The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
42
|
sequence length |
281
|
structure length |
281
|
Chain Sequence |
SEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEIAFRPNDPKSYMTYVDNIDNFLKKYRDSAQKDDMIFEDCGNVPSELKDRGELNNEQGERKVCRFKLEWLGNCSGINDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVQCTGKRDEDKEKVGSIEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Isolation, crystallization and crystal structure determination of bovine kidney Na(+),K(+)-ATPase.
pubmed doi rcsb |
molecule tags |
Hydrolase
|
molecule keywords |
Sodium/potassium-transporting ATPase subunit alpha-1
|
total genus |
42
|
structure length |
281
|
sequence length |
281
|
ec nomenclature | |
pdb deposition date | 2014-12-22 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF00287 | Na_K-ATPase | Sodium / potassium ATPase beta chain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | Single alpha-helices involved in coiled-coils or other helix-helix interfaces | Single alpha-helices involved in coiled-coils or other helix-helix interfaces | ||
Mainly Beta | Sandwich | Immunoglobulin-like | Na, k-atpase alpha subunit. |