2WTYA

Crystal structure of the homodimeric mafb in complex with the t-mare binding site
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
94
structure length
94
Chain Sequence
b'SDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKSEKLANSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTION FACTOR MAFB
publication title Design of a bZIP Transcription Factor with Homo/Heterodimer-Induced DNA-Binding Preference.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 38
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03131 bZIP_Maf bZIP Maf transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wtyA00
2WTYA 5AVWB 2P67A 5AVZB 1KQLA 3HE5B 1GU5A 4GKGA 5AW6B 3V4WA 1SP4A 1DH3A 1NWQA 4C7NA 1J2JB 2QM7A 1MFZA 3UIAA 2XV5A 3HTKA 3P8MC 3TYYA 4DZOA 3A7OA 5AVXB 1S9KD 3KQGA 1GD2E 3IR9A 1GK4A 2R5DA 2H7HA 5AVSB 2Q5UA 5APWA 3MD0A 4C7NB 3M9BA 3L35A 2P7JA 1CZQA 4I6MC 3VN0A 5AW1B 5APUA 1T2KC 3TK1A 2XU6A 5APSA 1OWAA 3MGNA 5AW5B 2R5BA 5AVYB 1GK6A 3OAKA 4I2LC 3VMXA 3NXSA 5CMZA 3L36A 5AVRB 2R3CA 3HE4A 5APQA 3VMZA 2P2UA 2YO2A 3NMDA 5AVQB 4HYTB 2W27A 2Q7CA 2ZXEB 1CSBA 3P7KA 4B86A 2Z5IA 1FOSF 4RESB 5AW2B 1CI6A 2BASA 3M0DA 3HE4B 3VTPC 1SLQA 5AVVB 2Q3IA 3NFQA 2E42A 4JYBA 1JNMA 3TNUA 3A3YB 1CI6B 3M9HA 2VRSA 3V4QA 2YNYA 2WT7A 1MUUA 1H8AA 3M91A 1HWTC 2IPPA 5APXA 2R32A 2E43A 5AVTB 5AVUB 2WPSA 2QM8A 1A02J 5AW4B 3TNUB 3A5TA 2JJLA 3M0AA 4GT1A 3I5CA 4JYCA 2ZFCA 5APVA 5AW3B 1X8YA 2WT7B 3L37A 1GTWA 2YO3A 3VMYA 2KP8A 2Z5HA 1G2CB 2WPRA 1T2KD 3V5BA 4LC1A 3P32A 5APYA 4AYCA 5AW9B 3O8ZA 1HBWA 5AW7B 2WPQA 4XE5B 1GU4A 2C9NY 5AW0B 3NTNA 4C46A 4AQRD 1HJBA 1HUCA 1MV8A 4EOTA 2W6AA 2XZRA 3B8EB 1S9KE 3SWFA 2C9LY 1FAVA 5APTA 1NAFA 1H89A 1GZLA 2WWWA 3LIEA 3HE5A 4AUWA 1IO4A 3KDPB 1YYCA 2N9BA 1H88A 3M06A 1OXZA 4KHXA 3T97A 1JUNA 3VYIA 4M3LA 3LIDA 1FOSE 3A2AA 5AW8B 1A02F
chains in the Genus database with same CATH superfamily
2WSSH 1RE3A 1NWQA 1RE4A 1OW8A 2XV5A 3WMM0 3A7OA 5AVXB 1JY3O 3AEDC 2FYNB 1GK4A 2NPSC 1QVGO 1NTZG 3SFEC 3CMAP 4YXDC 3HTKB 2YKPA 1G1IA 3EQ2A 3R4YA 4PV1D 2FYZA 3NXSA 1T8ZA 1FDMA 5EFWB 1X0TA 1LTGC 1BGYJ 4W7YA 2E42A 1NVOA 1K05A 1URQC 1KV4A 2XKMA 1IFIA 2BEQD 1X9VA 2M3EA 3CCJP 1MUUA 3CCRP 2KIKA 2WPSA 2QM8A 3PH0A 2QE7H 1GTWA 4ASVA 3BRTB 4LC1A 3L73D 2RMZA 3AEFC 1M90Q 1SQPK 2JP3A 4IFDK 2N1TD 4PJ0E 2JWDA 2Y9ZA 1HGVA 3IAOA 1JMMA 1TU3F 1SQVJ 4Y99B 1AA0A 4H0LD 1P84E 1LTJB 1SQPG 1S9KD 3WUTA 1RF1C 2ZT9B 1KB9D 3MTUE 4OH8B 5AVSB 5APWA 3V2NA 2FXOA 2QJPB 4I6MC 2G3AA 2V7QH 3Q5SA 1WRGA 1QGKB 2MKVA 2WITA 1NTMD 5APQA 2JKVA 2KZJA 1S2EA 2K9JA 2FYUD 2OGUA 2Z5IA 1EZVE 1OVRA 3CXHD 2DW3A 1NKZB 3U59A 3CCQP 1CI6B 3RBZA 3CX5E 1BDCA 2VRSA 5CBOA 2YNYA 1EDIA 5CCGD 4I7ZB 3H1ID 2Y0EA 2AEMA 2K3RA 1KILB 1P84I 4O9BA 2E74C 2R3SA 1M1JB 2AXCA 4BRYB 1LT9A 4PD4H 5AW0B 1JY3P 1FZBA 2PAJA 3D6YA 2Q3EA 1AQ5A 3AEEC 4W7ZA 2KZIA 2RH0A 4OGQC 1PPJE 3KDPB 1YYCA 1OXZA 3PRJA 3I56P 1FBMA 1JUNA 3H1HJ 3ITKA 3R2PA 1GL2B 1VQLP 3HE5B 5KJ7C 3RK3B 1EZVI 1FZCC 1DH3A 1M7LA 3AE5C 3H32A 3H1JE 1RQUA 1AVOA 3IR9A 1SS1A 1XTGB 3L35A 2IZ1A 3L73G 3MGNA 3Q5PA 2FKWB 3H6PA 1AFOA 1YJWP 2B87B 2QVAA 1LTIC 2K88A 1NU1D 2D2CC 5AW2B 4R4LA 5B5EE 1VQOP 1USDA 1BSNA 3NFQA 1EXJA 5KAFE 1KQFB 1YHQP 1IZNB 2I1KA 4H44C 1L0ND 1VPCA 5TJHA 4Z1MH 1G2CA 1U57A 3BASA 2G8YA 3HD7A 3L75D 2ZT9D 2PFXA 2P1JA 1S1CX 4IL6H 3WUUA 3V5BA 1T6AA 3P32A 1NTMG 4C46A 4AQRD 1NJIQ 3CI9A 2E75C 2W6AA 2FYUG 4EI2A 1HF9A 1H89A 3D6ZA 3I55P 1VQMP 1GZLA 3CD6P 1KMIZ 4IL6X 2NPSA 1SQQD 1N86A 1FOSE 1K04A 1Y8AA 5AVZB 3EFGA 1YJNP 1NKNA 1PGOA 1LWUA 4IFMA 3H1IG 3HUSA 1L4AB 3GHGB 1SQPE 2O01J 1T3UA 4ZNCA 2RN0A 4N78D 5CCHD 2KB7P 2MJZA 1KILD 1QLED 1OW7A 3SWYA 1AVYA 2O01N 2R3CA 2P2UA 3IN6A 5H2FH 1GDTA 4QMAA 3FXEA 3L4FA 2ZAEB 3BCCJ 4WVZA 2HFED 2KLUA 4JYBA 1H0TA 1BCCD 2PP6A 1NOHA 2WQYC 4PV1C 1IC2A 1NU1K 4L73A 3L72E 2V4HA 3AEBC 3N4XA 4A7PA 1IFPA 2JR8A 1BE3D 1EXIA 1L0NK 3FWNA 4ZMDA 1KYOI 1NGMB 1NU1G 4JF7A 3E7KA 2W83C 3C8VA 3LIEA 5CBNA 4AUWA 1RF1A 4L75A 2AEFA 4M3LA 3GMAA 1DX7A 1SQXD 3V6IA 5AVWB 2QJYB 2IX7C 2OYHA 3F5HA 1NTKE 1L0NG 2QM7A 2N1TC 1OMIA 2OTJP 4HKZH 5KLVD 5KLIB 3L75G 1CZQA 4I1LA 3AE8C 4GDOA 3CWBE 4H0LC 1E79H 3H1JJ 1Z56A 1ZOYC 2B89A 2W90A 1D7MA 4GOEA 1SQQG 1FDOA 2K9JB 4PD4E 2OYIC 4IOIH 2Z4EA 1SQBE 4JBZA 3L70D 3IFMA 4GODA 1J1EC 1Y9BA 4GT1A 1L4AD 2ITAA 2E5TA 1KZUB 2WZ7A 2KP8A 2FFDB 1PP9D 1S5LH 1U7MA 5CCGC 3TGUG 1UIIA 2WMMA 4EDFA 5APTA 1LT9B 4U3FE 5M1BA 1PZQA 2FXMA 3B5NA 2FYNC 1BCCG 3A2AA 1S5LX 3CCVP 3OJAB 2XDJA 3RL0D 3KQGA 2KXPB 4NPFX 4PD4I 1WMKA 1NTZK 1BE3G 3H32B 1KYOD 2QG4A 3BATA 1JY2O 2IDBA 2YXRB 2NZ2A 4WB4A 3CC7P 2QRXA 5GTHH 5CMZA 3LW5H 4ZKUA 3P8CE 5KLVK 1N7SA 2FY8A 1VQ5P 4K35A 1SQPJ 4RESB 1BGYD 3M0DA 2HG5D 4DT0A 3CC4P 4IL6E 3S4RA 1SQXG 2L91A 1IK7A 1MZ9A 5CHXA 2Q1KA 1VDFA 2H88C 5KLVG 3AEGC 1IJDB 3A0HH 1FJPA 1G2CB 3L71E 1Q82Q 1FZEA 4N3YB 5APYA 2WPQA 3HD7B 1MV8A 1JOCA 3B8EB 3L72J 1LTJC 2K9YA 1JCCA 2KNCA 1SQVD 1YQ3C 3CLQA 4EYYQ 3Q5RA 3H1KE 5DJUB 2QJPC 5AW8B 1A02F 2AEJA 1GU5A 3L70G 5AW6B 5H2FE 1L0LD 1J2JB 5KAIH 3P8MC 3AE4C 2KS1A 2IBZE 4DOJA 2R5DA 2Q5UA 3H1LE 4HJGH 2WSFH 1LWUB 4D6TG 3HUSB 4DJGA 2V7QJ 1YIJP 1PP9G 2XU6A 2BCCE 4H13B 1KQGB 2A06D 1NTKJ 1N73B 3L74G 3GF3A 2H8PD 3AE7C 4I7ZC 3BCCE 1LT1A 1KILC 4KJMA 2E5YA 2GUSA 1ZMEC 1K8AQ 4Y28J 1M1JC 3L73J 1QVFO 3CWBJ 3M91A 2IPPA 2YKOA 1H0TB 5AVUB 2ZYAA 4WBAA 2ZFCA 5BVZA 1KORA 1R5LA 3S1KA 2CPBA 2IBZI 1GL2C 1SQBJ 1HJBA 3RK3C 2JEEA 2QSIA 3TGUE 1RF0C 3SWFA 1BGYG 3CCUP 3H1HD 3U1CA 1H88A 3M06A 4NPDA 1JY2P 1BDDA 1QX8A 2WTYA 1RF1B 1BSHA 1JTHA 1QL1A 4WY4A 1SQVK 3RK3E 1W2EA 1ZRTE 2OARA 1DEEG 1HJ0A 2OYHB 1KB9H 3M9BA 4U3FJ 3VN0A 1AQTA 2A45G 4TLFA 1L0LK 3TK1A 5AW5B 3OAKA 2NRGA 2LXBA 3IF4A 1SQVG 3HD7D 1VQ7P 2HPCA 3A0BH 3CX5I 1NTZE 3CL3D 4ZKPA 3ABVC 3CXHH 3AE1C 2KK7A 3C9IA 3E1IA 3A3YB 3BRVB 1S5LE 1GW3A 1J1DB 1L0LG 1LTTC 2ZXXA 3WU2H 2E76B 2CK3H 2E74B 4OVNF 2NPSD 3I5CA 4JYCA 5BU8B 1FZAA 3L37A 2YMYA 1R5SA 1LP1B 1NTMK 2YMKA 2A06G 3NTNA 2ZVNB 1HUCA 2FYUK 2OTLP 4H13D 1FS0E 1NAFA 1OVUA 3CCMP 1L4AC 1MFTA 3GHGC 2B9BA 1G1JA 3CC2P 1QEXA 1AJYA 1RE3C 1RE4C 5GTHE 1SFCA 3L71J 1KQLA 1SP4A 3B5NB 1YJ9P 3TYYA 3RK2B 2POHA 2H7HA 1EDKA 5BU5A 1VQ4P 4D6TE 4IFFA 1T2KC 1YI2P 3H1KJ 5APSA 1U7JA 4I2LC 1OZHA 1P84D 3HE4A 2D2CB 1N7LA 2Q7CA 3B71A 3L74E 3MP7B 3H1HG 4LLHA 3A0HE 3USSA 1SLQA 1VF5B 3G71P 3H1LJ 1N7SB 3CCSP 2FBWC 1URQA 3FWLA 2BCCJ 3Q2YA 1H8AA 5APXA 2R32A 2O1KA 1FC2C 1A02J 2M5AA 2B88A 1WT6A 4GOFA 1EZVD 1LTJA 2LR2A 3VMYA 4R4MA 1JMBA 3RL0B 4AYCA 2L5GB 3CX5D 5KAIE 3G9RA 4UB6H 2QJYC 2QJKB 5B66H 3KPEA 3V2QA 1E5WA 4YXWH 1JCDA 3T97A 5KLIC 1VQ9P 2KNCB 3MUDC 2WSEH 1PV3A 1HGZA 4UB8H 3PP5A 1K73Q 1ZP0C 3FX0A 3TGUJ 5TISH 2W8ZA 3U1AA 2QEXP 1PPJD 3V2PA 2LXCB 2E76D 2E74D 2R44A 2KS1B 1VQ8P 2PRRA 3AECC 2J59M 4NPEA 2JWAA 1M8OB 3H1JD 1PGPA 2BASA 1SQQK 5AVVB 3GG2A 1JY3N 2P10A 3CCEP 3L73E 1KN7A 2FFDC 3SSUA 3V4QA 4JPZB 2M8RA 2FXPA 1GL2A 3B5ND 3HRNA 4K3AA 3M0AA 1RF0A 1LT9C 4U7JA 3RK2D 2KOGA 1NO4A 2Z5HA 1NTZJ 2KSJA 3KZIH 1Q2NA 1LJ2A 1S9KE 3O6QA 1KB9E 2D2CD 1X22A 1IO4A 1EC5A 2ZYDA 2B87A 3VYIA 3CCLP 1HH0A 2I1JA 1RH5B 1VF5D 4HB1A 5KKZB 3D71A 1UIXA 1N7SD 1NTME 1VL2A 4DZOA 5KJ7A 1FZCA 1EZVG 3A0BE 2WSCH 1GD2E 2FYUE 3EWKA 2O3JA 3K5BA 1JTHB 3KYQA 1EDJA 4WY4B 3CXHE 5APUA 1OWAA 3VMXA 3WU2E 3LW5J 5L8RJ 2KLVA 2YO2A 2W27A 3AE2C 1SQPD 1R8EA 3H1IE 3P7KA 1LTAC 1DIPA 4TT3H 1FJKA 2IZ0A 2H89C 1SQXK 1RHZB 2YIUB 3M9QA 1KB9I 4D6TJ 1VQNP 4WWIA 1PPJG 1KD1Q 3L74J 3B4SA 5AW3B 1S4XA 2WPRA 3H1JG 3MHVA 1NYHA 3MZWB 1SVFA 3CXHI 2WVRA 3L72D 1Q7YQ 2Q6QA 4YTPC 1ZR2A 1FAVA 3OW2O 2N9BA 4YPCA 3AE3C 1LWUC 3HUSC 2K37A 3EFFK 4Y99C 1MFZA 4H13C 1SFCB 1NU1E 4MN4C 1N73C 3OA7A 1AV1A 2C0WA 2O1JA 2WSFJ 2ZT9C 1ZLLA 1OVVA 4L76A 1N8RQ 1KYOH 1W5CE 1NTKD 2NPSB 2M3BA 3NMDA 1L0NE 1EDLA 4B86A 4L74A 1KFMA 2HYNA 3HE4B 3AE6C 3L75E 2HODA 2W6JH 1JNMA 1IFJA 2K1AA 2Y9YA 1LGHB 1IFDA 3CWBD 4UB6E 3SWKA 5B66E 2WT7A 1HWTC 3PJSK 3TSIA 2J5UA 3V2RA 1URQB 4BWNA 5CCHC 2UWJE 4KT0J 1SQQE 2M5AB 3JCUH 4PD4D 4WY4D 1NH4A 4UB8E 1SQBD 2IFMA 3O8ZA 5AW9B 2A45H 2C9NY 1NAYA 3MUDA 1L0LJ 5TISE 2WWWA 2OQQA 3W68A 2SPZA 3E1RA 4N78E 1FZFA 2OYHC 5CJ4A 1JEKA 1HBWA 1GMJA 1PL5A 1KILE 3KXDA 4GKGA 3V4WA 2RKLA 4C7NA 3CMEP 3G3ZA 3T97B 2ZJSE 2J58A 3PHLA 1MKMA 4U3FD 2N1TA 3MD0A 5KTBA 1YTZT 1VQ6P 3QWOC 2LKMA 1BCCE 1Q81Q 2R5BA 5AVYB 4RJTA 1KC8Q 2ZYGA 1EQ7A 3L36A 4JQ0D 3L72G 3F89A 1J1DC 1QL2A 2FFDA 1NTMJ 4HYTB 2ZXEB 2Q9IA 5CJ0A 1Q90D 3S9OA 2E76C 2FYUJ 1BE3E 1IFMA 2N9YB 1NTKK 3TNUA 3KZIE 2ZVOB 3P8CD 3RBXA 2OYIA 5AVTB 2P58A 1LTBC 5APVA 2KI7B 5C39A 2WPVB 3H1IJ 2AXTH 3GLMA 2M0BA 1YITP 1SFCD 3MIWA 2YO3A 2HR3A 2Y0DA 1SQXE 1W2BO 1NTKG 1RQVA 3VOPA 4GIFA 3B5NC 2C9LY 5KLVE 1DEBA 5K5GB 5CCGA 5E79H 3RK2C 1SQBK 3L71D 1XTCC 3O6QB 1PFIA 3G6EP 3CWBG 2P67A 1YBKA 1RY3A 3UIAA 3HTKA 1Y47A 4OGQB 2IYPA 5GTIH 3C1LA 4XFJA 4DCKA 1ZR4A 3H1KD 2JDIH 1FZCB 3AEAC 3JSVC 1URQD 1VF5C 1SQBG 3PLNA 1N7SC 3L70E 4ASWA 3M0DC 3N7NA 2IBZD 3TF5A 1FOSF 3H1LD 1NU1J 2Q3IA 4BXLA 1KQSO 2BCCD 1PP9E 3Q3DA 3RL0C 1HTLC 2GM4A 1Q86Q 3A5TA 4U3FG 1L0NJ 2W6BA 2HLOA 2QJKC 1JO5A 1PGQA 3BCCD 1X8YA 1K9MQ 3L75J 2IFNA 4H44B 3Q1MA 1GU4A 4OWFA 4C7RA 2PGDA 2XZRA 1LNQA 1YQ4C 1NHLA 3BVHA 4KHXA 1KYOE 3RGUA 2KUBA 2BEZF 1N73A 1KFNA 3VMAA 4EIJA 1SQQJ 2WSEJ 4N6JA 2E75B 1GW4A 1KTMA 1OIPA 3TGUD 2O01H 1ZN5A 4PJ0H 1BGYE 3QH9A 1OW6A 2P7JA 3GF7A 3KHUA 1M1KQ 5AVRB 1GL2D 3VMZA 1JB0J 1P84H 3RK3D 1ZRTD 1CSBA 1LTSC 3G4SP 1CI6A 3SFDC 3AE9C 3JCUE 3L71G 3PTZA 5CCHA 1BCCJ 4LGDE 1KILA 2JO1A 3JC22 2HODB 2OTKE 4RKUJ 2E43A 3FXDA 1M1JA 1VQKP 4BRYA 2JJLA 1JY2N 1SQVE 3TDKA 4OGQD 2WT7B 3H1KG 3W67A 1NTZD 4PV1B 2XNXA 1BE3J 1FDIA 5KJ7D 5AW7B 5DJTB 1L0LE 3CX5H 5KKZC 3WUVA 1IK9A 1T3JA 2IBZG 1OFCX 3H1LG 3HE5A 1PGJA 4WY4C 2BCCG 1OX3A 3GW6A 1L2PA 4CPGA 1SQXJ 2A06E 2A45I 2WSCJ 1HVVA 3BCCG 2YKQA 4C7NB 1S3JA 2I8DA 5KLVJ 1FE6A 5AW1B 2QIWA 1S72P 2N1TB 1GK6A 2YIUC 4HH2A 2CPSA 2C0XA 3II6A 5AVQB 4H44D 2IYOA 1LP1A 2AXTE 2Y0CA 1ZXGA 3VTPC 3CPWO 1CW5A 1M57D 4D6TD 4H0LB 3RL0g 3FGAD 3M9HA 1X79B 4RO0A 1FZGA 4W80A 1VQPP 2KYVA 1N2DC 1DD3A 3L70J 3H25A 1IFNA 3L74D 5AW4B 3TNUB 2E75D 4XA4A 5E79E 3VP8A 1DD4A 3H1HE 5B5EH 2KSEA 2GA1A 2OYIB 2YXQB 2GUVA 5KAFH 1T2KD 1FU1A 1PIXA 2QA4P 3D70A 2HPCB 1YTZI 1J1EB 4XE5B 1PP9J 2OYOA 1ZV8A 3ZDMA 4EOTA 1M56D 5GTIE 3HD7C 3VP9A 1SFCC 2H43A 2XNDH 1JM0A 3LIDA 1USEA 1ZW0A 1L4AA 3GHGA
chains in the Genus database with same CATH topology
1SFCA 5AVWB 1KQLA 4GKGA 3V4WA 1SP4A 2IX7C 3B5NB 1RE3A 2OYHA 1NWQA 4C7NA 1RE4A 3G3ZA 2QM7A 2N1TC 2XV5A 3TYYA 3WMM0 3A7OA 2J58A 5AVXB 1JY3O 3RK2B 2POHA 1GK4A 2NPSC 2N1TA 2H7HA 3MD0A 5KTBA 1YTZT 5BU5A 2LKMA 1CZQA 3HTKB 2YKPA 1G1IA 3EQ2A 4IFFA 1T2KC 5APSA 4I1LA 2R5BA 5AVYB 1EQ7A 4I2LC 2FYZA 3NXSA 1T8ZA 3L36A 3HE4A 1FDMA 1N7LA 1J1DC 1QL2A 2FFDA 4HYTB 2Q7CA 1Z56A 2ZXEB 2Q9IA 5CJ0A 1LTGC 4LLHA 1SLQA 1IFMA 4W7YA 2E42A 1N7SB 1URQC 2XKMA 1NTKK 3TNUA 1IFIA 2OYIC 2Z4EA 1X9VA 1URQA 1MUUA 3P8CD 3IFMA 1H8AA 5APXA 2R32A 2O1KA 2OYIA 5AVTB 2WPSA 1J1EC 2QM8A 1A02J 1WT6A 1LTBC 4GT1A 5APVA 1L4AD 1GTWA 1LTJA 1KZUB 2WZ7A 1SFCD 3MIWA 2YO3A 3VMYA 2KP8A 2FFDB 3RL0B 3BRTB 4LC1A 4AYCA 2L5GB 1SQPK 3VOPA 4GIFA 5CCGC 4IFDK 3B5NC 2N1TD 3KPEA 2C9LY 5APTA 1LT9B 1DEBA 5CCGA 3V2QA 1E5WA 2FXMA 1HGVA 3B5NA 3RK2C 1JMMA 1JCDA 3T97A 1SQBK 1XTCC 1PFIA 3A2AA 4Y99B 2P67A 2WSEH 1HGZA 3OJAB 1RY3A 3PP5A 2XDJA 3RL0D 1LTJB 3UIAA 3HTKA 1S9KD 1RF1C 3KQGA 3U1AA 3MTUE 1NTZK 4OH8B 5AVSB 5APWA 3V2PA 3V2NA 3H32B 4I6MC 1ZR4A 1FZCB 3BATA 1JY2O 1WRGA 1URQD 2J59M 4WB4A 1N7SC 5CMZA 3LW5H 2WITA 5APQA 4ZKUA 3P8CE 5KLVK 3M0DC 3N7NA 1N7SA 2Z5IA 1FOSF 4RESB 2BASA 3M0DA 2HG5D 1SQQK 5AVVB 2Q3IA 1NKZB 3U59A 1JY3N 1MZ9A 1CI6B 2FFDC 5CHXA 2VRSA 3V4QA 3RL0C 1VDFA 1HTLC 2YNYA 2M8RA 2GM4A 5CCGD 1GL2A 3B5ND 3HRNA 3A5TA 2W6BA 2HLOA 3M0AA 1IJDB 1JO5A 1RF0A 1KILB 1X8YA 1LT9C 4O9BA 3RK2D 1FJPA 2KOGA 1NO4A 2Z5HA 1G2CB 2IFNA 1FZEA 1M1JB 2KSJA 1LT9A 4N3YB 5APYA 2WPQA 3HD7B 1GU4A 5AW0B 4C7RA 1MV8A 1JOCA 1JY3P 1FZBA 2PAJA 2XZRA 3B8EB 1S9KE 1AQ5A 1LTJC 1JCCA 1NHLA 4W7ZA 1IO4A 3BVHA 3KDPB 1YYCA 3CLQA 1OXZA 4KHXA 1FBMA 1JUNA 3VYIA 1N73A 1KFNA 3R2PA 1HH0A 1GL2B 2I1JA 5AW8B 1A02F 1GU5A 4EIJA 3HE5B 5KJ7C 3RK3B 5AW6B 1FZCC 4N6JA 1DH3A 1M7LA 1N7SD 1GW4A 3H32A 1J2JB 3P8MC 4DZOA 5KJ7A 2O01H 1FZCA 1ZN5A 1GD2E 2WSCH 3IR9A 4DOJA 2R5DA 2Q5UA 2WSFH 1JTHB 3KYQA 4WY4B 1XTGB 3L35A 1LWUB 2P7JA 3HUSB 5APUA 2XU6A 1OWAA 3MGNA 2FKWB 3VMXA 5AVRB 1GL2D 3VMZA 2KLVA 3H6PA 1AFOA 2YO2A 3RK3D 1LTIC 1N73B 2W27A 1CSBA 2H8PD 3P7KA 1LTSC 1LTAC 5AW2B 1CI6A 1FJKA 3NFQA 1SQXK 1KILC 2GUSA 5CCHA 3M9QA 4LGDE 1M1JC 1KILA 2I1KA 3M91A 2IPPA 2HODB 2YKOA 2E43A 1VPCA 5AVUB 1G2CA 1M1JA 4WBAA 2JJLA 1JY2N 2ZFCA 5AW3B 3BASA 5BVZA 3HD7A 2WT7B 2XNXA 2P1JA 2WPRA 2CPBA 3V5BA 3P32A 5KJ7D 1GL2C 5AW7B 1SVFA 4C46A 4AQRD 1HJBA 3RK3C 2JEEA 3CI9A 1IK9A 1T3JA 2W6AA 1RF0C 1ZR2A 3SWFA 1FAVA 1H89A 1GZLA 3HE5A 2N9BA 3U1CA 1H88A 3M06A 2NPSA 1JY2P 1N86A 1FOSE 4WY4C 1LWUC 2WTYA 5AVZB 3HUSC 3EFGA 1RF1B 1JTHA 1QL1A 1NKNA 4WY4A 4Y99C 1MFZA 1LWUA 4IFMA 1SQVK 3HUSA 1L4AB 3GHGB 1W2EA 2OARA 1T3UA 1SFCB 2A45I 1HVVA 1N73C 3OA7A 2OYHB 2YKQA 4C7NB 2C0WA 2O1JA 3M9BA 1ZLLA 4N78D 5CCHD 3VN0A 2KB7P 5AW1B 2MJZA 2A45G 1KILD 1L0LK 3TK1A 3SWYA 5AW5B 2N1TB 1GK6A 3OAKA 2R3CA 4HH2A 2P2UA 2CPSA 2C0XA 2M3BA 2NPSB 3NMDA 3II6A 1GDTA 5AVQB 3HD7D 4B86A 3L4FA 1KFMA 2HPCA 2HYNA 3HE4B 3VTPC 1CW5A 2HFED 3CL3D 4ZKPA 2HODA 4JYBA 1JNMA 1IFJA 2PP6A 1NOHA 3C9IA 1LGHB 3E1IA 3A3YB 3BRVB 1GW3A 1J1DB 1IFDA 3M9HA 1X79B 1LTTC 1FZGA 1IC2A 1NU1K 4W80A 2WT7A 1HWTC 2KYVA 1N2DC 1IFNA 5AW4B 3TNUB 3TSIA 3V2RA 4XA4A 3N4XA 2NPSD 3I5CA 4JYCA 5BU8B 3VP8A 1URQB 5CCHC 1FZAA 3L37A 2YMYA 2OYIB 2GUVA 1T2KD 1FU1A 1NTMK 4WY4D 1NH4A 1L0NK 5AW9B 2IFMA 3O8ZA 2A45H 2HPCB 1YTZI 1HBWA 1J1EB 4XE5B 2C9NY 3NTNA 1ZV8A 1HUCA 3MUDA 4EOTA 2FYUK 4JF7A 3HD7C 1NAFA 2WWWA 3LIEA 4AUWA 1L4AC 3GHGC 3VP9A 1RF1A 1G1JA 1SFCC 2H43A 4N78E 1FZFA 2OYHC 1RE3C 4M3LA 5CJ4A 3LIDA 1L4AA 1RE4C 3GHGA 1DX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WTY A;  5AVW B;  2P67 A;  5AVZ B;  1KQL A;  3HE5 B;  1GU5 A;  4GKG A;  5AW6 B;  3V4W A;  1SP4 A;  1DH3 A;  1NWQ A;  4C7N A;  1J2J B;  2QM7 A;  1MFZ A;  3UIA A;  2XV5 A;  3HTK A;  3P8M C;  3TYY A;  4DZO A;  3A7O A;  5AVX B;  1S9K D;  3KQG A;  1GD2 E;  3IR9 A;  1GK4 A;  2R5D A;  2H7H A;  5AVS B;  2Q5U A;  5APW A;  3MD0 A;  4C7N B;  3M9B A;  3L35 A;  2P7J A;  1CZQ A;  4I6M C;  3VN0 A;  5AW1 B;  5APU A;  1T2K C;  3TK1 A;  2XU6 A;  5APS A;  1OWA A;  3MGN A;  5AW5 B;  2R5B A;  5AVY B;  1GK6 A;  3OAK A;  4I2L C;  3VMX A;  3NXS A;  5CMZ A;  3L36 A;  5AVR B;  2R3C A;  3HE4 A;  5APQ A;  3VMZ A;  2P2U A;  2YO2 A;  3NMD A;  5AVQ B;  4HYT B;  2W27 A;  2Q7C A;  2ZXE B;  1CSB A;  3P7K A;  4B86 A;  2Z5I A;  1FOS F;  4RES B;  5AW2 B;  1CI6 A;  2BAS A;  3M0D A;  3HE4 B;  3VTP C;  1SLQ A;  5AVV B;  2Q3I A;  3NFQ A;  2E42 A;  4JYB A;  1JNM A;  3TNU A;  3A3Y B;  1CI6 B;  3M9H A;  2VRS A;  3V4Q A;  2YNY A;  2WT7 A;  1MUU A;  1H8A A;  3M91 A;  1HWT C;  2IPP A;  5APX A;  2R32 A;  2E43 A;  5AVT B;  5AVU B;  2WPS A;  2QM8 A;  1A02 J;  5AW4 B;  3TNU B;  3A5T A;  2JJL A;  3M0A A;  4GT1 A;  3I5C A;  4JYC A;  2ZFC A;  5APV A;  5AW3 B;  1X8Y A;  2WT7 B;  3L37 A;  1GTW A;  2YO3 A;  3VMY A;  2KP8 A;  2Z5H A;  1G2C B;  2WPR A;  1T2K D;  3V5B A;  4LC1 A;  3P32 A;  5APY A;  4AYC A;  5AW9 B;  3O8Z A;  1HBW A;  5AW7 B;  2WPQ A;  4XE5 B;  1GU4 A;  2C9N Y;  5AW0 B;  3NTN A;  4C46 A;  4AQR D;  1HJB A;  1HUC A;  1MV8 A;  4EOT A;  2W6A A;  2XZR A;  3B8E B;  1S9K E;  3SWF A;  2C9L Y;  1FAV A;  5APT A;  1NAF A;  1H89 A;  1GZL A;  2WWW A;  3LIE A;  3HE5 A;  4AUW A;  1IO4 A;  3KDP B;  1YYC A;  2N9B A;  1H88 A;  3M06 A;  1OXZ A;  4KHX A;  3T97 A;  1JUN A;  3VYI A;  4M3L A;  3LID A;  1FOS E;  3A2A A;  5AW8 B;  1A02 F; 
#chains in the Genus database with same CATH topology
 2WSS H;  1RE3 A;  1NWQ A;  1RE4 A;  1OW8 A;  2XV5 A;  3WMM 0;  3A7O A;  5AVX B;  1JY3 O;  3AED C;  2FYN B;  1GK4 A;  2NPS C;  1QVG O;  1NTZ G;  3SFE C;  3CMA P;  4YXD C;  3HTK B;  2YKP A;  1G1I A;  3EQ2 A;  3R4Y A;  4PV1 D;  2FYZ A;  3NXS A;  1T8Z A;  1FDM A;  5EFW B;  1X0T A;  1LTG C;  1BGY J;  4W7Y A;  2E42 A;  1NVO A;  1K05 A;  1URQ C;  1KV4 A;  2XKM A;  1IFI A;  2BEQ D;  1X9V A;  2M3E A;  3CCJ P;  1MUU A;  3CCR P;  2KIK A;  2WPS A;  2QM8 A;  3PH0 A;  2QE7 H;  1GTW A;  4ASV A;  3BRT B;  4LC1 A;  3L73 D;  2RMZ A;  3AEF C;  1M90 Q;  1SQP K;  2JP3 A;  4IFD K;  2N1T D;  4PJ0 E;  2JWD A;  2Y9Z A;  1HGV A;  3IAO A;  1JMM A;  1TU3 F;  1SQV J;  4Y99 B;  1AA0 A;  4H0L D;  1P84 E;  1LTJ B;  1SQP G;  1S9K D;  3WUT A;  1RF1 C;  2ZT9 B;  1KB9 D;  3MTU E;  4OH8 B;  5AVS B;  5APW A;  3V2N A;  2FXO A;  2QJP B;  4I6M C;  2G3A A;  2V7Q H;  3Q5S A;  1WRG A;  1QGK B;  2MKV A;  2WIT A;  1NTM D;  5APQ A;  2JKV A;  2KZJ A;  1S2E A;  2K9J A;  2FYU D;  2OGU A;  2Z5I A;  1EZV E;  1OVR A;  3CXH D;  2DW3 A;  1NKZ B;  3U59 A;  3CCQ P;  1CI6 B;  3RBZ A;  3CX5 E;  1BDC A;  2VRS A;  5CBO A;  2YNY A;  1EDI A;  5CCG D;  4I7Z B;  3H1I D;  2Y0E A;  2AEM A;  2K3R A;  1KIL B;  1P84 I;  4O9B A;  2E74 C;  2R3S A;  1M1J B;  2AXC A;  4BRY B;  1LT9 A;  4PD4 H;  5AW0 B;  1JY3 P;  1FZB A;  2PAJ A;  3D6Y A;  2Q3E A;  1AQ5 A;  3AEE C;  4W7Z A;  2KZI A;  2RH0 A;  4OGQ C;  1PPJ E;  3KDP B;  1YYC A;  1OXZ A;  3PRJ A;  3I56 P;  1FBM A;  1JUN A;  3H1H J;  3ITK A;  3R2P A;  1GL2 B;  1VQL P;  3HE5 B;  5KJ7 C;  3RK3 B;  1EZV I;  1FZC C;  1DH3 A;  1M7L A;  3AE5 C;  3H32 A;  3H1J E;  1RQU A;  1AVO A;  3IR9 A;  1SS1 A;  1XTG B;  3L35 A;  2IZ1 A;  3L73 G;  3MGN A;  3Q5P A;  2FKW B;  3H6P A;  1AFO A;  1YJW P;  2B87 B;  2QVA A;  1LTI C;  2K88 A;  1NU1 D;  2D2C C;  5AW2 B;  4R4L A;  5B5E E;  1VQO P;  1USD A;  1BSN A;  3NFQ A;  1EXJ A;  5KAF E;  1KQF B;  1YHQ P;  1IZN B;  2I1K A;  4H44 C;  1L0N D;  1VPC A;  5TJH A;  4Z1M H;  1G2C A;  1U57 A;  3BAS A;  2G8Y A;  3HD7 A;  3L75 D;  2ZT9 D;  2PFX A;  2P1J A;  1S1C X;  4IL6 H;  3WUU A;  3V5B A;  1T6A A;  3P32 A;  1NTM G;  4C46 A;  4AQR D;  1NJI Q;  3CI9 A;  2E75 C;  2W6A A;  2FYU G;  4EI2 A;  1HF9 A;  1H89 A;  3D6Z A;  3I55 P;  1VQM P;  1GZL A;  3CD6 P;  1KMI Z;  4IL6 X;  2NPS A;  1SQQ D;  1N86 A;  1FOS E;  1K04 A;  1Y8A A;  5AVZ B;  3EFG A;  1YJN P;  1NKN A;  1PGO A;  1LWU A;  4IFM A;  3H1I G;  3HUS A;  1L4A B;  3GHG B;  1SQP E;  2O01 J;  1T3U A;  4ZNC A;  2RN0 A;  4N78 D;  5CCH D;  2KB7 P;  2MJZ A;  1KIL D;  1QLE D;  1OW7 A;  3SWY A;  1AVY A;  2O01 N;  2R3C A;  2P2U A;  3IN6 A;  5H2F H;  1GDT A;  4QMA A;  3FXE A;  3L4F A;  2ZAE B;  3BCC J;  4WVZ A;  2HFE D;  2KLU A;  4JYB A;  1H0T A;  1BCC D;  2PP6 A;  1NOH A;  2WQY C;  4PV1 C;  1IC2 A;  1NU1 K;  4L73 A;  3L72 E;  2V4H A;  3AEB C;  3N4X A;  4A7P A;  1IFP A;  2JR8 A;  1BE3 D;  1EXI A;  1L0N K;  3FWN A;  4ZMD A;  1KYO I;  1NGM B;  1NU1 G;  4JF7 A;  3E7K A;  2W83 C;  3C8V A;  3LIE A;  5CBN A;  4AUW A;  1RF1 A;  4L75 A;  2AEF A;  4M3L A;  3GMA A;  1DX7 A;  1SQX D;  3V6I A;  5AVW B;  2QJY B;  2IX7 C;  2OYH A;  3F5H A;  1NTK E;  1L0N G;  2QM7 A;  2N1T C;  1OMI A;  2OTJ P;  4HKZ H;  5KLV D;  5KLI B;  3L75 G;  1CZQ A;  4I1L A;  3AE8 C;  4GDO A;  3CWB E;  4H0L C;  1E79 H;  3H1J J;  1Z56 A;  1ZOY C;  2B89 A;  2W90 A;  1D7M A;  4GOE A;  1SQQ G;  1FDO A;  2K9J B;  4PD4 E;  2OYI C;  4IOI H;  2Z4E A;  1SQB E;  4JBZ A;  3L70 D;  3IFM A;  4GOD A;  1J1E C;  1Y9B A;  4GT1 A;  1L4A D;  2ITA A;  2E5T A;  1KZU B;  2WZ7 A;  2KP8 A;  2FFD B;  1PP9 D;  1S5L H;  1U7M A;  5CCG C;  3TGU G;  1UII A;  2WMM A;  4EDF A;  5APT A;  1LT9 B;  4U3F E;  5M1B A;  1PZQ A;  2FXM A;  3B5N A;  2FYN C;  1BCC G;  3A2A A;  1S5L X;  3CCV P;  3OJA B;  2XDJ A;  3RL0 D;  3KQG A;  2KXP B;  4NPF X;  4PD4 I;  1WMK A;  1NTZ K;  1BE3 G;  3H32 B;  1KYO D;  2QG4 A;  3BAT A;  1JY2 O;  2IDB A;  2YXR B;  2NZ2 A;  4WB4 A;  3CC7 P;  2QRX A;  5GTH H;  5CMZ A;  3LW5 H;  4ZKU A;  3P8C E;  5KLV K;  1N7S A;  2FY8 A;  1VQ5 P;  4K35 A;  1SQP J;  4RES B;  1BGY D;  3M0D A;  2HG5 D;  4DT0 A;  3CC4 P;  4IL6 E;  3S4R A;  1SQX G;  2L91 A;  1IK7 A;  1MZ9 A;  5CHX A;  2Q1K A;  1VDF A;  2H88 C;  5KLV G;  3AEG C;  1IJD B;  3A0H H;  1FJP A;  1G2C B;  3L71 E;  1Q82 Q;  1FZE A;  4N3Y B;  5APY A;  2WPQ A;  3HD7 B;  1MV8 A;  1JOC A;  3B8E B;  3L72 J;  1LTJ C;  2K9Y A;  1JCC A;  2KNC A;  1SQV D;  1YQ3 C;  3CLQ A;  4EYY Q;  3Q5R A;  3H1K E;  5DJU B;  2QJP C;  5AW8 B;  1A02 F;  2AEJ A;  1GU5 A;  3L70 G;  5AW6 B;  5H2F E;  1L0L D;  1J2J B;  5KAI H;  3P8M C;  3AE4 C;  2KS1 A;  2IBZ E;  4DOJ A;  2R5D A;  2Q5U A;  3H1L E;  4HJG H;  2WSF H;  1LWU B;  4D6T G;  3HUS B;  4DJG A;  2V7Q J;  1YIJ P;  1PP9 G;  2XU6 A;  2BCC E;  4H13 B;  1KQG B;  2A06 D;  1NTK J;  1N73 B;  3L74 G;  3GF3 A;  2H8P D;  3AE7 C;  4I7Z C;  3BCC E;  1LT1 A;  1KIL C;  4KJM A;  2E5Y A;  2GUS A;  1ZME C;  1K8A Q;  4Y28 J;  1M1J C;  3L73 J;  1QVF O;  3CWB J;  3M91 A;  2IPP A;  2YKO A;  1H0T B;  5AVU B;  2ZYA A;  4WBA A;  2ZFC A;  5BVZ A;  1KOR A;  1R5L A;  3S1K A;  2CPB A;  2IBZ I;  1GL2 C;  1SQB J;  1HJB A;  3RK3 C;  2JEE A;  2QSI A;  3TGU E;  1RF0 C;  3SWF A;  1BGY G;  3CCU P;  3H1H D;  3U1C A;  1H88 A;  3M06 A;  4NPD A;  1JY2 P;  1BDD A;  1QX8 A;  2WTY A;  1RF1 B;  1BSH A;  1JTH A;  1QL1 A;  4WY4 A;  1SQV K;  3RK3 E;  1W2E A;  1ZRT E;  2OAR A;  1DEE G;  1HJ0 A;  2OYH B;  1KB9 H;  3M9B A;  4U3F J;  3VN0 A;  1AQT A;  2A45 G;  4TLF A;  1L0L K;  3TK1 A;  5AW5 B;  3OAK A;  2NRG A;  2LXB A;  3IF4 A;  1SQV G;  3HD7 D;  1VQ7 P;  2HPC A;  3A0B H;  3CX5 I;  1NTZ E;  3CL3 D;  4ZKP A;  3ABV C;  3CXH H;  3AE1 C;  2KK7 A;  3C9I A;  3E1I A;  3A3Y B;  3BRV B;  1S5L E;  1GW3 A;  1J1D B;  1L0L G;  1LTT C;  2ZXX A;  3WU2 H;  2E76 B;  2CK3 H;  2E74 B;  4OVN F;  2NPS D;  3I5C A;  4JYC A;  5BU8 B;  1FZA A;  3L37 A;  2YMY A;  1R5S A;  1LP1 B;  1NTM K;  2YMK A;  2A06 G;  3NTN A;  2ZVN B;  1HUC A;  2FYU K;  2OTL P;  4H13 D;  1FS0 E;  1NAF A;  1OVU A;  3CCM P;  1L4A C;  1MFT A;  3GHG C;  2B9B A;  1G1J A;  3CC2 P;  1QEX A;  1AJY A;  1RE3 C;  1RE4 C;  5GTH E;  1SFC A;  3L71 J;  1KQL A;  1SP4 A;  3B5N B;  1YJ9 P;  3TYY A;  3RK2 B;  2POH A;  2H7H A;  1EDK A;  5BU5 A;  1VQ4 P;  4D6T E;  4IFF A;  1T2K C;  1YI2 P;  3H1K J;  5APS A;  1U7J A;  4I2L C;  1OZH A;  1P84 D;  3HE4 A;  2D2C B;  1N7L A;  2Q7C A;  3B71 A;  3L74 E;  3MP7 B;  3H1H G;  4LLH A;  3A0H E;  3USS A;  1SLQ A;  1VF5 B;  3G71 P;  3H1L J;  1N7S B;  3CCS P;  2FBW C;  1URQ A;  3FWL A;  2BCC J;  3Q2Y A;  1H8A A;  5APX A;  2R32 A;  2O1K A;  1FC2 C;  1A02 J;  2M5A A;  2B88 A;  1WT6 A;  4GOF A;  1EZV D;  1LTJ A;  2LR2 A;  3VMY A;  4R4M A;  1JMB A;  3RL0 B;  4AYC A;  2L5G B;  3CX5 D;  5KAI E;  3G9R A;  4UB6 H;  2QJY C;  2QJK B;  5B66 H;  3KPE A;  3V2Q A;  1E5W A;  4YXW H;  1JCD A;  3T97 A;  5KLI C;  1VQ9 P;  2KNC B;  3MUD C;  2WSE H;  1PV3 A;  1HGZ A;  4UB8 H;  3PP5 A;  1K73 Q;  1ZP0 C;  3FX0 A;  3TGU J;  5TIS H;  2W8Z A;  3U1A A;  2QEX P;  1PPJ D;  3V2P A;  2LXC B;  2E76 D;  2E74 D;  2R44 A;  2KS1 B;  1VQ8 P;  2PRR A;  3AEC C;  2J59 M;  4NPE A;  2JWA A;  1M8O B;  3H1J D;  1PGP A;  2BAS A;  1SQQ K;  5AVV B;  3GG2 A;  1JY3 N;  2P10 A;  3CCE P;  3L73 E;  1KN7 A;  2FFD C;  3SSU A;  3V4Q A;  4JPZ B;  2M8R A;  2FXP A;  1GL2 A;  3B5N D;  3HRN A;  4K3A A;  3M0A A;  1RF0 A;  1LT9 C;  4U7J A;  3RK2 D;  2KOG A;  1NO4 A;  2Z5H A;  1NTZ J;  2KSJ A;  3KZI H;  1Q2N A;  1LJ2 A;  1S9K E;  3O6Q A;  1KB9 E;  2D2C D;  1X22 A;  1IO4 A;  1EC5 A;  2ZYD A;  2B87 A;  3VYI A;  3CCL P;  1HH0 A;  2I1J A;  1RH5 B;  1VF5 D;  4HB1 A;  5KKZ B;  3D71 A;  1UIX A;  1N7S D;  1NTM E;  1VL2 A;  4DZO A;  5KJ7 A;  1FZC A;  1EZV G;  3A0B E;  2WSC H;  1GD2 E;  2FYU E;  3EWK A;  2O3J A;  3K5B A;  1JTH B;  3KYQ A;  1EDJ A;  4WY4 B;  3CXH E;  5APU A;  1OWA A;  3VMX A;  3WU2 E;  3LW5 J;  5L8R J;  2KLV A;  2YO2 A;  2W27 A;  3AE2 C;  1SQP D;  1R8E A;  3H1I E;  3P7K A;  1LTA C;  1DIP A;  4TT3 H;  1FJK A;  2IZ0 A;  2H89 C;  1SQX K;  1RHZ B;  2YIU B;  3M9Q A;  1KB9 I;  4D6T J;  1VQN P;  4WWI A;  1PPJ G;  1KD1 Q;  3L74 J;  3B4S A;  5AW3 B;  1S4X A;  2WPR A;  3H1J G;  3MHV A;  1NYH A;  3MZW B;  1SVF A;  3CXH I;  2WVR A;  3L72 D;  1Q7Y Q;  2Q6Q A;  4YTP C;  1ZR2 A;  1FAV A;  3OW2 O;  2N9B A;  4YPC A;  3AE3 C;  1LWU C;  3HUS C;  2K37 A;  3EFF K;  4Y99 C;  1MFZ A;  4H13 C;  1SFC B;  1NU1 E;  4MN4 C;  1N73 C;  3OA7 A;  1AV1 A;  2C0W A;  2O1J A;  2WSF J;  2ZT9 C;  1ZLL A;  1OVV A;  4L76 A;  1N8R Q;  1KYO H;  1W5C E;  1NTK D;  2NPS B;  2M3B A;  3NMD A;  1L0N E;  1EDL A;  4B86 A;  4L74 A;  1KFM A;  2HYN A;  3HE4 B;  3AE6 C;  3L75 E;  2HOD A;  2W6J H;  1JNM A;  1IFJ A;  2K1A A;  2Y9Y A;  1LGH B;  1IFD A;  3CWB D;  4UB6 E;  3SWK A;  5B66 E;  2WT7 A;  1HWT C;  3PJS K;  3TSI A;  2J5U A;  3V2R A;  1URQ B;  4BWN A;  5CCH C;  2UWJ E;  4KT0 J;  1SQQ E;  2M5A B;  3JCU H;  4PD4 D;  4WY4 D;  1NH4 A;  4UB8 E;  1SQB D;  2IFM A;  3O8Z A;  5AW9 B;  2A45 H;  2C9N Y;  1NAY A;  3MUD A;  1L0L J;  5TIS E;  2WWW A;  2OQQ A;  3W68 A;  2SPZ A;  3E1R A;  4N78 E;  1FZF A;  2OYH C;  5CJ4 A;  1JEK A;  1HBW A;  1GMJ A;  1PL5 A;  1KIL E;  3KXD A;  4GKG A;  3V4W A;  2RKL A;  4C7N A;  3CME P;  3G3Z A;  3T97 B;  2ZJS E;  2J58 A;  3PHL A;  1MKM A;  4U3F D;  2N1T A;  3MD0 A;  5KTB A;  1YTZ T;  1VQ6 P;  3QWO C;  2LKM A;  1BCC E;  1Q81 Q;  2R5B A;  5AVY B;  4RJT A;  1KC8 Q;  2ZYG A;  1EQ7 A;  3L36 A;  4JQ0 D;  3L72 G;  3F89 A;  1J1D C;  1QL2 A;  2FFD A;  1NTM J;  4HYT B;  2ZXE B;  2Q9I A;  5CJ0 A;  1Q90 D;  3S9O A;  2E76 C;  2FYU J;  1BE3 E;  1IFM A;  2N9Y B;  1NTK K;  3TNU A;  3KZI E;  2ZVO B;  3P8C D;  3RBX A;  2OYI A;  5AVT B;  2P58 A;  1LTB C;  5APV A;  2KI7 B;  5C39 A;  2WPV B;  3H1I J;  2AXT H;  3GLM A;  2M0B A;  1YIT P;  1SFC D;  3MIW A;  2YO3 A;  2HR3 A;  2Y0D A;  1SQX E;  1W2B O;  1NTK G;  1RQV A;  3VOP A;  4GIF A;  3B5N C;  2C9L Y;  5KLV E;  1DEB A;  5K5G B;  5CCG A;  5E79 H;  3RK2 C;  1SQB K;  3L71 D;  1XTC C;  3O6Q B;  1PFI A;  3G6E P;  3CWB G;  2P67 A;  1YBK A;  1RY3 A;  3UIA A;  3HTK A;  1Y47 A;  4OGQ B;  2IYP A;  5GTI H;  3C1L A;  4XFJ A;  4DCK A;  1ZR4 A;  3H1K D;  2JDI H;  1FZC B;  3AEA C;  3JSV C;  1URQ D;  1VF5 C;  1SQB G;  3PLN A;  1N7S C;  3L70 E;  4ASW A;  3M0D C;  3N7N A;  2IBZ D;  3TF5 A;  1FOS F;  3H1L D;  1NU1 J;  2Q3I A;  4BXL A;  1KQS O;  2BCC D;  1PP9 E;  3Q3D A;  3RL0 C;  1HTL C;  2GM4 A;  1Q86 Q;  3A5T A;  4U3F G;  1L0N J;  2W6B A;  2HLO A;  2QJK C;  1JO5 A;  1PGQ A;  3BCC D;  1X8Y A;  1K9M Q;  3L75 J;  2IFN A;  4H44 B;  3Q1M A;  1GU4 A;  4OWF A;  4C7R A;  2PGD A;  2XZR A;  1LNQ A;  1YQ4 C;  1NHL A;  3BVH A;  4KHX A;  1KYO E;  3RGU A;  2KUB A;  2BEZ F;  1N73 A;  1KFN A;  3VMA A;  4EIJ A;  1SQQ J;  2WSE J;  4N6J A;  2E75 B;  1GW4 A;  1KTM A;  1OIP A;  3TGU D;  2O01 H;  1ZN5 A;  4PJ0 H;  1BGY E;  3QH9 A;  1OW6 A;  2P7J A;  3GF7 A;  3KHU A;  1M1K Q;  5AVR B;  1GL2 D;  3VMZ A;  1JB0 J;  1P84 H;  3RK3 D;  1ZRT D;  1CSB A;  1LTS C;  3G4S P;  1CI6 A;  3SFD C;  3AE9 C;  3JCU E;  3L71 G;  3PTZ A;  5CCH A;  1BCC J;  4LGD E;  1KIL A;  2JO1 A;  3JC2 2;  2HOD B;  2OTK E;  4RKU J;  2E43 A;  3FXD A;  1M1J A;  1VQK P;  4BRY A;  2JJL A;  1JY2 N;  1SQV E;  3TDK A;  4OGQ D;  2WT7 B;  3H1K G;  3W67 A;  1NTZ D;  4PV1 B;  2XNX A;  1BE3 J;  1FDI A;  5KJ7 D;  5AW7 B;  5DJT B;  1L0L E;  3CX5 H;  5KKZ C;  3WUV A;  1IK9 A;  1T3J A;  2IBZ G;  1OFC X;  3H1L G;  3HE5 A;  1PGJ A;  4WY4 C;  2BCC G;  1OX3 A;  3GW6 A;  1L2P A;  4CPG A;  1SQX J;  2A06 E;  2A45 I;  2WSC J;  1HVV A;  3BCC G;  2YKQ A;  4C7N B;  1S3J A;  2I8D A;  5KLV J;  1FE6 A;  5AW1 B;  2QIW A;  1S72 P;  2N1T B;  1GK6 A;  2YIU C;  4HH2 A;  2CPS A;  2C0X A;  3II6 A;  5AVQ B;  4H44 D;  2IYO A;  1LP1 A;  2AXT E;  2Y0C A;  1ZXG A;  3VTP C;  3CPW O;  1CW5 A;  1M57 D;  4D6T D;  4H0L B;  3RL0 g;  3FGA D;  3M9H A;  1X79 B;  4RO0 A;  1FZG A;  4W80 A;  1VQP P;  2KYV A;  1N2D C;  1DD3 A;  3L70 J;  3H25 A;  1IFN A;  3L74 D;  5AW4 B;  3TNU B;  2E75 D;  4XA4 A;  5E79 E;  3VP8 A;  1DD4 A;  3H1H E;  5B5E H;  2KSE A;  2GA1 A;  2OYI B;  2YXQ B;  2GUV A;  5KAF H;  1T2K D;  1FU1 A;  1PIX A;  2QA4 P;  3D70 A;  2HPC B;  1YTZ I;  1J1E B;  4XE5 B;  1PP9 J;  2OYO A;  1ZV8 A;  3ZDM A;  4EOT A;  1M56 D;  5GTI E;  3HD7 C;  3VP9 A;  1SFC C;  2H43 A;  2XND H;  1JM0 A;  3LID A;  1USE A;  1ZW0 A;  1L4A A;  3GHG A; 
#chains in the Genus database with same CATH homology
 1SFC A;  5AVW B;  1KQL A;  4GKG A;  3V4W A;  1SP4 A;  2IX7 C;  3B5N B;  1RE3 A;  2OYH A;  1NWQ A;  4C7N A;  1RE4 A;  3G3Z A;  2QM7 A;  2N1T C;  2XV5 A;  3TYY A;  3WMM 0;  3A7O A;  2J58 A;  5AVX B;  1JY3 O;  3RK2 B;  2POH A;  1GK4 A;  2NPS C;  2N1T A;  2H7H A;  3MD0 A;  5KTB A;  1YTZ T;  5BU5 A;  2LKM A;  1CZQ A;  3HTK B;  2YKP A;  1G1I A;  3EQ2 A;  4IFF A;  1T2K C;  5APS A;  4I1L A;  2R5B A;  5AVY B;  1EQ7 A;  4I2L C;  2FYZ A;  3NXS A;  1T8Z A;  3L36 A;  3HE4 A;  1FDM A;  1N7L A;  1J1D C;  1QL2 A;  2FFD A;  4HYT B;  2Q7C A;  1Z56 A;  2ZXE B;  2Q9I A;  5CJ0 A;  1LTG C;  4LLH A;  1SLQ A;  1IFM A;  4W7Y A;  2E42 A;  1N7S B;  1URQ C;  2XKM A;  1NTK K;  3TNU A;  1IFI A;  2OYI C;  2Z4E A;  1X9V A;  1URQ A;  1MUU A;  3P8C D;  3IFM A;  1H8A A;  5APX A;  2R32 A;  2O1K A;  2OYI A;  5AVT B;  2WPS A;  1J1E C;  2QM8 A;  1A02 J;  1WT6 A;  1LTB C;  4GT1 A;  5APV A;  1L4A D;  1GTW A;  1LTJ A;  1KZU B;  2WZ7 A;  1SFC D;  3MIW A;  2YO3 A;  3VMY A;  2KP8 A;  2FFD B;  3RL0 B;  3BRT B;  4LC1 A;  4AYC A;  2L5G B;  1SQP K;  3VOP A;  4GIF A;  5CCG C;  4IFD K;  3B5N C;  2N1T D;  3KPE A;  2C9L Y;  5APT A;  1LT9 B;  1DEB A;  5CCG A;  3V2Q A;  1E5W A;  2FXM A;  1HGV A;  3B5N A;  3RK2 C;  1JMM A;  1JCD A;  3T97 A;  1SQB K;  1XTC C;  1PFI A;  3A2A A;  4Y99 B;  2P67 A;  2WSE H;  1HGZ A;  3OJA B;  1RY3 A;  3PP5 A;  2XDJ A;  3RL0 D;  1LTJ B;  3UIA A;  3HTK A;  1S9K D;  1RF1 C;  3KQG A;  3U1A A;  3MTU E;  1NTZ K;  4OH8 B;  5AVS B;  5APW A;  3V2P A;  3V2N A;  3H32 B;  4I6M C;  1ZR4 A;  1FZC B;  3BAT A;  1JY2 O;  1WRG A;  1URQ D;  2J59 M;  4WB4 A;  1N7S C;  5CMZ A;  3LW5 H;  2WIT A;  5APQ A;  4ZKU A;  3P8C E;  5KLV K;  3M0D C;  3N7N A;  1N7S A;  2Z5I A;  1FOS F;  4RES B;  2BAS A;  3M0D A;  2HG5 D;  1SQQ K;  5AVV B;  2Q3I A;  1NKZ B;  3U59 A;  1JY3 N;  1MZ9 A;  1CI6 B;  2FFD C;  5CHX A;  2VRS A;  3V4Q A;  3RL0 C;  1VDF A;  1HTL C;  2YNY A;  2M8R A;  2GM4 A;  5CCG D;  1GL2 A;  3B5N D;  3HRN A;  3A5T A;  2W6B A;  2HLO A;  3M0A A;  1IJD B;  1JO5 A;  1RF0 A;  1KIL B;  1X8Y A;  1LT9 C;  4O9B A;  3RK2 D;  1FJP A;  2KOG A;  1NO4 A;  2Z5H A;  1G2C B;  2IFN A;  1FZE A;  1M1J B;  2KSJ A;  1LT9 A;  4N3Y B;  5APY A;  2WPQ A;  3HD7 B;  1GU4 A;  5AW0 B;  4C7R A;  1MV8 A;  1JOC A;  1JY3 P;  1FZB A;  2PAJ A;  2XZR A;  3B8E B;  1S9K E;  1AQ5 A;  1LTJ C;  1JCC A;  1NHL A;  4W7Z A;  1IO4 A;  3BVH A;  3KDP B;  1YYC A;  3CLQ A;  1OXZ A;  4KHX A;  1FBM A;  1JUN A;  3VYI A;  1N73 A;  1KFN A;  3R2P A;  1HH0 A;  1GL2 B;  2I1J A;  5AW8 B;  1A02 F;  1GU5 A;  4EIJ A;  3HE5 B;  5KJ7 C;  3RK3 B;  5AW6 B;  1FZC C;  4N6J A;  1DH3 A;  1M7L A;  1N7S D;  1GW4 A;  3H32 A;  1J2J B;  3P8M C;  4DZO A;  5KJ7 A;  2O01 H;  1FZC A;  1ZN5 A;  1GD2 E;  2WSC H;  3IR9 A;  4DOJ A;  2R5D A;  2Q5U A;  2WSF H;  1JTH B;  3KYQ A;  4WY4 B;  1XTG B;  3L35 A;  1LWU B;  2P7J A;  3HUS B;  5APU A;  2XU6 A;  1OWA A;  3MGN A;  2FKW B;  3VMX A;  5AVR B;  1GL2 D;  3VMZ A;  2KLV A;  3H6P A;  1AFO A;  2YO2 A;  3RK3 D;  1LTI C;  1N73 B;  2W27 A;  1CSB A;  2H8P D;  3P7K A;  1LTS C;  1LTA C;  5AW2 B;  1CI6 A;  1FJK A;  3NFQ A;  1SQX K;  1KIL C;  2GUS A;  5CCH A;  3M9Q A;  4LGD E;  1M1J C;  1KIL A;  2I1K A;  3M91 A;  2IPP A;  2HOD B;  2YKO A;  2E43 A;  1VPC A;  5AVU B;  1G2C A;  1M1J A;  4WBA A;  2JJL A;  1JY2 N;  2ZFC A;  5AW3 B;  3BAS A;  5BVZ A;  3HD7 A;  2WT7 B;  2XNX A;  2P1J A;  2WPR A;  2CPB A;  3V5B A;  3P32 A;  5KJ7 D;  1GL2 C;  5AW7 B;  1SVF A;  4C46 A;  4AQR D;  1HJB A;  3RK3 C;  2JEE A;  3CI9 A;  1IK9 A;  1T3J A;  2W6A A;  1RF0 C;  1ZR2 A;  3SWF A;  1FAV A;  1H89 A;  1GZL A;  3HE5 A;  2N9B A;  3U1C A;  1H88 A;  3M06 A;  2NPS A;  1JY2 P;  1N86 A;  1FOS E;  4WY4 C;  1LWU C;  2WTY A;  5AVZ B;  3HUS C;  3EFG A;  1RF1 B;  1JTH A;  1QL1 A;  1NKN A;  4WY4 A;  4Y99 C;  1MFZ A;  1LWU A;  4IFM A;  1SQV K;  3HUS A;  1L4A B;  3GHG B;  1W2E A;  2OAR A;  1T3U A;  1SFC B;  2A45 I;  1HVV A;  1N73 C;  3OA7 A;  2OYH B;  2YKQ A;  4C7N B;  2C0W A;  2O1J A;  3M9B A;  1ZLL A;  4N78 D;  5CCH D;  3VN0 A;  2KB7 P;  5AW1 B;  2MJZ A;  2A45 G;  1KIL D;  1L0L K;  3TK1 A;  3SWY A;  5AW5 B;  2N1T B;  1GK6 A;  3OAK A;  2R3C A;  4HH2 A;  2P2U A;  2CPS A;  2C0X A;  2M3B A;  2NPS B;  3NMD A;  3II6 A;  1GDT A;  5AVQ B;  3HD7 D;  4B86 A;  3L4F A;  1KFM A;  2HPC A;  2HYN A;  3HE4 B;  3VTP C;  1CW5 A;  2HFE D;  3CL3 D;  4ZKP A;  2HOD A;  4JYB A;  1JNM A;  1IFJ A;  2PP6 A;  1NOH A;  3C9I A;  1LGH B;  3E1I A;  3A3Y B;  3BRV B;  1GW3 A;  1J1D B;  1IFD A;  3M9H A;  1X79 B;  1LTT C;  1FZG A;  1IC2 A;  1NU1 K;  4W80 A;  2WT7 A;  1HWT C;  2KYV A;  1N2D C;  1IFN A;  5AW4 B;  3TNU B;  3TSI A;  3V2R A;  4XA4 A;  3N4X A;  2NPS D;  3I5C A;  4JYC A;  5BU8 B;  3VP8 A;  1URQ B;  5CCH C;  1FZA A;  3L37 A;  2YMY A;  2OYI B;  2GUV A;  1T2K D;  1FU1 A;  1NTM K;  4WY4 D;  1NH4 A;  1L0N K;  5AW9 B;  2IFM A;  3O8Z A;  2A45 H;  2HPC B;  1YTZ I;  1HBW A;  1J1E B;  4XE5 B;  2C9N Y;  3NTN A;  1ZV8 A;  1HUC A;  3MUD A;  4EOT A;  2FYU K;  4JF7 A;  3HD7 C;  1NAF A;  2WWW A;  3LIE A;  4AUW A;  1L4A C;  3GHG C;  3VP9 A;  1RF1 A;  1G1J A;  1SFC C;  2H43 A;  4N78 E;  1FZF A;  2OYH C;  1RE3 C;  4M3L A;  5CJ4 A;  3LID A;  1L4A A;  1RE4 C;  3GHG A;  1DX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...