4XE5B

Crystal structure of the na,k-atpase from bovine
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
281
structure length
281
Chain Sequence
SEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEIAFRPNDPKSYMTYVDNIDNFLKKYRDSAQKDDMIFEDCGNVPSELKDRGELNNEQGERKVCRFKLEWLGNCSGINDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVQCTGKRDEDKEKVGSIEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Isolation, crystallization and crystal structure determination of bovine kidney Na(+),K(+)-ATPase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
total genus 42
structure length 281
sequence length 281
ec nomenclature
pdb deposition date 2014-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4xe5B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 4xe5B02
4DZOA 5AW1B 2XZRA 4RETB 1JUNA 5AW8B 4B86A 2ZXEB 3P7KA 4HYTB 1GTWA 4C7NB 5APYA 3L36A 3KDPB 1GD2E 2WPQA 2Q7CA 5AW2B 5AW4B 3M91A 1NAFA 1MUUA 3T97A 2JJLA 4KHXA 1GZLA 1CSBA 1MFZA 2WT7B 4AQRD 2YO3A 2XV5A 3M9BA 3NMDA 5AVZB 1S9KE 3TNUB 3TNUA 3HE4B 4LC1A 2ZFCA 5AW6B 1H88A 3I5CA 2VRSA 4JYBA 5AVRB 1CZQA 1X8YA 2YNYA 2N9BA 1S9KD 2YO2A 3A7OA 4GT1A 2Q5UA 3A2AA 5APQA 3V5BA 3V4QA 1IO4A 5AVQB 2R3CA 5APXA 2XU6A 4JYCA 1H8AA 2H7HA 1OXZA 4EOTA 5AW7B 4C7NA 1JNMA 4AYCA 2KP8A 3NXSA 3O8ZA 2R5DA 2WPRA 3M0DA 5AVSB 2IPPA 3HE5B 3VYIA 3KQGA 2C9LY 3L37A 3M0AA 2E43A 5APVA 4AUWA 3NTNA 1FAVA 2W6AA 1OWAA 3WGVB 5AVVB 1T2KC 1A02F 3IR9A 5AW5B 3B8EB 1G2CB 2QM7A 3VN0A 4C46A 3SWFA 2WPSA 1HWTC 3VMYA 4I2LC 4RESB 1FOSF 5AVXB 1GK4A 1HBWA 1KQLA 3LIDA 3V4WA 3VMXA 1CI6B 2Q3IA 4GKGA 5AVTB 3HE5A 5AW9B 3VMZA 3TYYA 2P7JA 2Z5IA 4M3LA 1HJBA 2BASA 5CMZA 2WTYA 2P2UA 1HUCA 1NWQA 5APSA 5AW3B 1GK6A 2W27A 2R32A 3OAKA 3P32A 2P67A 2QM8A 1T2KD 3A5TA 3NFQA 1J2JB 1SLQA 2Z5HA 3MGNA 1FOSE 5APTA 3A3YB 2C9NY 5AVUB 3L35A 3M9HA 1GU4A 1SP4A 3WGUB 1CI6A 3HTKA 3HE4A 5APWA 1A02J 2E42A 3P8MC 5AVWB 2R5BA 1YYCA 2WT7A 4I6MC 1DH3A 3UIAA 3VTPC 2WWWA 1MV8A 5AVYB 4XE5B 3TK1A 3M06A 3LIEA 1GU5A 1H89A 3MD0A 5AW0B 5APUA
chains in the Genus database with same CATH superfamily
1H6UA 1JPST 1SLUA 2VAJA 1M71A 3LZLA 4I87A 3VD0A 4Z0XB 3T0ED 2FTAA 2J71A 2VN3A 2DEWX 5I6XB 5I2IA 1RZFL 2OZ4A 1RIVH 3P11L 1SJHB 4HIJB 1MEXL 4P9ML 5SWSE 3U83A 5DYFA 4PG2A 2XQBL 1CIDA 2DQEL 1N4XL 1YEIL 4HJGB 5TFSL 3E2HB 4P4KB 3BVHA 1MXGA 3ERXA 4UB0H 5KLVK 1MI5B 4YDVA 1VZHA 1JE6A 3PHLA 2Z0UA 1CICB 1E4JA 2B59B 1T5WB 1XF5A 4PD4J 3DV6A 5D7IA 3RJQB 3V52L 4NO2B 5DVKA 4V33A 2XFXB 4IHBA 5KBDA 5SWZE 2R3CA 1N7SA 1DJIA 3GSQB 3M86A 4XVSL 4BSVA 2ZUXA 2BNRE 3L73G 2V33A 3ECVA 3FQ1A 3NZ8A 3JWDL 4FS0A 3UIZA 5IESL 2XV2A 4X7TA 5DVOA 4ODBD 2Q76A 2DQCL 4U3CA 4U1IA 2CO4A 3WEXB 4X4XA 2RALA 2QGBA 2EKSB 5E08H 3C5SA 3ZTNL 3F83A 3STBA 1N6QL 4UIKH 3PWJA 4HIIB 5MEQB 5SWZA 1N2RB 4BIKA 2AP2A 1TTCA 2CKBL 2K1MA 3F2LA 4M4RB 4D9RD 1O6SB 4WI7A 2G5BA 2QM7A 4E9WA 2BSRB 1X9QA 2AJUL 3AMLA 1IGYA 4MDRA 2AXCA 4ZS7L 3BASA 1IQWL 4QF1A 2J88H 3F6LA 3V4UH 4NWTL 5ENWA 4G7VH 4E9RA 3IYLW 4G6JH 2C3HA 1QSFE 5A2FA 4BCYA 2R8SH 3UFIA 5BV7B 2JI2A 4WHTB 2XWJB 4ZZKA 4B27A 1IBHA 1ROCA 1MIEL 3SYQA 1IVTA 3CHOA 4XBMA 1QFPA 3QDMD 1C16A 3KG5A 3GXNA 2APVA 2Z31A 4OCRH 4G43B 4L37B 3GRWA 2WZ0A 3M1BA 4BDVA 1IAIM 1L9RA 3TO4A 3LH9A 1RJLA 5E1HB 3KWTA 5EU5A 3SDDB 1P2CA 4F8OA 1MUJB 4GUOA 1I9IL 2BW5A 2Y9YA 1ITCA 1SP4A 1HHHA 3R8QA 3SEPA 2IDUA 5TE7L 2QELA 2R39A 5ALBH 3MA9H 4POZC 3I6KA 2CXKA 3L9RA 3CU1A 1VEMA 3OHMB 3ZK0A 3IJEB 4D94A 3KGSA 4L9LB 3GSNL 1TLMA 3LJ3A 3K2UL 3SBRA 3QUZA 3OXRB 4W68A 2FBJH 4FNRA 5FWQA 4PJCF 2VUOA 2H4EA 5H8DA 1QKZL 4A7PA 1W72L 1KNOA 4ZNCD 5CJXC 1I7UA 1DLFL 3ZW3A 5BV7L 4QKTA 1W2KT 3H1HG 4JHUA 3B7RL 3BZ5A 2I5YH 1U4EA 3O2DL 3RVVC 5DA0B 1G9NH 4U3FG 3QHFL 3C8HA 5HHPB 4Z7OF 2Y36L 4FEMA 2PP6A 4TLTA 4F20A 2NRDA 4U1NA 3VJ6B 2OQJA 1ZR2A 3BKCL 2AMUA 5DD3L 1X9UA 2VXSL 2PO6D 4IKKA 3OAWA 3UBXI 1RUMH 1WAAA 3SPVB 4JDVB 4FCHA 5I19H 4Y1AD 5I6OA 1NCHA 4GT1A 25C8H 4B53A 2OMNA 2CJTA 2PWHA 1KN4H 5I8CB 2ZXAA 3U30C 2QQKL 4MNGE 4ZSOB 4XNYL 2FBOJ 4LEEA 5AAMC 4M61A 2VLKA 2JQZA 4P2CG 2X4TA 1U91A 1HNGA 4ZFOB 5JPNA 5JOPE 4GP4B 2X4SB 1J8HB 3HE5B 3ABLB 3H2WA 3INOA 3FWLA 3K8KA 2JK5A 3P11H 5DJYB 3BKML 4D8OA 4L29A 3L72J 3V5HA 3GSRB 3ARTA 1J5IA 1UOKA 4JB9L 5F7BA 1AHKA 3DSNB 3GSXA 3HAEA 1UGNA 2QEJA 2JH2A 4MA1B 1PLGL 5FFLA 1AZBA 1ASQA 1LP9B 1ZT7A 5A3IC 4R8WH 4Y1TA 2Z5IA 1Y8AA 4U33A 1J9RA 4FQXA 4HUXA 4RIRA 3IRZA 1TNMA 1CG9B 1PZDA 3FQWB 3LZRA 3NEEA 4WJ5A 5BUGA 5IMLA 2ZYIA 1UM5H 4XWOD 2J44A 2VJ8A 3I9PA 1OPGH 4BFBD 1ZT1B 4O9HH 4R96A 1J1DC 1CFNA 2UX7A 3FQXB 2XCMC 2VISA 1RFDL 2X7LA 4CVZA 4HUMB 2QSVA 4D9QD 4UNUA 4Z7UB 3IAOA 1XTLA 3KPRE 1WWWX 4X6BB 3T97B 1BGYE 2IFMA 3NQKA 5BRZB 1QGKB 3JV4A 4I0PC 4OGYL 4WW2B 2OTPA 5JIHA 1AHMA 4CN4A 4RMQA 1H3TA 4KH9A 3DV4B 2NDGA 3MUGA 1NM9A 5E4AA 3GM0A 1N7ML 5DMKA 5E5LA 4XR8C 3IFOB 2YXQB 3MLTB 3SYCA 2WN2A 4HQQH 1NCWL 3DBXB 4HD5A 3QUYA 3SY0A 3GFUA 3E6FB 1F11A 5TQ0H 3HRZC 4WEBH 1OE2A 1UA6L 3BSGA 3B2MA 1ZHLA 2IFFL 4EN3A 3F62A 1ZVSA 2PCYA 1S7UA 4KQ3L 4P8QA 5B38G 2DJMA 1CURA 4CBZA 3PQYE 5KVGL 3NJLA 2EH8H 1FA4A 4L4VB 1XMEB 3N6YA 5E2WL 1QRNB 5FGBA 2GCYA 2BP8A 2PNDA 2D0GA 2EH7L 3QI9D 5ES4B 1V8HA 4MB4A 3T4YB 2HTLC 2VLLB 1JZDC 4FJ6A 5EDXA 2VUKA 1HHJA 4Z7VB 5F93C 1I8MB 1BWWA 4IRJA 2PTUA 3B6SB 1K5NB 1R5WA 3TH4T 3TNUA 1CTOA 4BK5A 4Y19E 4LCWA 1B9ZA 1IGIH 3PHQB 5C0DA 3FFCE 2G5UA 3CDYA 3VWKC 1R19A 3HC0B 4M6MH 3CBJB 3FCGA 1E5AA 2FEDC 2X40A 4JBSA 4HIXH 4XP1H 1DDHA 1HZKA 4DAGL 2ZT9B 4ABQA 2E75B 3BWUC 1E5YA 3ARDA 1RH8A 2CGYA 4U2ZA 5GHWH 1ACYH 4LK4A 2KP8A 3FAXA 4N5ED 5H35A 2A06G 3O6KH 3I84A 2EECA 4PJ5E 3U9UA 2WYTA 5CCHA 4BE6A 2R29H 4LLYA 3B56A 1INQA 2OYLA 3K3QA 3TF5A 3R4YA 1WWCA 4IBLT 4L2YA 4ZDHB 1IQDA 4KV5F 4RFNB 4LLWB 4N6QA 1NIBA 4GSXA 5A2LH 1EHNA 2HKFL 3AQDA 3CLQA 4NFBA 1IGFH 1WH0A 2YN5A 4UV7L 3RGVB 1DFBL 4PJFB 3TYFA 4MMZC 3PQYA 2W9DH 3U4KA 1FI8C 2IBGA 2RGSA 2X6BA 1H0TA 3RWGA 3WIAA 3WMPA 1S78C 3CCQP 4XOBA 1EZVE 3P30L 2VWEC 1CS6A 4Y4FB 3MRDA 2ZCLL 5SWSD 2NY4C 1T0OA 2XN0A 5IB2A 4ZMQA 3TASA 1JNLH 2BIPA 3SE9L 5HSFA 1FHGA 5T5NG 4H13B 2MOVA 3ZDZE 4KX8A 3S35H 4BZYA 2JKNA 3CC5B 1YNKH 2H47C 1RSYA 2O6CA 1O7DE 2DZEA 5DC4B 3VXQB 1FGVH 3BN9C 3I2CL 3CV5A 2OGUA 4K9JA 3SDYL 3OB8A 3DK2A 5E8OB 4AM0B 3ARGD 3TN0D 1BJ8A 3DC0A 7CGTA 2VC2L 2ZX6A 2MNUA 4GRLD 1A1MA 3RL0B 2RIKA 3B2DC 1ZIAA 2WUCL 1VQKP 3JSVC 1A21A 4NSKB 3IDMB 2R0WH 3C09B 4WSGA 2KPWA 5F7AA 2ARJQ 1MIML 4PJAA 1U8MA 4CW1B 3CX5J 1G7IB 3NSJA 4NQTA 3FZUC 3FULA 1MRFL 1H5BC 3GLAA 4XX1G 3VVVA 1SQPJ 3ARXA 4JFWA 3IU3B 4IEFB 3AROA 1TMQA 2NQDA 3MGOA 1W8EA 4RMSA 5HYFA 3BHBA 2ARWA 4N2CA 4PJ9B 4XWGL 3HMXL 1RE3C 4LARL 4IRZL 1CTMA 2Q7YA 3DYPA 4BH8B 2H6OA 5EBMB 4PREA 3UTQB 4U1LA 1K5WA 3FU0A 2X2IA 1J87A 1X5MA 1J1OH 1NJ9A 4NQXB 2ZSVA 1BM3H 1IM9A 1B0RA 4HZLB 4J3OC 3HMXA 2WCGA 1LD9A 4N5UA 4M7LL 3K8LA 4X0KA 5ETUB 1FNEB 4WEMB 5GS1A 4FQHA 1QL1A 2Q8BH 2VL4A 2YS4A 3FXDA 4NM4L 2GAZB 5D9SA 5IHUL 1F41A 3PJSK 2Z93B 5CILH 4XBPB 1Y6MR 4HIHB 3O2VH 2BVQB 2PO6B 3RIAK 1LK3H 4Y5XC 1FC1A 3J7HA 1CDBA 5KLVG 1RZIA 5T1DL 1JAEA 5CP3A 5CSZA 1A6UL 1G94A 3KVQA 1UM6H 2GSIB 2WIIB 1NBVH 3V6OE 5L2JB 4NGHL 5I1LA 3THMH 4JDZB 1K8IB 2DF3A 4AK1A 1RUPL 2HPCB 3IM1A 3QWQB 3MUHL 4FFWD 3K8MA 2IJ0C 3Q0HA 4UTAH 1XGQA 4MDJA 2FR4A 1QVOB 2K6WA 4IGBA 5GISH 2NQ3A 4KQ4H 2CZNA 4LBEB 1G7MA 4LB8A 3O8XC 1FJPA 1IUZA 1DBBL 3TCLB 4Y4FC 2K3HA 3VQMA 3AT8A 1ZRTE 1PD6A 1G9EA 4NN5B 3DHPA 2KLRA 5ICXB 1UM4L 1ZPUA 5ICYB 1SFDA 2H32B 2RR3A 1GPOH 3USSA 3RL1A 1P5VB 3WO4B 4EAEA 1DL7L 4HUKB 1BXAA 5I1HH 5C0CD 3GTTA 1W8OA 5KYNA 1BD2A 5FO2A 4IU3A 1KDJA 1MIMH 4GKOA 1KYUA 2CO2A 1MXDA 1UKSA 2X38A 3BCCD 1RPKA 3P4LA 4GO6B 4LPCA 1H8NA 4MNGA 4UIKL 4KTDL 1PG7W 2NXYD 2WKOF 2WZ6A 1QFWH 3G3LA 3H7BB 1QW9A 2ICEC 3QG7L 3RLSA 2LXBA 1QYGH 4K8RL 4IIQA 1YEFH 5C3TA 3ZTJG 1JZ6A 1VSCA 4OFPA 4ZQKA 2A74B 2VJ0A 5E7BA 4A38A 5C8JA 3DHMA 4AGQA 3DIFB 4N9OB 1KTLA 4JY4B 2CIKB 1DE4A 5E9DA 1QATA 4ZJ9A 1EQ7A 4OZIF 4IBSA 4FXTA 2QV2A 2YD8A 4PJEA 1G1OA 1HOCB 4ORGB 3VXPB 5DURB 3ZE1B 1TQBB 1KV4A 3AQZA 2NZIA 5AALA 1Z9SB 3V6ZA 4AI7A 1S3RA 3MLYL 1TSRA 1RK0B 4TTGA 4U1JA 1KWGA 1G7LB 1C5CL 4XMVA 2R0ZL 1L0YA 3HPLA 5C0AB 4ZOBA 4JM2D 5IY5B 3BQUD 1BJMA 3FW6A 4FXGB 4AVIA 5AAWA 1VB9A 5GGSY 4EJ1C 4UB0L 1M7IB 2J55A 5FM8A 3BISA 3CWBG 2OYIB 1HSBA 1NAFA 3ZDZB 5BCAA 1YUHA 3U6XA 3UYPB 5DLLA 1K2DA 4YGVB 3FUKA 3O3EB 4XCCH 2E5TA 1M8OB 5AW6B 4D6TE 4J3OG 4NI3A 3US0A 3MOBH 1YY9D 3VXSB 2CRMA 3QRBA 3JUZA 4FJYA 5DO2C 2WUCH 1XL6A 2VDOL 3SKUD 4BHUA 5CEYA 3HBGA 2GSGB 1REIA 3ETTA 2GBUA 1VEPA 1KPUA 4MQ7B 1P84H 2ED6A 1GW0A 2KS1B 1QAWA 4Q58C 5FA4B 1ZVYA 4JKNA 5IVOA 4IJTA 4YE4L 3TNMA 3HZYB 2X70A 4BA0A 2VQUA 5C08D 4MJIE 4XNDA 4I48B 5CZRA 1EIBA 3SYAA 4UUJA 5GSRA 1WFTA 4GOEA 1R3IH 1PF3A 5L4FA 5T3ZE 2Y0DA 4QY8B 1QBLH 3QCUL 3I6GA 4YLBA 3IGLA 5EWIL 1AGEA 2C4FT 5B39B 1Q9KB 3PL6D 1IFIA 5GGSB 1Q94B 4LZKA 1WK0A 4D0CA 5IV2A 4CGUB 2JCWA 1AQ8A 4OZIB 4L0YA 4XFJA 1BM7A 1IAMA 5FO7A 4F7TB 4XP5H 2X4NA 2O5XL 2YR3A 4BWTA 3EDEA 4C54A 1B6UA 1YY8B 5HY9B 4PBDA 2AI0H 1MCBA 4EUPG 1JWMA 1X7QA 4QRPE 4X6CE 2MTPA 1P7KB 3V5KB 5ISZA 1HHGA 4Q8BA 3HNVL 2QM8A 1LJ2A 1M6OA 1SQPD 1OW7A 4JFOB 3VXNA 3K2IA 1G0XA 3IMWA 1YAZA 4BSJA 1URQD 2EYTB 1C08B 3OF6D 4W9ZA 3FCSB 3NK4A 4JM0A 1UC6A 4M7JH 4YC2B 1BWMA 1AO7D 2H1XA 2KOGA 2LFEA 1WZ1L 3S4SA 1IC0A 1OW0C 2GJ6A 4NKDA 3FF7A 4QTFA 3LIEA 2EEAA 2VLJA 2ZNWA 3V95A 3FOMB 2N1TE 5LGHH 3B2UD 2OPCA 2AEQH 3MLXH 4F9PC 2OJEB 2MKVA 4C4UA 1KEGH 2F61A 3ISWA 1T1WB 5KUMA 1I8AA 4GXFA 3QEQB 1SFCB 1FLRL 1F4HA 1NIEA 2FKWB 3KMDA 1LE5B 1Z32X 3QHFH 1C12A 2Y36H 4P9HC 2YBGA 4CUCA 1U93B 2NYKA 1TYEB 3Q8CA 4XOAA 2CU9A 1G6RH 2PP9A 1IB5A 2D31B 2RD0A 4PJIE 4TN9A 3N1PC 4IM8A 2MMXA 3QUXD 3H32B 3RZCB 2X0UA 1FAIH 3CDFA 4BKTC 1PDKB 3OMAB 3HB3D 5AVZB 3T6QC 4R4BB 1F97A 3C9NB 3FPYA 5D5MF 1PP9J 1ECZA 1WISA 4D0DB 3BWUF 3G08B 4DFIA 2HRPL 4PB0H 4WV1A 2AAAA 3EYOA 2YJLA 1KGJA 4YSDA 4JMXA 2A4CA 3NACL 4ODTL 3NCFB 3FUEA 2C9UA 2XQ0A 3B9KC 2FY8A 1JPFA 3QORD 2EIZA 5JW4N 5BVPH 1QX1A 2WXQA 2MJZA 3PS6A 1FL3B 2XA3A 3U2IA 3HRPA 2I7SA 1IZNB 2WSFJ 1KB5B 4HS3B 5CBAB 3GSNA 3VH8B 2IYOA 2E9JA 1KB9K 3BCCJ 1CXLA 1UVQA 1Z9LA 4WUUE 1Q0YH 1YI2P 1OWAA 1T3FB 4RAVA 2G2RA 1W0WA 3RIFF 3PAVA 1QUNB 1HYSD 5HDBF 1EDLA 1KJ3H 1GGBL 1DJYA 2PPFA 3FHAA 4NNYB 5I1KH 2GT9B 2EVHA 1AD0A 3NP3A 1A47A 3H1HJ 2FYUE 3LIDA 1R3HA 2NNCA 3BI9X 3RL2B 2FX7H 4GKGA 2DQUL 1X79B 4MAUL 4DGVH 4U3FJ 3GHGC 2HG0A 4LDCA 4LKCB 3TO2A 5KSBB 4HWBL 1GHFH 4D9LL 2KQNA 1YN7A 3AE4C 3D06A 3GW6A 3N40F 4GJTB 2JCCA 4K94L 1MELA 4W9GC 2JKLA 2Q20A 4AUYA 2VR8A 3O9WB 2HMID 2NLJA 1XD0A 3MOAH 5IUCA 1A02N 3GPSA 4ZUWA 4CKQA 4OFKA 2F19L 4XNZB 4PJ8B 1MKMA 4UU9B 5ADPH 3D2UB 2BSCA 1VKXA 3B7UX 3KDMB 3BN9D 3NCCB 1W0WB 1XT5A 1IAII 3F85A 4MA8H 4OV5B 3AS2A 3KYMA 3HG1B 1ZS8B 4OGAD 3CK0L 5MEOB 1IILE 1MCIA 3T0XA 5D4QA 4YOKA 1NTZG 3SSGA 3EF4A 4OLUH 4O02B 5FUOL 4LLDA 5I66A 2P5WB 4PYHA 1XEUA 3C5XA 2BXYA 2AJXL 3HZKA 2D9CA 3IJYB 3NSCA 3OHXA 5D1QA 2WLNA 3BP6B 2YHGA 3H9HA 3MRJB 2CPSA 3FT3A 1T0MA 2B4CL 2XQBH 3X1GA 3IKCB 2QGCA 3S36H 1GTWA 3G08A 4ATWA 5CJ4A 3HNVH 4H8UA 2A06E 4JVUA 5D4JA 4I1RA 1R24B 5I8KL 3VXUD 2JCCF 5F7FA 1Y0LA 2ICWI 2DWSA 4J12A 1LTXA 3MRGA 3FQUB 1S9XB 2QQLL 3PWNA 5JPMC 1F90H 2AJVL 4L3FA 5E6ID 2K9JA 1NKNA 2NY7H 3ROOA 5I0DA 1BOYA 2WLMA 3NJMA 5C0JA 1ZANL 2YGQA 4JYBA 3C9IA 1YSOA 4GW4A 4DN3L 4F57H 2YD4A 1TZHB 3LPFA 5D1QC 4MNQB 3OKYA 1PNCA 2Q7NA 1LE5A 2VSCA 3A4FA 3MC0A 4AQ1B 1U4FA 1QBLL 1R0AH 2XXCB 2FYYB 4JX0A 4XMZA 3H1LJ 3DHUA 2YPVA 4YBHA 2CK0L 2W60A 3EYSL 2AJZA 3MV8A 4WK4B 1JGIA 2B87A 1OCOB 1X4XA 4KU1A 1KFNA 1G1KA 4P9HH 3FHQA 1A7QH 3UCRA 3W5NA 3VFSA 2XNXA 4DT0A 3M0DA 3HHMA 2MRYA 1EQWA 2V8MA 2XZAL 3S4SB 8FABB 4XWGH 3W9DB 4P5TD 1FZOA 4O02H 5J1AB 3GHGA 4Y9FA 2LV4A 1AGDA 3BYTA 2NYYD 2VZUA 2XN2A 3DX7A 3FSVA 4KJPC 4WWPA 2EYTA 4NB7A 4AV4A 4S0HA 2EDMA 4JRXB 1FAIL 3M46A 2P1JA 2UZYA 5FCUL 1A5FH 1D5XB 1M6OB 4Z0BL 2J21A 5DD5L 1OZUA 5JIDA 2V5SA 3O4LB 4NT6A 3MUZ1 1V7NH 1P7KA 2A1WL 4G8IB 4Z95L 3UO1H 1HHKA 3AGWA 1JMXA 1JBJA 4M3LA 3H6AA 1L3WA 1DCEA 2QPSA 3VU2A 4WI8A 1L0NG 4H5SB 2D3VA 3QJQB 3BPNC 3CC7P 1KIRB 5F7DA 1RZ7L 3CFMA 3KAAA 4PJ8C 1BCCJ 4QJ4B 2YA1A 4FG6C 3RPKA 3BUDA 4G42A 2AJXH 3MRRB 5AZEL 2K3TA 3F05A 4F9LA 2H45A 3B9KA 4JDEB 1FZGA 5KS9B 1FOSE 3RIKA 2ITCA 4TTDC 1SQXG 3AY2A 4L4TA 3THML 4DW2H 1JPEA 2Y9ZA 2DMHA 1DYZA 4AYEC 2JTYA 2XWXA 3UG4A 3KPMB 1BXVA 5EF0A 2HCZX 4UUJB 5GSRB 4M5ZH 3GIZL 4HG4J 3H55A 1WRFA 4XN5A 3OPZH 2X70B 1OPOA 3BWAA 2XN9E 2WXFA 3FH7A 3B5HA 5D4HA 1BREA 1ZLVH 3U1SL 2VLMD 3ULVH 1FBMA 2W0FB 2ICWA 2AXHA 2CXGA 5J12C 2QVAA 5LNEA 3LEYL 3TBVA 5CKAA 3FMGL 1JZ8A 3D6ZA 3KNBB 1PS3A 3PU7A 3C2AL 2Q6QA 3VXSA 5D2LB 5HDLA 4MJ2A 2G4EA 2ZKHH 4N2AA 2BSDA 1NTKK 2B1AH 5IBUB 2OR7A 3TJEH 3LZFH 3L5XL 4RWYH 4ICXA 4WZ9A 5T1LB 3FS9A 3OZ9H 4DQOH 2ID5A 3MZTA 3QEQD 4LSRL 4OCMC 1YDPB 4AQRD 1ZHBB 3BEVB 4DTGH 1YUHB 2P47B 1HSBB 1JHLH 5FGRA 1G4MA 3MRIA 5K5YA 5KSBE 3CK0H 1M7IA 5ANMA 2E9GA 2IDQA 4IOSA 4LPVA 2JB5H 1GZHC 1IO4A 3LNEA 2BXZA 3H1HD 1XB6A 2Z8WC 1WQVT 2NY0D 5D1XB 5E99H 5IOKA 1RK0A 1EEUA 2WO4A 1OZHA 5HJBA 4AYMC 3HB3B 3UBXA 5C3IA 3CZEA 2B39A 3UP1A 1U6AL 1PD1A 4PJEB 3V4PL 1WBZB 5TGBA 5A7BA 1MWAH 5TF1L 5GS0H 3SDCA 1D6EA 2J8HA 3ZX1A 4HWBH 4YSTA 5KS9F 1OAXL 3IFMA 5KAQG 3LQZB 4FX5A 2DEXX 2IVFC 4XH2B 4C56D 1OALA 5JTWA 3X3FH 3SWKA 1CLVA 2VSMB 1VESA 4RESB 4IRJD 1NANI 4AVJA 3T2NH 3EJSA 4GP8B 2I9TB 4P46D 5AVTB 2QADB 3OAYH 2ZCZA 2ADIB 3IDYC 3LXUX 4PGCA 3AXIA 4PJCB 2A4EA 5BO1H 2GQHA 5CR8A 5KVEE 2FSEA 3ULUL 1OTUD 1E4XH 1TVHA 4U6XA 3IJHB 3FK3A 5ICXA 2DJSA 1IFHH 2F5AL 2CO1A 2CNZA 4OLUL 2R32A 1A4AA 1AZUA 2FGWH 3D85A 4P59L 3DO7B 4GIFA 3UAJD 1SEQL 1ZHBA 5EZPA 1U92B 4RMBA 4IGBB 1BA9A 1VQLP 3MUJA 4WK2B 2VLJD 3FT4B 5TQ0L 1SJVA 2B20A 3O81A 1KB9D 4APXB 4JKKA 3T09A 1W9XA 1TJMA 1T83C 3PAYA 1GMIA 1SN5A 4BWNA 4HPOL 2E0PA 2N9YB 1OZTG 4PJ8D 3L4UA 1XIWD 4B6ZA 1I85A 4H44D 5GJTH 3BRFA 2BVQA 2PO6A 4FA6A 1A3RL 3KWVA 2QMJA 3FOLA 2GAZA 2I7OA 3EIFA 1XTGB 1BFOA 2Y2YA 4N0CC 3STZB 1J9TA 1T0PB 1GGYA 5DMIH 1RVFH 2F7PA 3EH5B 4FQHB 4WUUD 5D5MA 4YLCA 4RBPK 3S37L 4P3CL 3IGKA 1DJWA 4LNRA 1FRGL 4J3WA 5C1MB 4UM8B 2ZSVB 2LFGA 1PSKH 1TVBA 3MLRL 2FATH 4P2RA 4R7LA 2X4PB 1SY6A 1U3ZA 4G9DB 3L2LA 2FYUD 4UT6L 3UACA 4EKXA 2Y0SA 4ENZA 2H6UA 3UEZA 2JNZA 2KLUA 2GBAA 5B21A 4MD4A 1ZGLP 1FBIH 1MCOL 4BH8A 1X6LA 2Z92B 1LWHA 1V27A 4PD4K 4HPHA 2JQAA 1WZ1H 3CL3D 1SYSA 3BHBB 4JKPL 5DUBB 3ZE0E 4AM0Q 2FLMA 1JD9A 3B9DA 1AP2A 1M56D 4H5SA 5LAXA 4NCDA 4TVPD 5ECJE 4TS6A 3TBCA 4NEHB 2VM9A 1XEDA 3O41A 4JQIA 3H1LE 2NPLX 2ZT9C 2FX8L 4S1QH 4NJAL 1D5XA 3WKQA 3QE5A 1MY5A 2UZYB 2O01N 5AL8A 3DUSB 5GRVK 4N85A 5C0IA 4MNQD 4X8GA 3O3DB 1RI8A 1JXGA 3L37A 2CDFA 2VH5H 1A1MB 5L0QB 3IRPX 1QZ1A 2MH4A 1DVFA 3OKOA 4NKIH 1F45A 1CDUA 1T22A 4QR7A 3ZL2A 1J8HD 3HTKB 2CJUH 3SB3A 2D0FA 4WW2F 4MCZA 3PJNA 1CZ8L 4QHMA 4L0ZA 1NAML 1KCVH 2DQGL 4RAHA 3VFSB 4Q4EA 2LAGB 4XP5L 2YPLA 1FZJB 3QZNA 1FOSF 1RIUH 3GF7A 2IWFA 3QI9B 4YHYC 4BELD 1M3JA 1TF4A 2X4UA 3R0MA 2APFA 1YTZT 4ONFL 4ZUVB 3WIIH 4UM9D 4R6UA 5T8IA 3TL5A 2BC4A 5A2KH 4H8WH 5D7JD 4Y4FA 4J3VA 1ZMYA 3HCVB 1JGVL 5E2JA 2YZ1A 3FF8A 2OMZA 4AE1A 4WY7H 2FHFA 1NTZK 1FE8L 3ZLQC 2OI9C 4WDIB 1HEHC 2ZCKL 5IJCC 1QTPA 5L8KB 4BH7A 2CDGA 4BRYB 1OK8A 5KN5A 3QJHB 3WFCL 3SFEC 2AXFB 2W9EL 2C34A 4TL4A 5I74B 5HGBA 4ZW5A 4LLWA 1FZFA 3WY3A 5EOQH 2G60H 5F3HA 3TDKA 5DD0H 2LLNA 4DZBA 4U2YA 2N1TA 2NNFA 4PS4H 1U3HC 3MUUA 5K59F 1TEFA 4GRWH 1JZ7A 4FA7B 4PG9B 3M06A 3MRJA 4DEPB 3TYGH 4O58L 1UT1A 3RL0C 2WSFH 4GXUM 4PHZA 2KPNA 5GRUL 1BQSA 3D48R 4V11A 4ZD3L 2KZWA 2FYNC 4XVOA 1JZGA 3HZKB 3OHXB 3RWEB 1USEA 2C8NA 3MD0A 2KYIA 2WSDA 4ES9A 3ARDB 1W15A 3OKNA 4JFFD 3VGAC 1I9JH 3CE1A 4LVOC 1L9PA 4GSDL 4PJHF 4NPFX 3I56P 2WAHA 4ISVB 2G9HA 3REWB 3F8UB 5C0DB 1KGCD 3OKLB 3RWIB 2HODA 1J88A 4NLHA 2YWYA 2HG5D 1UJ3B 1AAJA 3MREB 3KPTA 1VKXB 1E8XA 3LPPA 5LNDA 2WCPA 4Y8AA 4IKLA 2AQTA 3WAKA 4AG4H 4Z7VA 5AKRA 4YX2L 1ZA3B 2R0LL 1T0NB 3BLBA 4MRCA 5TH2B 5E70A 2NPSA 3P8CD 2NUPA 2ENJA 1QRNA 1BCCE 2D7PA 4F5CE 3CWGA 4KZEL 2JCCB 2Y0EA 1S7XA 3E3QC 4HPOH 4NOFA 3S9DB 3NH7H 4MXWH 1EAPB 3VTTA 4JFXA 4R0LB 1A2YA 1EPFA 5KYUB 2YMXL 3F00A 4EN3B 3UL4A 2DI7A 4LLAA 3ARGB 4EZJA 4TLFA 2C5DC 2IMMA 3RDJA 4YS4A 3FBQA 1SLXA 3V6OC 2Q3XA 1R3HB 1XZ0A 2XY1A 2XNDH 1JY3N 1D5BA 1EDJA 1QUNA 5BQDA 4JG1H 3FXEA 2ZSWB 1PYWA 5F7KC 3WDIA 4EZMA 4LMQI 5JXEC 3M45A 4KHXL 5I8OH 3TESA 3U6RA 2WKOA 3D39E 2X6CA 2B1OA 1VZIA 3MCG1 4QAMB 1VEOA 3MROB 4KJQD 3G4SP 4PRHA 4WWKA 2ZKMX 3ZHLA 3OAYK 1DBJH 2VISB 4AQZA 1P4LA 2XKUA 1JPFB 1TOXA 2O30A 4D8PB 4Z7OE 1T1XA 4OZFB 1N5YH 5EU7C 3BKCH 2CR6A 1HJBA 1HYRC 4TM9A 1NSNL 5DFWH 2IBZG 1NQBA 2J2ZB 1CG9A 1KILA 2K9FB 1O0VA 2KI7B 1N18A 1USZA 3FQWA 3QUYD 1BCIA 1DSYA 1N5AA 4JGMA 4XNMA 4C56B 4BEIA 3J27A 4D0DA 3FQRA 2J3SA 1SQBJ 4O58H 4Z7NF 2FT6A 1LP9A 1ZT7B 3EWKA 2XZCH 2GI7A 4Y9GA 3LPGA 3HAEB 2FFDA 2ZICA 4WW1B 4HUUA 4AV0A 2H26A 3G9VA 4H2CA 3DI3B 2F6AA 5F97E 5CILL 4JUSA 2G4GA 4G8AC 1NAMA 2Y72A 4KTEH 4AYBA 4L29B 3T2LA 4BKSC 5I1JH 3OKEB 1U93A 2WSCH 4HJEA 5DJYA 3BKJH 4O9BA 4BQ6A 5F7UA 3LIZH 5T1LD 2CLVA 2A6IB 3HNSL 1EAOA 4OCXL 5AL0A 1QLEB 4GRLB 1M42A 1YEKH 2FNBA 4ZNEA 3L74J 4PJGA 5HYJA 1KWKA 2N0KA 1INDL 1IZJA 3BAWA 3QIUA 4CSTA 2E6JA 5I8EA 1G6RA 5T3ZH 2FL5B 1RZ7H 3QNZB 4NKDB 2E74B 2P58A 1G7HB 5T1MA 4ZX3A 4ZAKA 2DYRB 2ODHA 1LEIA 2BOCA 3DK0A 3GMOA 1EJOL 1C08A 2OTLP 4D2NA 5EEYA 2G3AA 2BNQE 2HRHA 2ZZUT 2O61B 2VT0A 2G5RA 1CD0A 8PAZA 3VJ6A 2I9LA 1SS1A 1MFZA 1JV2A 2A9BA 1PZSA 5DJ0A 5JPMA 4R2GB 2XXGA 4RMVA 2X2UA 2MCG1 4LT7A 2CBQA 4Y89A 4IHOB 3MODH 4S1DC 1OARL 4UT6A 1PZQA 1B4LA 3SN6N 2XDHA 3JTSA 3OPZL 1A4BA 4PJ7F 3KGUA 4FHBD 2A9NH 4NERA 1KTDB 2VQ1A 2GITA 2E9BA 3TV3L 2V9RA 3FUFA 1A7QL 4G8EA 4TSCL 2YMYA 4P5MA 4Z8FH 3H4HA 3FT2A 1G9NC 4N8CH 3TFBA 1SOKA 5FR3A 1OMIA 3IF4A 2CGRL 3Q1SH 3SPGA 1WD8A 4FMFA 3TN0C 4OZHB 2N1KA 4Z7NB 5I30H 2EDFA 2VLJE 1NTZJ 3MNZA 4UTCA 1TNNA 4QNPE 1NH6A 1RURL 3HZVB 1LXMA 3RPIB 2YPLD 1GGIL 3BUYA 5IM7B 1BDDA 3TX4A 3KYOB 5FYKL 1G1IA 4N90D 3NTNA 1T7YA 3E2HC 4P4KC 3DX1A 5EU6A 2A9CA 3RWJB 2DLGA 4PJGF 2HRGA 4LSDA 4YDIH 4I48A 2BZCA 1R5VA 4NO0D 5KVEL 4PLNC 3U4BH 3MBWA 2EH7H 1TTGA 1DHKA 2D3JA 3UAEA 1T6BX 2IV8A 4LLQA 3TEXA 2VZ1A 3EFGA 4G43A 3UO8B 2WWOA 4GBXB 1LTSC 1XGTA 1TMCB 1SUHA 3B9EA 1IFRA 1GZPB 1FF5A 3D0VB 1NCNA 1VQNP 4EI5D 3LKSB 4FNPA 1E65A 4MJJA 1WLHA 1DUZB 1LWRA 1YJDC 2XWJA 4K23L 5KTEH 1QTSA 2WYIA 2I07B 5EO1B 1AVOA 2OTUB 1U6AH 3BIBX 2EE2A 2O5ZH 1TO4A 1NOHA 3A5TA 4MB3A 3OAZH 5EU3A 1EHKB 1KJ2B 4YGVA 5AAMA 4DZ8B 3TEZA 3GMNA 1ZE3C 1IGYB 1QI5A 2I1JA 1W0VA 4OJEH 3MRMA 3KYNB 3VFWA 1BBJB 2OSLA 3GIZH 3SGEH 5FECA 1O6SA 5EZOH 2HB0A 2ZF8A 4BZ2A 4PJ5A 2NY5H 4G6ML 4QXUH 3PIQA 2X88A 1RPUA 2PXYD 1T2QH 2ADJA 2AV1B 3POHA 3ULVC 4F2EA 3RNKA 3H1KG 5I17A 3OR7A 3UC0H 4OQ1A 4WUKL 1X44A 2J8OA 2QMKA 3AUVA 2E74C 5MENA 3RA7L 2JIXB 4WB4A 2IWGA 2UWEE 4XC3H 1GYWA 3U1QA 3WHXA 3NFNA 1ODUA 3KHQA 1VQPP 2BSTB 3MRKB 4U0QB 3Q1MA 4D6TJ 1J8HE 3C60C 1AIFA 2WGNB 2YD6A 1FZMB 1RY7B 4JO8A 4WWIA 4WY4A 2X4OA 2XZCL 4ODXA 5TTRA 1XCXA 5T1KD 3CVHH 2KDGA 4H0IA 4ZQKB 2FJSA 5HGDB 3A0HH 4KI5C 4KRMB 2IGLA 4FZ8H 1I8IA 2FD6H 1MEXH 3EJYD 4H0LC 1D6VL 1ZCRA 1E6JH 2NW2B 4N6JA 4P9MH 2ZAIA 5LXGL 1EANA 4HJGA 3U36B 1H6TA 4QXWA 5CBOA 2JKWA 3KBHE 2VDRB 5CZKA 1T7ZA 3ZYOA 2J1ZA 4IU3B 2XKMA 3WUUA 1H88A 1U8NA 3V2AR 3VFOA 1UD8A 1DANT 2DLHA 4XP9L 5DJZB 3U36A 3CLEH 3BSHA 5DWUH 2XA8L 1Z3GL 2Q5UA 3VGDA 1P5VA 3CWBD 5DD6B 2XKNB 1I8IB 3KEDA 1SQXJ 2YD5A 3VSVA 4GG6F 1J0HA 5ICYA 2P44B 4NHUA 4HOMA 1LO0L 1NTKE 4YNYB 4RKUJ 5F0LB 1FZMA 5L2KD 3B4NA 4KC3B 2JXMA 4NQCE 5HPMA 4KK5C 5EBLA 1GJUA 1QRKA 4XNQA 4ZFZB 3D3VD 3NT0A 4PB9L 3RUGB 1XF2A 2DH2A 1XGQB 4KI5E 5HI5D 4XC1H 1OW0A 3ASNB 3HHRB 1M57D 5CLWA 2Z0BA 2Z1KA 2WXKA 4MWFB 2GSIA 2A9ML 3RNKB 1SF5A 2AJ3A 4N1EA 1TETL 3IT8D 2DBLH 4HFWA 1GGCH 2VRKA 2RAMA 3GMRB 4XVJL 1KQLA 2IFNA 2IH3B 2IXQB 3V4UL 3MRMB 4LKXB 4MS8C 2BCCE 3CWBJ 4CC4C 3BSZL 2X4QA 3GMNB 3K6NA 4E5XB 1KJ2A 1Y1UA 3CFCH 3QZLA 5JHMA 2VR4A 1FZAA 4JREC 12E8H 1SRDA 2IANE 2QJPC 1LD9B 2YD2A 2WINA 4S2SB 1KUMA 2NY1C 5APSA 3PGDB 4A63A 3C6EA 1IM9B 1B0RB 4HZLA 4LVOB 4NC0B 4XN2A 3H0TA 5E00B 5BRPA 4KK9D 1DBML 1QHPA 4WCYL 3LKSA 3D07A 1TZGH 4YSOA 1FZCA 2GIMA 1RURH 1FDOA 4J3TA 4AV5A 4ODVH 4GBXA 1MREL 1VADA 4HCRA 2YQGA 2CAKA 4WGVB 1MJJA 4P04A 5T3ZL 3O6LH 3ZTJH 5I1DA 2WSEH 4GW1A 4YAQB 3CMGA 3ZDXE 3L7FB 5FKPB 1EDHA 2DMCA 3IFNH 3MBWB 4Z3HA 1FHNA 2AC0A 1TG8A 4N4YB 3RGVC 1AZZC 1DQKA 3CD6P 4C4KO 1N7SD 4PRAB 3WG7B 2CMRL 5FGBC 3TLRA 4X4ME 2HJFA 4Y2NA 5KVFE 4ZAKD 2CLRA 4IL6E 1KTJA 2P8LB 3V79C 4PJAB 4CW1A 4U7MA 1AQMA 4HGMA 1O9ZA 3T3PB 2NNRA 3IDMA 4NSKA 5AEAA 4EN3C 4XP9H 5BUAA 1BZ7B 2A6JB 1XSOA 2ZWKA 3QJFA 3PABA 2FQGA 2FQFA 3D39D 4UOW1 3FQYA 4ZYKA 2AJVH 5DWPA 3KDPB 1ETJA 5KS9E 3V9EA 3F84A 3H54A 1GL2A 2GITB 4IKJA 1KTDA 2VQ1B 2DD8H 2YOCA 1Q90D 2PPCA 4MKMA 3JV5A 4KDTC 1Z0NA 2C9XA 4JFDB 4N2IA 5GS2D 1CICD 4CU7A 4Y2DC 2EIDA 2YRZA 2W0LA 4HJSA 5C0CA 4GXVL 5JPMB 3H9SA 2YN3A 4OFYA 1GRWA 4GKLA 4XXDB 3VB9A 2N9BA 1A4JB 1BZ9A 5DLMH 2OLDA 5AAWC 2YRLA 3V2QA 1YNLL 1IFJA 3BPOC 5LNGA 4YDIL 1GTFA 1EUUA 4HUVA 3PDGA 1CR9H 4GFXA 1JVKA 3TXAA 1XMWA 1LEIB 5C39A 4IS6B 3FJTA 4MA7L 5JHDB 3M7FB 3BCDA 4MD0B 2H3KA 3UTTE 1WS7A 3RGVA 3A6BH 5F89B 5I23A 5IEKB 3WN5A 1T20B 3FHEA 1IAKA 1E9OB 5DQDL 1G6RB 3F7PC 5L7XL 3QULB 5FFGA 4U1SA 3RFRA 4WVZA 2BOBA 4N20A 1MHEB 4HCRH 3HS9A 1MLCA 1ED3B 5DRXB 3PE9A 5GGVY 5G55A 3FCTA 5TE6L 1PFIA 1D6VH 2OQQA 1J1EC 1IGCL 2BZ7A 2VN4A 4LIQL 3DMMC 4LLYB 2KNCA 4MB1A 3E38A 3R0NA 4OFDA 4PEEA 4E42B 1KELL 3QIWC 2E7HA 1X5LA 2VR9A 2XIDA 1I8KA 1W72H 4HUUB 4QYAA 3GI8H 4CC4A 1U8CB 2CK3H 3SE4C 1DR9A 4WTZA 2NY3D 1Z9NA 1IVLA 1UACL 3ETSA 1LVEA 5CUSL 3LB6C 1GXEA 5HDOA 4YO0A 1UT9A 1J5DA 4KJPD 3BPNB 3OB0H 4QJ5B 3FRPA 1SLVA 2DQJL 4U3SA 2C9VA 5J89A 1R0AL 3CVBA 5C86A 4KHXH 5I8OL 2FZ3B 4IU2B 1Q2NA 2VLLA 1RLWA 3DX6A 4A2DA 5L4IA 4O5LH 2F54A 4PI0A 1XSIA 4JJOA 2D9QB 1IAOA 1BBDL 2QPFA 4JFHD 1KN4L 1EC5A 3AXLB 4MMZB 4PRPB 1NL0H 3IETB 1N7MH 1S72P 4YHZL 2C0XA 1Q38A 3DHJA 1ZVSB 1CYWA 4PLKC 5FWRA 3S5LA 5HJ3A 5F96H 3VFVB 1AACA 5B7EA 1UQSB 3BH4A 1RUKH 5D1QD 3UG3A 5DYOA 2YPLE 2YSSB 3L5HA 1KYDA 2PCPB 1IC7L 4EOWH 3IFOA 1IAIL 3TJEL 3O6FD 3KHOA 4OZ4B 5GGVL 2JSFA 4AL8C 3ARGA 2IX7C 4L3AA 2HLAB 1OP4A 1R46A 4F8PA 5I75C 3BT2L 3KW7A 1F18A 4BYHA 2ED7A 5HI4C 3WJJA 4Y2DB 2ZAEB 1DO5A 4ORZC 1PIXA 1GZLA 1UUNA 2YBRB 5JW3H 5JZ7C 2P45B 5M1BA 3ZUNC 2NUPB 2FK9A 1NJIQ 1AGFA 1OVVA 3UERA 4R96B 1PPJD 2VZOA 5HYSG 3FUHA 4ASVA 5KYXB 2UYLA 3KPSD 4YVUA 3MREA 2DWXA 3ZE1F 4JJ5A 4JFSA 1RF0A 2Z34A 3HE6C 4MAYD 4WI3A 3UTSE 2HODB 2BZDA 2X9WA 2XQYG 3LDBB 3RWIA 2OCFD 5A2JH 3VD4A 5C07A 1QBML 5KTBA 4N3UA 1EFXD 3BAJA 3LS5L 4OJYA 3A6CL 3X13B 4AENA 1TTBA 2BIMA 1N70A 3KGTA 3J8F7 4HEME 4PJIB 5IVZB 2VDPH 2ITEA 3ZT5A 5DZVA 1OGTB 3OKNB 4GP5B 1XXDC 3G5ZB 2OYIC 3S35X 5KVDH 4PP2B 2L91A 1NDMB 3RWEA 3CFCL 3SFDC 4K5LA 3TBBA 2CRZA 4HAKA 3K1DA 1PX3A 1J8HA 4OTXH 1COBA 2EP6A 4OZHF 5CD5D 4E0RB 4JO2L 2JWAA 2DQIL 5GGRB 5J5EA 1KLUA 3GJEA 4NZFA 2CBTA 5FYLE 3MACL 3S36X 4DPBX 1FWXA 4HOZA 2EVGA 1FO0H 3ZQWA 3NIGE 2Q7AA 5L6YH 4BFNA 4DUXA 3WU2H 3OAUL 5FHBL 1NBYA 3AG3B 1P6AB 1MY7A 2CKBH 5EZIH 3K5BA 4PJDA 4KROC 4BH7B 4OKDA 5GRJL 3V6FB 3D8MA 3SE8L 5FKAA 3T4AA 5AD0A 1MCSA 4RISH 3HMXH 5MP6L 5E2UH 4AYDC 4Y16C 2VIRA 1KBVA 4P2YA 4ZUUA 3WENA 5EEZA 3AUWB 3FSZA 4I3RH 5CN1A 4Z77A 3TBSA 3TZVC 1Q72L 4MLSA 1G0DA 2VDRL 1OM3L 2F5BH 2BC4B 2OQJB 2LHAA 4MX7B 1IC7H 1PQZB 3K6DA 5E8PA 2F08A 5F21B 5HHPA 2HA1A 1NKOA 2GUOB 2OR8A 4G9FE 1U57A 4KTYA 2BCCJ 1NU1E 3CWBE 4TRPH 3D69A 2AV7B 2WBXA 4QWWD 1IE4A 1OP9A 4FG4A 1CXHA 1SEBB 1BQRA 5L2KE 4F24A 1UD3A 1T22B 1DVFB 2JP3A 4W80A 2BVEA 1F8TL 3EFFB 5I0VA 1H89A 3O3DA 3UG5A 1FGVL 2AEWA 3I2CH 3OV6A 4PRIE 1ZHKA 3HS0A 4OF3A 3HB3C 1UASA 4N1HB 3DXAD 3ZKMD 1MCCA 4V1DE 2FQDA 2WITA 2OMUA 3O41B 4M7LT 1MCOH 2QADD 3SGKC 2BCKB 1JPSL 4X0NA 1PIFA 1BE3J 3VWKA 1TJHH 1X0TA 3IJ7A 4IRZH 4LO9A 4BCZA 3V6IA 3FB7A 3LPOA 1DQQA 3T0DA 4OI7A 4EVNA 1L0NJ 1P2CB 3DRQB 1F00I 4EE2A 2XV5A 3PWPA 4KAQL 3MO1A 5J57B 3M1BB 1OSEA 1M57B 1DCLA 3MV9E 4XPFL 1QOKA 4K5NA 4NI6A 1CZQA 1T7VA 2WN3A 2W07A 5EUOA 2ETWA 3MX0B 4WU5A 5KVMC 4PJBF 3UZQA 2ZG2A 3ZHNA 4F1ZA 2XSKA 3M8OH 3UBHA 2AJYL 3QPQD 4Z7VE 1F3DJ 2V8LA 3ILQC 3BW9B 2MQCA 1FL5B 1WIOA 1IT9L 1YNKL 3PL6A 1URQC 2YGVA 2GUSA 1M7DA 3AG4B 3MFFB 2IDTA 4X5PA 1BGXL 4LEXL 3NJGA 2VERA 3BUIA 4M4RA 4MN4C 3BMWA 3I74A 4LRNH 3HC3H 5I73C 4C47A 1E6OL 4M9PA 4PWJA 1AR1D 1K4DA 3OQ3B 4HIIA 4XVUC 4I0PA 3ZKND 2QJKB 5KOVC 1EHLH 3GS4A 3RUGF 4NQDB 3JVGA 4RA3A 1OB1B 5GISL 1CT8B 4DGYL 4U1IB 1MW0A 1AOZA 3T08A 5IBLD 4AEHH 1KILC 2QJDA 2VW4A 1TEGA 2R0ZH 2DOCA 4DP6X 2I60H 2QQLH 5BZXA 5IHZA 5FK9B 1ZK9A 2VXQH 1N7SB 2YD3A 1E67A 5C9JA 4CN6A 4WTQA 2XFXA 3PL6C 3DO7A 3DX8B 4NKMA 1UUSA 2JMRA 2W80C 3BGFC 3BVXA 4X7FC 4PMEA 3VI4B 1IEHA 1WFOA 2EADA 3AS1A 4LSQH 2FSEB 1KBBA 2OXHA 2ZXGA 2BSSA 2WTPA 4PGCB 4XMXA 2OI9B 4X83A 2AQRA 3IMVA 2JKVA 2YFOA 3BKYH 2MIZA 4KZDL 1KCSH 1SJHA 2OYOA 1FNHA 1ND0B 1NTKG 4LVNC 4LEBA 3LW5J 1ZT4A 4KRPC 4EDXA 4JM2A 4N3TA 2FT8A 3CC4P 4P48A 4PJ0E 4QRRE 4UNIA 3RY5A 5AKVA 2JELH 3MNDA 3QA3B 3FTWA 4FQQA 1JMBA 1D6EB 4BXSV 5IW3A 3W38A 25C8L 3CVHL 1V3LA 4NAMA 4HKJA 4UQ2B 3QK0A 3GBNL 3F65A 3O9WC 1HQRA 5CS7A 3SE8H 2VDMH 4B86A 2VZSA 1HVVA 3ATEA 4K5PA 5E7FA 3UBXB 3V4VB 3FB6B 4YHLL 5LDSA 4PJ9D 2BVPB 1MF2H 1NFAA 3EJCA 4I2XA 5LBSL 3RE0A 5DHYB 2J57A 3IDUA 2NSMA 3ABMB 5DZOA 3ZTCC 1TJGL 4UQ3A 2YC1B 2C9AA 3NCWA 4I3SH 2FO8A 3VA6A 43C9B 5C0FA 1A9VA 3MI6A 5IKCA 3OB0K 4I7ZC 3MRIB 2WLHA 5FB8B 4S0TD 4NJ9H 4LC1A 3LQAL 4NBYB 5ICUA 4L5FE 4LRNL 2C9QA 3DETC 1I1AB 3U0WH 2Z35B 3LZNA 2EEFA 3OJ2C 3VUAA 2YIUB 2BFGA 5JW4Q 3M1CA 1ZHNB 2H3NA 2V9TA 5D2LA 2ARJB 4NQDE 4WO0A 1DQLH 3VMPA 2Y1AA 1JK9A 5C0BA 4FFYA 2F54D 4XC1L 5K1VA 2Q87A 2QTEA 5E4OA 1MFDL 2ICWB 2W0FA 2XICA 5KJ7E 3TBTA 4ELMA 4DK3A 2H6PB 3L2MA 1XVSA 5E79E 3II2A 3ZT6A 5DK0B 5FYLH 1AKJD 3KYKH 1Z0MA 2WBJC 2Y1VA 3BWAB 4C59B 2FECL 1PP9D 2ZYGA 4AKQA 4PW9A 2DWYA 3B9AA 1LTAC 3LKOA 1ZTXH 1JXFA 1A7PH 2NDFA 2VRQA 1AH1A 3ZL4L 1X5AA 1R5IA 1Z3RA 4Q89A 3WUWA 2HFGL 3TVMA 1I7RB 4HUWA 5D1QE 3TBTB 4IKIA 3SGEI 3KPMA 4P5TA 4OCNC 1ECYA 5LO7A 4YBLB 1MCHA 3CU7A 3ME0B 3MZGB 5BJTA 5K9QI 1U3JA 3NSFA 1F02I 2LR4A 3FSWA 4LSRH 5LCVA 4PRPD 4Z95H 4R9HA 3MMEA 1FLTX 3OKMA 4QCIA 5HGGS 4G42B 4H13C 1SOXA 3MRLA 2Z35A 4J7RA 2QQNH 1L4AA 1IGFL 5AW3B 5H2BA 5AB1A 5LGJB 1Z1WA 1HCYA 4F15B 4UOJA 3US1A 4ZO7A 4WWOA 5EORL 4W9IC 3QCTH 1AMYA 4R4NC 1NDGB 3IKKA 5GGQL 2FRGP 4FI8A 3D30A 5AYTA 2QVTA 1HHKB 3A3YB 2V4HA 5TDNB 2BIIA 3L35A 3HZMA 4PRNB 4ZPVA 1BE3D 4APQD 3GSVB 3CFKB 1QD0A 3L13A 1SXNA 4KJYB 5E9AA 1KULA 4IBQA 2V7QH 4MYPA 3KPEA 3FB6A 3UZVA 5CFHA 1GY2A 3ZR6A 3KS0J 3NAAL 1SHXA 1HQRB 5C2BH 4H88H 2BIQA 4M5ZL 3ZE1E 2F2HA 4JG0L 1E4WH 5INDA 4ZKPA 2MJWA 5JMRA 3GTVA 1UTDA 3DJZA 3IXTA 3KLLA 1HQ4B 1E5ZA 2B16A 4HIXL 2E4FA 4J3OD 4HLEA 5K1NA 4AGLA 2XZRA 4PR5A 5JDSA 3G5XB 5ITFA 3DA0A 3ARDD 3ZE2B 1ZT4B 4OGXH 5I16A 1SXCA 3VSQA 1EFXB 1M2VB 1GYAA 4YXHH 3HN5A 4FAAB 1U8PB 1DP0A 1K3ZA 4RNRA 2IMNA 1KGXA 4TLUA 3QUMH 4KX9A 4K35A 4MNQA 4LBAA 4A7SA 5FW6A 1HINH 4MBOA 1BVKA 5SX4I 5G4NA 5LQBH 2RHEA 3CJJA 4WNSA 2GUYA 5BZWA 1CFVH 3N42B 3KXDA 1BFVH 3NIFE 3VG0H 2Q2LA 4A67A 1IQWH 2EEBA 4TSBH 3D9AH 4KMTL 3WIHA 1P4IH 2N4IA 2E7LC 3V4QA 1R24A 3QJVB 1R9FA 1ES0A 4PJFE 4N2MA 3N0AA 4AUJA 1ZD6A 1N59A 1P4BH 5EU6E 1YPZB 1JVOA 3L1EA 4G6KH 4JLRB 1E27B 5TF0A 4HH2A 4WWNA 5E99L 5JHAA 3D05A 4M7KL 1L0LK 1W80A 4HEPA 4LSTH 4H1LA 2E27H 2PN5A 3H9HB 1A1OA 1AC0A 1PJ9A 3GXUB 1IU1A 1KC5H 5FAAA 4TMPA 4A39A 3RKDD 3QDGB 1KB9I 4UB8H 4UYPA 3C5ZB 2LXCB 5BUPA 2LU5A 4LLHA 3UJTL 3C08H 4XPBH 3QWRA 1HKFA 4ZO9A 1FVEB 3BDYH 3ARUA 3HD7C 1ZS8A 4JRYE 3KYMB 5ILTL 4NN5C 3GI8L 5MEOA 4GUPA 2EUWA 1UWXK 3DVIA 3QPXH 1A64A 2VN7A 4K23H 4AEIH 4EDWL 3IJ8A 2ZOLB 5EFIB 2B4CH 3CN3A 3T2QA 1JCKA 4V1DD 3L3OB 3G6DL 4YQXH 3S8GB 2NY6C 1KZQA 3BGMA 1FYTD 1ZOXA 3LRHA 2VDNH 3BJLA 3KBPA 1MH5B 4M4PA 1GGBH 2AJSH 3ECBA 3OAKA 3PHOA 4P23B 2V9QA 3PWPB 4JPZB 3QIBD 5KSBA 2PMZA 1JDAA 2EILB 1DQQB 2YEQA 2Q8AH 1VZGA 1CI6A 2QGEA 2V3EA 3MRHB 5FUCE 2IEPA 3WYRA 2O6DA 3NUKA 4X6DE 4NO5A 4P2AA 1N86A 5G5DB 3BJ91 2BCKA 3QFDB 4FA8A 1AS8A 4R2GC 4ERSH 3B9VA 5I30L 4JL1A 3P3SA 4Y4KC 3QUKA 1T3FA 3UP6A 3VXUB 3L3GB 4FKHA 3HS0B 3OAUH 1TJGH 2M8XA 3VH8A 3GSNB 3HFFA 4BFOA 1TZIA 1ZS2A 2P24A 5F6HI 2DPKA 1ZA6A 2W65B 1WS8A 3QBTB 4M62H 1J1PL 3F7YB 1BFVL 4IDJH 4NO0B 4W9HC 4F33A 1IM3A 1BZEA 1ROWA 4PRDA 5FGCB 1SEBA 4QOKE 1E6JL 3DYMA 3QHTC 4AIXA 5EN3A 3TH3T 3IEAA 5DMIL 2DV6A 2YKKA 1KIPB 1DQML 3S6CA 2PW1A 5KZCB 5MEPA 5I1CH 3LH8A 3T0EE 3M91A 1OAKL 4KV5E 2D0HA 1X4ZA 3EYOB 4WGKA 2NW3B 1PQZA 2C1OA 1PZCA 3C9NA 1QHOA 2G3XA 4R4BA 4RGOH 1UOLA 3X14B 4B9YA 4OUUA 3VWJC 3ZDYE 1QLFA 3PLNA 1QBMH 3RZCA 3H32A 4R2GD 1MAML 3HC4H 5AD0B 3MU3A 4XNUH 3T4AB 4HAFA 5C2BL 1T6VN 3N43F 3QJUB 3PP3H 4TUUA 4MMYB 4ANUA 4QRQB 1MG2C 4PJDB 3CFDA 5FV2A 1H8AA 4KKAC 4HJGH 3ARRA 3KZIH 3IPBA 4UANA 2VERN 2WYHA 1JCCA 1SFCA 3QEQA 1KLUB 3GJEB 4I0PD 3FYEB 2VTFA 3D6YA 1CE6B 3DRTB 3Q5PA 4E68A 4QGTA 4PGBB 2CPUA 1HT6A 4TOYL 4BINA 4NENB 2UWEB 4G7SB 2WXGA 4AT6B 5F7YC 4I1PA 3CG8A 1MDAA 2GJ6B 4OJCA 1ZLLA 4GMSL 1FH5H 3QFJD 1GCFA 4O2CA 3D1MC 1FJKA 3CZSA 1D7BA 3FCSA 1KCVL 2DQGH 4K0OA 4KGJA 1Y7VA 1YEDB 3OXSA 2XTJC 3T8MA 4Z0BH 1T89C 3X13A 7FABH 3VMZA 1BAFH 5D1XC 1DBAL 4XBGB 3HG1E 1F56A 4X7CC 2C3XA 2P7JA 4JQXA 2NUTA 3HE7B 2DWEB 2CO7A 4TULH 1FIEA 5ID0B 4PHXA 3JQOB 1A9EA 5AWNH 1JHKH 1KCWA 4DWHA 5KYXA 2K45A 1ORSA 5GSVA 5CMAA 2VDMB 1AG6A 4AWJC 3ARFD 3QDME 4G7QB 4DVBA 3DTDA 3HI1B 5I1EL 4RBPH 4L1LA 3R2PA 3ZTDC 3JCUE 2AGJL 5E6UB 4Z3EA 1RAMA 3D4ZA 5FO7B 4F7TA 5IVXB 4PVLA 3TS8A 1TU2B 5IV2B 1KEMH 2HLAA 3HZ3A 5IT2L 4DN3H 4GQZA 5CCGA 5GRVL 3FDWA 5B39A 3RVWC 5ESAB 2Y4SA 3AE6C 3D3VB 4K9EC 1WT5C 4CMMA 4R7NA 4DT2A 2JKSA 2KIKA 3C8KA 2PCPA 3PRJA 5KJ7A 2ZNXA 1I1AC 3F5WA 3T77B 1ET7A 4ZG1A 1FFOB 3ARSA 2JVUA 2X89A 4Z7UA 4R4MA 1E3XA 4WO4A 15C8L 1DEBA 5LQBL 3QEGL 1YBKA 2WSKA 1MHHA 1DDTA 3C87A 3JWOC 4JW3A 1PP9E 2CHXA 4FQCH 3MIWA 3GGWA 1WCBB 5B7MA 3IE9A 5CFAA 1EZVI 2VNCA 4W9KC 1KPUB 1CDHA 4PUBH 5GS3A 1GTNA 2GM4A 2CO6A 5DHMC 3Q9PA 5HI3C 3I9GH 1SQMA 3AEAC 2XLLA 3RK3E 4N0UA 3KPQA 4U3SB 3QRFM 1RU9H 4NC1E 2P48B 4RQQB 2VLKD 3VXTA 1JNJA 3NCBB 2YQBA 2R59A 1S7RA 3PNWA 5AUMA 3LKRB 4L4TE 5DJCA 3EYQD 2CUIA 2R51A 4OQTA 3ROLA 4JAMA 3I6SA 3QDMA 4B96A 5DQDH 4G70B 4ZUSA 4DFHA 2XU6A 4FMVA 4LAQH 3QO0B 1VQ9P 3VGAB 1SEQH 1SJMA 3LW5H 3ECWA 4DTGL 2XXMB 4XCYB 3BPCA 1MQKL 3L7EB 1G7LA 4JPKL 2R5DA 2C9SA 4WHDA 5DZ9A 3RI5F 3D25B 2R1XB 3GSUA 3OLDA 4Q9RL 5JUEH 2X1PA 2NXZB 3CX2A 4H13D 4GQPH 1RZPA 1ED3A 5DRXA 1FIGH 4JG9A 2JJTA 2JQMA 3OMIB 2ZCHH 3KXFE 3UX9B 4HKXA 3QQDB 4ZW3A 1CGVA 1IAKB 1JZFA 1T20A 1UOVA 3MP7B 4D6TG 2E56A 2YRBA 4FLOA 3GXIA 4XPGH 4AW7A 5C8JB 2YKPA 4NNPH 3ML9A 4QIRA 3S37X 1IFMA 4M00A 4MXVF 2DLFH 4NPKA 5ESVB 3VFNA 1J9CT 3DVGA 3V4VL 1OAXH 3S3SA 4K7PX 5T3XL 5I76A 1VACB 1XZWA 2WWMD 5GJSL 4X8JB 4NPYB 5DI8A 3V2NA 5D7LD 1V54B 4NQEA 2FCBA 1FZEA 1XIWB 2PYFA 4PN6A 3P9LA 1GJWA 3O6MH 4JFDA 4XCFH 2ZOKB 4FXKC 3MXVH 2CKNA 3AQYA 5EUKB 4OF5A 5DEFB 1Q4NX 3ZE2E 1EHAA 4KK6C 2LTQC 5C92A 1T2JA 2E42A 1GL2B 4QOKB 4D9QE 2Z31D 1G7MB 3INUH 3IU4L 1QVOA 5KBLA 3L3HB 2O6EA 4LL4A 1HKLH 1U36A 1FC2D 3SQBB 5ADPL 3P3TA 1LHZA 3LN4A 1G7QB 2XJKA 1OAQL 2VDQB 4GQQA 1YQ3C 1QWNA 2AXWA 3TGUE 3NGBB 4U3XA 4XB7A 5E6IA 1IBZA 4AQOA 3CN2A 5D2NC 1SQVD 1QG3A 4Y28J 4XAKD 2FECI 3ARZA 4HHAB 3PHAA 4WVRA 3GMLB 5AOKA 3F12A 1CGSH 2WCSA 3C6LD 1OEZW 2Z93A 3M1OA 2IGTA 2OKMA 1HEZA 3BH8A 4AXWA 3D0AA 1ZE3H 3PWPE 2FATL 3SODB 2OMWA 4XX1E 1BQHG 2GW5A 2VM3A 1NZRA 4WFGE 1DX7A 1L7TH 1ZXGA 1OGSA 5A2IH 2BEQD 4FJZA 4QHLA 5CGYD 4UTAL 3S37H 4K5MA 1VCBC 1NJ9B 5GZOA 3QORA 4NRYA 3O2WH 2WINB 4Z18A 2OYHA 5IROA 4FTVA 4JG0H 2HLFC 2A9AA 2X6AA 2VDNB 4OJFH 4M6NL 1NHLA 2VSKB 2F53A 3QXDB 4PRBB 1SXSA 1MFUA 3POCA 3M6DA 5K9JL 4JBZA 1EGJA 1KT2A 4GFTB 5FGSA 5KJRL 3MGOB 1R3LB 3RK2C 4NZTL 1NTKJ 1LGVA 1NTMD 2KLSA 2IH3A 3GMRA 3OJAB 4XI5D 3EFOA 1OE1A 1RMFH 3TFKC 1RJZA 2R9HD 3ARBD 3RWFA 4UM9B 4MKTA 3OW2O 4U05A 1PPJG 5BXFB 1RXLA 3UABA 5KSVB 2V9UA 1U21A 4NBXB 2J8UE 3BN3B 4KTDH 3RDTC 4XAWL 4P2RD 1CUOA 4FFVD 1CD9B 4L4JA 2FO4B 3O6FB 2H2SC 1XH3A 1MW1A 4HJ0D 4XNQB 2DQDL 4X5LA 3K72B 2M0BA 1T66C 3JTBA 3LQAC 2WLZA 2YEVB 3WLBA 4QOKA 2FD6L 4L23A 4F7MB 5CZVL 2APTA 1H3GA 4YNYA 5EUKA 3CC5A 1G7PB 3RBGA 3LV3B 3T0BA 5JW3L 3L2NA 4JPVH 2DDQH 1S6NA 2ZVNB 3S0PA 3MA9L 4P3DA 4DP9X 2HRLA 4LSTL 3ZUCA 3VFOB 1U8NB 1A6WH 1EX0A 2OMTB 2X42A 1OAZL 4G7RB 2Y3NA 3BVTA 5INCA 3PLYA 4NPYA 3LXAA 1U41A 1VACA 4FQXD 3FFCA 4FFZH 5ESVA 3VFNB 4QRPB 2AS5M 1T4WA 4FTVE 1AXTL 3CTTA 3NPZB 4NM8H 1ZLSL 4N87A 1P84J 2KMWA 5CJ0A 3D7PA 4LEOA 5T3XD 3WS6A 4A7GF 2BSED 5L9DL 3U46B 1PGQA 4ODXB 4YK4B 3KL3A 2ESVE 5TQ2L 2BSTA 3HG2A 4PS4L 3JV6B 1HOEA 2R69L 3P77A 4MA3B 1IQDB 4WTWA 3C8VA 5F44A 5ADOH 1KN7A 1OIPA 1LO3H 4HXAH 4F7EA 1SPDA 1LTIC 3HE6B 4BZ1A 2LVEA 1INQB 2Z8VC 5HGHB 1HGVA 3LRKA 3V6BR 4KX7A 1Y1DA 4U31A 3GD1C 4PJXA 2XV6B 3X11A 4OQTH 5APYA 1MHCA 2VMDA 4L8CA 3QO0A 4PJ5B 1ZN5A 2UZXB 4Y4KA 5CZXD 5CIPH 3L70D 2DKMA 4G5ZL 4Q6IC 4UOW0 1CZ8H 4JAMB 4OBRA 2XBZA 4LGPB 3U6XS 4AZ8B 1CK0H 5DJCB 5C97A 1CSBA 4XB3A 4IDLA 3EAKA 1A3LH 4G3YL 4ZS6C 5EU3B 3SDCD 2QVIA 3G5YA 3L3JB 3LEYH 3TNUB 3MVSA 1QI4A 2VO8A 1K5NA 3QCVL 3QJOA 2W88A 4QTHA 3OA7A 1NC2D 4WEBL 2XNAB 4OFIA 4QRUA 3ZTEA 4UQEA 1DUZA 4Y19B 2EZ0D 1LK2B 1KQGB 3O6LL 2HTKC 4X80L 1PZ5B 3LKPB 5HYIA 4WU7B 3ZL1A 3SKNA 3QW9A 2BP0B 2R2BA 5JYLA 1QHQA 4L4VA 1SBSL 3BQUB 3NYKA 4AMWA 4ESKA 2BM3A 4JO4H 3LRSA 1BYOA 4Y5YB 4A68A 1OOAA 2P5ED 1N68A 1ZHLB 5J56B 4IIQC 4HEMA 4PJDF 1OGAB 5I1CL 3GJFB 3RWJA 4I4WB 1IFPA 4M8UA 5F9JB 1RIVL 1CCZA 4ELKB 1FAVA 4HMCA 3T77A 3WGVB 5IM7A 2VMFA 4FLSA 4M7ZC 1PG7L 1P6FA 5E1IA 4JFEE 4C57C 5DMKB 5E9NA 1NTMG 3D3VA 2AEJA 2XBDA 3GWJA 2VXQL 4XP1L 1ZLVK 3EBGA 4DOHB 4OZHA 2CCVA 4G59C 4WW2A 1NFIB 5KSUA 1JOIA 4FFVC 3TPUA 1I9JL 4NBZB 1DVFC 1IK9A 3IMTA 4WHYH 4WGWB 4CVZB 2J5LB 1HILA 3ULSA 3ZZ1A 4DVBB 4S1RH 1ZT1A 2VMEA 1WBYB 3CH1B 5FM5O 1ORSB 2AEFA 5GSVB 1KV7A 5TISE 1ZVNA 3FXIC 1XH0A 3V7MA 4P2QD 5BOJA 5HJDA 3I02A 3VRJA 1B90A 1A6AB 2FIKA 2NUTB 2I9LB 2Q3AA 3HI6L 4HQQL 3RK2D 5DJ0B 3FO2B 2RN0A 3TT3H 3KH4A 4UB8E 4NKOA 1R5LA 2QE7H 3UTZB 1DJXA 5DS8B 3QT2A 3RZCD 3TA3D 1MJUL 1HXMB 3VSTA 4XBEL 3LZPA 1P53A 4HWEL 5HHNA 4NQQA 1BAFL 4LPWA 5J06A 4WI2A 1V10A 3N2JA 1TCRA 1BG9A 2D2CC 4P57A 4YJZL 5KSBF 4L74A 3OGCA 5HI4D 3TGUJ 3SE9H 2Y7LA 7PCYA 5ALCH 5D72L 3O2WL 2A6IA 2BY3A 2ZJSL 3FUDA 4PGJA 1SVCP 1WWAX 3OLGA 5I18H 4BM7A 1EXIA 2Q9IA 1T04B 1S4IA 1URQB 1NAMB 4QRQA 4MMYA 3DXAB 1SMAA 1INDH 3H9YA 3IN2A 1K8AQ 1XO8A 1CE1H 4PWHA 4B41A 5KEZA 2BJML 5C0RH 2C3VA 1FC2C 2LE9A 4Y4HA 2GK0A 3EG9A 2J12B 4WI0B 4MVBD 3TEUA 4GY4A 3FO2A 4QUOA 4AQAA 2ZPKH 4BBWA 2NW3A 1N5AB 3X3FL 1FZKB 4D6TD 2D03H 4DKFL 4X6DA 4LCWE 3PF2A 4PJAF 3D4CA 1K9TA 2OP4H 1IKNA 2EE9A 3QJXA 1MFEL 5SX5H 5MI0C 1M7UA 2FBWC 4EIGB 3QIUD 4UILH 5LBGA 4L0PB 1MI5D 3AWEA 2RFXB 4NS0A 4OD3H 3IRCA 5L0QC 1MLBA 4NO0A 3QYMA 5A6MA 1BJ1J 3TPUB 3VDCA 4HLJA 3A6BL 3TTYA 1OGAE 1TENA 5KSUB 1LYQA 5B66E 1TZIB 2P24B 2F5AH 3EJQA 4JPVL 1OF0A 4RGND 2MSPA 2ZWLT 3L3GA 1BM3L 4EEEA 1G0YR 1XQ4A 1QSED 2EVJA 5SV4A 1PYWB 1OAZH 3IJEA 4AYGA 1KV3A 4P05A 4KZCA 3UMTA 2XYBA 3MV7D 3HNTH 4I4WA 3U1PA 4XT1C 4G6JL 3DMMD 2QV4A 1CI6B 1AC6A 1KOAA 3MRHA 1NLBH 4TYUA 4YFDB 3RIAF 2AQSA 2G75B 2ORBL 2EVFA 5AKTA 5E94B 1ZMEC 5AOZA 1M1JC 3BQUA 3LD8C 3HOGA 4AY0A 4BDVB 4POYA 4ICWA 1DIPA 4PJFF 2BP0A 4TSAL 3SDXF 4ADIA 2UUDH 1OB0A 4R4FL 2M83A 4XN4A 5FM4A 4ZOAA 3H1KD 1LO3L 3VMOA 2G2NA 2G3ZA 5F7MC 4NWUL 1UD2A 4KJWC 4MNHB 2YPKA 2HKHH 2ZUTA 1FG2A 2OR9H 5TE7H 2XTSA 1SQPE 5I9QC 5ENWB 3OKLA 3MV8D 2NR6A 4KXBA 3WEMA 3REWA 4QF1B 2V0AA 1GMEA 2ZYAA 3GXFA 4O5LL 3W0WE 1NMBL 3X3GL 4EI6B 3K2UH 2ZCKH 3UJJH 5LN4A 1T2QL 3QXAA 4D0BA 4IRSD 4PLJD 5TPWL 2EXWD 5I6MA 2ADFH 3DNKA 1BXUA 4JREB 4G3YH 1IJ9A 1N73A 1WCQA 2EIEA 3H1IJ 2EDTA 4KNQA 4P5RA 3C5SB 2ZYHA 4H1LB 2Y1YA 5DGQA 1DEEA 3A0OA 4UB6E 1QBAA 3SIKA 1U3NA 3ZQ9A 3G7TA 4DEUA 3PP3K 2VAAB 5ACMA 5DCCA 2PPDA 3B7YA 5EZIL 1KCBA 4F3FA 1LTTC 3KD4A 3H56A 1P1VA 1N8ZB 3GSQA 3P77B 2FB4H 3WFZA 5B22A 1OQOA 4FZ8L 3H1JG 3OKDA 4PV9B 3O11B 3KJ4C 4WNJA 5IGXL 1MFNA 2AXJA 4JPQA 1T5WA 4FQLL 5I15L 1DQJA 1H0DB 3PDOB 3HD7D 2O5YH 2XY2A 1FSKC 4R4LA 1E0OB 2H3XC 3VVWA 1QQDB 4XN7A 4UQDA 3RQ3A 4YDVB 3L16A 5CSBA 3V55A 2OMZB 2YMTA 3FFCB 2OX5B 5J3HC 1MZZA 5INCB 3EJZD 4U7KA 3Q2VA 5BS0E 3B8SA 3D39A 1DN0A 1KIUB 2OCCB 2R1WA 4M1GL 2R0LH 4ZX4A 5I2IB 4X9YA 1M6UA 2GSMB 4L3EE 1PIGA 4Z0XA 1M71B 3DOIA 2VR3A 5JDSB 1UZ8A 3SCMC 2CIIB 3GMMB 1G7PA 1JGVH 4YTPC 3CLWA 5JW5A 4MCZB 4QHMB 3L45A 5LJYH 3QWOB 2B3IA 4PD4E 4AKPA 3TONA 2RQEA 2UXTA 1VGEL 2OTKE 2EIBA 1RE4C 3ELQA 4BQ9A 2ICEB 3WFBL 5GS0C 4ZXBA 2CDFB 2NNXA 3L3KA 3O6FA 3KLHC 1RY3A 2K0RA 3DUSA 4KJYA 3Q06A 2GB2A 3VM5A 4B60A 3GSVA 2JJTC 4Z1PA 1NINA 4EPSA 4IBUA 4GRMB 4CU8A 4PRNA 5TDNA 1N0LB 2HVJB 5KLIB 4G72B 5BRQA 1T3JA 1NDGA 5K59E 2AAVA 2EDQA 3P0VH 4JDTL 1AQDB 1L0NE 4EIBA 3K7UA 1JUFB 3U1SH 1F86A 2DBLL 5TJWK 4PRBA 1A9BA 1J1XL 3NEOA 4WKXA 2BVOA 3WFHA 1HNYA 3W82A 3M8OL 2Z1PA 4NO3A 5HYJE 4AH2A 1ZP0C 5IMOB 1XB3A 4OGYH 4FNUA 1ETB1 1U33A 2MFNA 4HJIA 5DQJB 5H37H 3ABZA 5I71C 1JHTA 1TTUA 3CCMP 1CB4A 5D96B 1UXMA 4LASL 1YYML 2HH0L 1YYCA 2WT7A 3ZO9A 1C5DB 1DH3A 4A7GA 2XN9A 2OMWB 4DKTA 2GK2A 3CXHK 3VWJD 3OTTA 3V8OA 4AXWB 2B15A 1HEZB 1LO0H 3BH8B 1BFOB 3TC9A 3U9PL 4XPAH 3CQPA 4N0YH 3NA4A 4HKBA 3QO1A 2W59A 1KMGA 1BQUA 2E76C 1AY1L 3DLQR 2VXVH 4KTEL 4JFDD 2DDQL 2CG9X 3VDAA 1YPZF 5J6SA 1IRAY 4XHJD 4E41A 1S5HA 1G9ML 1CD1A 1J8SA 1JNNL 1ORQB 5ABAA 2IH1B 4X9BA 1NPUA 1P69B 5H94A 5KYWA 4APXA 3SDXE 1GD2E 2EEXA 3EOYG 4JRWA 2IPKB 3LS4L 3FTGB 3IMSA 5JIMA 1P4UA 2F9BT 3MRCA 4JPIA 2OARA 3L3HA 4OLWH 2YUZA 5CGBA 1ERNA 1I1AA 1FVDA 4OD3L 8CGTA 4J28A 3MLSH 1YTZI 1CF8H 3MLVH 3O3BA 1SFHA 3EKCA 3MNVA 1MAJA 5CJXA 2FJHB 1X9RA 4YN3A 4FYRA 1VGEH 5C0FB 1UA3A 2R69H 5GIRB 2H5UA 1IGML 1P0SE 3LRGA 1NM4A 4MASA 1K9MQ 4WO4C 4IOIH 5JQHC 2YAHA 3P9LB 4JANB 5EHFA 1EEYB 3E80A 4WUUA 1D2OA 4GLRI 2A6DA 3IK2A 5F9DC 1W72B 1YMHB 3EO1B 3MJ7B 4WCYH 1QFOA 1RUQH 3GK8H 1VF5B 5DI8B 3WNPA 3ZHFA 4CC0A 2L0DA 3D50A 4NRXA 3JV0A 4HC1L 5H4YA 2Z65C 1E3FA 1F2QA 4PJBB 2FGWL 1E90A 3DUUA 4P59H 5IB3A 3RJDA 1TQSA 5EUOF 1XR9A 4N2DA 2V5MA 3VXOA 2VQTA 5C3LD 7FABL 3AAZA 2Y2TA 4IL6X 2CDEB 3D0LB 4HKXB 3HLAB 2CKBB 5HHQA 1KGYE 4R4FH 3MR9B 4TULL 4FQIL 5DFAA 2Y22A 3RURA 4YHML 2P52A 3BVNA 2X6UA 4FYQA 4OV6F 1OAKH 1XAUA 1CTNA 4X6EB 5JOPD 1FGNH 1IAIH 1MQ8A 2E9WA 2YK1H 3DIDA 3SSUA 3EO0A 1HXKA 1WGVA 4JQXC 2OXHB 5DHVB 5E23A 1L4AC 1S5IH 3UDWA 3BPCB 3BATA 3L7EA 4MJ6A 4BZ2H 2CRIA 4JR9H 4QHKJ 2P2UA 4K15A 2X05A 3REVB 3L72E 1EJFA 1KYOE 2BINA 4QLRA 5SV3A 5HHVH 3T6WA 3CBRA 1EXUB 1T2KD 1AY1H 1J5OL 3BEVA 1SLQA 2M3EA 4KO9A 1PKQE 2UWJE 3N04A 5D2LE 1J0JA 2GTWA 2QPUA 5FK9A 2H8PB 5K33A 3LKRA 2OV0A 5ALBL 3JCUH 1ZOYC 1KQFB 1KBPA 2WLKA 4RO0A 4BA8A 4RQQA 3E8VA 1GKEA 4PJHA 3WEAA 4NQEE 3RZCC 5ADOL 4GQRA 4HJUA 3QXUA 3PV7A 4X99A 1M3IA 4I0PB 1HHIB 1OTSD 2AK1H 1LTGC 4YHNA 1DANU 3T1WA 3EOTL 4ODHL 1K6QL 1T6WA 4PWGA 3N43B 4XO9A 3WXWL 1CF8L 2ZXBA 3L4YA 3MLVL 4UDUB 4HETA 3WXVH 3KPRD 1WCBA 1L9MA 4JM2F 2O5YL 4Y2OA 5IMMB 2N0MA 4MXVE 5JA9A 3TH2T 1WA1X 4LF3B 5JORA 3WTWA 2XACC 3TZVB 3ULVF 1A14H 5ISZD 1FFOA 3MJGX 1DBAH 3F5WB 3UZQB 1AFVL 4G7VL 4R7NB 4XXCC 1KILD 1KORA 4K9EL 2W07B 2FE0A 5EUOB 2OW7A 3NFSL 3CLFH 4C83A 2EDYA 5HHOE 1JCVA 2ADGA 5FHBH 4MXQC 4PV1B 1UWYA 2K70A 3GKWH 35C8H 2VLRA 4EVNB 2QQKH 1KIRA 5F7DB 3FB7B 3IDJB 3HI1A 4G9FA 3QAZB 3OMNB 5L88L 3NCMA 3ZMRA 1RUPH 3WUZA 1SGKA 2NZ1A 4EBQH 5JHDD 2R56H 5DK3A 4XMLH 3OJDA 5H2FE 4IK6A 4K3EH 3EH1A 5G2NA 5KW9H 2GJ6E 3IJSB 3O8ZA 3IBOA 4ONGH 2QIWA 3FH5A 1DQDL 3UAFA 1ZWIA 2DWEA 3HE7A 2XRAH 2NXYB 3VB8A 4PVBA 1K4CA 4JO3L 5IR1B 1ZLWH 3BAEL 3FFCD 1NMCB 2BY2A 4DOJA 2VR5A 3OJMB 5E5RB 4KRLB 3DUHA 4MSWB 2HWZH 4ONOA 3CH8A 1FCGA 5J1AA 5CLZA 1FZOB 2NXZC 4O2CB 4QHNB 1KXQE 4LCVA 1GHFL 1DL7H 1S3KL 8FABA 3MN8A 1ZLUH 3CZFA 1X5IA 1F1AA 1ONQA 4FD0A 3JUYA 3D69B 1KTRL 4PUBL 1B0GB 3WJLA 4KKQA 2GUOA 3AU0A 3MV8B 4OCYL 1ADQL 3CXHJ 2IGFH 1SUJA 1CE6A 1J1OL 2A3TA 2V6HA 3DRTA 4H26A 1BECA 1BOGB 1S9VB 3A67H 4X9FA 5E8PB 3NIDF 4NYLB 3ZMEA 3HR5A 4KGLA 4Z77B 5HDBB 4QRSA 2WY3B 4NLAA 5IQLA 1TZHA 2VIRB 4ZUUB 5C07D 4MA8L 2YXMA 3VGGA 3CFDB 4AYSA 2WZ5A 2WQVA 3NFQA 2ZOWA 4GSDH 4HC1H 5J11C 5FS5A 2GC4C 5EULV 2APSA 1S5LX 2FX9L 3ARED 2VDRH 2NT0A 3FQUA 4HPYL 3CVDA 4ZO8A 2FEJA 2CQVA 5APWA 3QUMB 1EZVD 3QQ9C 3CMOL 1LTJC 4U3HA 1CFTB 1EVTC 3KPSA 5EC1A 4UOZA 5BS0D 2ATAA 4L1TA 4OF6A 1FSKB 1OSYA 3H25A 2MCAA 1H3PH 1PZ2A 1T0MB 2WZPD 4L3ED 4YXLH 4A2LA 1YYLH 3ALXA 2CALA 1P7BA 1UATA 3OX8B 4JKWA 5D1QB 1V7ML 1D5ZA 3KPNA 3G5WA 1YC8A 5F1OB 1WT6A 4JQIH 5E8EA 3OQRA 4JN1L 1FG9C 4ZODA 3ILDA 3BVWA 3VM7A 3P7KA 2F1AA 2NX5E 5DZPA 1P7QB 4XB8A 5F6IC 1JPSH 3G5VA 2FWUA 3JBG7 4UNVA 1EWHA 3QUKB 4M8QA 4FQ2H 2PGDA 1QACA 5CJOH 4PB9H 1NUFA 2WMPA 2YAPA 3MSPA 3ULUE 5KVDE 5KSAD 5D7EA 5F7NC 4YSQA 1I75A 3MUDA 1NTDA 3WDJA 1ZPLA 2CK0H 1AGFB 2WAQA 3IPFA 1NMBH 5C0BD 2DL2A 2X9YA 1HL9A 1FN4B 4LSSH 4DH2A 5C0AD 3RDTD 5A2CA 1NGWB 3DBSA 1YN7B 5CGTA 1MJ8H 3PY9A 3VOPA 1XCTA 2J8UA 1JZEA 1NDTA 2Q9OA 4ONHB 4EI0A 2Q2EB 4OZ4A 5LCVL 4TVPE 1NWOA 3N42F 1AMXA 1EBAA 4N22A 1ZAGA 2BVTA 1SXAA 3LZFL 3QJRB 3W9EB 2HG5B 1I8LA 1I9RL 2G2RB 5GZNA 3RU8L 1OF2B 1S5IL 2EDLA 2ZOLA 5IIEA 3T8XB 3VMNA 1Q9LA 3FFDA 2J4WL 3UO1L 4F37F 3OSVA 2OL3H 2Z7YA 1M1KQ 2AI0L 1M9WA 2H1PH 4PRPA 4XP4L 5D70H 4GW5A 3HW7A 3ZIMA 4C55A 4L1SA 3MTUE 1IAOB 3MLUH 5DJ8B 3GUFA 3GKWL 3T1FB