3HZ3A 3SPHA 1KZYA 3AY4C 2WO3B 1V27A 1WPCA 1ANUA 2CKBA 2VB5A 4LLVA 3GHGB 4RGNB 1CFTA 5BO1H 3UDWC 1VF5D 4OZFA 3VJ6B 2IBZG 4GPVA 3NACH 1UZ8B 1SEQL 2FJUB 4RETB 4JRLA 1K8DA 4W81A 1CJYA 3DX6B 1M7IB 4UM9D 5DZNA 5HYSA 4G9FE 4M7KL 1P7KA 2YLHA 1TDQA 1TZ8A 1BM3L 1NTMK 2YRLA 4WKZB 1KJ2B 1JJUA 4WNSA 2X6AA 3KBEA 2OJEB 3FB8B 4YSQA 2X0VA 3MUGA 4RMBA 1JUNA 4JCMA 4YFLF 3CMAP 1KNOB 1I85C 4NFCA 1MW2A 4FG2A 2HX9A 1T03H 3F65A 3G04A 1VADA 1D7FA 1W72B 3QPQD 3Q2NA 4F33A 1WD8A 3CLFL 2DTML 4EXKA 4HB1A 2R83A 3HG1E 3JWDL 4UCFA 1HJBA 2DN7A 3FBQA 5JHDB 1H6FA 3FB5B 5KS9A 1AQKH 1IAKB 4N78D 1YDPA 3CQFA 4ODSL 3TWYA 4NPJA 2YJLA 5LB1A 3D8MA 2X7LB 4KKBD 1HIMH 4GW1B 4KK5C 4A55A 1VPCA 3KNBB 4I2XB 3MFFA 3QXVA 2IADB 2JJSC 4G42A 1EZVI 4GSRA 4DZBB 5BQ7B 1FZAA 3A0BH 3G9AB 1LT1A 2QQQA 3GHBH 5GS0L 4GKLA 3FN3A 4UUJA 4HJ1A 4NKDB 4F7CA 5EU4A 2N9BA 2G30A 2A77H 1ACXA 3L2LA 3RUGB 1MCBA 5DU7A 1U6AL 2ZAIA 4KRLB 5A40E 2V3FA 3IDYB 1A6WH 1GRWA 1MFUA 2AVGA 2W59A 4Q97A 2XXCB 4XP4L 3HE7A 3S0PA 1RZKC 2WKOF 5DK2B 4BINA 4HH2A 5EUOF 2NY6C 5A2KH 2AK4E 4YIQB 1NMCC 1UM6H 3WKQA 4HFUH 4JFZL 3VQMA 3I2CL 3U7AA 2XY1A 3WEAA 4Z78B 5KYUB 2RB8A 1LEIB 2BHZA 5CGMA 3PFUA 4D7BA 2CO4A 2RQ8A 1T0PB 1WAEA 2C9VA 5D5MA 4OFPA 1DO6A 2P5WA 4LNRA 3IMTA 1MPAH 1ASPA 2NTFA 1DVZA 5DZJA 2Q6WA 4AIZA 2WW8A 4DTGH 2FIRT 2XKNB 2JF1A 5L2JA 1LP9F 3BAJA 3ZDWA 3TA3A 2DQEH 1GK6A 3QP3A 5D1XB 5EO1B 5KYXA 3VCLA 2RCSL 5I6OA 4IOIA 5L8KB 4H44B 4YZWA 1KPVA 1FV1B 1JZHA 5ANME 5A7BA 2B1HH 3LZFL 4AH2B 2Z8SA 3APDA 3BHBB 4IRSA 3REVB 3KPQA 5EZJA 4Y2DB 3VXPA 3KGUA 3QGVA 1KELL 5CILL 3TA4D 3WJMA 3DX9B 4I48B 2WQUA 1JGVH 4KK5D 5KLVJ 4QXVA 1QAWA 3QUYC 3D33A 5JO5A 5K9JH 4N2MA 3HE7D 2DF3A 4NN5B 1I8LA 5E79E 1K5NA 5DO2C 3EOAB 2GUYA 4OWFA 3ZDZE 1RQUA 2KLTA 1GYVA 3SCMB 1JZ8A 4U1GC 1T66D 4MA8H 2JFCA 3Q3GB 2XQYA 4MNHB 5DZVA 3VXMA 4W93A 4P2RA 1TZOA 3ISYA 1OGAA 3U7WL 3KYOB 2WNWA 4JGUA 3ULVD 4OLZH 2P5WD 4JO8A 3VXOA 4YX2H 1YPZA 3II2A 1NVOA 4GFTB 3ZR5A 3B83A 1GHFL 1CICC 1YMHA 3EOBB 1HL8A 1ZN5A 1C5DA 1OW8A 4K2UL 4NLHA 2IPKA 2GT9B 2LGNA 5FM8A 3TA3D 3IPFA 4QRPE 5DHXB 3HE5A 4LCCC 4MB4A 1DUZB 4GRWF 4M5ZH 5A3IC 4IRSD 5AW3B 4PRHB 4K73A 4Z7WB 4Y7MA 5D2NB 3CFDB 1OK8A 2EXSA 4R2GB 5DJYB 4YOKA 4DP4X 5DMYA 4LF3B 4YDZA 1JPGA 3EGSA 5TPWH 1P84H 1VENA 1KTKE 1T4KB 5FA3A 3RNKA 3WO4C 4Z3TA 1F1DA 1IARB 1U8QA 3GLEA 4LBAA 4UBDD 4B7LA 3VXMD 5IW1A 2IQAA 3Q5RA 4P2RD 1G4MA 3SE4C 1ZLVK 5ITBL 1PBYA 3G9RA 5SWQB 1OGAD 1ONQB 3QDME 3WFDH 3V6FA 5JPNC 2Y2TA 4AVJA 3QR1A 1TKWB 2VGLM 4PTTA 2VXUH 5DO2D 5CCHC 1UTDA 3L71D 1N7MH 1DVFC 1JI2A 1XF5B 1UOVA 2XTSA 3IJYB 3L2NA 4O2CB 5DFVD 5IHLB 5IHZB 1E5WA 4LVNB 1V7NL 4JG0H 4HCIA 4ZTOH 4JDZB 2GSIB 5FGBC 1VL2A 1BBJB 1AE6H 1S8DA 4E5XB 2GBUA 1KG0A 4EI2A 4BEIA 1VFMA 5G5DB 2YWYA 3RIAF 1L0LJ 4HZ1A 1Z5HA 1PGOA 4N90E 4RRPA 1T89A 2FX9H 2XTJB 3CX5J 3N9GL 5E2WH 4PRAB 3FU0A 3VI4F 2P80A 2F15A 3IDNB 2XN9A 1JGUH 1P4BL 5HVHC 1RULH 1UWEL 4A68A 5D1QC 3RVUD 1IB5A 2CDEB 1A3RL 3QWOB 5HI4C 1E4XH 4GI9A 4I8DA 4PTUA 2WO2B 5FECA 3QYMA 3MKGA 5DMIH 1QQDA 4LRNL 1DBBL 1Q9WA 4HPOL 4XPBL 2PNDA 3BEWB 4H5SA 2CBTA 3F62A 4N0FB 5A3ID 5I1AB 3L7EA 1N64L 3ZL2A 3VXSA 1ZTXH 4YDKL 4Z8FH 3GKWH 2E7DA 3MJ9A 3IU3A 1RZGB 1UKTA 1B0WA 4QR7A 1Y18A 3TCXA 3QW9A 2O5XH 1RD6A 3DMMB 4QHMB 3LSOA 4LHUB 2BS71 3SDDB 2FQDA 2D4DA 1AFOA 3V5KB 2B5IB 4P5MA 3BWUF 3TF4A 1QFWI 4YDJA 2OMXB 3O0RL 3VAEA 4LPYA 4MHHI 3C2AH 5I71B 1ECZA 2EECA 4JPIA 4G8EA 3A5VA 5F7DA 2HZHA 2VRQA 1T1YB 1NDMB 5J3HC 4AGPA 4YNYA 2XN9D 4NO5A 2CBMA 4B96A 3WLBB 4JM4H 4LSUL 4AEEA 2FK9A 3CX5H 3UGXA 4OF0A 1JHTA 2NQDA 2ZYRA 1MCPH 1FE8L 2EKSA 4CJ1A 1FSKB 2JVUA 2HRLA 2AJUL 3CVHA 3T0EC 1P9MC 1MHEB 3FQUA 1SQ2N 2B4CC 4IBQA 2R0ZH 3QUHA 1JF5A 2A83A 3U1QA 2E4FA 3VXSD 4EDXB 5I1KL 3DIVA 2MPAL 4NQVB 4BFBD 1EDLA 5HI4D 1FZBA 4XPGL 4XX1G 2P26A 1BD2B 3V4UL 3U30C 4UIMA 4E41B 2VWEE 5EB9A 1WSST 3IMVA 4LSVL 5DVPA 1AXSB 2LOEA 4JO2L 4S1SH 4WUUA 3UTSE 1IBGH 3OAUH 3AT9A 5CHXA 2BVPB 2WTOA 3EYSL 2X6CA 5L4IA 4W70A 4IEFA 5HD8D 5ICYB 3UTTE 5KBKA 4Q9BA 1HSAB 1H5BC 2CJTA 4X6CF 3ZTDC 2HPOA 3GT6A 1JDDA 1Q8MA 4WI5A 2JWYA 1B88A 2LU4A 2LQRA 4YDVA 3TCLA 1JNNL 5FO7A 1NMBL 3UP6A 1XGUB 4QJ5B 2CO3A 5AVVB 4HD5A 4QXTB 2YAMA 5I5JA 1H5BA 2CG9X 2BLFA 1G1CA 4OZIE 2UWEB 2APTA 4ISVB 2F18A 2GTQA 3TH4T 5DJ8A 3LMJL 2NLJA 4H1LA 4I0PB 4YPJA 2BXZA 1FC2C 1D7DA 4LMQE 4QRSB 4YHNA 4DOJA 5IZ7A 1IM9A 2Q2LA 4EIGB 1LNUA 5FLVA 3DX1A 4L8DA 4FCHA 4X4XB 5KJ7C 1W91A 2AZUA 3ZHDA 1CF8H 2BRRH 4FTVB 2JKSA 2N7BA 2P8MB 4L4TE 5I8KL 4JFQA 1U8LB 4L23A 4XAKD 1PSKH 4WUUD 1KQGB 2RQEA 2WYZA 4HIJA 2B08A 5AZEH 2VIRB 4DZ8A 4YPGB 2VLRB 3GK8H 1YUHB 2BZDA 1T20B 1BF2A 1GL2B 2OTUB 2C34A 5IHUH 2JJTA 3HLAA 3AREC 1XF4B 3GNMH 2KH2B 4LFHG 5I1EL 3BAKA 4UT6L 1T1WB 1Z6JT 4K3AA 2B1OA 2QADB 4R3SA 1NTZE 1NGXB 3BP7B 2OSLB 3HNSL 3NH7H 3JV0A 5DRWB 3PV7A 1PZUB 3WO3B 4F27A 1AGBA 4U1JB 1N26A 1FOSF 4JUTA 2OFQA 3IDMA 4TLFA 2HN7A 4N87A 5GIRB 1V3JA 5DSCB 3L1FA 2CIKB 2IH3B 3HW7A 1VB9A 5CINH 1SJEA 5JHBA 2YQ3A 3T08A 1IM9D 3VMYA 2KERA 5TQ2L 3OR6B 1R8EA 3ARDA 2XBZA 3BRDA 3U36B 1XGRB 4CVUA 3HI1B 1PYWB 2D7MA 4WEEA 1RJLA 3KPPA 1QYGL 2D31A 3W3BA 2K1AA 2XWCA 3KE0A 4PRPE 4YHLL 3LIDA 2OW6A 4KXBA 3CDGA 3TU6A 2NYYC 3AS0A 1CDGA 2FFDB 3JWOL 5KBMA 1G9EA 3ZIYA 2IBZX 4LLMA 2HFFA 3SGDH 3Q06A 5MENB 3MRQA 2BS9A 2XU9A 3WUWA 2P7TB 4A6YB 2ADFL 5B38B 4DPAX 5L4MA 2AFNA 3K46A 1O7SA 3CHSA 1J1PH 3L95A 4PJBE 4PW9A 1KEGH 3GPSA 2OR9L 4K94C 4ELMA 4MASA 4FN0A 1J1OL 4JQVA 1JBJA 2HRPH 2VMCA 3PUUA 2WWMD 4X0KA 1FGNL 4J3XA 2R8SL 5DJZA 1OXZA 5SWSE 4YVUA 3L74J 5T1KA 4R97C 3QISA 3V0AC 4K35A 3U7YH 4QKXB 2DDQH 3HZYB 4W9JC 4JJ5A 1ACZA 3HIZA 1H88A 2QV4A 3ZE0B 4IL6H 2BOBA 4XBGA 5L2KE 3K0WA 3ARDD 1XCTA 4JPSA 2QVKA 5I26A 3RVVD 1E9OA 1NJ9A 1NAKH 2B1AL 4ZX5A 5LGKA 5HDBF 4KKLC 1UYWH 3RZWA 4PV1B 4IDJL 1DJSA 4YWGL 4KTDL 4O2FB 1G9NH 5C0FB 1FH5H 2W60A 3ECWA 4PJFE 3VWKB 5J11B 3U9PH 2WCPA 2R27A 4GO6B 4MMYB 1KIRA 1EHXA 5JHMA 5HGHB 2ARWA 2WY3B 3QSKB 1P1ZB 2ZXDA 2ORBL 4WB4A 4HWEH 4LLWB 4UINL 5GGSA 5CJXA 2A74C 1KEMH 1NQBA 3L7FA 1EO8H 4JG1L 4WW2B 2M83A 2PXYA 4YDNA 1X9VA 2MNJB 4N86A 3VD7A 3OKEA 5T1KD 3FTZA 4X4YB 2DQTH 2L4OA 4NQCB 4M8RA 1EGJL 3WJLA 3GMNB 3X13B 2I69A 1HJCA 5DWUL 1BHGA 1ADQA 2A4CA 2J1ZA 2MHAB 1CYGA 1EAPA 2WBJC 4I9XA 3OJAB 5KUKA 5IGXH 1CFVH 4QRUB 1S9VB 3NAAH 3KL0A 1TETL 3ZJAA 4YXHH 1PD6A 2X42A 3M46A 4ZFQA 3GMPB 1GXEA 3MBXH 1N9PA 2VE6B 3NP4A 4PGBA 3DX2A 4KRMB 4BJLA 2OXHB 5I74B 3DVIA 5DZOA 1KFMA 5C0JA 2QDVA 1RY7B 1SQBK 1J9TA 4LSSL 1RUML 3O3BA 1N2RB 4XN8A 4JYBA 4MTMA 2DJUA 3JV4B 2EDFA 2NY1C 4UAOB 5IB5A 4GSDH 2CXKA 3BLKA 5K1VA 2WTPA 1UOKA 4X6DE 1KZUB 2ITAA 2PN5A 4CL7A 1KLFA 4PG2C 2CKBL 3OMIB 3TIEA 4LSRL 4JB9H 2HH0H 4HSAC 3RAJL 3S35H 1OAQH 2PXYD 4DPCX 5IJVA 4JBZA 4IRJA 4XE0A 1DCEA 4OGYL 3GSRA 3HN3A 4ERSL 3GIVB 5I82A 2HR3A 4ZZFA 1ZRUA 1AD0B 3BAEL 3IB4A 1NAMA 5TJHA 1MRDH 4MMXA 2I9TA 1UEMA 3FCSB 4PG2A 3OC8A 3H1ZA 1PZCA 1XD0A 2O6DA 4EMZA 4HOXA 2ZCLL 3CCMP 3GXUB 4HW6A 4MBOA 2QKSA 4PJ9B 3ZT6A 2VDKL 3CLWA 3L5WB 3HS0C 4KH2A 3DI3B 1DDTA 4IGBB 2CO7A 1RZIB 3NZHH 2Z0UA 4PUBH 1BGYE 5EWIH 1NCIA 1KCRH 3BKJL 5E1AB 4B9CA 4L18A 2VERA 3B8SA 5SWZA 3TO4A 3NFPA 3SKUD 3FO2A 1SXSA 3HG3A 3OKNB 1CC3A 1KBGH 1AGCA 3C9NA 2ZWSA 5KYYB 1E4XI 2ZUTA 3VU1A 1V3LA 5EU6B 1RY3A 2AQ3A 3L5HA 5E8NB 1XCXA 2B8OT 3FONB 3T0XA 5E8PA 4WFFE 1Q7YQ 2D2CC 4WW1B 1F56A 4YSRA 1QWNA 3H9SA 4OZGE 4IRJD 2ZQKA 2ZOWA 3KDMA 5IQ9A 5BVPH 1IBBA 4BFJA 1P7HL 1JGLH 1H0DA 1XFPA 4TTDD 3PP4L 1F58H 3CXHD 1VDFA 3O3EA 2LR4A 4FNUA 2KZ1B 4JJHA 4KJYA 4PJCA 5TE4H 2NW3A 3N41B 1GYWA 3TYYA 1QLRA 1RIHH 2CBPA 1ZA6A 4L4VE 4P5RA 5DQJB 4HOZA 5BUAA 1PU0A 2WSFJ 3RZCB 1DSYA 2VR8A 4HT1L 5I15H 3IDJB 3V4VH 5AW8B 1NBQA 1YN6B 1VEPA 3CZJA 3MI6A 5IB4B 5D93C 3GSWB 1QEWB 4XA4A 4BELD 2R2HA 1KN4L 3M1BB 1RE3C 2WNXA 3FQYA 1LE9A 4DGIH 4Z3HA 5SWZD 1HNGA 3TO4D 1EAJA 1T7YA 3FQNA 4ODTL 1GJIA 2XV0A 4UM8B 2G9HA 3CX5I 2ZOLB 5EEZA 4A7QA 1XSOA 2Z4QA 3DLQR 2DMHA 3QI9C 4LVHC 4N2BA 2HLOA 4U33A 1OZHA 2XNDH 1FE6A 4EJ1C 1BCCG 3TWCL 2WKLA 2K9JA 1EXGA 3DX4A 4M3JA 3QJFA 1PIGA 3O3AA 3ZL4L 4XVTH 3H9SD 1WAAF 5GRJH 4M5YH 4V11A 1BZ7A 2NCEA 2CDFB 2IG2L 3PWPB 4H0LD 1AQTA 1UWXK 2A6KA 2WVTA 5B1JC 1DL7H 1OP5K 4R4FL 1TU2A 3GF3A 1UM5L 1SP4A 2DD8H 2E9BA 3TV3H 5D70H 3AEAC 5EIIA 5I0XA 7PCYA 1WFUA 2CJUL 2ZYDA 4FNSA 4AJ0A 5LGJA 2BNRE 1MCQA 1TZAA 1RJCA 3KXFA 1OY3B 4N0UA 3FWLA 1OCCB 1RP9A 2XPGB 3LKPA 3HUJE 1T5XB 4H8UA 3ZE1B 4GEJA 1WEJH 5B3JE 5KSUB 2WSFH 3ABVC 3T3MB 1RK0B 1AKJB 4EN3B 3A6CH 3HE6B 3E2HB 2B9AA 2VL4A 3QEGH 4LOVA 2HVJB 4XAWL 4Y1AA 1MCWM 3HRZA 4P5KB 5AAMA 3VFSA 3B9VA 1OT2A 3GTNA 5IB2A 3DRTB 3QCTL 4CW1A 1EBPA 1FVEB 1M6OB 3KPRE 2A1WL 4MD0A 2YSSA 2V9RA 3LB6C 4HOWA 3VFUA 1K4DB 5FB8A 2DQFA 4K7FB 1FL5B 3IGLA 5ID1A 1CL7L 3HNVL 1Q9KA 4HUWA 1AFVL 1VZGA 2B87B 1NCDL 4MGXA 2LKMA 3MYZA 1A1NA 3EBAA 4PJ0E 3FT2A 4DP7X 3UBXA 1MFCL 3H0TB 4G7YH 3KWTA 1XGZA 4M7ZB 1DQDH 2WQVA 5LG6A 4PJ8B 5AAWC 4AKQA 4Z77B 3AB0C 5I17B 1M6UA 5FOJA 2BNUA 2FL5A 2X10A 1M71A 5I8CA 4F8NA 4K5LA 4D9LL 4YBLC 4Z5RA 1L0NG 3ZTNH 5AL0A 4R0LB 3DGGB 3BE1H 5I9QB 1SXBA 1JPTH 2YBRA 3VRIB 1S7SB 4RX4A 5CIPH 1T0MB 5HGDA 5JW3L 3D12B 5E2VL 1QBML 2COQA 4V1DE 3FCTB 1HS6A 4Y1AD 5G4MA 4OH2A 2BFVH 3GB7A 3S34L 5J12C 4MXVE 2KK7A 4KKZA 4YSUA 3ZRSA 2WLMA 5T33L 2XFXB 2XVBA 4URTB 3ES6B 3J2PA 3P3TA 1BECA 2ZWYA 1VQOP 4ELMB 4UB8E 3HHRB 4LKXB 3AECC 3BJ91 1PL5A 5J06A 4ALAH 2MNUA 4K9JA 1MSPA 5TDNA 4F3FA 4NKIH 5TQ0L 3VMNA 4KMTH 2C3XA 3GLZA 3UYOD 3FUDA 5B39A 3FQ1A 4YEFA 1YI2P 4L8SA 1JWSB 2H26A 1IFJA 1KIQB 1J7VR 2APFA 2DIAA 3GLDA 3IETB 1USDA 1TFPA 4AJVA 3SGDI 4TQHA 4HKJB 1JXJA 4LEOA 5CJBA 4RX4D 3G5YB 4M48H 1KY7A 5DHMC 1B6UA 3VFTA 3KLDA 1AHWB 1KYOJ 3EIFA 3TGUD 3G5WA 4FXLA 3FPYA 4XMLL 3B2DC 3WNLA 5JZ7C 3CSFA 4G9DB 3HE4B 2ZXXA 1QLED 1S78C 4LSQL 1U8MB 2H2PC 2GCYB 2F68X 1I31A 2I1KA 4QRRA 4Q6IB 1PZQA 2W1NA 3H7BB 3D70A 1AD9A 4X80L 2IV9A 3Q8CA 4AUWA 1CD1A 4KROD 4JFDE 4XPHH 5ICXB 4A39A 2HMIC 1XCQA 1LP1A 5LAPA 1OB1A 1KFGA 3GBDA 5ITFA 3PHQB 1F41A 3UAAA 1ODUA 2FHFA 1BZDA 1NCCH 4KPHH 4AQEA 3ECUA 1P53A 2BINA 5JQHC 4F20A 1A7OL 3C6SA 1X3DA 2OMTA 3TBSA 1TEYA 5DEFB 5FYLD 5GISL 1R47A 3OKKA 4PJGB 5F7MC 2AAAA 4CMHC 4FYRA 3IXTB 2IO5A 2ZJSL 4ZOEA 1J1DB 1A25A 1YNKH 3CFUA 3MR9A 3RWCA 3WAKA 4AK1A 1H15B 5EC1A 5EZIH 2N1KA 2F61A 3IE9A 4GQ9H 4ZUSB 3W2DH 2QPEB 4X7CC 3WJJC 1NFDA 4XP6H 5A6IA 1TCMA 2EICA 4EDWL 1VGEH 4JDEB 4MDIB 1U8OB 2DI8A 4XBEH 1NBCA 1KYOH 4X4ZA 4Z76B 2YQBA 3V5DB 3WBDA 4P9HH 4QRRD 2I60L 1A47A 4P4KC 2GC4C 4XRCA 5HJDA 1CXIA 3IDIA 3B7SA 3N44F 2F9BT 5CZKA 5K93A 4C83B 3X2QB 2FX7L 2ESVB 2B39A 3WJJA 2IF7A 5DMGC 5CEXA 3CCRP 2CBQA 3ZUCA 2K3TA 2A9NH 2AJVL 2HTLD 3IN2A 3T1FB 2H2PD 2MTAA 5CBNA 4WEBH 2J72A 1CI3M 1MW0A 4N4YB 3JTBA 2XVGA 4HKZA 3IN6A 2VC2H 4DKDC 4M62H 4I2XE 2X1WL 1TEFA 3DV6B 4MXQD 4AYCA 4Q0XL 3FUKA 1PZ5A 1NTKE 1JV5B 2RH0A 3DURB 4LCIH 5C0IB 3SDCC 3RFZC 3CDCA 1ETZB 2XNXA 2QJDA 3RUGE 4NNXA 3QARA 4RWYL 1TJHL 3IGAB 4UOJA 3HZVA 3L54A 3WNNA 2FNWA 43C9A 1MWOA 1PLAA 3OMZA 1YRKA 3TPUA 5DHYA 3VW3L 1JHKL 5KVEL 3K2UH 4GLRI 3SGJC 1KGUA 1JGEA 2VDMH 1EUUA 4Z7OF 4HJJL 4D0DA 1ZKAA 4ZODA 1BREA 4Z7VE 5JHLH 5KZCD 1N7SC 3PQYA 2OQJA 3BP4B 3MNVB 4S2SA 5CEZH 1JWUB 9CGTA 5B5EE 1WFIA 4QHUB 3ZDYE 1LTBC 3A6BL 1EZVY 2BWQA 4ELKB 1F4HA 2Y0SA 4AYFA 1F8TL 2FEDC 4UU9A 3UXFA 1CQKA 3AWGA 3BGMA 1NCNA 2WLKA 2WNGA 3C5ZC 1N7SA 1ED3B 2VXVL 4NC1E 2JQAA 1WLHA 5D1XE 2YA0A 4OQTH 2YAEA 3WLWC 5DMGD 3OJDA 4DP2X 1J18A 1R4XA 2BOCA 3TPKA 3NDYE 1V7ML 2JMRA 1NTZK 1W0WB 2YAPA 1NKNA 3ATEA 1SHWA 4CU8A 3DYOA 5E5RB 1Q94B 1AO7B 3T0AA 3D0LA 4ONFH 4PJHE 2UXGA 2FJHA 1FCGA 1MLCA 2YD1A 3UO1L 3MA7B 2ARJQ 1D9KA 3DKHA 5C9JB 1WK0A 3KG5A 2R7EB 3KAAA 3NTNA 2N1TC 4HCRA 2QFPA 4YE4H 4NI6A 2NPSC 5JIDA 2IDFA 2YD3A 3PQYD 4FQQB 3LRSB 5I8OL 3ABMB 1R5VA 6PAZA 4L8CA 4Y9EA 1JCDA 2FYUK 1KCSL 4NKOB 5E8OA 2EXTA 1U58B 2KUTA 3Q6GH 5IBLD 2YNYA 1OCWH 4G1EA 3GG2A 4APQB 5IFJB 2F5BL 4QTHB 3SOBH 1QGKB 3DBSA 3T4AB 1X5HA 3LQAL 2PF6A 3SDYL 4G70B 5AVWB 1KCVL 1E6OL 4ZMOA 1B0RA 5HY9B 1S7TB 2A7BA 3U83A 2YS4A 1EXUB 1SN2A 2BM3A 3TIDB 4PRHE 4FYQA 5IP4A 3OHXB 1X5GA 4MAZA 4K8RC 4AYBA 5L0QC 1D9KD 2D4FA 2OCCB 5EMYA 3FS9A 3B5NB 3AM8C 1FO0A 5E6IA 5FHBL 4B41A 1YHQP 1ESOA 5DHVB 2W38A 2JB5L 2MJWA 2J8UB 5JYMA 1UVQA 1RE4A 1CLZL 1VF5B 2CPSA 3ZQ9A 3BVHA 3AE8C 1TQBC 2HB0A 4K5PA 5CKGA 4XCCL 1HQRB 4ENZA 1IKNC 3VA6A 3VACA 3C5SA 3OKOB 1MFDH 4KDTC 4A7VA 1KPRA 4NZUL 3OX8A 2BSTB 3PDOB 2DS4A 4UANA 4JRXA 5CLZA 3H1KJ 4DJMA 4PWGA 1IGTB 1ZY9A 1E2VA 2ADIA 2ZCKH 2GBAA 2IFGA 1XBRA 1XGPB 4AGOA 2XTJE 2IALB 4QXGL 1A14L 3QZWB 4FABL 1S5HA 1SN5A 1E27B 5L4FA 1NIBA 1H3WM 3D25A 5L7XH 3WKMH 2OYHB 2GY7B 2WYHA 5D7JA 3L1EA 1KULA 2FKWB 1R33A 4QGYA 3W1ZA 4XI5D 1EC5A 1ADQL 1E65A 3K72B 5E6ID 5IKCA 1LTJC 1KB9E 3S3CB 2HP4A 2ZX8A 4LLVB 2CKBB 1DBJL 4RFEA 5BOPA 2EDKA 1CFTB 3EYOA 2QSIA 1S9KC 4OZFB 4FKEA 1HEHC 4K8RD 4KU1A 1PAZA 5I8EA 4KHTH 1GGIH 2BY1A 2QJYB 1H6EA 3I6LD 5CGYD 4EI5C 4OVUA 2DMBA 2FLBT 2WPVB 2Q8AH 5CSZA 1MCLA 1K8DB 3H1IJ 2GVYA 2VJ8A 5HYSB 4JRXD 5CKAA 3QCUL 4TSBL 2ODIA 1A7QL 3MXVL 2WSSH 5EBLA 5ADPL 1FZCC 3BWSA 3MLUH 5E4EB 5C2UB 2WLNA 4JPKH 2MCG1 1CPUA 4S11A 4XNMB 2W9DH 1I3VA 5EHFA 1FHNA 4OSUH 5D7JD 4BK4A 4X5LA 3G04B 4MRCA 1YJNP 1NCWH 1DEDA 2E9GA 3BN9D 1KCUH 3A2AA 1LWUA 2O5NA 1FZCA 4FYTA 1WS7A 2JCCE 2IH8A 2PKDA 3I9PA 3OAWA 1J1EC 2CRZA 5D7SH 2FXMA 3GMMA 5I0VA 4YDMA 2ZCHH 3GTTA 3KYNA 1EX0A 1IIKA 4NAQA 5KS9B 2XKUA 3HFML 3HB3C 2IBZE 4WWKA 2EIEA 1HI6A 3O6ML 1WZAA 3EYQC 4JMNA 4IBVA 3O8XC 3F04A 2NY5L 1DQTA 3W38A 1OO2A 2KPNA 4YBHA 3CN0A 4G42B 3ZZLA 3MJ8A 3T09A 3CHXA 2ZKYA 3D50A 1NANH 2POHA 2XVKA 2Q3XA 2EZ0D 4R96A 4UUJB 3L4UA 4F7CB 2GUVA 3QEUA 5C7XL 5DT1L 3S5YA 1NMAH 2YAFA 4CPGA 1FFRA 3O4LE 4H8VA 5C70A 2AERT 4ZFGH 2R44A 3CIAA 4KMLB 3HE7B 5KYWA 2JKXA 3NOIA 4ZTEA 3X3FL 2FEJA 4M1DL 4N2KA 5F9OL 4CNIB 3UX9B 5D2LA 5E4IA 2PLTA 4CDGC 3N85H 3N40F 3VRJA 1G6RA 2XWRA 1CGWA 4PS3A 5D5MB 5ECJE 2CE6A 3MCYA 4WWKD 2P5WB 4LNRB 3IMRA 4APXA 1D6VH 2DYSB 4FTVE 1INQA 4ZMTA 4N8VG 3SDXA 5JW4Q 1JI1A 1JFQH 2CALA 2NTFB 2NY6B 2R69H 3QRGL 3OPZL 4QMEA 2Y3AA 1NMCB 4X99A 4LPCA 5CP3A 7FABH 2Y2YA 5L2JB 2VLRE 3TA3B 4ZKPA 2Z31A 3VCLB 4O4YH 1J8SA 2AEJA 4IOIB 4FZ8H 1KPVB 1H3UA 4K07A 3D4ZA 2UV3A 3HB3D 1A3LL 4IRSB 1CYWA 1FGVL 3ET9F 5EZJB 3VXPB 3WJMB 4NQEE 1KYOI 4GI8A 3ZMEA 4UOW1 3H2PA 2WM0A 5JO5B 1C5BH 1IT9L 1K5NB 4QPEA 5DJDB 1MHCA 1B0GA 4KKCD 1FF5A 4OKVB 2X2UA 1TCRA 2X12A 3MRDA 1T21A 3DXAE 4BE5A 1BV8A 3T04D 3UPRB 3HHMA 3FFCA 3VXMB 2XI9A 3N1FC 1S9YB 3NQKA 1PX4A 4NOBA 5DS1A 4KK9C 5IMKA 1OGAB 1HCZA 4I89A 1ACYH 4PP1D 5GJTL 3K1KC 3VXOB 5LXGH 1EERB 1JG9A 1EO5A 1N6QH 2X4OA 3H42H 3LKNA 2QELA 3VG0L 4F92B 4CA4A 1NOAA 2WSCJ 1C5DB 1IC4L 3DIFA 1Q72H 2H32H 1FZJA 1EHLL 1HHHA 4PJAF 5DD0H 1PLGL 2QIWA 1ITCA 3MBWA 2Z31D 2CLVA 5LVEA 4XNYL 1OE1A 4WHTA 3M91A 1B6DA 2ZXEB 4PJ6A 3GI9H 1QUPA 4JFXA 1HINL 1NL0L 2PABA 1KFAL 3PLYA 4X4ME 5F88A 4U3FG 4H0IA 5J9PB 4FXTA 2YKKA 3NSCA 3IKCA 3G7TA 3OZ9H 1GC1L 4N3UA 4R26L 3BCCG 1ZLSH 5D7KD 2J8OA 4TQIA 5FA3B 3RNKB 3CC5B 2B0SH 4JO3H 3UYPB 3IAGC 3IAQA 4PBXA 4KUZL 3FO1B 4BD4A 1U8QB 1AVAA 2E7LA 2I07A 1F00I 2HT3D 3G4SP 4G6JH 4ZYKA 4X6EA 1BWWA 3RY6C 1A3QA 1E50A 2Z9TA 5IW1B 3FFCD 4GO8A 2IQAB 4PGJA 3WFCH 1OGTA 4M1CC 4N5UA 1IFPA 1UIXA 1BEXA 5DQDH 3V6FB 1OARH 4YAQA 1J5CA 4PTTB 2YMKA 4HC1H 1I8MA 3RG1C 2VAJA 3WO4B 4P57A 3MLSL 5KUMA 1YJDC 1DQMH 3D48R 1A2YB 3D09A 3GRBA 2AXHA 3BW9B 3PABA 2FJSA 4ZW3A 1MFZA 4ASVA 1NFAA 2PWGA 4ANWA 3CPUA 7TAAA 5IQMA 4GRLA 4S1RH 1KG0B 5F6HJ 1Q0XL 4KI5D 4JY5H 2PFXA 1QLEL 2WSCH 3DX7A 3FOLA 3O11A 4KK9D 4GOEA 4PB0H 4F7TA 5IVNA 2DBLL 4XZ4A 1TIUA 3VXUB 4KY2A 1B2WH 1DVFB 2ZF8A 5E9DE 1RUKL 4XMKH 5EUKA 2XN9B 1KJ2H 4KVCH 2V7NB 3EJJX 5J13C 3BSZA 3G6JE 1XL6A 2ARJA 5IROC 4LLQA 1QBLH 4PTUB 1S5IL 5A2FA 2OCFD 3WV0A 1QQDB 4P9ML 5D7IA 1Q9WB 3LS5L 5HHOE 2WGXA 5ALBL 4NQCE 1KJ3L 3RU8H 1W72H 1JZ3A 5C2BH 5D1QB 2YAHA 2Y4SA 3C09C 3IU3B 5FYLL 1ZOYC 1Y18B 2O5YH 4FL4B 2E9JA 3HI6L 3ULUL 2H6PA 4KHXH 3ULUE 5ESAA 3LSOB 4AXWB 3P32A 1FJ1A 2KNCA 4YXDC 4ZUVA 3DYMA 4K3DH 4Z7UF 5D8JH 4OGQC 3WMM0 5TE6H 3MV7A 3JZ7A 4P5MB 4YDJB 2FT7A 1CW5A 4GRLD 1IJDB 1S3RA 5I1CL 1RF0A 4JPIB 4OCNC 1UCBH 4G8EB 1A0QL 1U30A 4G8AC 4M93B 4PCKA 1LO3H 1QHQA 3HAEG 4GAJL 4RFNB 5F7DB 3VFMA 1WO2A 3MRBA 4PCSA 2EIDA 1L0PA 1LO5A 4MNQA 3U59A 2GJ6E 4NO5B 2AEQH 4YNYB 5CFAA 3BPLC 4P2OC 3H1HJ 3M17B 4GKNA 5CLTA 1NLBH 3L4FA 1JHTB 2WXLA 5GS1C 4GP8B 4WEMB 1YNTF 5J89A 5GJSH 5D1ZA 3CVHB 2AQPA 4H8WL 3M9HA 3TOPA 4F24A 5F7BA 3FQUB 1Y1UA 4I7ZB 3QEQA 1OAKL 2A83B 4RAUB 5BQDA 4P2OA 2VN3A 5BXFA 2IWEA 1PIFA 3P2DA 4CBPA 4C4UA 3ESOA 4MQXC 3EGXA 1S7QA 4UIMB 2OYKA 4TNVK 2IGTA 4HGWA 4UV4H 5DO8A 2OK0L 2P5PA 1JZ2A 4JKMA 1EEQA 4FULA 1CGTA 4WUUB 3T0EB 3MV7D 1FIGL 5GGVH 1LQSR 3WU2E 3VWJC 3WFEL 2NZ9D 3LZNA 4IEFB 5KSBA 3AT0A 2QVFB 3BP6B 4KKAC 3IMSA 4H8HA 3VYIA 1YYCA 1CLYH 4NZ8A 1YHPA 3WTWA 3QAQA 4EIZC 3VI4B 1XGTA 3GHEH 4GODA 4XC3L 4B7IA 5EU6E 4MNQD 2CNYA 2DW5A 1OKEA 2R0WH 3CWBD 3F7LA 2XYCA 5E1HB 3GSUB 2ZD0A 1CT8A 2IAMA 4IBSA 4YDVB 2BCCJ 1U3HC 5FO7B 3TCLB 4DKFL 2LXBA 3WDJA 1NUNB 1LWRA 3WS3B 4U6VH 3C6LA 1NFIA 5FGCE 3JCUE 1H5BB 5D1ZD 4YXLL 4NO3A 1FVDA 2YXVA 3APCA 3PRZA 3WSQH 3QEQD 4N6RA 3NT0A 4H1LB 1Y8AA 4JFPA 2PO6C 2C0WA 2RN0A 2ZT9C 3M0DA 2OTJP 4P2OD 4PI2A 1KILA 5EFWB 4YHNB 1IM9B 4BK8A 1F4AA 1IAMA 1JZFA 4N0CC 1H9DA 3FCGA 2GJJA 2DQGH 4JFFE 4B97A 2V5MA 1KTCA 2SODB 2A4ZA 4XX1E 3H4HA 1NTKK 4JFQB 5B4MC 2XA8H 4JF7A 5FIEA 2WITA 4HIJB 4IKJA 3CZNA 2PPFA 2WUBH 4NS0A 4DZ8B 4Y4KA 1MJJA 4UIKH 1ZHKA 2OMZA 2PO6A 1BSIA 4DK6A 25C8L 1KB5H 1UXSA 2OZNA 2AVFA 3P0YH 3VMXA 4JQXC 4XPFL 3CWGA 4JG9A 2UZPA 4M6OH 3HLAB 2H2SD 2P49B 3ARRA 3SE3C 3SO3B 1SQQJ 4TN9A 1OAYL 1ZLEA 3B5HA 4KQ3L 3FRPA 1ZLVH 1RIVH 5F3HB 3ZHKA 4XFJA 5FCUH 2IAMD 3AXLA 3GGWA 4OI8A 3AAZA 4WLCA 4U31A 2OX5A 4WBAA 3HZMA 2DIEA 3C6LD 4RFOL 3AREB 4WWPA 3D3VB 2HN7B 5E1IA 4QRAA 1URQA 1GA2A 5F6IB 3ETSA 1WWCA 4ZMDA 2J4WL 3LW5J 2VERN 1VA9A 1KILD 1OALA 1T1ZA 4J12A 4Y8DC 3ARDB 1G9NC 1WCBA 1R5WA 4MJ2A 3H6JA 3P0VL 5LHDA 4H8PA 3UADA 4QCIA 1XGYH 3DX8A 3KPPB 4RDQF 2D31B 1NANI 4PRBA 3CC2P 4N8VB 3CDGB 3ZE1E 3MV9A 4Y4KD 4Q2ZA 1VKXA 1UZGA 4JZNA 2PO6D 1ES0A 3T3ME 4XVJH 4LLMB 3MV8A 2HFFB 1HL5A 4XXWA 1M1JC 3MRQB 3A67H 3O9WC 4TQEH 3VSUA 3WUWB 3LD8C 1X9LA 2VZSA 1BE3E 1EZVG 2K70A 3BMWA 3L95B 4L3CA 4F57L 2WP3T 3MCLL 1OVUA 2FGWL 1SY6A 2AQ2A 2Y36H 4X0KB 1ZK9A 4CVZA 4UT9A 1A8ZA 2EE3A 2IFNA 5DJZB 2VW4A 5HHME 2M5AB 2YGNA 5JPMC 2NY4D 2NT1A 1SVCP 3FXDA 2B3RA 1Y07A 4W4OC 5T1KB 4D6TJ 1I3UA 1URQD 3EZ8A 2WOYA 2GK2A 3FQXA 3V9EA 2BOBB 4XBGB 3VFOA 4N24A 3MA9L 3NBNA 3B6SA 5AOJA 1E9OB 1NJ9B 2VO5A 3LW5H 5DD5H 2IYPA 1GS8A 1XX9C 4H4NA 4E9RA 3AE2C 1WA2X 3V4PL 3MV9D 5L88H 3HI5H 4J3SA 1GGBL 4UWQB 1NU1D 3EYFA 1EZUA 1AZUA 1NUFA 3EGDB 4NC0B 4PJXF 3MV8D 1E90A 1KIRB 3KH4A 2Y07H 1ZIBA 4JN1H 1N18A 3BI9X 1JHLL 4O00A 4UB0L 4G6FB 4X42A 3JBG7 2JQZA 4DKTA 4ZG1A 4KNTA 5BRZE 4P46A 5GHWL 4WCYH 5HHXL 1KWGA 5GGSB 3RL0C 2Y5EA 3L7FB 3WKYA 4TUOB 3L72J 3M0AA 2HKHH 1G9HA 1JY2P 2W9LA 2ZUVA 3LH2H 1JY2O 2PXYB 4J28A 3AQYA 2X41A 2IGLA 2ZUUA 3HR5A 3WAJA 2DQHH 5T3ZD 4RO0A 1KGXA 1PPJD 4J1UA 1NKRA 2IH9A 2XSKA 4LGDE 2R29A 1IFIA 1XF1A 1EAPB 3SQBA 4YE0A 3WN5C 2A74B 1UD6A 3MLRH 3RX7A 4HQQH 3CSTA 2W65A 5CZVH 3B2UC 4JE4B 2JI2A 3K81A 2YPKA 3PGDA 3P73A 1X5IA 4YSTA 5C0JB 1XTMA 1TTGA 4PJEA 1PG7X 1LNQA 4AYGA 3CMGA 4YSDA 4OUOA 4R90H 4AENA 5IBTL 3IDXH 4HEME 2WBJB 2P58A 5I30L 4TULH 5IB5B 4KVPA 3QJXA 3L4VA 4GG6A 4P46D 3Q8BA 4YBQD 2K6ZA 5LQBH 4J39A 5IJKC 1KLFB 5E2TL 4IBLT 4WK2B 4OCSH 1KB9K 2C4FU 2TSBA 2FUTA 3KCPA 4L8BA 2IZ0A 4LARH 3QQ9C 5DEGA 3TIEB 2J55A 1G1YA 3SIKA 2HUHA 4X5RA 5IJVB 4ZNEE 4IRJB 3VXRB 3WIHA 2DWEA 1PL3A 2FH6A 2NY1B 2G2NA 3GSRB 3JXAA 4PV9A 5IBUG 3VGDA 1P5VB 1NAMB 1IEAA 1NCGA 2JK5A 4Y4FC 3H4FA 2I9TB 1YJ9P 1EVUA 3IWUA 2ITDA 1PP9G 3KLQA 3OG6B 2YEQA 4HX1A 2P2UA 1HFUA 1ACCA 1IVLA 1OT1A 5LNEA 3S3JA 1R17A 4AG4L 5DD3H 5FUCC 2YPVA 5HDBB 3TC9A 2GJZA 1MVUA 3MLZH 5IVZA 4PJGE 2ATPA 1ZT4A 4WHCA 1PZ3A 3GXMA 2CO7B 1BPVA 3MGNA 1X9UA 5C09A 1OTSC 3ZTJH 2A0LC 1TQSA 1ODAA 1KLUA 2R0KH 4GXVH 2XJLA 3B4SA 5L8JB 2GEQA 4QAMB 1QO3A 4JZJC 1DJHA 1VFAA 1AGCB 3C9NB 5KVDE 4TS6A 3VTMA 1P5UA 3T2NL 4DN3H 3NIDB 2V3DA 4NC2B 1PX3A 3CXHK 3RL0g 5E8PB 3GS4A 1QKZH 3NIFF 1CR9L 3H9SB 3VFVA 3SYCA 1U2HA 3N55A 3X12A 4DGYH 1H89A 2ESVE 1SQXG 3DDFA 3KDMB 1H3PH 4H0LB 4JL2A 5IQ9B 2V5YA 4UNTA 2PTTA 5T3XE 2GHWB 4OZHA 4FQJL 1SLWA 3O3EB 3TT1H 2NW3B 4F7MA 1ZGLP 1JCCA 3NGBC 1QLRB 5DUPL 1FDOA 3QQ9D 3BZFA 1A9BA 4HIQA 2Y6SD 4LPUA 3ETTA 2LW3A 3GLAA 4IIZA 4DKAA 1JVLA 5EN3A 2VM9A 4WK4B 4ZPTA 2GFBA 2CMRH 3UG5A 3L13A 5C09D 1IBZA 4E9SA 2R2HB 3ULAB 1LE9B 1KXHA 5F6HI 2A6JA 3OMNB 3VGHA 4DPRA 3FQNB 1JY2N 3K2MC 4FQHA 2G9HB 3L3HA 2EE6A 3UC0L 5DYFA 4FEIA 4XBMA 3V5HA 2F54E 1MAMH 5FM4A 2O4EA 3ATDA 4A6YH 4ENEC 2E6PA 3QJFB 2DYPA 2A0LD 3O3AB 2Q7YA 1G6RL 1JOCA 3H1LJ 3BDYH 2HTKD 2FXPA 1OM3L 3II1A 2WWNA 4EOWH 1BZ7B 4EVNA 4S0TD 2QZQA 1GTWA 2IQ9H 2D3JA 4C47A 3VE0A 4YHOH 1NHLA 2A6KB 2Z1KA 4RNRA 3NCYS 4OJAA 1GW0A 1TU2B 3X3GH 4LVHB 3NPSC 4JQIH 2X6VA 2K0RA 4NZFA 4Q14A 1JY3O 1ZV8A 3BVNA 5EIIB 4LVEA 3WMSA 4AIEA 5K5GB 5D7LB 4FX5A 2GQHA 1KOAA 2K4WA 2BX5A 4U49A 4XODA 5LGJB 2ZPKH 3KXFB 1J0IA 2K9UA 4N0UB 2KLSA 4GBXA 5C6TH 4A2HA 5KVFH 3LKPB 3GHPA 2GUSA 4OZIF 1K2DA 3IKKA 4QOKB 1SQVD 4FQIL 2D0HA 2A45H 2NZ2A 3M9QA 1BAWA 5GTHH 3ELAT 4NJAL 1ID5I 3UTOA 4BFEA 4HUMB 4Y1AB 4LCWA 3BKYH 3FZUD 4LO9A 4NWUL 2YD4A 3HRZB 5K39A 1WE5A 3DO7A 1AJYA 4LT7A 2NY2D 5AVYB 3VFSB 1DBAH 1QFPA 4A7GA 5IB2B 1CTMA 1TR7A 2XXFA 4CW1B 3POHA 4ALAC 4MD0B 1R3JA 2DYPD 4L2LA 4OLXL 3SDAC 3W39A 1FHGA 1BCCE 2JO1A 2WINA 2YSSB 3QUMB 1H3GA 1N73C 1J8HA 3L48A 3VFUB 2JJUA 2RA1A 2YKOA 1WJ3A 2DQFB 5ID1B 4LGRB 1MIML 1VQMP 1Q9KB 2VZTA 3MOQA 4A04A 1L9QA 4GSXA 1DP0A 1A1NB 2VXSH 3FT2B 4HXBL 3UBXB 3B2PA 1GJWA 2G3ZA 4PIBA 2YOAA 1V5JA 2Y7NA 1INEH 4XMWA 5FYJE 2GYSA 2BNUB 2FL5B 4Y16A 1M71B 4DUXA 5IM7A 4GBXD 5DF0A 1XSIA 4IOFC 1K73Q 3PJNA 2YBRB 1A6ZB 5JDSA 4AV4A 5HGDB 2BVEA 1UD4A 2WYIA 1CFSA 1CFNB 4NRZA 4LCWD 1M3IA 2ZF9A 4WY4A 4AL8L 2ZUWA 4TMPA 1SUJA 1GY1A 1CDCA 1E7VA 2JTYA 4FFZA 4HIXL 3L4TA 4M7KH 2IDQA 2GTWA 1HQ4A 2HFTA 4BA0A 3BUPA 2KYVA 1J8HD 2VXTL 4HJ0D 4GFXA 3QJHA 3QORD 4KROB 1X0TA 3HPLA 3O4OC 3CU7A 4U6YA 3EYUL 4AUUA 5HJ3A 1FUNA 5TDNB 4F3FB 1N70A 3HNTL 2JKVA 1IX2A 3MACL 5C3TA 3F05A 1SJHB 4PJBF 1N2DC 4C56E 1RKRA 4L8SB 2H26B 1I8IA 2QSVA 2X6MA 3OQRA 2EJ1A 1X9QA 4Y16D 1ZMEC 3CLFH 4QTIL 1FLRL 1K85A 2HLFD 4P99A 5C0EB 3JWDH 4LEOB 3FUNA 2NR6A 4GIPD 5AZ2L 1L0NE 3BSZL 1HHKA 2GIMA 1QBBA 2YUVA 3VFTB 4PEEA 3E6HA 5KBDA 3FW6A 4ODSH 3N5AA 4P9HC 1RPUA 3VGFA 4WY4D 4D9RD 2H4EA 1Q4NX 5D6CA 1AS7A 1MCRA 1IGYA 3EYVA 4PJ7A 1BVKB 4RA3A 3WTYA 3TNUA 2WO4A 1FG9C 1KDIA 4QRRB 1W80A 2UY6A 1JY3N 4GT7A 3ESUF 3T97A 3AS2A 4DQOH 1P4LB 5GS0H 1XCQB 3L37A 1LP1B 4WU7A 1OB1B 2YMXL 2KKQA 1NCJA 4MMZC 3MTRA 2W88A 2VDNB 2W5PA 1CMOA 2WZPA 1VJSA 1KGYE 4XXCC 4AQEB 2VSCA 4RZCA 3EJZC 1TNMA 5DRZA 3C6SB 2OMTB 2R4RH 3TBSB 2YD2A 1WUNT 2YFOA 2DB8A 2Z91B 3CFIC 1SJVA 2WAQA 3WNJA 2WLHA 3OKKB 3PDDA 5FA4A 3I2CH 4MMZA 2NR6D 2RFXA 1TQUA 1WZKA 3MR9B 4X98A 1RIUH 3RWCB 2OM5A 3CZFA 3VYNA 3PGFH 5EC1B 3C8VA 2Z4EA 4KV5E 3L5IA 4DKEH 1NFDB 3RE0A 3GDBA 2CO1A 3WFBL 3QQ4A 1KTRL 1I1AA 4NZJA 1L9RA 2D7PA 5GS2H 4U1HA 1ILUA 3IJSA 3WKNA 5BZWA 4CMHB 1BQKA 2X4QA 5IREA 1KBWA 2FLMA 4N0YL 4XRCB 2WWKO 4S0HA 3ARPA 2RCSH 4MAYA 2VCOA 1OFCX 2O6PA 4BUGA 1A02F 4IU3B 3QJTB 1ZLWK 1EZVX 1HE7A 4PJDF 5CEXB 3I5CA 4UB6E 5EDXA 5CILH 1JZDC 1KELH 3ZXAC 2WLIA 4I1NB 3MLXL 4RISL 2WZPD 1T2QH 1PG7W 5FM5M 1H0TA 1VZIA 2ZIDA 3B9DA 2VDLB 4O51A 3CVDA 4HKZB 3KLLA 2DI9A 4P4KB 1Z0MA 3FFDB 3PWUA 4U1SB 2Y6TE 4FNPA 3ZKMD 4RESB 3CI9A 1EXJA 1MI5A 4BH8A 2NXZC 1HGZA 4IFFA 1PZ5B 3LH8A 4GDOA 2G75A 3FH5A 3VVWA 1Y6MR 4PMFA 4NNXB 2VMDA 3HZVB 1SOXA 2GAZA 2NZ1A 43C9B 2NNCA 1I1AD 1GHFH 3ML9A 3TPUB 1RMFL 5DHYB 5K9QI 3L70D 3BKML 1QSFE 4K2UH 5AZUA 4D0DB 3LHAA 3U0WL 5DZ9A 3TEXA 4MAYD 2W6AA 5KLVG 3GLMA 1T22A 2VQ4A 1AQDA 2OQJB 4DUVA 2DQIL 3IU4L 4IBYA 1YC8A 1NGQL 2XWXA 4S2SB 4FTDA 3GSVA 4FXGC 4XZUA 4BFOA 1T5KA 5GZOC 1ZIAA 1RZKL 1U33A 4XCFL 2VISA 1OK0A 4FP8L 3DJTA 3TJEL 4AYFB 3CLEL 1RCYA 3TNMA 2YKPA 2OTKE 1QRNE 3BGMB 4MJJA 4MQSB 3AG3B 5ES4B 1BBDH 2L5GB 1N7SB 1MI5D 1IKFL 4YGVA 5DRXA 1BQHG 3OJDB 4ODUA 3Q8AA 3WEMA 2L7QA 2BOCB 4AUJA 5AOLA 1BQ5A 1E3XA 3ZW3A 5ITBH 2VDRL 2FVNA 4OD1H 4Y89A 4ZS6D 3VQ1C 2D7NA 3D9AH 3GZKA 3FT0A 3D0LB 4PJIA 4BZ2H 2OZ4L 4CSSA 1BM7A 1MLCB 15C8L 1WP6A 3PUCA 1TQCC 2BS8A 2NXZD 1V7NH 5BW7C 3BO8A 1JNJA 4FJZA 3ROOA 3CPLA 1QTYT 3T6WA 4E68A 3T2OA 4UDTA 1UZ6F 3GW6A 4QRBA 2VN6A 3GO1L 3KGSA 1R5VB 3N9GH 5CBAA 3TLRA 4UF7C 4L8CB 5APSA 3H85A 1OGAE 2D73A 4ZDHA 1FORH 1RUAL 5E8OB 1QSVA 1UWEH 3EHBC 3GYRA 2DEWX 2Z8WC 1NBYA 4G1EB 2FHCA 5KAFH 2N1TB 3N3EA 3NIGB 2NPSB 1A4BA 3KJ6L 4MX7A 2NMSA 4DCQB 2E3VA 4PS8A 1DUYA 1R3IL 4LRNH 1DBBH 5C1MB 4XPBH 4EEEA 4M8QA 4GYBA 1B0RB 1CGVA 3I6KA 3T65A 1DQJA 5TK2A 4LLUA 3FN0H 2HLAA 1JNHA 2XZQL 3B9KC 1KN2L 2P5EE 5HYJA 1NKGA 3EOTH 4I13B 4K3HA 4UT9L 1WF5A 4NXSA 3N7NA 2OYIC 1EBAA 1ZA3A 4OT1L 35C8H 1L0LG 5T3ZL 2XWBB 5EUOE 4Z6AT 2I26N 1Q1JH 1X5MA 3H1JJ 4XVUC 3ZLQC 1FO0B 3C5JA 5F0LB 1T6AA 3DO3A 5JXAL 3LHPL 5B3JF 1SDAB 4ZO9A 3VH8A 3SFDC 2DEXX 4U3SA 4GMSH 5ALCL 3EH1A 1UVQB 4Q9RL 3PP3K 3QRLA 4JFTA 3BKCL 1RUQH 2HJKA 2Y1YA 1BSNA 4X4KA 4Y88A 4LSUH 4IDLA 2GPZA 4LCYA 5GRUH 1SBBA 1KPRB 2DAVA 2BSEA 3OX8B 1LP9E 1FE8H 5FCSH 5CZRA 4JRXB 2AJUH 4A37A 4P2QE 5K1NA 4EIBA 1U95B 2XFGB 5I1KH 3D4YA 2MPAH 3SKOA 2FATH 3VXUE 3J8F7 5CCHE 5HYJD 3PJSA 1J9SA 1MG3C 1S5HB 2WUCL 4XPGH 1SQPD 2A9ML 3JTTB 3D25B 1QHOA 3O6FC 4GUCA 3J7HA 5D7JB 4LSVH 3GRWA 4JO2H 3DUSA 3VD4A 3OLDA 1G84A 4U7SA 3PLNA 3GI8L 1MQKL 2PPCA 1QX1A 2GJPA 3NRQA 2R29L 1B9ZA 5IKCB 1IFHL 3MHZA 1NKZB 5BV7B 1JOIA 4PGCA 4RFEB 3EYOB 1SFCC 5D1QE 1FYHB 5I8EB 3BPOC 3DV4A 3JYBA 3HUSC 1GGUA 4YHPA 4MXVF 4ODWA 3OXSA 1JNNH 4WUKL 1NMBH 1RHHA 5H94A 3TJHC 1YEDA 2BSED 3RYMA 4M43H 3BRFA 2FYVA 2BHYA 5JW4R 2ZG2A 3Q9QA 2OMYA 2J20A 2QLVB 5EBLB 1MHHA 3ARFA 2FYUJ 3PXLA 2Q7CA 1J9CT 1YECL 3OTTA 4CN1A 3LRSA 2MSPA 4EI5B 2FECL 4RGMC 3KZ8A 1VQ4P 2DMKA 3WY2A 3F64A 4JREC 3BPNB 2H3NB 4G7SB 4GMTL 5BOZG 5AVSB 5GRWA 3B43A 3WIHL 3L73J 5FAAA 5A2CA 1K6QL 3MOBL 2E74C 1HBWA 1D5BA 2AXFA 4RAVA 1HDMA 2WXFA 1JIBA 1S72P 1FZCB 4BQCA 2I32A 4OTXL 3FWNA 3X11A 4K7PY 2WXGA 4ZS7L 5E0FA 3GMMB 1DLHA 1ZWIA 5I1EH 1U4FA 1MFTA 4UT6H 3KYNB 3B3IA 2R59A 4P59L 4TL5A 5DVMA 2BIQA 4WWKB 1HI6B 3TF7C 2X4UA 2FJGA 2ID5A 1LD9A 4WUUE 3TBCA 2Y7LA 3T0EE 3BH4A 2LFEA 2XZZA 4QAWA 2VLKE 1K4CA 1H8LA 4KK6D 4BFFA 5I0YA 1J1EB 2ODHA 5M7QA 2Q8BL 4FCAA 3ESPA 4PSRA 3ARFD 3B2VL 3TFKC 1JGIA 2W6BA 4YS4A 4FQ2H 4R96B 3HB3B 3DJZA 5DZPA 3VI4E 1IGFL 3QEUB 5TQ2H 1IKOP 3O8XB 3QFJA 3CXDH 3UJTH 1GPOH 4EI6A 2PWDA 1BVNP 4Q56A 1YYML 5KYWB 5LBSA 1SNRA 3JWOH 4DERA 1P2CA 3VTTA 4HUNB 2P4AB 4TOYH 2EXWC 4HZLA 3MMEA 3M8OL 1WT5C 5D2LB 3ASWA 2YO3A 2DQDH 1E28A 2ADFH 4FMFA 4PD4H 2OP4H 2FZ3B 2YA2A 3FO9A 3VRJB 2QJKC 1S9XA 3RDJA 2OR9H 4J8RA 2CA3A 4ZNCA 3B37A 4APXB 2YD0A 5LXVA 1SHMA 1Z3GH 1FGNH 3WXWL 3EUUA 3BIKA 4ZUUB 4LE8A 1BAGA 1AIFA 3RK3E 1NBZB 1UADC 2Z7ZA 3GZOA 4RMWA 2Z31B 3ATAA 5IQ7L 4NO0A 3EDEA 4AC2A 5KJ7E 3GFUA 4QXWA 2K9YA 3MBEC 3WTSA 2BVQB 4OLWL 4LQFL 3QFJD 3LIZL 4GXUM 3PWJA 5EG6C 5C07A 4HD9A 4XXDB 3KLHD 1Q9LA 1TVHA 1KGCD 4ZO8A 1WBYA 4IDJH 2AJXL 3FJTA 4KTDH 3SJVA 5APYA 4BRJA 1B0GB 1MFMA 3D3VE 4Q4IA 4X5XB 1TCRB 1YEGL 3FMGL 4MD5A 5F9AC 4URKA 2J71A 3L3IA 3MRDB 2WXOA 5L8RJ 4X6FA 3RUGF 3FFCB 1E4HA 2NSQA 2ORBH 1AOZA 3BVUA 4QHNA 5IMKB 1WCQA 2VW6A 3X17A 5DHVH 4UINH 3VSVA 2O5ZH 2P8PA 3L74G 3FUJA 4ZNCD 1UURA 2X4OB 3EBGA 3WN6A 3B9AA 3LKNB 4JG1H 3V0IA 4I3RL 4WWOA 1JP5A 1U3YA 3E38A 1MN4A 1HHHB 2WXJA 4XP1L 3OWEA 1KCKA 4KBPA 3MBWB 2CLVB 2EVGA 2VLJE 3LKRA 2DWXA 2D7QA 5KBPA 4WHTB 4NO0D 4X6CE 2DWYA 2YO2A 1KQFB 3QE5A 1BQHB 5DWUH 4MJ5A 2IAAC 4JFXB 5F88B 1TZHA 1KIPA 3MXWL 4U3CA 4G8IA 4I0CC 4YFDB 5H37H 3WTUA 1TETH 5CJOL 4L1SA 2XX1A 5C07D 5INCB 2F53E 5FHAL 4U1LA 3IKCB 4G6KL 3GM0A 3U4AA 4DH2A 1HILA 4S1QH 1KBKA 1E42A 3SJVD 2VAAA 5KYNA 3FO0H 2ZUYA 4LSSH 4N1EA 4WY7L 3VP8A 3S97C 4AW4A 5AW7B 4BWUA 4HBCL 4WJ5A 2I07B 3THML 3IJEA 1KXVC 4X6EB 5TE7L 2ZXAA 4YPCA 1ET8A 1TU3F 2V8LA 1YEEL 4FXKC 5I1GL 5FYKD 4ATWA 1OGTB 4RDQG 3KPSA 2NX5A 1NTMD 4YAQB 2AEMA 3A6OA 2CKBH 3FYEB 4I87A 3IE4A 5C3IA 4JN2A 4P57B 4CILA 4MCZB 4OZFH 4GW5A 5F1SA 4F9LC 3RAJH 5EORL 5IOKA 3VM5A 3BZDA 4HJEA 4ERSH 2AJYH 4WF7A 4GRLB 5E2UH 2OMUB 4QF1B 3RWIA 5ABZA 3AGVA 3FOLB 1Q38A 5TISH 3O11B 4F7TB 5CD3A 4FFZL 2NY0D 2DWSA 1F0LA 9PCYA 2QHRL 3S9OA 1A1OA 2BVUA 1SFDA 2GITA 2WN2A 3DJSA 3JV5A 5EUKB 4DEWA 2R4SL 1WA0X 2VDKH 3IDYC 4U3FE 4LAJH 4CJ0A 2YA1A 4LLQB 4ONGH 1FOSE 1VACA 4ESKA 5CCGC 4MJIA 3AE1C 1FNGA 5FFGA 5DR5L 1IBFA 2YAOA 1GZPB 3IEAA 5J4MA 2APSA 3BGFB 4PPTA 4I4WB 1OSZA 4TNGA 3C08L 3LXCA 4Z7WF 5HPMA 2QVAA 1U93A 2AF2A 1NZRA 2ED7A 2HKFH 2FWOA 2WXQA 1G7PA 1ET5A 1F13A 2NX5D 3KPSD 3MRNB 4MNGA 4PHXA 3V0WL 3LJ3A 5EZLA 1KXQE 3AY2A 5ESAB 1EAQA 1AH1A 3PPEA 3DUUB 1FJ1B 2KNCB 4ZUVB 1SLQA 3MV7B 5ISZE 1L0NK 2H6UA 4BA8A 5JIMA 1D7CA 2C7FA 2N7SA 5HDLA 3SYAA 2NY7L 1XMWA 3LYRA 3KYKH 1CU4L 2OULB 3PP4H 4HWBA 1G1IA 4Y5XC 4H44C 1CE6A 3VFMB 2XWJA 2N59A 3T4YB 5AW4B 3MRBB 4Y2DC 4FHBD 4WTZA 1LO5B 4MNQB 1QTSA 3VVVA 2DWDA 1MEXL 3MOAL 5CBEA 4GKNB 4HT1H 3D0AA 1X5ZA 5JW4N 4NN5C 1E5AA 3ZKXB 3Q01A 5E56A 1MREL 4MJID 3SY6A 4Y5XA 1J5HA 4IJ3B 3VXRE 4R8WL 3T6ZA 5AYTA 5D1ZB 3SCMC 2C9UA 4RMUA 1GCYA 3LRKA 3QEQB 1EHKB 4FG6C 3AADB 4TYUA 3MRJA 3BPLB 4P2OB 4OFYA 3OLGA 4IRZL 1S1CX 4J3WA 4N0RA 4YHIB 2DH3A 1I9JL 2QGDA 2UUDH 1CD8A 3CFEA 4OBRA 3TWCH 3EGXB 3TL5A 3NRPA 1RPQA 1TZGL 5BZXA 4HGWB 5HDBE 32C2A 3DTXA 5GGTA 3ZL4H 2EIJB 5JIKA 3D4GA 3U0PA 4QXUL 1OVVA 5MERB 4M7LH 2FY8A 3FULA 4NQDB 3AQDA 3ULVH 2IG2H 1S6NA 4HJUA 4JFSA 1K3IA 4R4FH 3MNMA 4TNWK 3ISRA 3BFWA 2VN7A 4TVSa 2CUMA 1PAMA 1XGTB 3VMAA 4JANA 2WZ7A 3MJ7A 4MDJA 1LYQA 5D2NC 2CJUH 2UWJE 4IOIH 5F1NA 1I7RA 1DEEG 2PETA 3HC0A 4P05A 4OUUA 3VWJB 4L3AA 4YO0A 4B95C 1DJWA 1YEFL 3P3RA 5DJ2A 3WIFA 1J88A 4DCKA 5F0PB 4TVPL 4LRIA 4M6NL 2CLZA 4NO3B 5LBVA 1QVFO 3TO2A 1CD9B 3IR9A 5KTEL 2NQ3A 4UQCA 2OL3A 3QYCA 4XAWH 3MC0A 1LWHA 4XN9A 1KILB 3CCQP 2A73A 4OFYD 1ZOXA 3V6ZB 4A1RA 4MKMA 4AI7A 4JEGB 6PCYA 2EH7L 5CGTA 2WCSA 2YRBA 4AYEC 3VFNB 2LHAA 2ZXBA 3QUZA 2LV4A 4LVNC 4XO9A 3BESR 2H1XA 3NPZB 1CDJA 4PRIB 3QXAA 3HNVH 4Y4KB 1MJJB 3L5XL 1LVEA 1EWHA 1ZHKB 2OMZB 2PO6B 2X44D 1NCDH 3C75A 4BH7A 4FQXC 1MFCH 1JVOA 1LT9C 3GS0A 3UBHA 1QBAA 5MP6H 3FRPB 2R23A 3ZYJA 1WV7T 1DE4A 3AXLB 3GGWB 3QWOC 3AAZB 1NJIQ 2GM4A 1MIEL 5FDYA 4D9LH 4OFKA 2OX5B 3P4OB 3EF7A 3HZMB 2NY4B 4Q52A 5E1QA 1XXDC 1TMQA 2FO1A 4I18C 5JW3H 1ZHBA 1URQB 5E2VH 1QBMH 4PY7B 4MZ3A 4NEHB 1LT9A 3BT2H 4AM0B 4J6RH 1TNNA 3G5ZA 1MCWW 4GY4A 3S34H 3T8VA 3TVMA 4K3GA 1T1ZB 1ZEAL 1YSOA 4YEEA 2FYNB 1NCUA 5I6XC 3T0WA 5EF2A 4HS8L 1COBA 2HAZA 1WCBB 1R5WB 5D7LE 1T2KD 2DBJA 3DMMC 3F8UB 3CN2A 1Y0LA 3DX8B 1A7BA 3KXFE 3ASOB 3T0BA 2UYLB 2YUZA 3QUZD 4K7PL 3TT3L 2O1AA 2CK3H 1C1EL 4PRBB 3MV9B 2F8VA 2UWEF 4QOKE 5KANI 4Q2ZB 3IFNL 4JZNB 4EKJA 5C8JB 1VKXB 1ES0B 4F37K 2DM2A 4C4KT 3MV8B 4AV5A 5I71C 1I7ZA 4O9HH 4AYMC 2AQNA 4AKOA 1U8HB 2Q20A 3FSAA 4L74A 5AW1B 1OTUD 3N6YA 3OMAB 3QS3A 3Q5SA 1J0ZA 4HFWA 4MLSA 4BUQA 3MN8A 1QTPA 1HCYA 2Z7UA 5KOVC 4JFOA 4F9PC 1SYVB 3S3PA 1JN6B 4OCRH 4MRBA 3V6OA 4FNTA 4CVZB 1HZHL 3ITKA 1FAIL 2WIIB 1MNNA 2R56L 3K5BA 3S4SG 1BX2A 2C0XA 3O9WB 1FSKC 2JXMB 4OF3A 3QQ3A 1DSFL 5ILTL 5CLWA 1CLOL 5GGVY 2EXYD 2HRGA 2QM8A 3GC3A 2I9LA 2FQGA 3FQXB 3TVMD 1CXKA 3QQNA 3R4DA 2X38A 3FCBA 2PCFA 3TEYA 1A6VH 1UWFA 3C60A 2Y5QA 4HIEA 4LSQH 3B6SB 5F9DC 4ZTPL 3IFOA 1B4JL 5AB0A 3PAZA 3MJ9H 3FOMA 4JVPA 1L9SA 4MXWL 3WTVA 5CCJA 1RV6X 1S7XA 2NNAB 2OXGA 3EYFB 2YFNA 2PCYA 1U0QA 4M6MH 3M7FB 4B3EA 4MQTB 2ZX5A 4QRQB 3PL6A 3GIZL 4WI0A 3MP7B 1OF2A 1W6WA 5E95B 1NTKJ 3MU3A 2PYEA 4ES8A 4P46B 2MQGA 1ETB1 1EZVE 1A7OH 4GG8A 5J1AA 1P7QA 5HGAB 1MJUL 1VQLP 3IK2A 5GISH 2GBVA 1WAAE 5IQOA 4WVZA 4LIQE 4M6AA 2MJZA 2ZJSH 4FFYA 4JHUA 4BSJA 2EYSB 3QHZL 2ZG1A 2XIDA 2QQKH 3FHEA 3CHOA 3NCYP 4LAQH 4J1UB 4CSPA 3QT2A 4I0PC 4F2MA 5DJAA 3OW2O 1IRAY 2QV2A 1LO4L 3KEHA 1I9RH 1TJGL 2X9YA 2XQBH 4GB9A 3SQBB 4YFEA 4FLQA 3CVHH 1HEZB 3C60D 4G8GE 3GJFA 2W65B 4XX5A 2H7HA 2I60H 1OP4A 4D6TD 3CFCL 2HVBA 1RQ5A 1PKQA 1W0YT 3P73B 1VQ7P 3P4MA 5CZXC 4PJEB 3ULSA 2FYYB 2CHNA 2FX7H 4ZUWA 4AENB 5IEKB 3GRWL 1F4WL 1FZFA 2AI0L 3WN5B 2AJVH 3ZE0F 1YVLA 3PL6D 2B4CH 2YUXA 1N4XL 2ICEA 1XR9A 1OAXL 2ZG3A 3MRLA 4FFWC 4K3JL 4QI3A 2PYED 4GG6B 2FX8H 1OOAA 43CAB 1P7QD 2BNQE 3CFMA 3R8QA 3IAOA 2CPUA 3KCPB 4Q0XH 5DEGB 3S36H 1KCWA 3I3EA 2OPCA 5AW9B 2DWEB 1WFTA 4PV9B 1NEZG 3ABLB 3P8CD 1YY9C 3V2PA 4RWYH 1TJHH 3RNQA 1GH7A 2DQMA 3VI3F 2B20A 2V7HA 4WI6A 3Q1EA 4B3VA 3VW3H 5D7HA 4JG5A 5KVEH 4YUEH 4H1LH 3HC3L 4HJJH 5KVGE 2GJZB 3M06A 1RF1C 3QJVB 1MVUB 4NBYB 2YIHA 4PREA 5AUMA 5IVZB 3FU6A 1JTTA 1ZT4B 2ATPB 4I1RA 4EUPA 5JDJA 3MUY1 5C09B 3ISWA 1M90Q 2FB4L 5DI8A 4L1BA 2VRSA 3S37L 3H9HA 3A6BH 1QO3B 1NO4A 1VFAB 3ARZA 4YHKL 1F8TH 4YXKH 3SKMA 3SD5A 4IBTA 1X8YA 2RJMA 4N2LA 1D2OA 3BMVA 2D2OA 2CIIB 1F18A 2ZOOA 1WH0A 3VXNA 2VXVH 4Z0XA 1FL3A 3RKDD 2L3BA 2B59A 3I75A 1GW3A 4QNPF 4XPAH 4Y19E 3VFVB 2UXTA 4YK4C 3HMWL 2WQ8A 3RIFF 1U8JA 1E5UI 1W9XA 1V7MH 3X12B 1YMMA 4UNVA 3RWFA 2PPAA 3SPJA 1GCFA 4KK8D 2PTTB 2ICCA 3SGKC 3F83A 1FFPB 4OZHB 3RDTA 1AC0A 4M29A 1U8KA 2VM3A 3EJTA 1MFEH 4WDIA 4A38A 3BZFB 1Y6NR 5JR1L 1PP9E 1FNLA 2AEPL 4FI6A 3S35X 2CUAA 3MRFA 4W9FC 4ZPTB 2WQXA 3LKQA 5HTSA 4MWFA 5H2FH 5C0CA 2AC0A 1XSJA 5I8OH 3KZIE 4AQRD 1YY9D 2ZKXA 4Z7UA 3SGKA 5J11C 3KPMA 3VWKC 2GBTA 1XT5A 3QO1A 5CLYA 1X5KA 2A6JB 1KCSH 4L3EE 5BS0E 2HT4C 4FQHB 1DZ0A 1N10A 3LTVA 1EMTH 2V4LA 1QWHA 5AB1A 2NY2B 2F5BH 1DQIA 3ECBA 4RBPK 3PWNA 3V5HB 3O2DA 4DP9X 3BCFA 1OCOB 1U57A 4UQIM 3TCTA 3FFOA 3UCRA 3LQAH 1KCVH 3MRIA 2VXQL 4AUYA 1A4JA 3VD2A 2J1KA 1YNTA 4EVNB 3T3PB 1YMMD 4Q8BA 2Y1AA 3EDJA 4MLIA 1FJPA 1Z9SA 3VE0B 3FT1A 3N0PB 1SQXE 3RDTD 4Z3EA 4JZOA 3FT3B 3HBGA 3I85A 1SQVK 1UGKA 5AYQA 2EDBA 1LTGC 3BVNB 2Y0DA 2EACA 3D18A 5DK0A 3F89A 1BIIA 2YN5A 1MHPH 2X5PA 4GBXB 5C0CD 2NSMA 1W5CE 1K2DB 2OS7A 1AGFA 5F7NC 1R1CA 1SBSL 5EDSA 3CHQA 1OP9A 3NCJL 4GUQA 4BYHA 4XCCH 2G3NA 2W0KA 3N41F 3OKDA 4TSAH 1C08A 3SEPA 3MRHB 4MD4B 3SPVA 2HJLA 2J1WA 1VCBC 2WJ5A 2X0UA 5K39B 3DO7B 3JVGA 5CIPB 4NZUH 5HI3C 3KJ4B 4B53A 1J11A 3D05A 4AIXA 4ECNA 3L9YA 1R3JB 4UZSA 3W39B 2EH8L 5FYKL 4JGJA 3TNNB 3Q1MA 4G9FA 4ABUA 3UMNA 4QY8A 4PWKA 1KIUA 2EE9A 2ITFA 4NUGL 1QR4A 1A14H 1NYHA 2NUPB 4QXGH 4MZRA 5IHBA 1HYSC 1A7NL 4CN4A 1AACA 1CXLA 2GSMB 5AYUL 3CXHJ 3HG2A 1IFNA 1SQBD 2N1TE 1TTUA 1CYXA 2BHFA 3SDAB 2O61A 3JWDC 2YK1L 4PJ9C 4XCEA 4HIIA 1NAFA 1CL7I 1WDAA 5ESQA 1ADQH 4HHGA 2K3HA 1KUMA 4U3XA 4D9QE 1S4XA 1D5IL 3QRFM 2MMXA 4ZW6A 3IVKA 2A4EA 2XRAL 1M7DA 5JDSB 1LTAC 3D6GA 3GBNL 3OZLA 3MLVL 3UTZA 1AVYA 1CFSB 1HWGB 3HG1A 4NRZB 4UILL 3H1KG 1Z32X 2DJ4A 4FFVC 2FBWC 1AZRA 3VGBA 4BXSV 3IYLW 1L7IL 1U4EA 2MKWA 4W9DC 4LC1A 5FW7A 5GS0C 3Q05A 2RMZA 4ANXA 4A67A 2GTWB 3ZE1F 4TSBH 3P7KA 2YUWA 4OLYL 4PJ5E 3T3MF 1B3IA 3H54A 4G9FD 1DYZA 5ADPH 3HPLB 2JDIH 1DLFH 4U6YB 5HJ3B 4A7SA 1UJ3A 2HA1A 3W11C 5HI3D 3EFDL 3NACL 3TYGL 3ILPA 1GKOA 1I8IB 1SDYA 2GG1A 1NAMH 2YD9A 3CXHH 3RZCC 1K8IB 2YEVB 3QH3A 4GP5B 1HYSD 4WTQA 4WI7A 2ZAGA 2HWZH 5GXBB 2AK4A 1HHKB 3DO4A 3H1IG 3L9RB 1YEHL 5FO8A 3E6HB 3HG1D 3HFMH 3N04A 3NYKA 1CLCA 5D6CB 1BVOA 1IGYB 1L4AC 3EYVB 2RACA 2C7UA 2V6HA 2C9QA 4PJ7B 4NZDA 1EANA 2ADJA 3VGAC 3TNUB 1M9WA 4OFQA 5D4QA 2UY6B 3K7UA 2X1OA 2I5YH 2AXTH 4LPWA 3T97B 3H9ZA 1AZVA 4KRPC 4DEPB 5C86A 3G6DL 4E9LA 4WU7B 4W9HC 3K0YA 5DT1H 3BZEA 3RGVA 1RI8A 5ANMA 2CM5A 1F1AA 4GUPA 4L48A 1I1CA 3IT8D 4AQ1C 1UOLA 4HWBL 1AQKL 4W68A 5DRZB 3CCEP 2VJXA 4KVNL 1C9SA 5PCYA 1SGKA 4M1DH 5F9OH 4LOUD 1S9KE 1F4XL 4AMKL 5ICZA 1JZJA 3DSNA 3A47A 4MMZB 2RFXB 1BXXA 5APXA 2AK4D 3ELQA 4X98B 4N6JA 3W11D 3CZFB 1XH3B 3WHE0 5DA4A 3E2HC 3KLAA 4A2EA 1P4UA 1N8ZA 4AQ1A 3A0BE 1L6PA 2VR6A 3ARQA 3V79C 3BUDA 4LKCA 3QRGH 1U7MA 4U1HB 3IJSB 1RZJL 4YDLC 5BZWB 3TBTA 3BWZA 1DEBA 1EEYA 2JKLA 2P52A 2X4QB 3R4RA 4MVBC 5EEVA 1R9FA 1IAOA 2R1XA 4MAYB 1DBML 3QB7C 5IK3A 4BDVB 1NIAA 1A3LH 1E8ZA 5DCCA 1FGVH 1HC1A 2J7LA 3AEFC 5GGTL 4HFUL 3S8WA 2WLIB 3RGVD 1NEZB 1UEYA 2BVYA 5JIIA 3GMQA 4M7ZC 1H0TB 1JK8A 1KPUB 4PJ8C 1IT9H 4G1MA 4O51B 3BH8A 4HUVB 3ETBJ 3NK4A 3B1TA 3PWUB 1U21A 3QZPA 1YQVL 4KRPD 1MI5B 4F58L 4BH8B 1MPAL 1ZCRA 2H6OA 4F15B 1XH0A 1OX3A 3L36A 4XCYA 4ZAKC 4R0LC 4PB9L 1T7VA 2XG4A 3DROA 1QRKA 2XDHA 3CZKA 3N1QC 1AY1H 2IC2A 5KAQF 5GJTH 1HF9A 4Z7NF 4NERA 3TGUJ 1AANA 5GGQL 2GAZB 3QWRA 3CK0H 4Z7IA 4N2DA 3VG0H 2NXZB 4JKPL 1XVSA 1JYVA 1EHLH 3LQMA 4KJQC 2QFRA 2OL3L 4PJGF 4ZAKA 1PLGH 2A06G 4N5ED 1D5XB 4XNYH 1XH1A 3G08A 2WWOA 2X53A 1EVTC 1T22B 2OMNA 4QRPD 1NL0H 2WQWA 1KFAH 1BG1A 4XZUB 4JPQA 2F7QA 3CDYA 5KN5A 3AG4B 2VISB 1KQSO 4UQDA 3TEWA 3WFHA 1GC1H 3QIWA 4BQ9A 4JVUA 4R26H 3QDGB 1R5IA 4MZ2A 1A4AA 3TNMB 4LP4A 3I50L 1P1VA 3V5BA 2FWLB 4OLZL 4S10A 3IRCA 4KUZH 4YGVB 4EKXA 3II3A 1CDBA 4GP4B 3W0WB 3IFPA 3EG9A 3T2QA 3MX0A 3A3YB 4XVOA 4YVNA 1JGDA 4M8UA 1QVOA 1ZHNA 4UTBA 2WXHA 2YD8A 3IS0X 3SPGA 4KXCA 4DF9A 1AHWC 3KWUA 2MH4A 4DPBX 1WFJA 3BP5A 3QWRD 4M5ZL 4ZO7A 4X5WA 4PFEA 4KRNA 2D3LA 3NESA 4PJIB 3MLSH 1C7SA 3U9UA 3RA7L 3P4NA 1HKLL 5TF0A 4EN2A 4GUOA 3BO8B 4AV0A 4ZAKD 1UT9A 1FNSH 3ROOB 3CPLB 3AS3A 4QHLB 5TPWL 3B34A 3ZE2B 5I6KA 4AYDC 3P9MA 3GEFA 1P84E 1QLEH 4UDTB 3SE6A 2Y3NA 4X7FC 5C0AE 3VGGA 3NQIA 5KLVE 4ZDHB 3RVWC 1RUKH 4LIQH 1Z5LA 1LWJA 4H7VA 2X9ZA 4N90D 4WTWA 5TDOA 3QIWD 3F6LA 1NBYB 1S3KH 4U6TA 4HJGA 1INDL 5AOKA 4MX7B 1BZ8A 3HN5A 2HFEA 1SXCA 2VXUL 3TS8A 2G9KA 1N7ML 1XTLA 2DMCA 4M8QB 4QLRA 5ALBH 1PY0A 2YPLE 3I6KB 3T65B 3X1FA 1DQJB 3OGCA 3NFNA 1KJ3H 5EN2B 5B7FA 1CG9A 1S7UA 1SQMA 2HLAB 1J1DC 1JNHB 2DQUL 3BOVA 3T6QC 2QQNL 1BQSA 1ZV5A 1ZJBA 2VQ1A 2Q9IA 3EHBB 5FYLH 5HYJB 3HI6H 3GD1C 2P1YA 4U0RB 2FX9L 5D72L 1E4KA 5E2WL 3HTKA 1ZA3B 1BA9A 1WICA 4ETQA 2YGOA 3L5JA 3WKPA 5AVZB 1JGUL 1MCKA 3JQOB 5ENWA 4AOFA 3P54A 3VFRA 3C5JB 1M7XA 3B9KB 3UTSA 4ATTA 3TGXA 3VH8B 1HGVA 3GBLA 1UB6B 3NZ8A 4U3SB 2OTWA 3GXTA 4B9JA 4GAJH 4AWJC 3SBWC 1U8PB 2PWFA 2XKSA 4OZ4A 1JERA 8FABA 3UTTA 5D4JA 4RQQA 1BVLA 2XZAL 4Z8FL 2DM3A 1ZTXE