2WTYA

Crystal structure of the homodimeric mafb in complex with the t-mare binding site
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
94
structure length
94
Chain Sequence
SDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKSEKLANSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTION FACTOR MAFB
publication title Design of a bZIP Transcription Factor with Homo/Heterodimer-Induced DNA-Binding Preference.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 38
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03131 bZIP_Maf bZIP Maf transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wtyA00
3IR9A 1T2KD 1KQLA 3TK1A 3V5BA 1NWQA 2W27A 3NTNA 3M0DA 3VN0A 3MGNA 5APQA 4AUWA 2IPPA 3VTPC 5AW6B 1OXZA 5CMZA 2R5BA 2WT7B 3OAKA 3VMXA 5AW4B 3L36A 1JUNA 2WTYA 2Z5IA 1GTWA 3HTKA 5AVXB 4C7NA 2C9LY 2WPRA 1CI6A 5AVYB 4LC1A 1MUUA 5AVQB 5AVUB 1NAFA 2W6AA 3M06A 1H89A 5AW5B 1SLQA 2WPSA 5AW7B 2E43A 3M9BA 5APVA 2WT7A 5AVVB 1FAVA 3NFQA 2Z5HA 2Q3IA 1H88A 4GT1A 5AW1B 3KQGA 3M9HA 3P7KA 5AW3B 2KP8A 2WWWA 4KHXA 3A2AA 5AW2B 4AQRD 1S9KE 3P8MC 1OWAA 2H7HA 4JYBA 5AVTB 3P32A 1GK6A 1CZQA 1H8AA 3LIEA 2JJLA 3UIAA 3MD0A 1JNMA 5AW9B 1MFZA 4EOTA 3HE5B 4DZOA 1GD2E 4B86A 1CSBA 2Q7CA 3TNUB 3A3YB 2YO3A 5APUA 1HJBA 2ZXEB 4JYCA 1GU4A 2N9BA 2XV5A 3HE4B 2ZFCA 2XZRA 1T2KC 5AVWB 1IO4A 2R5DA 3V4WA 3M0AA 1X8YA 4I6MC 1HUCA 2C9NY 1MV8A 2QM7A 3VMYA 1A02F 5AVZB 3NMDA 3B8EB 4C46A 3I5CA 1GU5A 2QM8A 1S9KD 1GZLA 4GKGA 5AW0B 3T97A 3M91A 3V4QA 3O8ZA 5APWA 2BASA 3HE5A 5APSA 1SP4A 1YYCA 5AVSB 3A5TA 2R32A 3TNUA 5AW8B 3TYYA 3VYIA 3HE4A 3L35A 5APYA 3NXSA 2Q5UA 2YNYA 2P67A 3LIDA 1G2CB 4I2LC 5APXA 4XE5B 1FOSE 1J2JB 3A7OA 1HWTC 2XU6A 2P2UA 1GK4A 4RESB 4HYTB 4AYCA 1DH3A 1HBWA 3SWFA 2P7JA 3KDPB 1A02J 4C7NB 2VRSA 3L37A 5APTA 4M3LA 2R3CA 5AVRB 2WPQA 1CI6B 3VMZA 2E42A 2YO2A 1FOSF
chains in the Genus database with same CATH superfamily
3IR9A 1DIPA 3D6YA 1K05A 2ZJSE 2GM4A 2H43A 2FYUJ 4H0LC 1NYHA 1EZVG 1S5LH 2OARA 4ASWA 3H1IJ 1W5CE 2FYNC 2Y0EA 1OW6A 2NZ2A 1SFCB 1FZCA 3JC22 2AXTH 1HH0A 5AW3B 1X9VA 1DD4A 2KNCA 3HE5B 1LT9A 4B86A 2W6BA 3TNUB 2YIUB 3RL0C 2KS1A 1NTKG 1X8YA 4H13D 4HH2A 4I6MC 3BVHA 5KLVG 4K35A 1SQXK 1OZHA 1SFCC 3A0BE 5GTIE 2HPCA 1NTZJ 4UB6H 3M91A 1AFOA 4PV1B 4D6TD 3BATA 1RHZB 1GW3A 2H88C 1ZOYC 3OW2O 1VQMP 3AEFC 4WY4C 2E76D 4AYCA 5KJ7C 3WMM0 4DJGA 1OVUA 3GF7A 1P84I 2YIUC 4EIJA 1CI6B 2WZ7A 3VMZA 2QJPB 1R8EA 5L8RJ 3D70A 2HFED 1PFIA 1VL2A 2WT7B 4O9BA 2ZT9C 1VQLP 1L2PA 1KZUB 4PV1C 1URQA 4PD4E 1EXJA 1GMJA 3M06A 5H2FE 3RK3D 3NFQA 3CMEP 2QJPC 3HUSB 3AEBC 4IL6X 2RH0A 1DX7A 2JJLA 1IFMA 3AE2C 4XA4A 3B5NA 1FBMA 2IYPA 1T8ZA 3AE8C 1FC2C 1EZVE 1HF9A 4D6TG 2O01J 2W83C 1AV1A 3C8VA 3GW6A 2KZIA 1FDOA 2YNYA 4GIFA 2M3BA 3LIDA 3HUSC 3EQ2A 5GTHH 2XU6A 1QX8A 2FYUD 2QE7H 2PFXA 3AE1C 2FBWC 2K9JA 3SWFA 2I8DA 2ZYGA 1YHQP 1Q86Q 4YTPC 1VQ7P 4WB4A 4W7YA 1L0NG 2YO2A 1FZFA 1JO5A 1PZQA 3C1LA 1JY3O 3NTNA 3VN0A 3G71P 2WSFH 3HD7B 3H1LJ 1VF5D 2D2CD 3CL3D 1JUNA 1PIXA 2HR3A 3SFEC 2WPRA 3QH9A 1QL1A 2Y9YA 1ZLLA 2V4HA 5CJ0A 4OGQD 4BRYA 1N7SB 2A45G 2Q3IA 1Q2NA 1M7LA 3IFMA 3V2NA 2JR8A 2N1TB 1PGQA 2AEJA 2YXQB 1W2BO 3MD0A 3HD7C 1YJ9P 1NTZD 2WPVB 2JP3A 1NH4A 3BRTB 3PHLA 3K5BA 1JB0J 3CCEP 1T3JA 2KSJA 3MTUE 1PGOA 2WSCH 2AXTE 1LP1B 1N7SC 1OW7A 2QJYB 2L91A 5APYA 4WVZA 2FYUG 1LTJB 3BCCJ 3RBXA 1RF0C 3WU2H 1FDMA 3A0HE 4OVNF 1KC8Q 3KHUA 4DOJA 1N73C 1KYOD 3L74J 3H1KE 1QVGO 1AVYA 2R5BA 1NTKJ 1SQVJ 3VMXA 3H32B 5KLVJ 2A06D 4IFDK 2N9YB 3L73J 4H13C 2HLOA 3GG2A 3T97B 1U7JA 1LTJC 4Y99B 3B71A 1YIJP 3CX5E 2V7QJ 5APVA 3LW5H 1SFCD 4GT1A 1H88A 3HRNA 3CC7P 2WWWA 3A2AA 2RMZA 3JSVC 1NTZG 1JNMA 2E76C 1MFZA 1YBKA 1ZR4A 1YJWP 1L0NE 2OYHB 2FFDB 2ZVNB 3D71A 1LWUA 2B9BA 4IL6E 5GTIH 1NU1J 2C9NY 2QM7A 2KIKA 4C46A 2NRGA 4Y99C 2KYVA 1GZLA 1KILA 4OWFA 4JPZB 3WUVA 3RK3E 4XE5B 1K73Q 5KLVK 4PV1D 3PP5A 2DW3A 2M5AA 3H1LD 3L71E 2IBZI 1KQGB 2POHA 2OYHC 2FFDC 1FOSF 3AEAC 2P10A 5DJTB 3V5BA 1NWQA 4N78D 2A06G 1EDIA 4GODA 3EFGA 4PD4H 2QEXP 1NTMD 5AVXB 1FZEA 3P8CD 4D6TJ 5GTHE 5H2FH 1JY3P 5TISE 1RF1B 1P84D 1LTTC 2NPSB 1SLQA 2SPZA 1KTMA 2FYUE 4U3FJ 2IDBA 4N3YB 3P32A 3H1IE 1SQQD 2KLUA 1EDLA 3FXEA 3LIEA 2FXPA 1SFCA 3G6EP 3FGAD 1GD2E 3SFDC 3VOPA 3RK2B 4JQ0D 3B4SA 3AE6C 3M0AA 2MKVA 3CCMP 2XNXA 1JTHB 3BCCD 4WY4A 2PRRA 4L74A 3VMAA 2NPSC 3V4QA 5APWA 5KJ7A 3HE5A 2E74B 2IZ1A 3ABVC 3TNUA 1DEEG 5AW8B 3TYYA 2JKVA 2LR2A 3H1LG 3AE9C 3L74D 1HWTC 1GK4A 1ZMEC 1SQVD 1NTZE 1T2KD 5E79E 4NPEA 3L73D 3KZIE 2IFNA 1KILE 2YMKA 3MUDC 1SS1A 3PLNA 1NTMG 3CWBJ 1FZAA 2L5GB 1KB9H 3HD7D 2E74C 2WSEH 1X22A 2KB7P 1CI6A 3CXHH 2M3EA 1L0NK 1GL2B 1S3JA 5K5GB 1ZRTE 2K3RA 3QWOC 1RE3C 4DCKA 2WT7A 1QL2A 1KORA 1SQQG 2H7HA 1OWAA 1VQ4P 4HKZH 1VQKP 1N7SD 3V6IA 1NU1D 4I7ZB 1LGHB 1HGVA 1KYOE 1PGPA 1LTSC 1M1JB 2Y9ZA 2N1TD 3BCCG 2A06E 1A02F 1GL2C 3HUSA 1XTGB 3TGUD 4NPFX 4GOFA 3IAOA 4UB8E 2QRXA 3MHVA 3RBZA 3Q5PA 3L70D 4WBAA 1PGJA 3L74G 3A0HH 3VP8A 1UIIA 2J58A 2P67A 1FOSE 5KTBA 4C7RA 1SQVG 2IZ0A 1M1JC 2P7JA 3L73G 4JBZA 3AE4C 1OMIA 4BWNA 2B87B 3SWKA 3S4RA 3TK1A 1BCCJ 2ZYAA 2FYUK 1GDTA 3L75J 1GTWA 3AE7C 4U3FD 3CX5H 1AVOA 2AXCA 4LC1A 1N2DC 1MUUA 1EDJA 4PD4I 1KFNA 3HD7A 3L72D 3FWNA 1JY3N 3M9BA 3H1LE 1HVVA 1NU1G 2I1JA 2CPBA 1BGYJ 1H8AA 4LGDE 2Q3EA 2Y0CA 5CBNA 1T3UA 4N78E 4IL6H 4DZOA 2O01N 2Q7CA 1AQTA 1N7SA 3TGUG 2XZRA 1IO4A 3L70G 1RF0A 1N7LA 1BSNA 3CCQP 1VQ8P 1P84E 1NTZK 3O8ZA 3A5TA 1JCDA 3S1KA 1Z56A 1NO4A 1N73A 3WUTA 3CC4P 5KAFE 1S2EA 1FZCB 4KJMA 2G8YA 4H44B 2OYIB 1PV3A 4RESB 3JCUE 1LTAC 4I1LA 3HTKB 2WITA 1S72P 3CWBD 4XFJA 2IYOA 2VRSA 4Z1MH 2OTJP 1HJ0A 1LP1A 2M0BA 4RKUJ 1OVRA 1LTJA 2KS1B 4U3FG 3BCCE 4HJGH 5TISH 2E5TA 1IK7A 2OTLP 3FWLA 2IBZD 1SQXD 3L72G 3U59A 2CPSA 3D6ZA 1K04A 2OYIC 3L74E 5TJHA 3H1JD 1K9MQ 3H32A 1MFTA 3Q1MA 1IFNA 3II6A 2NPSD 1NTKE 1SQVE 5KLVE 1CZQA 1KQFB 3L73E 1YTZI 2M8RA 1KB9E 2P58A 3A3YB 2YO3A 1LTGC 1HJBA 2AEMA 3CXHE 1NTMJ 1T2KC 2R5DA 1FE6A 1PP9D 1YQ4C 3VP9A 5AVZB 3RK2D 1S9KD 5KKZB 1URQB 1YYCA 4LLHA 1SQBJ 2OYHA 2GUSA 2FFDA 5BU5A 5B66H 3I56P 3E1RA 4YXDC 2E74D 3I55P 1SQQJ 3CWBG 1BCCD 4WWIA 2P2UA 2KLVA 1OW8A 1VQ6P 1NU1E 1SQPJ 5E79H 2GA1A 3KZIH 4C7NB 1L0LJ 1WRGA 3L75D 3KXDA 1JOCA 1ZW0A 3CMAP 2CK3H 1ZP0C 3B5NB 2O1KA 1M90Q 2N1TC 2AEFA 2IBZG 3PRJA 1SQXG 1Q81Q 2C9LY 5CBOA 1RH5B 3N4XA 3H1HJ 2PP6A 5AVQB 2BCCD 1BGYD 2W6AA 3H1JG 2K88A 1AJYA 4CPGA 1KFMA 3CX5I 5AW7B 1GL2D 1ZV8A 3W68A 1KYOH 2KP8A 5AW2B 4AQRD 2H89C 2YKOA 2JWDA 1M1KQ 2QJYC 1N86A 1VQOP 2I1KA 4EOTA 4D6TE 1L4AB 3O6QA 2PAJA 2NPSA 3CD6P 2MJZA 1EQ7A 1PP9G 1ZXGA 5KAIE 2ZFCA 2E75D 4UB8H 4ASVA 4W80A 4U3FE 1BDCA 3E1IA 5AW0B 2O1JA 5AVSB 3FX0A 3SSUA 2WMMA 2KSEA 1BCCG 3L35A 3NXSA 3C9IA 4BRYB 2QSIA 3MUDA 3IN6A 3L75G 2O01H 1JTHA 1L4AC 2IFMA 1BDDA 3PTZA 1JCCA 1USDA 3AEDC 4TT3H 1E79H 2K9YA 3MGNA 4L75A 1RE3A 3TGUJ 5CMZA 1NTKK 1SQVK 2WTYA 3L70J 4GOEA 2BCCG 1BGYG 1TU3F 2J5UA 1SVFA 2R3SA 1VQ5P 1QGKB 3KPEA 5CCHD 4IFFA 1Q90D 2HODA 3OJAB 3KQGA 3M9HA 3P7KA 4KHXA 3CWBE 1E5WA 1FS0E 3CCSP 1JM0A 1GL2A 1Y9BA 3FXDA 5BVZA 1MZ9A 4PD4D 3AE3C 4QMAA 1J1EB 1SQBD 1WT6A 1P84H 3V4WA 1NU1K 1DEBA 1CW5A 3NMDA 3RL0g 3L4FA 2IBZE 4OH8B 3E7KA 1M1JA 5KAFH 1SQPD 3BRVB 3L72J 1L0LD 1NKZB 2PGDA 3JCUH 4HB1A 1JMMA 2B89A 3MIWA 1G2CB 5APXA 4R4MA 3A7OA 2BEQD 4HYTB 2R44A 1RF1C 2YKPA 1JMBA 1IK9A 2R3CA 4H44D 2K37A 2UWJE 3H1HD 3VTPC 5AW6B 2XKMA 1LWUB 5AW4B 2OQQA 2ZVOB 5KLIB 1FZBA 5B66E 1KN7A 1KILB 1YITP 2LKMA 3RK2C 3MZWB 3BASA 1M57D 1IFIA 1BCCE 3KYQA 3GF3A 2Z5HA 1WMKA 4H0LB 3PH0A 1LTBC 3L75E 2M5AB 3IF4A 5AW9B 4MN4C 1SQBG 2V7QH 1IFDA 2RKLA 5KLIC 1FDIA 2N9BA 2XV5A 3Q2YA 3EWKA 1YI2P 3R2PA 4IFMA 1LJ2A 1SQXJ 1SQPG 1GU5A 1L0LG 1BGYE 3Q3DA 2QG4A 1QEXA 2E75B 1J1DB 3H1JJ 2Q1KA 2KXPB 3N7NA 2E5YA 5CHXA 2JEEA 1URQD 1BSHA 1ZR2A 2WSFJ 4BXLA 3RL0B 1VPCA 4M3LA 2FXOA 3H1HG 5M1BA 4EI2A 1S5LX 1PP9J 1BE3J 5BU8B 1OXZA 2YKQA 2OYIA 4KT0J 4IOIH 4I7ZC 3B5ND 2W8ZA 3HTKA 1FZGA 3CLQA 1M8OB 2E75C 1J1DC 4WY4B 2LXBA 2FY8A 2WVRA 3M0DC 3U1CA 1NHLA 4PJ0E 4GDOA 3H1KD 4L73A 2E43A 1VQNP 1H0TB 1FU1A 3GLMA 1OIPA 5AVTB 1NAYA 1KMIZ 2ZT9B 5KAIH 5CCGC 2WSCJ 3S9OA 3GHGB 1S1CX 3H6PA 3HE4B 3CX5D 1L4AD 5C39A 4ZMDA 1Q82Q 1JY2O 2BCCJ 2QM8A 1K8AQ 2KOGA 3W67A 1IZNB 1RE4C 4R4LA 4U7JA 1L0ND 2Q5UA 1IFJA 1J2JB 2ZXXA 1NTME 5CCHC 3AEGC 1EZVI 3G9RA 3P8CE 2N1TA 3CCJP 3GHGC 1IC2A 1GW4A 1LTIC 1SQBE 2A45H 2IPPA 2ZYDA 1SQQE 3LW5J 5B5EE 4C7NA 1XTCC 1RQVA 1Y8AA 1SQPE 1EC5A 3L71D 1L0LE 1Y47A 3H1KG 2KNCB 1LT9B 3CC2P 3V2PA 1NOHA 1YQ3C 4JF7A 4A7PA 1FJKA 3WUUA 1JEKA 2HPCB 2Y0DA 3H1HE 1MKMA 1KB9I 1FZCC 1S4XA 1NJIQ 4NPDA 4H44C 5APUA 2ZXEB 4K3AA 3CXHI 3H25A 1T6AA 2Q9IA 2P1JA 2JO1A 3H1ID 1LT9C 1L4AA 3T97A 1UIXA 4Y28J 5APSA 1SP4A 1NGMB 2WSSH 1R5SA 1BE3D 1HTLC 1LNQA 1PPJD 5APTA 1KQLA 4N6JA 5APQA 1G1JA 3TSIA 1U57A 1ZN5A 2JWAA 3L71G 2Z5IA 4RO0A 2O3JA 2XDJA 1S5LE 2XNDH 2QVAA 2K1AA 1NKNA 4ZNCA 1H89A 2C0WA 1N73B 2KZJA 1KQSO 1KILD 2KUBA 3V2QA 1W2EA 5AW1B 5KKZC 3TGUE 3R4YA 1URQC 3P8MC 3L70E 2ITAA 4H0LD 4H13B 2G3AA 2Q6QA 1ZRTD 1NTMK 3AE5C 3CCLP 1IFPA 1MV8A 2YXRB 3H1IG 3VMYA 3Q5SA 1QVFO 2BEZF 1DD3A 2K9JB 3B5NC 1RF1A 1KD1Q 1SQBK 4DT0A 2E76B 4UB6E 1BE3G 1AQ5A 1SQQK 4W7ZA 3CCRP 1JY2P 1PPJG 2LXCB 3CCVP 1SQPK 3V2RA 1HBWA 3KDPB 1L0LK 1A02J 2WSEJ 3RL0D 1M56D 2KI7B 3G4SP 3L72E 2J59M 2W27A 5CJ4A 1G2CA 4AUWA 3F5HA 3TDKA 3USSA 4YPCA 3OAKA 2A45I 5CCGD 4PJ0H 5DJUB 4ZKUA 5AVYB 3Q5RA 5AVUB 1NAFA 3RK3B 4TLFA 4WY4D 1USEA 1N8RQ 2QA4P 2WPSA 4RJTA 3A0BH 5KJ7D 2C0XA 3EFFK 3M9QA 3CPWO 3PJSK 1X79B 2RN0A 1Q7YQ 2H8PD 1CSBA 1IJDB 2ZT9D 2FYZA 3TF5A 4JYCA 3AECC 1HUCA 1OX3A 1X0TA 3I5CA 3RK3C 1YTZT 2BASA 2FKWB 3H1KJ 2IX7C 1VQ9P 3F89A 3VYIA 1VDFA 1G1IA 2QIWA 3U1AA 1DH3A 1SQXE 1OFCX 1VQPP 4EDFA 2WQYC 5AVRB 2WPQA 2E42A 3O6QB 1VF5B 2D2CB 3M0DA 1FJPA 3H1JE 5B5EH 1U7MA 1EXIA 2FXMA 1YJNP 3L36A 3G3ZA 1OVVA 1EZVD 4OGQB 1L0NJ 1HGZA 3ZDMA 1J1EC 5CCGA 5AW5B 4YXWH 2QJKB 1RQUA 1PP9E 3ITKA 5AVVB 1FAVA 1BE3E 4EYYQ 2KK7A 1S9KE 1PPJE 4JYBA 2W6JH 1R5LA 2JDIH 1GK6A 1VF5C 1EDKA 1QLED 2D2CC 3UIAA 1D7MA 2B87A 2OTKE 2Z4EA 3RGUA 1GU4A 1RE4A 1H0TA 5AVWB 2B88A 2HYNA 1RY3A 4OGQC 3L71J 3B8EB 4ZKPA 5CCHA 1NTKD 5KLVD 4GKGA 1PL5A 2FYNB 2OYOA 2QJKC 1KYOI 2R32A 3GMAA 3CI9A 3GHGA 2YMYA 3SWYA 2GUVA 1LWUC 3CCUP 1KB9D 4L76A 5EFWB 3HE4A 3OA7A 4I2LC 1LT1A 2W90A 3AEEC 3CXHD 1NVOA 2HODB 1KILC 2OGUA 2HG5D 3MP7B 1KV4A 3L37A 2BCCE 1AA0A 2ZAEB 3WU2E 1JY2N
chains in the Genus database with same CATH topology
3IR9A 3V5BA 1NWQA 2GM4A 3B5NB 2O1KA 2A45H 2H43A 4N78D 2IPPA 2OARA 2N1TC 3EFGA 5AVXB 4C7NA 2C9LY 1FZEA 1XTCC 3P8CD 3N4XA 2PP6A 5AVQB 1JY3P 1RF1B 1SFCB 1LTTC 2W6AA 1KFMA 1LT9B 2NPSB 3V2PA 1SLQA 1NOHA 1FZCA 5AW7B 1GL2D 1HH0A 1ZV8A 5AW3B 4JF7A 2KP8A 5AW2B 4AQRD 1FJKA 4N3YB 1X9VA 3P32A 2YKOA 3LIEA 1N86A 2I1KA 1SFCA 4EOTA 2HPCB 1L4AB 3HE5B 2PAJA 1GD2E 1FZCC 1LT9A 2NPSA 4B86A 2MJZA 1EQ7A 2W6BA 3VOPA 3RK2B 3TNUB 5APUA 2ZXEB 3RL0C 2ZFCA 3M0AA 1X8YA 4HH2A 4I6MC 3BVHA 2Q9IA 2P1JA 4W80A 2XNXA 1SQXK 1JTHB 4WY4A 1SFCC 3E1IA 5AW0B 1LT9C 1L4AA 2NPSC 2O1JA 3M91A 5APWA 3T97A 3V4QA 3HE5A 5APSA 1SP4A 5AVSB 5KJ7A 1AFOA 3TNUA 3BATA 5AW8B 1GW3A 3TYYA 3L35A 3NXSA 3C9IA 3MUDA 4WY4C 1HWTC 1GK4A 2O01H 1JTHA 1L4AC 4AYCA 5KJ7C 3WMM0 2IFMA 1JCCA 1HTLC 5APTA 4EIJA 1CI6B 2WZ7A 3VMZA 1T2KD 1KQLA 4N6JA 2IFNA 2HFED 2HPCA 3MGNA 5APQA 1PFIA 1G1JA 1RE3A 3TSIA 5CMZA 2WT7B 4O9BA 1NTKK 1SQVK 1ZN5A 2WTYA 1FZAA 2L5GB 2Z5IA 1KZUB 3HD7D 2WSEH 2XDJA 2KB7P 1CI6A 1URQA 1SVFA 1L0NK 1GL2B 1NKNA 1H89A 3M06A 2C0WA 3KPEA 1N73B 1RE3C 5CCHD 4IFFA 1KILD 2WT7A 3V2QA 1W2EA 1QL2A 3RK3D 3NFQA 2HODA 3OJAB 5AW1B 3KQGA 3M9HA 3P7KA 4KHXA 1URQC 3P8MC 1OWAA 1E5WA 2H7HA 3HUSB 1DX7A 1N7SD 1GL2A 1LGHB 2JJLA 1HGVA 1IFMA 1LTSC 1M1JB 4XA4A 5BVZA 1MZ9A 2N1TD 3B5NA 1FBMA 1J1EB 1NTMK 1WT6A 3V4WA 1T8ZA 1NU1K 1DEBA 1MV8A 3VMYA 1A02F 1CW5A 1GL2C 3HUSA 3NMDA 1XTGB 3L4FA 4OH8B 1M1JA 3B5NC 1RF1A 3BRVB 1SQBK 4WBAA 1NKZB 3VP8A 2YNYA 1JMMA 2J58A 4GIFA 2P67A 2M3BA 1G2CB 3LIDA 3MIWA 5APXA 3HUSC 1FOSE 1AQ5A 3EQ2A 1SQQK 5KTBA 4W7ZA 3A7OA 2XU6A 4C7RA 1JY2P 4HYTB 1SQPK 3V2RA 1M1JC 1HBWA 1RF1C 2YKPA 3SWFA 2P7JA 3KDPB 1L0LK 1A02J 1IK9A 2R3CA 4WB4A 4W7YA 3RL0D 2YO2A 1FZFA 1JO5A 3TK1A 1JY3O 2J59M 2W27A 3NTNA 5CJ4A 3VN0A 2WSFH 2FYUK 3HD7B 1G2CA 4AUWA 3VTPC 1GDTA 5AW6B 2XKMA 1LWUB 3OAKA 5AW4B 3CL3D 1JUNA 2A45I 1GTWA 5CCGD 1FZBA 2WPRA 4ZKUA 5AVYB 1KILB 2LKMA 4LC1A 3RK2C 1N2DC 1MUUA 3BASA 5AVUB 1NAFA 3RK3B 1KFNA 1QL1A 3HD7A 4WY4D 1ZLLA 2WPSA 5CJ0A 1IFIA 3KYQA 5KJ7D 2C0XA 1JY3N 3M9BA 1N7SB 2A45G 2Z5HA 2Q3IA 1HVVA 1M7LA 2I1JA 3M9QA 3IFMA 3V2NA 1LTBC 2CPBA 2N1TB 1H8AA 1X79B 4LGDE 3MD0A 5AW9B 3HD7C 1T3UA 4N78E 4DZOA 2H8PD 1CSBA 1IJDB 2Q7CA 1IFDA 2FYZA 4JYCA 1N7SA 1NH4A 2N9BA 2XV5A 2XZRA 3BRTB 1IO4A 1HUCA 3R2PA 4IFMA 1T3JA 1RF0A 1N7LA 2KSJA 3I5CA 3RK3C 1GU5A 3MTUE 1NTZK 2WSCH 3O8ZA 1YTZT 2BASA 3A5TA 2FKWB 1JCDA 2IX7C 1Z56A 1NO4A 1N73A 1N7SC 1J1DB 3VYIA 1VDFA 3N7NA 5APYA 5CHXA 2JEEA 1URQD 1G1IA 1LTJB 1FZCB 1ZR2A 1RF0C 3U1AA 2OYIB 3RL0B 1FDMA 1VPCA 4RESB 1LTAC 1DH3A 4I1LA 3HTKB 2WITA 4DOJA 2VRSA 1N73C 4M3LA 5AVRB 2WPQA 2E42A 3M0DA 1FJPA 1LTJA 5BU8B 2FXMA 1OXZA 2YKQA 2R5BA 2OYIA 3VMXA 3L36A 3H32B 1FZGA 3G3ZA 3B5ND 3HTKA 3CLQA 4IFDK 4WY4B 1J1DC 2HLOA 3M0DC 1HGZA 3U59A 1J1EC 1LTJC 1NHLA 2CPSA 4Y99B 3U1CA 5CCGA 5AW5B 2OYIC 2E43A 5APVA 3LW5H 5AVVB 1FAVA 3H32A 1SFCD 4GT1A 1H88A 3HRNA 1FU1A 1IFNA 2WWWA 3A2AA 2NPSD 3II6A 1S9KE 4JYBA 5AVTB 1GK6A 1CZQA 3UIAA 5CCGC 1JNMA 1MFZA 1ZR4A 1YTZI 2M8RA 2Z4EA 2OYHB 3GHGB 2FFDB 3A3YB 2YO3A 1LTGC 1HJBA 1GU4A 1RE4A 3H6PA 3HE4B 1T2KC 1L4AD 1LWUA 5AVWB 2R5DA 2C9NY 2HYNA 2QM7A 3VP9A 5AVZB 1RY3A 3RK2D 3B8EB 4C46A 4ZKPA 4Y99C 1JY2O 2KYVA 2QM8A 5CCHA 1S9KD 2KOGA 1GZLA 1KILA 4GKGA 1URQB 1YYCA 2R32A 3CI9A 4LLHA 2OYHA 3GHGA 1RE4C 2GUSA 2FFDA 2YMYA 3SWYA 2GUVA 1LWUC 5BU5A 3HE4A 3OA7A 2Q5UA 1IFJA 4I2LC 4XE5B 1J2JB 2HODB 5KLVK 2P2UA 3PP5A 5CCHC 2KLVA 1KILC 2HG5D 3P8CE 2N1TA 2POHA 4C7NB 1WRGA 2OYHC 3L37A 3GHGC 2FFDC 1IC2A 1GW4A 1JY2N 1LTIC 1FOSF 1JOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IR9 A;  1T2K D;  1KQL A;  3TK1 A;  3V5B A;  1NWQ A;  2W27 A;  3NTN A;  3M0D A;  3VN0 A;  3MGN A;  5APQ A;  4AUW A;  2IPP A;  3VTP C;  5AW6 B;  1OXZ A;  5CMZ A;  2R5B A;  2WT7 B;  3OAK A;  3VMX A;  5AW4 B;  3L36 A;  1JUN A;  2WTY A;  2Z5I A;  1GTW A;  3HTK A;  5AVX B;  4C7N A;  2C9L Y;  2WPR A;  1CI6 A;  5AVY B;  4LC1 A;  1MUU A;  5AVQ B;  5AVU B;  1NAF A;  2W6A A;  3M06 A;  1H89 A;  5AW5 B;  1SLQ A;  2WPS A;  5AW7 B;  2E43 A;  3M9B A;  5APV A;  2WT7 A;  5AVV B;  1FAV A;  3NFQ A;  2Z5H A;  2Q3I A;  1H88 A;  4GT1 A;  5AW1 B;  3KQG A;  3M9H A;  3P7K A;  5AW3 B;  2KP8 A;  2WWW A;  4KHX A;  3A2A A;  5AW2 B;  4AQR D;  1S9K E;  3P8M C;  1OWA A;  2H7H A;  4JYB A;  5AVT B;  3P32 A;  1GK6 A;  1CZQ A;  1H8A A;  3LIE A;  2JJL A;  3UIA A;  3MD0 A;  1JNM A;  5AW9 B;  1MFZ A;  4EOT A;  3HE5 B;  4DZO A;  1GD2 E;  4B86 A;  1CSB A;  2Q7C A;  3TNU B;  3A3Y B;  2YO3 A;  5APU A;  1HJB A;  2ZXE B;  4JYC A;  1GU4 A;  2N9B A;  2XV5 A;  3HE4 B;  2ZFC A;  2XZR A;  1T2K C;  5AVW B;  1IO4 A;  2R5D A;  3V4W A;  3M0A A;  1X8Y A;  4I6M C;  1HUC A;  2C9N Y;  1MV8 A;  2QM7 A;  3VMY A;  1A02 F;  5AVZ B;  3NMD A;  3B8E B;  4C46 A;  3I5C A;  1GU5 A;  2QM8 A;  1S9K D;  1GZL A;  4GKG A;  5AW0 B;  3T97 A;  3M91 A;  3V4Q A;  3O8Z A;  5APW A;  2BAS A;  3HE5 A;  5APS A;  1SP4 A;  1YYC A;  5AVS B;  3A5T A;  2R32 A;  3TNU A;  5AW8 B;  3TYY A;  3VYI A;  3HE4 A;  3L35 A;  5APY A;  3NXS A;  2Q5U A;  2YNY A;  2P67 A;  3LID A;  1G2C B;  4I2L C;  5APX A;  4XE5 B;  1FOS E;  1J2J B;  3A7O A;  1HWT C;  2XU6 A;  2P2U A;  1GK4 A;  4RES B;  4HYT B;  4AYC A;  1DH3 A;  1HBW A;  3SWF A;  2P7J A;  3KDP B;  1A02 J;  4C7N B;  2VRS A;  3L37 A;  5APT A;  4M3L A;  2R3C A;  5AVR B;  2WPQ A;  1CI6 B;  3VMZ A;  2E42 A;  2YO2 A;  1FOS F; 
#chains in the Genus database with same CATH topology
 3IR9 A;  1DIP A;  3D6Y A;  1K05 A;  2ZJS E;  2GM4 A;  2H43 A;  2FYU J;  4H0L C;  1NYH A;  1EZV G;  1S5L H;  2OAR A;  4ASW A;  3H1I J;  1W5C E;  2FYN C;  2Y0E A;  1OW6 A;  2NZ2 A;  1SFC B;  1FZC A;  3JC2 2;  2AXT H;  1HH0 A;  5AW3 B;  1X9V A;  1DD4 A;  2KNC A;  3HE5 B;  1LT9 A;  4B86 A;  2W6B A;  3TNU B;  2YIU B;  3RL0 C;  2KS1 A;  1NTK G;  1X8Y A;  4H13 D;  4HH2 A;  4I6M C;  3BVH A;  5KLV G;  4K35 A;  1SQX K;  1OZH A;  1SFC C;  3A0B E;  5GTI E;  2HPC A;  1NTZ J;  4UB6 H;  3M91 A;  1AFO A;  4PV1 B;  4D6T D;  3BAT A;  1RHZ B;  1GW3 A;  2H88 C;  1ZOY C;  3OW2 O;  1VQM P;  3AEF C;  4WY4 C;  2E76 D;  4AYC A;  5KJ7 C;  3WMM 0;  4DJG A;  1OVU A;  3GF7 A;  1P84 I;  2YIU C;  4EIJ A;  1CI6 B;  2WZ7 A;  3VMZ A;  2QJP B;  1R8E A;  5L8R J;  3D70 A;  2HFE D;  1PFI A;  1VL2 A;  2WT7 B;  4O9B A;  2ZT9 C;  1VQL P;  1L2P A;  1KZU B;  4PV1 C;  1URQ A;  4PD4 E;  1EXJ A;  1GMJ A;  3M06 A;  5H2F E;  3RK3 D;  3NFQ A;  3CME P;  2QJP C;  3HUS B;  3AEB C;  4IL6 X;  2RH0 A;  1DX7 A;  2JJL A;  1IFM A;  3AE2 C;  4XA4 A;  3B5N A;  1FBM A;  2IYP A;  1T8Z A;  3AE8 C;  1FC2 C;  1EZV E;  1HF9 A;  4D6T G;  2O01 J;  2W83 C;  1AV1 A;  3C8V A;  3GW6 A;  2KZI A;  1FDO A;  2YNY A;  4GIF A;  2M3B A;  3LID A;  3HUS C;  3EQ2 A;  5GTH H;  2XU6 A;  1QX8 A;  2FYU D;  2QE7 H;  2PFX A;  3AE1 C;  2FBW C;  2K9J A;  3SWF A;  2I8D A;  2ZYG A;  1YHQ P;  1Q86 Q;  4YTP C;  1VQ7 P;  4WB4 A;  4W7Y A;  1L0N G;  2YO2 A;  1FZF A;  1JO5 A;  1PZQ A;  3C1L A;  1JY3 O;  3NTN A;  3VN0 A;  3G71 P;  2WSF H;  3HD7 B;  3H1L J;  1VF5 D;  2D2C D;  3CL3 D;  1JUN A;  1PIX A;  2HR3 A;  3SFE C;  2WPR A;  3QH9 A;  1QL1 A;  2Y9Y A;  1ZLL A;  2V4H A;  5CJ0 A;  4OGQ D;  4BRY A;  1N7S B;  2A45 G;  2Q3I A;  1Q2N A;  1M7L A;  3IFM A;  3V2N A;  2JR8 A;  2N1T B;  1PGQ A;  2AEJ A;  2YXQ B;  1W2B O;  3MD0 A;  3HD7 C;  1YJ9 P;  1NTZ D;  2WPV B;  2JP3 A;  1NH4 A;  3BRT B;  3PHL A;  3K5B A;  1JB0 J;  3CCE P;  1T3J A;  2KSJ A;  3MTU E;  1PGO A;  2WSC H;  2AXT E;  1LP1 B;  1N7S C;  1OW7 A;  2QJY B;  2L91 A;  5APY A;  4WVZ A;  2FYU G;  1LTJ B;  3BCC J;  3RBX A;  1RF0 C;  3WU2 H;  1FDM A;  3A0H E;  4OVN F;  1KC8 Q;  3KHU A;  4DOJ A;  1N73 C;  1KYO D;  3L74 J;  3H1K E;  1QVG O;  1AVY A;  2R5B A;  1NTK J;  1SQV J;  3VMX A;  3H32 B;  5KLV J;  2A06 D;  4IFD K;  2N9Y B;  3L73 J;  4H13 C;  2HLO A;  3GG2 A;  3T97 B;  1U7J A;  1LTJ C;  4Y99 B;  3B71 A;  1YIJ P;  3CX5 E;  2V7Q J;  5APV A;  3LW5 H;  1SFC D;  4GT1 A;  1H88 A;  3HRN A;  3CC7 P;  2WWW A;  3A2A A;  2RMZ A;  3JSV C;  1NTZ G;  1JNM A;  2E76 C;  1MFZ A;  1YBK A;  1ZR4 A;  1YJW P;  1L0N E;  2OYH B;  2FFD B;  2ZVN B;  3D71 A;  1LWU A;  2B9B A;  4IL6 E;  5GTI H;  1NU1 J;  2C9N Y;  2QM7 A;  2KIK A;  4C46 A;  2NRG A;  4Y99 C;  2KYV A;  1GZL A;  1KIL A;  4OWF A;  4JPZ B;  3WUV A;  3RK3 E;  4XE5 B;  1K73 Q;  5KLV K;  4PV1 D;  3PP5 A;  2DW3 A;  2M5A A;  3H1L D;  3L71 E;  2IBZ I;  1KQG B;  2POH A;  2OYH C;  2FFD C;  1FOS F;  3AEA C;  2P10 A;  5DJT B;  3V5B A;  1NWQ A;  4N78 D;  2A06 G;  1EDI A;  4GOD A;  3EFG A;  4PD4 H;  2QEX P;  1NTM D;  5AVX B;  1FZE A;  3P8C D;  4D6T J;  5GTH E;  5H2F H;  1JY3 P;  5TIS E;  1RF1 B;  1P84 D;  1LTT C;  2NPS B;  1SLQ A;  2SPZ A;  1KTM A;  2FYU E;  4U3F J;  2IDB A;  4N3Y B;  3P32 A;  3H1I E;  1SQQ D;  2KLU A;  1EDL A;  3FXE A;  3LIE A;  2FXP A;  1SFC A;  3G6E P;  3FGA D;  1GD2 E;  3SFD C;  3VOP A;  3RK2 B;  4JQ0 D;  3B4S A;  3AE6 C;  3M0A A;  2MKV A;  3CCM P;  2XNX A;  1JTH B;  3BCC D;  4WY4 A;  2PRR A;  4L74 A;  3VMA A;  2NPS C;  3V4Q A;  5APW A;  5KJ7 A;  3HE5 A;  2E74 B;  2IZ1 A;  3ABV C;  3TNU A;  1DEE G;  5AW8 B;  3TYY A;  2JKV A;  2LR2 A;  3H1L G;  3AE9 C;  3L74 D;  1HWT C;  1GK4 A;  1ZME C;  1SQV D;  1NTZ E;  1T2K D;  5E79 E;  4NPE A;  3L73 D;  3KZI E;  2IFN A;  1KIL E;  2YMK A;  3MUD C;  1SS1 A;  3PLN A;  1NTM G;  3CWB J;  1FZA A;  2L5G B;  1KB9 H;  3HD7 D;  2E74 C;  2WSE H;  1X22 A;  2KB7 P;  1CI6 A;  3CXH H;  2M3E A;  1L0N K;  1GL2 B;  1S3J A;  5K5G B;  1ZRT E;  2K3R A;  3QWO C;  1RE3 C;  4DCK A;  2WT7 A;  1QL2 A;  1KOR A;  1SQQ G;  2H7H A;  1OWA A;  1VQ4 P;  4HKZ H;  1VQK P;  1N7S D;  3V6I A;  1NU1 D;  4I7Z B;  1LGH B;  1HGV A;  1KYO E;  1PGP A;  1LTS C;  1M1J B;  2Y9Z A;  2N1T D;  3BCC G;  2A06 E;  1A02 F;  1GL2 C;  3HUS A;  1XTG B;  3TGU D;  4NPF X;  4GOF A;  3IAO A;  4UB8 E;  2QRX A;  3MHV A;  3RBZ A;  3Q5P A;  3L70 D;  4WBA A;  1PGJ A;  3L74 G;  3A0H H;  3VP8 A;  1UII A;  2J58 A;  2P67 A;  1FOS E;  5KTB A;  4C7R A;  1SQV G;  2IZ0 A;  1M1J C;  2P7J A;  3L73 G;  4JBZ A;  3AE4 C;  1OMI A;  4BWN A;  2B87 B;  3SWK A;  3S4R A;  3TK1 A;  1BCC J;  2ZYA A;  2FYU K;  1GDT A;  3L75 J;  1GTW A;  3AE7 C;  4U3F D;  3CX5 H;  1AVO A;  2AXC A;  4LC1 A;  1N2D C;  1MUU A;  1EDJ A;  4PD4 I;  1KFN A;  3HD7 A;  3L72 D;  3FWN A;  1JY3 N;  3M9B A;  3H1L E;  1HVV A;  1NU1 G;  2I1J A;  2CPB A;  1BGY J;  1H8A A;  4LGD E;  2Q3E A;  2Y0C A;  5CBN A;  1T3U A;  4N78 E;  4IL6 H;  4DZO A;  2O01 N;  2Q7C A;  1AQT A;  1N7S A;  3TGU G;  2XZR A;  1IO4 A;  3L70 G;  1RF0 A;  1N7L A;  1BSN A;  3CCQ P;  1VQ8 P;  1P84 E;  1NTZ K;  3O8Z A;  3A5T A;  1JCD A;  3S1K A;  1Z56 A;  1NO4 A;  1N73 A;  3WUT A;  3CC4 P;  5KAF E;  1S2E A;  1FZC B;  4KJM A;  2G8Y A;  4H44 B;  2OYI B;  1PV3 A;  4RES B;  3JCU E;  1LTA C;  4I1L A;  3HTK B;  2WIT A;  1S72 P;  3CWB D;  4XFJ A;  2IYO A;  2VRS A;  4Z1M H;  2OTJ P;  1HJ0 A;  1LP1 A;  2M0B A;  4RKU J;  1OVR A;  1LTJ A;  2KS1 B;  4U3F G;  3BCC E;  4HJG H;  5TIS H;  2E5T A;  1IK7 A;  2OTL P;  3FWL A;  2IBZ D;  1SQX D;  3L72 G;  3U59 A;  2CPS A;  3D6Z A;  1K04 A;  2OYI C;  3L74 E;  5TJH A;  3H1J D;  1K9M Q;  3H32 A;  1MFT A;  3Q1M A;  1IFN A;  3II6 A;  2NPS D;  1NTK E;  1SQV E;  5KLV E;  1CZQ A;  1KQF B;  3L73 E;  1YTZ I;  2M8R A;  1KB9 E;  2P58 A;  3A3Y B;  2YO3 A;  1LTG C;  1HJB A;  2AEM A;  3CXH E;  1NTM J;  1T2K C;  2R5D A;  1FE6 A;  1PP9 D;  1YQ4 C;  3VP9 A;  5AVZ B;  3RK2 D;  1S9K D;  5KKZ B;  1URQ B;  1YYC A;  4LLH A;  1SQB J;  2OYH A;  2GUS A;  2FFD A;  5BU5 A;  5B66 H;  3I56 P;  3E1R A;  4YXD C;  2E74 D;  3I55 P;  1SQQ J;  3CWB G;  1BCC D;  4WWI A;  2P2U A;  2KLV A;  1OW8 A;  1VQ6 P;  1NU1 E;  1SQP J;  5E79 H;  2GA1 A;  3KZI H;  4C7N B;  1L0L J;  1WRG A;  3L75 D;  3KXD A;  1JOC A;  1ZW0 A;  3CMA P;  2CK3 H;  1ZP0 C;  3B5N B;  2O1K A;  1M90 Q;  2N1T C;  2AEF A;  2IBZ G;  3PRJ A;  1SQX G;  1Q81 Q;  2C9L Y;  5CBO A;  1RH5 B;  3N4X A;  3H1H J;  2PP6 A;  5AVQ B;  2BCC D;  1BGY D;  2W6A A;  3H1J G;  2K88 A;  1AJY A;  4CPG A;  1KFM A;  3CX5 I;  5AW7 B;  1GL2 D;  1ZV8 A;  3W68 A;  1KYO H;  2KP8 A;  5AW2 B;  4AQR D;  2H89 C;  2YKO A;  2JWD A;  1M1K Q;  2QJY C;  1N86 A;  1VQO P;  2I1K A;  4EOT A;  4D6T E;  1L4A B;  3O6Q A;  2PAJ A;  2NPS A;  3CD6 P;  2MJZ A;  1EQ7 A;  1PP9 G;  1ZXG A;  5KAI E;  2ZFC A;  2E75 D;  4UB8 H;  4ASV A;  4W80 A;  4U3F E;  1BDC A;  3E1I A;  5AW0 B;  2O1J A;  5AVS B;  3FX0 A;  3SSU A;  2WMM A;  2KSE A;  1BCC G;  3L35 A;  3NXS A;  3C9I A;  4BRY B;  2QSI A;  3MUD A;  3IN6 A;  3L75 G;  2O01 H;  1JTH A;  1L4A C;  2IFM A;  1BDD A;  3PTZ A;  1JCC A;  1USD A;  3AED C;  4TT3 H;  1E79 H;  2K9Y A;  3MGN A;  4L75 A;  1RE3 A;  3TGU J;  5CMZ A;  1NTK K;  1SQV K;  2WTY A;  3L70 J;  4GOE A;  2BCC G;  1BGY G;  1TU3 F;  2J5U A;  1SVF A;  2R3S A;  1VQ5 P;  1QGK B;  3KPE A;  5CCH D;  4IFF A;  1Q90 D;  2HOD A;  3OJA B;  3KQG A;  3M9H A;  3P7K A;  4KHX A;  3CWB E;  1E5W A;  1FS0 E;  3CCS P;  1JM0 A;  1GL2 A;  1Y9B A;  3FXD A;  5BVZ A;  1MZ9 A;  4PD4 D;  3AE3 C;  4QMA A;  1J1E B;  1SQB D;  1WT6 A;  1P84 H;  3V4W A;  1NU1 K;  1DEB A;  1CW5 A;  3NMD A;  3RL0 g;  3L4F A;  2IBZ E;  4OH8 B;  3E7K A;  1M1J A;  5KAF H;  1SQP D;  3BRV B;  3L72 J;  1L0L D;  1NKZ B;  2PGD A;  3JCU H;  4HB1 A;  1JMM A;  2B89 A;  3MIW A;  1G2C B;  5APX A;  4R4M A;  3A7O A;  2BEQ D;  4HYT B;  2R44 A;  1RF1 C;  2YKP A;  1JMB A;  1IK9 A;  2R3C A;  4H44 D;  2K37 A;  2UWJ E;  3H1H D;  3VTP C;  5AW6 B;  2XKM A;  1LWU B;  5AW4 B;  2OQQ A;  2ZVO B;  5KLI B;  1FZB A;  5B66 E;  1KN7 A;  1KIL B;  1YIT P;  2LKM A;  3RK2 C;  3MZW B;  3BAS A;  1M57 D;  1IFI A;  1BCC E;  3KYQ A;  3GF3 A;  2Z5H A;  1WMK A;  4H0L B;  3PH0 A;  1LTB C;  3L75 E;  2M5A B;  3IF4 A;  5AW9 B;  4MN4 C;  1SQB G;  2V7Q H;  1IFD A;  2RKL A;  5KLI C;  1FDI A;  2N9B A;  2XV5 A;  3Q2Y A;  3EWK A;  1YI2 P;  3R2P A;  4IFM A;  1LJ2 A;  1SQX J;  1SQP G;  1GU5 A;  1L0L G;  1BGY E;  3Q3D A;  2QG4 A;  1QEX A;  2E75 B;  1J1D B;  3H1J J;  2Q1K A;  2KXP B;  3N7N A;  2E5Y A;  5CHX A;  2JEE A;  1URQ D;  1BSH A;  1ZR2 A;  2WSF J;  4BXL A;  3RL0 B;  1VPC A;  4M3L A;  2FXO A;  3H1H G;  5M1B A;  4EI2 A;  1S5L X;  1PP9 J;  1BE3 J;  5BU8 B;  1OXZ A;  2YKQ A;  2OYI A;  4KT0 J;  4IOI H;  4I7Z C;  3B5N D;  2W8Z A;  3HTK A;  1FZG A;  3CLQ A;  1M8O B;  2E75 C;  1J1D C;  4WY4 B;  2LXB A;  2FY8 A;  2WVR A;  3M0D C;  3U1C A;  1NHL A;  4PJ0 E;  4GDO A;  3H1K D;  4L73 A;  2E43 A;  1VQN P;  1H0T B;  1FU1 A;  3GLM A;  1OIP A;  5AVT B;  1NAY A;  1KMI Z;  2ZT9 B;  5KAI H;  5CCG C;  2WSC J;  3S9O A;  3GHG B;  1S1C X;  3H6P A;  3HE4 B;  3CX5 D;  1L4A D;  5C39 A;  4ZMD A;  1Q82 Q;  1JY2 O;  2BCC J;  2QM8 A;  1K8A Q;  2KOG A;  3W67 A;  1IZN B;  1RE4 C;  4R4L A;  4U7J A;  1L0N D;  2Q5U A;  1IFJ A;  1J2J B;  2ZXX A;  1NTM E;  5CCH C;  3AEG C;  1EZV I;  3G9R A;  3P8C E;  2N1T A;  3CCJ P;  3GHG C;  1IC2 A;  1GW4 A;  1LTI C;  1SQB E;  2A45 H;  2IPP A;  2ZYD A;  1SQQ E;  3LW5 J;  5B5E E;  4C7N A;  1XTC C;  1RQV A;  1Y8A A;  1SQP E;  1EC5 A;  3L71 D;  1L0L E;  1Y47 A;  3H1K G;  2KNC B;  1LT9 B;  3CC2 P;  3V2P A;  1NOH A;  1YQ3 C;  4JF7 A;  4A7P A;  1FJK A;  3WUU A;  1JEK A;  2HPC B;  2Y0D A;  3H1H E;  1MKM A;  1KB9 I;  1FZC C;  1S4X A;  1NJI Q;  4NPD A;  4H44 C;  5APU A;  2ZXE B;  4K3A A;  3CXH I;  3H25 A;  1T6A A;  2Q9I A;  2P1J A;  2JO1 A;  3H1I D;  1LT9 C;  1L4A A;  3T97 A;  1UIX A;  4Y28 J;  5APS A;  1SP4 A;  1NGM B;  2WSS H;  1R5S A;  1BE3 D;  1HTL C;  1LNQ A;  1PPJ D;  5APT A;  1KQL A;  4N6J A;  5APQ A;  1G1J A;  3TSI A;  1U57 A;  1ZN5 A;  2JWA A;  3L71 G;  2Z5I A;  4RO0 A;  2O3J A;  2XDJ A;  1S5L E;  2XND H;  2QVA A;  2K1A A;  1NKN A;  4ZNC A;  1H89 A;  2C0W A;  1N73 B;  2KZJ A;  1KQS O;  1KIL D;  2KUB A;  3V2Q A;  1W2E A;  5AW1 B;  5KKZ C;  3TGU E;  3R4Y A;  1URQ C;  3P8M C;  3L70 E;  2ITA A;  4H0L D;  4H13 B;  2G3A A;  2Q6Q A;  1ZRT D;  1NTM K;  3AE5 C;  3CCL P;  1IFP A;  1MV8 A;  2YXR B;  3H1I G;  3VMY A;  3Q5S A;  1QVF O;  2BEZ F;  1DD3 A;  2K9J B;  3B5N C;  1RF1 A;  1KD1 Q;  1SQB K;  4DT0 A;  2E76 B;  4UB6 E;  1BE3 G;  1AQ5 A;  1SQQ K;  4W7Z A;  3CCR P;  1JY2 P;  1PPJ G;  2LXC B;  3CCV P;  1SQP K;  3V2R A;  1HBW A;  3KDP B;  1L0L K;  1A02 J;  2WSE J;  3RL0 D;  1M56 D;  2KI7 B;  3G4S P;  3L72 E;  2J59 M;  2W27 A;  5CJ4 A;  1G2C A;  4AUW A;  3F5H A;  3TDK A;  3USS A;  4YPC A;  3OAK A;  2A45 I;  5CCG D;  4PJ0 H;  5DJU B;  4ZKU A;  5AVY B;  3Q5R A;  5AVU B;  1NAF A;  3RK3 B;  4TLF A;  4WY4 D;  1USE A;  1N8R Q;  2QA4 P;  2WPS A;  4RJT A;  3A0B H;  5KJ7 D;  2C0X A;  3EFF K;  3M9Q A;  3CPW O;  3PJS K;  1X79 B;  2RN0 A;  1Q7Y Q;  2H8P D;  1CSB A;  1IJD B;  2ZT9 D;  2FYZ A;  3TF5 A;  4JYC A;  3AEC C;  1HUC A;  1OX3 A;  1X0T A;  3I5C A;  3RK3 C;  1YTZ T;  2BAS A;  2FKW B;  3H1K J;  2IX7 C;  1VQ9 P;  3F89 A;  3VYI A;  1VDF A;  1G1I A;  2QIW A;  3U1A A;  1DH3 A;  1SQX E;  1OFC X;  1VQP P;  4EDF A;  2WQY C;  5AVR B;  2WPQ A;  2E42 A;  3O6Q B;  1VF5 B;  2D2C B;  3M0D A;  1FJP A;  3H1J E;  5B5E H;  1U7M A;  1EXI A;  2FXM A;  1YJN P;  3L36 A;  3G3Z A;  1OVV A;  1EZV D;  4OGQ B;  1L0N J;  1HGZ A;  3ZDM A;  1J1E C;  5CCG A;  5AW5 B;  4YXW H;  2QJK B;  1RQU A;  1PP9 E;  3ITK A;  5AVV B;  1FAV A;  1BE3 E;  4EYY Q;  2KK7 A;  1S9K E;  1PPJ E;  4JYB A;  2W6J H;  1R5L A;  2JDI H;  1GK6 A;  1VF5 C;  1EDK A;  1QLE D;  2D2C C;  3UIA A;  1D7M A;  2B87 A;  2OTK E;  2Z4E A;  3RGU A;  1GU4 A;  1RE4 A;  1H0T A;  5AVW B;  2B88 A;  2HYN A;  1RY3 A;  4OGQ C;  3L71 J;  3B8E B;  4ZKP A;  5CCH A;  1NTK D;  5KLV D;  4GKG A;  1PL5 A;  2FYN B;  2OYO A;  2QJK C;  1KYO I;  2R32 A;  3GMA A;  3CI9 A;  3GHG A;  2YMY A;  3SWY A;  2GUV A;  1LWU C;  3CCU P;  1KB9 D;  4L76 A;  5EFW B;  3HE4 A;  3OA7 A;  4I2L C;  1LT1 A;  2W90 A;  3AEE C;  3CXH D;  1NVO A;  2HOD B;  1KIL C;  2OGU A;  2HG5 D;  3MP7 B;  1KV4 A;  3L37 A;  2BCC E;  1AA0 A;  2ZAE B;  3WU2 E;  1JY2 N; 
#chains in the Genus database with same CATH homology
 3IR9 A;  3V5B A;  1NWQ A;  2GM4 A;  3B5N B;  2O1K A;  2A45 H;  2H43 A;  4N78 D;  2IPP A;  2OAR A;  2N1T C;  3EFG A;  5AVX B;  4C7N A;  2C9L Y;  1FZE A;  1XTC C;  3P8C D;  3N4X A;  2PP6 A;  5AVQ B;  1JY3 P;  1RF1 B;  1SFC B;  1LTT C;  2W6A A;  1KFM A;  1LT9 B;  2NPS B;  3V2P A;  1SLQ A;  1NOH A;  1FZC A;  5AW7 B;  1GL2 D;  1HH0 A;  1ZV8 A;  5AW3 B;  4JF7 A;  2KP8 A;  5AW2 B;  4AQR D;  1FJK A;  4N3Y B;  1X9V A;  3P32 A;  2YKO A;  3LIE A;  1N86 A;  2I1K A;  1SFC A;  4EOT A;  2HPC B;  1L4A B;  3HE5 B;  2PAJ A;  1GD2 E;  1FZC C;  1LT9 A;  2NPS A;  4B86 A;  2MJZ A;  1EQ7 A;  2W6B A;  3VOP A;  3RK2 B;  3TNU B;  5APU A;  2ZXE B;  3RL0 C;  2ZFC A;  3M0A A;  1X8Y A;  4HH2 A;  4I6M C;  3BVH A;  2Q9I A;  2P1J A;  4W80 A;  2XNX A;  1SQX K;  1JTH B;  4WY4 A;  1SFC C;  3E1I A;  5AW0 B;  1LT9 C;  1L4A A;  2NPS C;  2O1J A;  3M91 A;  5APW A;  3T97 A;  3V4Q A;  3HE5 A;  5APS A;  1SP4 A;  5AVS B;  5KJ7 A;  1AFO A;  3TNU A;  3BAT A;  5AW8 B;  1GW3 A;  3TYY A;  3L35 A;  3NXS A;  3C9I A;  3MUD A;  4WY4 C;  1HWT C;  1GK4 A;  2O01 H;  1JTH A;  1L4A C;  4AYC A;  5KJ7 C;  3WMM 0;  2IFM A;  1JCC A;  1HTL C;  5APT A;  4EIJ A;  1CI6 B;  2WZ7 A;  3VMZ A;  1T2K D;  1KQL A;  4N6J A;  2IFN A;  2HFE D;  2HPC A;  3MGN A;  5APQ A;  1PFI A;  1G1J A;  1RE3 A;  3TSI A;  5CMZ A;  2WT7 B;  4O9B A;  1NTK K;  1SQV K;  1ZN5 A;  2WTY A;  1FZA A;  2L5G B;  2Z5I A;  1KZU B;  3HD7 D;  2WSE H;  2XDJ A;  2KB7 P;  1CI6 A;  1URQ A;  1SVF A;  1L0N K;  1GL2 B;  1NKN A;  1H89 A;  3M06 A;  2C0W A;  3KPE A;  1N73 B;  1RE3 C;  5CCH D;  4IFF A;  1KIL D;  2WT7 A;  3V2Q A;  1W2E A;  1QL2 A;  3RK3 D;  3NFQ A;  2HOD A;  3OJA B;  5AW1 B;  3KQG A;  3M9H A;  3P7K A;  4KHX A;  1URQ C;  3P8M C;  1OWA A;  1E5W A;  2H7H A;  3HUS B;  1DX7 A;  1N7S D;  1GL2 A;  1LGH B;  2JJL A;  1HGV A;  1IFM A;  1LTS C;  1M1J B;  4XA4 A;  5BVZ A;  1MZ9 A;  2N1T D;  3B5N A;  1FBM A;  1J1E B;  1NTM K;  1WT6 A;  3V4W A;  1T8Z A;  1NU1 K;  1DEB A;  1MV8 A;  3VMY A;  1A02 F;  1CW5 A;  1GL2 C;  3HUS A;  3NMD A;  1XTG B;  3L4F A;  4OH8 B;  1M1J A;  3B5N C;  1RF1 A;  3BRV B;  1SQB K;  4WBA A;  1NKZ B;  3VP8 A;  2YNY A;  1JMM A;  2J58 A;  4GIF A;  2P67 A;  2M3B A;  1G2C B;  3LID A;  3MIW A;  5APX A;  3HUS C;  1FOS E;  1AQ5 A;  3EQ2 A;  1SQQ K;  5KTB A;  4W7Z A;  3A7O A;  2XU6 A;  4C7R A;  1JY2 P;  4HYT B;  1SQP K;  3V2R A;  1M1J C;  1HBW A;  1RF1 C;  2YKP A;  3SWF A;  2P7J A;  3KDP B;  1L0L K;  1A02 J;  1IK9 A;  2R3C A;  4WB4 A;  4W7Y A;  3RL0 D;  2YO2 A;  1FZF A;  1JO5 A;  3TK1 A;  1JY3 O;  2J59 M;  2W27 A;  3NTN A;  5CJ4 A;  3VN0 A;  2WSF H;  2FYU K;  3HD7 B;  1G2C A;  4AUW A;  3VTP C;  1GDT A;  5AW6 B;  2XKM A;  1LWU B;  3OAK A;  5AW4 B;  3CL3 D;  1JUN A;  2A45 I;  1GTW A;  5CCG D;  1FZB A;  2WPR A;  4ZKU A;  5AVY B;  1KIL B;  2LKM A;  4LC1 A;  3RK2 C;  1N2D C;  1MUU A;  3BAS A;  5AVU B;  1NAF A;  3RK3 B;  1KFN A;  1QL1 A;  3HD7 A;  4WY4 D;  1ZLL A;  2WPS A;  5CJ0 A;  1IFI A;  3KYQ A;  5KJ7 D;  2C0X A;  1JY3 N;  3M9B A;  1N7S B;  2A45 G;  2Z5H A;  2Q3I A;  1HVV A;  1M7L A;  2I1J A;  3M9Q A;  3IFM A;  3V2N A;  1LTB C;  2CPB A;  2N1T B;  1H8A A;  1X79 B;  4LGD E;  3MD0 A;  5AW9 B;  3HD7 C;  1T3U A;  4N78 E;  4DZO A;  2H8P D;  1CSB A;  1IJD B;  2Q7C A;  1IFD A;  2FYZ A;  4JYC A;  1N7S A;  1NH4 A;  2N9B A;  2XV5 A;  2XZR A;  3BRT B;  1IO4 A;  1HUC A;  3R2P A;  4IFM A;  1T3J A;  1RF0 A;  1N7L A;  2KSJ A;  3I5C A;  3RK3 C;  1GU5 A;  3MTU E;  1NTZ K;  2WSC H;  3O8Z A;  1YTZ T;  2BAS A;  3A5T A;  2FKW B;  1JCD A;  2IX7 C;  1Z56 A;  1NO4 A;  1N73 A;  1N7S C;  1J1D B;  3VYI A;  1VDF A;  3N7N A;  5APY A;  5CHX A;  2JEE A;  1URQ D;  1G1I A;  1LTJ B;  1FZC B;  1ZR2 A;  1RF0 C;  3U1A A;  2OYI B;  3RL0 B;  1FDM A;  1VPC A;  4RES B;  1LTA C;  1DH3 A;  4I1L A;  3HTK B;  2WIT A;  4DOJ A;  2VRS A;  1N73 C;  4M3L A;  5AVR B;  2WPQ A;  2E42 A;  3M0D A;  1FJP A;  1LTJ A;  5BU8 B;  2FXM A;  1OXZ A;  2YKQ A;  2R5B A;  2OYI A;  3VMX A;  3L36 A;  3H32 B;  1FZG A;  3G3Z A;  3B5N D;  3HTK A;  3CLQ A;  4IFD K;  4WY4 B;  1J1D C;  2HLO A;  3M0D C;  1HGZ A;  3U59 A;  1J1E C;  1LTJ C;  1NHL A;  2CPS A;  4Y99 B;  3U1C A;  5CCG A;  5AW5 B;  2OYI C;  2E43 A;  5APV A;  3LW5 H;  5AVV B;  1FAV A;  3H32 A;  1SFC D;  4GT1 A;  1H88 A;  3HRN A;  1FU1 A;  1IFN A;  2WWW A;  3A2A A;  2NPS D;  3II6 A;  1S9K E;  4JYB A;  5AVT B;  1GK6 A;  1CZQ A;  3UIA A;  5CCG C;  1JNM A;  1MFZ A;  1ZR4 A;  1YTZ I;  2M8R A;  2Z4E A;  2OYH B;  3GHG B;  2FFD B;  3A3Y B;  2YO3 A;  1LTG C;  1HJB A;  1GU4 A;  1RE4 A;  3H6P A;  3HE4 B;  1T2K C;  1L4A D;  1LWU A;  5AVW B;  2R5D A;  2C9N Y;  2HYN A;  2QM7 A;  3VP9 A;  5AVZ B;  1RY3 A;  3RK2 D;  3B8E B;  4C46 A;  4ZKP A;  4Y99 C;  1JY2 O;  2KYV A;  2QM8 A;  5CCH A;  1S9K D;  2KOG A;  1GZL A;  1KIL A;  4GKG A;  1URQ B;  1YYC A;  2R32 A;  3CI9 A;  4LLH A;  2OYH A;  3GHG A;  1RE4 C;  2GUS A;  2FFD A;  2YMY A;  3SWY A;  2GUV A;  1LWU C;  5BU5 A;  3HE4 A;  3OA7 A;  2Q5U A;  1IFJ A;  4I2L C;  4XE5 B;  1J2J B;  2HOD B;  5KLV K;  2P2U A;  3PP5 A;  5CCH C;  2KLV A;  1KIL C;  2HG5 D;  3P8C E;  2N1T A;  2POH A;  4C7N B;  1WRG A;  2OYH C;  3L37 A;  3GHG C;  2FFD C;  1IC2 A;  1GW4 A;  1JY2 N;  1LTI C;  1FOS F;  1JOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...