2WTYA

Crystal structure of the homodimeric mafb in complex with the t-mare binding site
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
94
structure length
94
Chain Sequence
SDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKSEKLANSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords TRANSCRIPTION FACTOR MAFB
publication title Design of a bZIP Transcription Factor with Homo/Heterodimer-Induced DNA-Binding Preference.
pubmed doi rcsb
source organism Mus musculus
total genus 38
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03131 bZIP_Maf bZIP Maf transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wtyA00
2WT7B 3HE4B 2Q7CA 3M06A 3O8ZA 5AVYB 3TNUA 2WPRA 1MUUA 1T2KC 4EOTA 2QM8A 3LIDA 1GK6A 3VMZA 1FOSE 4GT1A 1CI6B 5AW2B 4DZOA 3KQGA 3NTNA 4B86A 3P32A 1GU4A 5AVQB 1G2CB 3L37A 4C7NA 1GD2E 3HTKA 4I6MC 5AW9B 5APQA 2WPQA 3NFQA 5AW7B 3VN0A 3P8MC 2ZXEB 5AVVB 3HE5A 5AW0B 2P2UA 1HWTC 3A2AA 1FOSF 2W6AA 1OWAA 2R32A 3VYIA 1MV8A 1HUCA 4KHXA 4C46A 2IPPA 3M0AA 3V4WA 1MFZA 3VTPC 3M9HA 2C9NY 1CI6A 5AW1B 2YO2A 2Z5HA 1HJBA 5APUA 4AYCA 2C9LY 3V4QA 2WTYA 1A02F 4JYCA 4AQRD 2R3CA 1J2JB 1SLQA 2N9BA 1JNMA 1IO4A 2YO3A 2P7JA 1NWQA 1NAFA 5APYA 3MD0A 1SP4A 5AW3B 3TYYA 2WPSA 1KQLA 3TNUB 1FAVA 2R5DA 5AW6B 1S9KD 1GTWA 1H89A 2WT7A 3HE4A 2JJLA 5AVRB 3UIAA 4M3LA 3A5TA 3M91A 2WWWA 5APTA 4AUWA 3MGNA 1H8AA 5CMZA 3M9BA 3NXSA 4XE5B 1CSBA 2Q3IA 2QM7A 2XZRA 3TK1A 3P7KA 1T2KD 3NMDA 2E43A 3IR9A 3VMYA 2KP8A 5AW4B 2BASA 3A7OA 3SWFA 2XU6A 2Z5IA 2P67A 5AW8B 3T97A 5AVUB 3A3YB 1S9KE 1H88A 5APSA 3B8EB 2R5BA 5APXA 4HYTB 2E42A 1HBWA 3M0DA 2W27A 2H7HA 2XV5A 3LIEA 1A02J 4C7NB 3KDPB 1DH3A 4GKGA 5AVZB 5AVXB 1X8YA 1GU5A 1YYCA 3L35A 2ZFCA 4RESB 5AVTB 2VRSA 3L36A 2Q5UA 3OAKA 5AW5B 5APVA 4I2LC 5AVWB 2YNYA 1GZLA 3HE5B 5APWA 1CZQA 4LC1A 1GK4A 4JYBA 5AVSB 3I5CA 3V5BA 3VMXA 1JUNA 1OXZA
chains in the Genus database with same CATH superfamily
3I56P 1RE3A 1J1DB 4RKUJ 3VMZA 4PV1B 3CX5D 5AW2B 4DZOA 1JO5A 3L37A 1J1EC 3H1LG 1BGYE 2IBZG 4HH2A 3H25A 1L2PA 3CC4P 5H2FE 5AW7B 3CMAP 3VN0A 2Q1KA 1HVVA 4ZKUA 4H13D 1SQBE 2NPSA 5KJ7C 4DOJA 4KHXA 4N3YB 1U57A 2Z5HA 3S9OA 3CCQP 5APYA 1NHLA 1FZCB 2IBZD 1GL2D 2FYUJ 2R5DA 4EYYQ 2KOGA 4W7YA 3H6PA 3W67A 1M1JB 4OH8B 1L0LD 1SQXG 4R4LA 3P7KA 5KKZB 1JOCA 1LP1B 3A3YB 2KUBA 1HBWA 1NYHA 2B89A 4GDOA 2LR2A 1T3UA 3V2PA 3LIEA 5KLVJ 4IOIH 3RL0C 1FZGA 4C7NB 4OGQC 2BCCD 3L35A 3RK3E 3K5BA 1GZLA 4JPZB 1NTZG 1SFCA 1HJ0A 3KPEA 4N78D 1QL1A 3H1HJ 4PV1D 5CCGC 1NU1J 2WSEJ 2M8RA 2H8PD 4WWIA 1USDA 1ZN5A 1VQPP 5AVVB 4RO0A 5AW0B 3PHLA 1EDKA 2HLOA 2FYUK 2WVRA 2W6AA 2J58A 1MV8A 2OTKE 4ASWA 4ZMDA 3L73J 1CI6A 3A0HE 2B9BA 2YO2A 1KILE 1TU3F 3H1KG 1A02F 1NTKJ 1L0NG 1SQVK 2QSIA 2WT7A 1E5WA 4BWNA 3KXDA 1VQ6P 3HD7C 3NMDA 2Q3EA 3O6QB 1FZEA 2YIUC 3GG2A 2G3AA 3H1KD 3CWBE 2FYNB 5APXA 2OTLP 2E42A 1A02J 2W6BA 1GL2C 1GU5A 2KYVA 2N1TC 5APVA 2CK3H 1K9MQ 1QL2A 2AXTH 1RF0A 1ZLLA 3HRNA 4UB8H 1GW4A 3M06A 2FXOA 1MUUA 5M1BA 1FOSE 4GT1A 2KZIA 1KYOH 1NTKK 4WY4A 3L75J 1BE3D 3T97B 1M90Q 2B87B 2E75B 3G4SP 3TGUD 3AE3C 1MFZA 3GF7A 5APUA 2E5YA 1W2EA 2AEJA 2FYUG 1EZVG 4DJGA 1J1DC 2R3CA 1AVOA 2FXMA 1GMJA 3CL3D 4PV1C 4U3FJ 3G6EP 3FXEA 1HF9A 1AQTA 1QVGO 2PP6A 1ZP0C 3SSUA 1G1JA 2A45H 1AQ5A 1LT9C 1H8AA 4XE5B 5KLVG 1FZAA 1NKNA 1LTJA 4K35A 2QVAA 1NTME 3AEEC 3D6YA 4PD4H 1SQQG 1KFNA 2GM4A 3PLNA 4NPEA 5AW5B 3H1HG 1S5LX 3C9IA 3W68A 1NU1G 4L76A 4C7RA 2M3EA 5AVSB 1MFTA 1XTCC 3AE4C 1NO4A 1W5CE 2KNCA 2KZJA 1GK6A 3BCCE 2OYHB 5KLIB 3H1JJ 3L71G 3P8CE 5KKZC 1EXJA 3WU2E 2LXBA 5KJ7A 3L70J 3CPWO 1R5LA 2AEMA 2M0BA 3NFQA 4GOFA 1SQQD 3L74E 3KZIH 3GHGB 1FOSF 2E75D 2ZYDA 2AXTE 1NTKG 1VQ9P 1L4AA 2C9NY 1RF1B 1OW7A 1YTZI 1H0TB 1EDLA 2C9LY 3V4QA 4H0LC 1SLQA 1KYOE 2Y0CA 2WSEH 5GTIH 3RL0g 1KORA 3B71A 1FAVA 5AW6B 2H89C 1BGYG 2WMMA 1HTLC 1OZHA 2WQYC 3M91A 2KSEA 2IX7C 1PP9E 3ABVC 1RH5B 1SQBG 2K1AA 1KZUB 4OGQB 1S9KE 2POHA 3CC7P 5TJHA 3RGUA 3LW5J 2V7QJ 1UIXA 2G8YA 4PJ0H 1T6AA 1BGYD 3CD6P 1YQ3C 4YXWH 1ZXGA 3HE5B 3R4YA 4GOEA 2KSJA 2PFXA 3HE4B 1KQGB 2IZ0A 4KT0J 5AVYB 1SQBD 1NH4A 2YKQA 2J5UA 1LWUB 3EQ2A 2C0XA 1IFIA 1PV3A 1IC2A 1KTMA 1Y8AA 5K5GB 1P84D 4EI2A 1HJBA 1KB9D 1NTMJ 1KV4A 2FBWC 1FJKA 2Y9ZA 4LGDE 1YJWP 3CLQA 3AE5C 1YBKA 3H1IJ 3TYYA 2IYPA 2A06D 1SQVE 1NKZB 1LJ2A 1IFPA 3HD7B 1L0LK 2YIUB 3HTKB 2DW3A 3BCCJ 3CI9A 1R8EA 3WUTA 3Q2YA 5KAIE 4OGQD 2N9YB 3L74J 3N4XA 2N1TB 3M0DA 3USSA 2XV5A 3U1CA 3EWKA 1JY3P 3H32B 3TF5A 1NJIQ 1OVRA 3B5NB 1IK7A 2OYIC 4I1LA 1PPJE 1AJYA 5CCGD 4LC1A 3V6IA 2Q9IA 2WSSH 1OXZA 3L73E 1WMKA 3VOPA 4QMAA 3V2NA 3CXHD 4Z1MH 1K04A 1NTMK 3MTUE 2HPCB 4PJ0E 1HH0A 3CX5I 3CWBG 2JWDA 1OW8A 2K9JB 3FX0A 1JEKA 4WBAA 5GTHE 3GMAA 3VYIA 1RE4A 5B66E 3HUSB 3M0AA 3VTPC 1S3JA 3M9HA 1VQ8P 2Z4EA 5CCHD 2JEEA 1JNMA 1NWQA 2ZVOB 2OYHC 5KLIC 2BEQD 5AW3B 1LT9B 2B88A 1PZQA 3CWBD 1H89A 1KQSO 1Q82Q 3HD7D 5AVRB 2YMKA 2IBZI 3TGUJ 1LTGC 3CCMP 3GHGC 1AA0A 4BXLA 3AE8C 2IYOA 4HKZH 3OJAB 1RF1C 3D6ZA 3H1LD 1FZCA 1BSNA 1H88A 1JM0A 1Q81Q 2NPSB 1JMMA 1N7SA 2N1TD 1M1JA 3R2PA 1IFJA 1W2BO 2BEZF 1KQFB 3L75E 5AVTB 3B5ND 1N86A 5BU8B 1LP1A 1URQA 4GODA 4L74A 2WPRA 3TNUA 2QM8A 3LIDA 1YI2P 1SQVJ 3NTNA 1G2CB 4C7NA 4U3FE 2IDBA 3LW5H 2V7QH 3BASA 1LT1A 1SQXD 1BCCE 1QLED 1JY3N 1HWTC 1JY3O 1NTMG 3E1IA 4IFFA 3RBXA 2R32A 1OX3A 4Y99C 4H0LB 4C46A 3AEDC 5AW1B 3MUDC 3BVHA 2CPBA 1U7JA 2PRRA 2ZT9B 4JYCA 1SFCB 1VQ5P 1FU1A 3BCCG 1LWUC 1KILC 3AE7C 1NTZD 1IZNB 2E76B 4D6TJ 3MGNA 3L74G 1CSBA 1YHQP 2Y0EA 1JTHB 1HGZA 2KP8A 2OYOA 1K73Q 3OA7A 5AVUB 2SPZA 5APSA 2QRXA 3AE2C 3VP8A 1Q90D 5CCHC 4HYTB 2NPSD 3H1JE 3L72J 2I8DA 3L70E 1LNQA 5CHXA 1YYCA 3P8CD 2JO1A 2JWAA 4Y28J 2QJKB 1QVFO 4R4MA 4EIJA 1IFMA 2WT7B 1AVYA 2JKVA 3CX5E 3WU2H 1L0ND 1E79H 1PP9G 1LTAC 3FGAD 1DX7A 2FFDC 1KYOD 3IFMA 3VMAA 3M9QA 1RHZB 3B5NC 4H0LD 5TISE 1ZR4A 4LLHA 1SQPJ 1M8OB 1XTGB 3GF3A 2A45G 2ZT9D 2J59M 1BDDA 2N9BA 1RQVA 1SFCD 1X22A 1RQUA 1S9KD 1FZFA 1L0LE 2O01J 1M7LA 2E76D 3F89A 1DEEG 3G9RA 3EFGA 1Z56A 1S1CX 3HUSC 4IL6X 5CBNA 2Z5IA 2R5BA 1QGKB 1BCCJ 4L75A 1QX8A 3CCEP 2OYIB 2BCCE 4NPFX 2ZFCA 2YNYA 1SQVG 4PD4D 4JF7A 4N78E 1VQMP 1EDIA 4ASVA 2FYUD 1S5LH 1EZVD 4TLFA 1SQPK 2KB7P 2W83C 2NPSC 5AW9B 3H1IE 3Q5PA 2WPQA 5DJUB 2NRGA 4ZKPA 2ZXEB 2P2UA 1ZR2A 3WUVA 4H44C 1ZRTD 5KLVD 1FDOA 2MJZA 3L4FA 1FE6A 2ZAEB 1PPJG 2WTYA 2K9YA 1JY2P 3L73G 1NGMB 1MZ9A 2PGDA 2KNCB 3H1HD 1NU1D 4U7JA 2R44A 1EC5A 5APTA 1KMIZ 5CMZA 3AEGC 4W80A 2XZRA 2IZ1A 5KAIH 4DCKA 1Q7YQ 1IJDB 2RH0A 3L71D 1PPJD 1CW5A 2WSCJ 2ZT9C 2HODA 3L73D 1WT6A 1SFCC 3E7KA 1FS0E 3CCSP 1GDTA 3JC22 3AE1C 1NTKD 4I2LC 3RK3B 2GUSA 2E76C 2FYZA 2M5AA 3BRTB 1GK4A 3VMXA 1JCCA 1NOHA 1G1IA 1PL5A 3O8ZA 2ZYGA 3BATA 1JCDA 1GD2E 1L0LJ 2WPVB 1BE3E 4Y99B 5GTHH 2QA4P 3IF4A 3HE5A 1EQ7A 5B66H 1EDJA 5CCGA 3A2AA 3TGUE 2D2CC 3L75G 4BRYB 1S5LE 2QJKC 2P58A 1Y9BA 4L73A 1P84I 3SFEC 1KILB 2BCCJ 2L91A 1IO4A 3CC2P 2YO3A 1KB9I 3PH0A 4U3FG 2WWWA 1FDIA 1BCCG 3L75D 3TK1A 4NPDA 5AW4B 3A7OA 1KC8Q 2QG4A 5AW8B 1SVFA 4I7ZB 3HD7A 1JY2N 1JY2O 1NVOA 4KJMA 1PGPA 2AXCA 1N73B 2O01H 2V4HA 2VRSA 3D71A 5AVWB 4K3AA 3RK3D 2W8ZA 2KS1A 4WY4C 1GL2A 1JUNA 2N1TA 2FFDB 2UWJE 4GIFA 3H32A 2QJYC 4I6MC 2K37A 3CXHI 3JCUH 1PGQA 3H1JG 1T3JA 1VF5C 1YQ4C 3BRVB 1PIXA 3H1KJ 1N2DC 3L70G 4D6TE 1Q86Q 2ZJSE 1ZV8A 1N8RQ 1T8ZA 2KLUA 3CMEP 2YXQB 1KILD 4AQRD 1J2JB 1VQLP 1KN7A 2PAJA 4YXDC 3MD0A 2KLVA 2ITAA 3L72E 1KFMA 1VQOP 3H1JD 5E79H 3A5TA 3EFFK 1HGVA 3L70D 3M9BA 2Q3IA 2QM7A 3AE9C 2BASA 3CXHH 1BE3J 2JDIH 1LT9A 3CCVP 2OQQA 2RN0A 5AVZB 5AVXB 1X0TA 1FJPA 3CCLP 4WB4A 3CX5H 1CZQA 1L0LG 2LKMA 3I5CA 2YXRB 1GW3A 2Q7CA 1SQPE 5BVZA 3IN6A 1L0NK 4B86A 4IFMA 3SFDC 2WSCH 1VQNP 2E74B 4H44B 1L4AC 4MN4C 3AEFC 4CPGA 5TISH 1P84E 2QJPC 2BCCG 3G71P 1N7SB 1HUCA 1M1KQ 1YITP 3RK3C 1RY3A 1KB9E 2OGUA 1G2CA 2KIKA 1VQ4P 2A06E 1URQB 3AECC 2ZXXA 3JCUE 3TNUB 1NAYA 3UIAA 1YTZT 1S72P 3H1IG 1DD4A 4AUWA 1SQQJ 3ITKA 1IFNA 2H7HA 1NTMD 3WMM0 4DT0A 2P1JA 3KHUA 5E79E 3H1ID 1JTHA 5APWA 3TDKA 3L71J 2R3SA 3CCRP 3CXHE 1FDMA 1CI6B 3MHVA 3BCCD 2I1KA 2KXPB 4JQ0D 2D2CB 2E74D 2M3BA 2ZVNB 3AE6C 4H44D 4I7ZC 2O3JA 3O6QA 3AEBC 3L74D 1S2EA 1N73C 1X9VA 2IFNA 3WUUA 5KLVK 1N7SD 1KYOI 2WSFJ 3I55P 2H43A 3PRJA 4H13C 2K3RA 3QH9A 2YKPA 1SQQK 1BGYJ 2P7JA 1M57D 5C39A 1VQKP 2C0WA 3CCJP 1LGHB 1URQD 1AV1A 1PFIA 4A7PA 3G3ZA 1NU1K 1DD3A 1BE3G 1SQBJ 5EFWB 2O1JA 3M0DC 1T2KD 1IFDA 3H1LE 3TGUG 1U7MA 3CCUP 3S4RA 1PP9D 2IBZE 2XU6A 2XNXA 3T97A 2NZ2A 4IL6H 2I1JA 4EDFA 2B87A 2Q6QA 2XNDH 1BSHA 2A45I 5B5EH 1AFOA 1OVUA 3KDPB 4WY4B 2YKOA 3V2QA 1R5SA 2HG5D 2KI7B 2FXPA 3F5HA 3U1AA 3MIWA 3V5BA 2QJYB 2Y0DA 3FWLA 1LTTC 4PD4I 1UIIA 2OYIA 1EZVI 3KQGA 1GU4A 5AVQB 1VF5B 1RE4C 1RE3C 2D2CD 1SQXE 3P8MC 1VL2A 1X79B 1FC2C 4JBZA 2W6JH 1OWAA 1SQBK 3V4WA 4IFDK 1KD1Q 1LTBC 1YIJP 4OVNF 4ZNCA 4YPCA 3RK2B 1K8AQ 2HR3A 1MKMA 1OMIA 3FXDA 2AEFA 1SP4A 1LTJB 3KYQA 1LTIC 3A0BH 1OW6A 1VPCA 3GW6A 1NTZE 2E74C 4W7ZA 1SQVD 2IFMA 1FZCC 3Q5RA 2QEXP 2LXCB 2OYHA 1SS1A 3NXSA 2H88C 1N7SC 2P10A 1M1JC 1USEA 3IR9A 3VMYA 1Y47A 2HYNA 3PP5A 4D6TG 1J1EB 3GHGA 3B8EB 3S1KA 4UB6H 1YJNP 1VQ7P 5KAFH 1RF1A 1DH3A 1URQC 2O01N 5CBOA 4RESB 4WY4D 1ZOYC 3MP7B 2XKMA 1H0TA 3L36A 2KK7A 3L72G 1VDFA 3H1KE 1EXIA 1JMBA 5L8RJ 1L0NE 5CJ4A 1T2KC 4EOTA 3Q1MA 3CWBJ 1L4AB 1OFCX 4D6TD 4IL6E 3VP9A 4UB8E 3P32A 2K88A 1VF5D 2QJPB 3IAOA 1ZW0A 5APQA 3MZWB 5B5EE 2E5TA 2RMZA 2L5GB 3H1LJ 2HODB 3ZDMA 3L72D 3AEAC 1YJ9P 2Y9YA 1FBMA 3RK2D 4TT3H 4OWFA 1D7MA 2YMYA 2M5AB 1NAFA 3RL0B 1SQPG 3B4SA 3MUDA 2WPSA 3FWNA 3HE4A 2FY8A 2JJLA 1PGJA 1QEXA 2ZYAA 4BRYA 3PTZA 2OARA 3SWYA 3SWKA 1WRGA 1LWUA 1KILA 2WSFH 3PJSK 2P67A 1K05A 1FZBA 1SQXJ 2HFED 3Q3DA 4O9BA 1SQPD 3E1RA 2W27A 3C1LA 5H2FH 2JP3A 3OW2O 2FKWB 3A0BE 4GKGA 2FYNC 1IK9A 4HJGH 2QIWA 2A06G 4PD4E 5CCHA 5KJ7D 2QE7H 2FYUE 4RJTA 1EZVE 2XDJA 3II6A 1S4XA 1ZMEC 4JYBA 5DJTB 4N6JA 1L4AD 1RF0C 1JB0J 1NTZJ 4UB6E 3HTKA 1N73A 1M56D 3N7NA 1P84H 4U3FD 5KAFE 2CPSA 1BCCD 1ZRTE 5KLVE 4H13B 1KB9H 3KZIE 2IPPA 1N7LA 5BU5A 2OTJP 1PGOA 2FFDA 4WVZA 4AYCA 3JSVC 2E75C 4YTPC 1SQQE 3V2RA 4XA4A 3B5NA 1SQXK 4XFJA 1BDCA 3RL0D 2KS1B 1GL2B 3GLMA 2GA1A 3H1HE 1KQLA 1GTWA 1NU1E 3C8VA 2RKLA 5CJ0A 5GTIE 4M3LA 2JR8A 3TSIA 1L0NJ 2HPCA 3L71E 1OVVA 2E43A 1DEBA 2GUVA 3U59A 3SWFA 3Q5SA 2O1KA 1LTSC 2W90A 3RK2C 2K9JA 1DIPA 2MKVA 1Q2NA 1NTZK 3HUSA 2WZ7A 1NTKE 1LTJC 3D70A 1X8YA 3QWOC 4HB1A 2Q5UA 3OAKA 1OIPA 3RBZA 2WITA 1PP9J 3A0HH 5KTBA
chains in the Genus database with same CATH topology
3HE4B 1RE3A 1J1DB 5AVYB 1SQPK 3VMZA 1FDMA 1CI6B 1NH4A 5AW2B 4DZOA 1JO5A 2KB7P 2YKQA 3L37A 1J1EC 1LWUB 4HH2A 3EQ2A 2I1KA 2NPSC 5AW9B 2C0XA 2M3BA 2WPQA 1IFIA 1IC2A 5AW7B 4ZKPA 3VN0A 2ZXEB 1HVVA 2P2UA 1ZR2A 4ZKUA 1N73C 1X9VA 2IFNA 5KLVK 2NPSA 5KJ7C 1N7SD 4DOJA 4KHXA 4N3YB 2H43A 2MJZA 2Z5HA 3L4FA 1HJBA 2WTYA 2YKPA 1FJKA 1JY2P 1SQQK 2P7JA 4LGDE 3CLQA 5APYA 2C0WA 1NHLA 1FZCB 1LGHB 1URQD 1GL2D 3TYYA 1NKZB 1PFIA 1MZ9A 2R5DA 2KOGA 4W7YA 3H6PA 3G3ZA 1NU1K 3HD7B 1M1JB 1L0LK 4OH8B 3HTKB 5APTA 5CMZA 4W80A 2XZRA 3P7KA 2O1JA 3M0DC 1T2KD 3CI9A 1IFDA 1IJDB 2XU6A 2XNXA 3T97A 1JOCA 3A3YB 2I1JA 1CW5A 1HBWA 3N4XA 2HODA 1WT6A 2N1TB 3M0DA 1SFCC 1T3UA 2A45I 2XV5A 3LIEA 3V2PA 3U1CA 1GDTA 3RL0C 1AFOA 1FZGA 4C7NB 1JY3P 3H32B 3KDPB 4WY4B 2YKOA 3L35A 3B5NB 3V2QA 2HG5D 4I2LC 3RK3B 1GZLA 2OYIC 2GUSA 1SFCA 4I1LA 3U1AA 2FYZA 3BRTB 3MIWA 5CCGD 4LC1A 1GK4A 3V5BA 3KPEA 4N78D 1NOHA 1JCCA 1G1IA 3VMXA 2Q9IA 1OXZA 1QL1A 1LTTC 3VOPA 3O8ZA 3V2NA 3BATA 1JCDA 2OYIA 3KQGA 5CCGC 1GU4A 1NTMK 5AVQB 1GD2E 2M8RA 3MTUE 2H8PD 2HPCB 1RE4C 1RE3C 1HH0A 4Y99B 1ZN5A 3P8MC 5AVVB 1X79B 3HE5A 5AW0B 1EQ7A 2HLOA 2FYUK 3A2AA 5CCGA 4WBAA 1OWAA 2W6AA 2J58A 3VYIA 1MV8A 1RE4A 1SQBK 3HUSB 3M0AA 3V4WA 4IFDK 3VTPC 3M9HA 1CI6A 1LTBC 2YO2A 2Z4EA 3RK2B 5CCHD 1KILB 2JEEA 1A02F 1IO4A 1JNMA 2YO3A 1NWQA 2OYHC 1SP4A 1LTJB 5AW3B 3KYQA 1LT9B 1LTIC 1VPCA 4W7ZA 1SQVK 1H89A 2WT7A 3HD7D 5AVRB 2IFMA 1E5WA 1LTGC 1FZCC 3GHGC 2WWWA 2OYHA 3NXSA 3TK1A 1N7SC 3HD7C 3NMDA 1M1JC 3IR9A 1FZEA 3VMYA 5AW4B 3A7OA 3OJAB 1RF1C 2HYNA 3PP5A 5AW8B 1J1EB 1FZCA 3GHGA 1H88A 3B8EB 5APXA 2NPSB 1JMMA 2E42A 1SVFA 1N7SA 2N1TD 3HD7A 1JY2N 1JY2O 1M1JA 3R2PA 1IFJA 1A02J 1RF1A 1DH3A 1URQC 2W6BA 1GL2C 1N73B 1GU5A 4RESB 4WY4D 2O01H 2XKMA 2VRSA 5AVTB 3L36A 2KYVA 2N1TC 3B5ND 5APVA 5AVWB 1N86A 1QL2A 3RK3D 1VDFA 1RF0A 5BU8B 1ZLLA 1URQA 4WY4C 1GL2A 1JUNA 3HRNA 1GW4A 3M06A 5CJ4A 3TNUA 2WPRA 1MUUA 1T2KC 4EOTA 2N1TA 2QM8A 3LIDA 1L4AB 1FOSE 4GT1A 3VP9A 2FFDB 3NTNA 3P32A 4GIFA 1G2CB 4C7NA 3H32A 1NTKK 4I6MC 4WY4A 3LW5H 5APQA 3BASA 1T3JA 1JY3N 1HWTC 1JY3O 3BRVB 3E1IA 4IFFA 2L5GB 2HODB 1N2DC 2R32A 4Y99C 4C46A 1MFZA 1ZV8A 1T8ZA 5AW1B 3BVHA 5APUA 2CPBA 1W2EA 1FBMA 3RK2D 1KILD 4JYCA 1J1DC 2R3CA 4AQRD 1J2JB 1SFCB 2YMYA 2FXMA 1NAFA 2PAJA 3CL3D 3RL0B 1FU1A 3MD0A 3MUDA 2KLVA 1LWUC 1KILC 2WPSA 2PP6A 1KFMA 3HE4A 2JJLA 2OARA 1G1JA 3A5TA 3SWYA 1HGVA 2A45H 3MGNA 1AQ5A 1LT9C 1H8AA 3M9BA 4XE5B 1CSBA 1WRGA 1LWUA 1KILA 2Q3IA 2QM7A 2WSFH 1JTHB 1FZAA 1HGZA 2KP8A 2BASA 3OA7A 2P67A 1NKNA 5AVUB 1FZBA 1LTJA 2HFED 4O9BA 5APSA 3VP8A 1LT9A 5CCHC 4HYTB 2NPSD 2W27A 1KFNA 2FKWB 2GM4A 4GKGA 5AVZB 5AVXB 5CHXA 1IK9A 1YYCA 3P8CD 5CCHA 1FJPA 5KJ7D 5AW5B 4WB4A 3C9IA 1CZQA 2XDJA 3II6A 4EIJA 4C7RA 4JYBA 1IFMA 2LKMA 3I5CA 5AVSB 1XTCC 2WT7B 2Q7CA 1GW3A 5BVZA 1NO4A 1L0NK 4N6JA 1GK6A 1L4AD 1RF0C 2OYHB 4B86A 1LTAC 4IFMA 3P8CE 3HTKA 2WSCH 1N73A 3N7NA 5KJ7A 1DX7A 1L4AC 3NFQA 2FFDC 3GHGB 3IFMA 2CPSA 1FOSF 3M9QA 1N7SB 3B5NC 1HUCA 2IPPA 1N7LA 5BU5A 1ZR4A 1L4AA 3RK3C 4LLHA 2C9NY 1RF1B 1RY3A 2FFDA 1YTZI 1G2CA 4AYCA 1XTGB 2A45G 2C9LY 3V4QA 2J59M 3V2RA 4XA4A 1SLQA 2N9BA 3B5NA 1SFCD 1SQXK 2WSEH 3RL0D 1URQB 1GL2B 1KQLA 3TNUB 1FAVA 5AW6B 1S9KD 1GTWA 1FZFA 3UIAA 5CJ0A 1M7LA 1YTZT 4M3LA 1HTLC 3M91A 3TSIA 4AUWA 3EFGA 2IX7C 1Z56A 2HPCA 2E43A 1DEBA 3HUSC 2GUVA 3U59A 3SWFA 1KZUB 2Z5IA 2O1KA 1LTSC 1S9KE 1IFNA 2POHA 2R5BA 3RK2C 1NTZK 2H7HA 2OYIB 3HUSA 2WZ7A 3WMM0 1LTJC 1X8YA 2P1JA 2ZFCA 2Q5UA 3OAKA 2YNYA 1JTHA 4JF7A 3HE5B 4N78E 5APWA 2WITA 5KTBA 2KSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WT7 B;  3HE4 B;  2Q7C A;  3M06 A;  3O8Z A;  5AVY B;  3TNU A;  2WPR A;  1MUU A;  1T2K C;  4EOT A;  2QM8 A;  3LID A;  1GK6 A;  3VMZ A;  1FOS E;  4GT1 A;  1CI6 B;  5AW2 B;  4DZO A;  3KQG A;  3NTN A;  4B86 A;  3P32 A;  1GU4 A;  5AVQ B;  1G2C B;  3L37 A;  4C7N A;  1GD2 E;  3HTK A;  4I6M C;  5AW9 B;  5APQ A;  2WPQ A;  3NFQ A;  5AW7 B;  3VN0 A;  3P8M C;  2ZXE B;  5AVV B;  3HE5 A;  5AW0 B;  2P2U A;  1HWT C;  3A2A A;  1FOS F;  2W6A A;  1OWA A;  2R32 A;  3VYI A;  1MV8 A;  1HUC A;  4KHX A;  4C46 A;  2IPP A;  3M0A A;  3V4W A;  1MFZ A;  3VTP C;  3M9H A;  2C9N Y;  1CI6 A;  5AW1 B;  2YO2 A;  2Z5H A;  1HJB A;  5APU A;  4AYC A;  2C9L Y;  3V4Q A;  2WTY A;  1A02 F;  4JYC A;  4AQR D;  2R3C A;  1J2J B;  1SLQ A;  2N9B A;  1JNM A;  1IO4 A;  2YO3 A;  2P7J A;  1NWQ A;  1NAF A;  5APY A;  3MD0 A;  1SP4 A;  5AW3 B;  3TYY A;  2WPS A;  1KQL A;  3TNU B;  1FAV A;  2R5D A;  5AW6 B;  1S9K D;  1GTW A;  1H89 A;  2WT7 A;  3HE4 A;  2JJL A;  5AVR B;  3UIA A;  4M3L A;  3A5T A;  3M91 A;  2WWW A;  5APT A;  4AUW A;  3MGN A;  1H8A A;  5CMZ A;  3M9B A;  3NXS A;  4XE5 B;  1CSB A;  2Q3I A;  2QM7 A;  2XZR A;  3TK1 A;  3P7K A;  1T2K D;  3NMD A;  2E43 A;  3IR9 A;  3VMY A;  2KP8 A;  5AW4 B;  2BAS A;  3A7O A;  3SWF A;  2XU6 A;  2Z5I A;  2P67 A;  5AW8 B;  3T97 A;  5AVU B;  3A3Y B;  1S9K E;  1H88 A;  5APS A;  3B8E B;  2R5B A;  5APX A;  4HYT B;  2E42 A;  1HBW A;  3M0D A;  2W27 A;  2H7H A;  2XV5 A;  3LIE A;  1A02 J;  4C7N B;  3KDP B;  1DH3 A;  4GKG A;  5AVZ B;  5AVX B;  1X8Y A;  1GU5 A;  1YYC A;  3L35 A;  2ZFC A;  4RES B;  5AVT B;  2VRS A;  3L36 A;  2Q5U A;  3OAK A;  5AW5 B;  5APV A;  4I2L C;  5AVW B;  2YNY A;  1GZL A;  3HE5 B;  5APW A;  1CZQ A;  4LC1 A;  1GK4 A;  4JYB A;  5AVS B;  3I5C A;  3V5B A;  3VMX A;  1JUN A;  1OXZ A; 
#chains in the Genus database with same CATH topology
 3I56 P;  1RE3 A;  1J1D B;  4RKU J;  3VMZ A;  4PV1 B;  3CX5 D;  5AW2 B;  4DZO A;  1JO5 A;  3L37 A;  1J1E C;  3H1L G;  1BGY E;  2IBZ G;  4HH2 A;  3H25 A;  1L2P A;  3CC4 P;  5H2F E;  5AW7 B;  3CMA P;  3VN0 A;  2Q1K A;  1HVV A;  4ZKU A;  4H13 D;  1SQB E;  2NPS A;  5KJ7 C;  4DOJ A;  4KHX A;  4N3Y B;  1U57 A;  2Z5H A;  3S9O A;  3CCQ P;  5APY A;  1NHL A;  1FZC B;  2IBZ D;  1GL2 D;  2FYU J;  2R5D A;  4EYY Q;  2KOG A;  4W7Y A;  3H6P A;  3W67 A;  1M1J B;  4OH8 B;  1L0L D;  1SQX G;  4R4L A;  3P7K A;  5KKZ B;  1JOC A;  1LP1 B;  3A3Y B;  2KUB A;  1HBW A;  1NYH A;  2B89 A;  4GDO A;  2LR2 A;  1T3U A;  3V2P A;  3LIE A;  5KLV J;  4IOI H;  3RL0 C;  1FZG A;  4C7N B;  4OGQ C;  2BCC D;  3L35 A;  3RK3 E;  3K5B A;  1GZL A;  4JPZ B;  1NTZ G;  1SFC A;  1HJ0 A;  3KPE A;  4N78 D;  1QL1 A;  3H1H J;  4PV1 D;  5CCG C;  1NU1 J;  2WSE J;  2M8R A;  2H8P D;  4WWI A;  1USD A;  1ZN5 A;  1VQP P;  5AVV B;  4RO0 A;  5AW0 B;  3PHL A;  1EDK A;  2HLO A;  2FYU K;  2WVR A;  2W6A A;  2J58 A;  1MV8 A;  2OTK E;  4ASW A;  4ZMD A;  3L73 J;  1CI6 A;  3A0H E;  2B9B A;  2YO2 A;  1KIL E;  1TU3 F;  3H1K G;  1A02 F;  1NTK J;  1L0N G;  1SQV K;  2QSI A;  2WT7 A;  1E5W A;  4BWN A;  3KXD A;  1VQ6 P;  3HD7 C;  3NMD A;  2Q3E A;  3O6Q B;  1FZE A;  2YIU C;  3GG2 A;  2G3A A;  3H1K D;  3CWB E;  2FYN B;  5APX A;  2OTL P;  2E42 A;  1A02 J;  2W6B A;  1GL2 C;  1GU5 A;  2KYV A;  2N1T C;  5APV A;  2CK3 H;  1K9M Q;  1QL2 A;  2AXT H;  1RF0 A;  1ZLL A;  3HRN A;  4UB8 H;  1GW4 A;  3M06 A;  2FXO A;  1MUU A;  5M1B A;  1FOS E;  4GT1 A;  2KZI A;  1KYO H;  1NTK K;  4WY4 A;  3L75 J;  1BE3 D;  3T97 B;  1M90 Q;  2B87 B;  2E75 B;  3G4S P;  3TGU D;  3AE3 C;  1MFZ A;  3GF7 A;  5APU A;  2E5Y A;  1W2E A;  2AEJ A;  2FYU G;  1EZV G;  4DJG A;  1J1D C;  2R3C A;  1AVO A;  2FXM A;  1GMJ A;  3CL3 D;  4PV1 C;  4U3F J;  3G6E P;  3FXE A;  1HF9 A;  1AQT A;  1QVG O;  2PP6 A;  1ZP0 C;  3SSU A;  1G1J A;  2A45 H;  1AQ5 A;  1LT9 C;  1H8A A;  4XE5 B;  5KLV G;  1FZA A;  1NKN A;  1LTJ A;  4K35 A;  2QVA A;  1NTM E;  3AEE C;  3D6Y A;  4PD4 H;  1SQQ G;  1KFN A;  2GM4 A;  3PLN A;  4NPE A;  5AW5 B;  3H1H G;  1S5L X;  3C9I A;  3W68 A;  1NU1 G;  4L76 A;  4C7R A;  2M3E A;  5AVS B;  1MFT A;  1XTC C;  3AE4 C;  1NO4 A;  1W5C E;  2KNC A;  2KZJ A;  1GK6 A;  3BCC E;  2OYH B;  5KLI B;  3H1J J;  3L71 G;  3P8C E;  5KKZ C;  1EXJ A;  3WU2 E;  2LXB A;  5KJ7 A;  3L70 J;  3CPW O;  1R5L A;  2AEM A;  2M0B A;  3NFQ A;  4GOF A;  1SQQ D;  3L74 E;  3KZI H;  3GHG B;  1FOS F;  2E75 D;  2ZYD A;  2AXT E;  1NTK G;  1VQ9 P;  1L4A A;  2C9N Y;  1RF1 B;  1OW7 A;  1YTZ I;  1H0T B;  1EDL A;  2C9L Y;  3V4Q A;  4H0L C;  1SLQ A;  1KYO E;  2Y0C A;  2WSE H;  5GTI H;  3RL0 g;  1KOR A;  3B71 A;  1FAV A;  5AW6 B;  2H89 C;  1BGY G;  2WMM A;  1HTL C;  1OZH A;  2WQY C;  3M91 A;  2KSE A;  2IX7 C;  1PP9 E;  3ABV C;  1RH5 B;  1SQB G;  2K1A A;  1KZU B;  4OGQ B;  1S9K E;  2POH A;  3CC7 P;  5TJH A;  3RGU A;  3LW5 J;  2V7Q J;  1UIX A;  2G8Y A;  4PJ0 H;  1T6A A;  1BGY D;  3CD6 P;  1YQ3 C;  4YXW H;  1ZXG A;  3HE5 B;  3R4Y A;  4GOE A;  2KSJ A;  2PFX A;  3HE4 B;  1KQG B;  2IZ0 A;  4KT0 J;  5AVY B;  1SQB D;  1NH4 A;  2YKQ A;  2J5U A;  1LWU B;  3EQ2 A;  2C0X A;  1IFI A;  1PV3 A;  1IC2 A;  1KTM A;  1Y8A A;  5K5G B;  1P84 D;  4EI2 A;  1HJB A;  1KB9 D;  1NTM J;  1KV4 A;  2FBW C;  1FJK A;  2Y9Z A;  4LGD E;  1YJW P;  3CLQ A;  3AE5 C;  1YBK A;  3H1I J;  3TYY A;  2IYP A;  2A06 D;  1SQV E;  1NKZ B;  1LJ2 A;  1IFP A;  3HD7 B;  1L0L K;  2YIU B;  3HTK B;  2DW3 A;  3BCC J;  3CI9 A;  1R8E A;  3WUT A;  3Q2Y A;  5KAI E;  4OGQ D;  2N9Y B;  3L74 J;  3N4X A;  2N1T B;  3M0D A;  3USS A;  2XV5 A;  3U1C A;  3EWK A;  1JY3 P;  3H32 B;  3TF5 A;  1NJI Q;  1OVR A;  3B5N B;  1IK7 A;  2OYI C;  4I1L A;  1PPJ E;  1AJY A;  5CCG D;  4LC1 A;  3V6I A;  2Q9I A;  2WSS H;  1OXZ A;  3L73 E;  1WMK A;  3VOP A;  4QMA A;  3V2N A;  3CXH D;  4Z1M H;  1K04 A;  1NTM K;  3MTU E;  2HPC B;  4PJ0 E;  1HH0 A;  3CX5 I;  3CWB G;  2JWD A;  1OW8 A;  2K9J B;  3FX0 A;  1JEK A;  4WBA A;  5GTH E;  3GMA A;  3VYI A;  1RE4 A;  5B66 E;  3HUS B;  3M0A A;  3VTP C;  1S3J A;  3M9H A;  1VQ8 P;  2Z4E A;  5CCH D;  2JEE A;  1JNM A;  1NWQ A;  2ZVO B;  2OYH C;  5KLI C;  2BEQ D;  5AW3 B;  1LT9 B;  2B88 A;  1PZQ A;  3CWB D;  1H89 A;  1KQS O;  1Q82 Q;  3HD7 D;  5AVR B;  2YMK A;  2IBZ I;  3TGU J;  1LTG C;  3CCM P;  3GHG C;  1AA0 A;  4BXL A;  3AE8 C;  2IYO A;  4HKZ H;  3OJA B;  1RF1 C;  3D6Z A;  3H1L D;  1FZC A;  1BSN A;  1H88 A;  1JM0 A;  1Q81 Q;  2NPS B;  1JMM A;  1N7S A;  2N1T D;  1M1J A;  3R2P A;  1IFJ A;  1W2B O;  2BEZ F;  1KQF B;  3L75 E;  5AVT B;  3B5N D;  1N86 A;  5BU8 B;  1LP1 A;  1URQ A;  4GOD A;  4L74 A;  2WPR A;  3TNU A;  2QM8 A;  3LID A;  1YI2 P;  1SQV J;  3NTN A;  1G2C B;  4C7N A;  4U3F E;  2IDB A;  3LW5 H;  2V7Q H;  3BAS A;  1LT1 A;  1SQX D;  1BCC E;  1QLE D;  1JY3 N;  1HWT C;  1JY3 O;  1NTM G;  3E1I A;  4IFF A;  3RBX A;  2R32 A;  1OX3 A;  4Y99 C;  4H0L B;  4C46 A;  3AED C;  5AW1 B;  3MUD C;  3BVH A;  2CPB A;  1U7J A;  2PRR A;  2ZT9 B;  4JYC A;  1SFC B;  1VQ5 P;  1FU1 A;  3BCC G;  1LWU C;  1KIL C;  3AE7 C;  1NTZ D;  1IZN B;  2E76 B;  4D6T J;  3MGN A;  3L74 G;  1CSB A;  1YHQ P;  2Y0E A;  1JTH B;  1HGZ A;  2KP8 A;  2OYO A;  1K73 Q;  3OA7 A;  5AVU B;  2SPZ A;  5APS A;  2QRX A;  3AE2 C;  3VP8 A;  1Q90 D;  5CCH C;  4HYT B;  2NPS D;  3H1J E;  3L72 J;  2I8D A;  3L70 E;  1LNQ A;  5CHX A;  1YYC A;  3P8C D;  2JO1 A;  2JWA A;  4Y28 J;  2QJK B;  1QVF O;  4R4M A;  4EIJ A;  1IFM A;  2WT7 B;  1AVY A;  2JKV A;  3CX5 E;  3WU2 H;  1L0N D;  1E79 H;  1PP9 G;  1LTA C;  3FGA D;  1DX7 A;  2FFD C;  1KYO D;  3IFM A;  3VMA A;  3M9Q A;  1RHZ B;  3B5N C;  4H0L D;  5TIS E;  1ZR4 A;  4LLH A;  1SQP J;  1M8O B;  1XTG B;  3GF3 A;  2A45 G;  2ZT9 D;  2J59 M;  1BDD A;  2N9B A;  1RQV A;  1SFC D;  1X22 A;  1RQU A;  1S9K D;  1FZF A;  1L0L E;  2O01 J;  1M7L A;  2E76 D;  3F89 A;  1DEE G;  3G9R A;  3EFG A;  1Z56 A;  1S1C X;  3HUS C;  4IL6 X;  5CBN A;  2Z5I A;  2R5B A;  1QGK B;  1BCC J;  4L75 A;  1QX8 A;  3CCE P;  2OYI B;  2BCC E;  4NPF X;  2ZFC A;  2YNY A;  1SQV G;  4PD4 D;  4JF7 A;  4N78 E;  1VQM P;  1EDI A;  4ASV A;  2FYU D;  1S5L H;  1EZV D;  4TLF A;  1SQP K;  2KB7 P;  2W83 C;  2NPS C;  5AW9 B;  3H1I E;  3Q5P A;  2WPQ A;  5DJU B;  2NRG A;  4ZKP A;  2ZXE B;  2P2U A;  1ZR2 A;  3WUV A;  4H44 C;  1ZRT D;  5KLV D;  1FDO A;  2MJZ A;  3L4F A;  1FE6 A;  2ZAE B;  1PPJ G;  2WTY A;  2K9Y A;  1JY2 P;  3L73 G;  1NGM B;  1MZ9 A;  2PGD A;  2KNC B;  3H1H D;  1NU1 D;  4U7J A;  2R44 A;  1EC5 A;  5APT A;  1KMI Z;  5CMZ A;  3AEG C;  4W80 A;  2XZR A;  2IZ1 A;  5KAI H;  4DCK A;  1Q7Y Q;  1IJD B;  2RH0 A;  3L71 D;  1PPJ D;  1CW5 A;  2WSC J;  2ZT9 C;  2HOD A;  3L73 D;  1WT6 A;  1SFC C;  3E7K A;  1FS0 E;  3CCS P;  1GDT A;  3JC2 2;  3AE1 C;  1NTK D;  4I2L C;  3RK3 B;  2GUS A;  2E76 C;  2FYZ A;  2M5A A;  3BRT B;  1GK4 A;  3VMX A;  1JCC A;  1NOH A;  1G1I A;  1PL5 A;  3O8Z A;  2ZYG A;  3BAT A;  1JCD A;  1GD2 E;  1L0L J;  2WPV B;  1BE3 E;  4Y99 B;  5GTH H;  2QA4 P;  3IF4 A;  3HE5 A;  1EQ7 A;  5B66 H;  1EDJ A;  5CCG A;  3A2A A;  3TGU E;  2D2C C;  3L75 G;  4BRY B;  1S5L E;  2QJK C;  2P58 A;  1Y9B A;  4L73 A;  1P84 I;  3SFE C;  1KIL B;  2BCC J;  2L91 A;  1IO4 A;  3CC2 P;  2YO3 A;  1KB9 I;  3PH0 A;  4U3F G;  2WWW A;  1FDI A;  1BCC G;  3L75 D;  3TK1 A;  4NPD A;  5AW4 B;  3A7O A;  1KC8 Q;  2QG4 A;  5AW8 B;  1SVF A;  4I7Z B;  3HD7 A;  1JY2 N;  1JY2 O;  1NVO A;  4KJM A;  1PGP A;  2AXC A;  1N73 B;  2O01 H;  2V4H A;  2VRS A;  3D71 A;  5AVW B;  4K3A A;  3RK3 D;  2W8Z A;  2KS1 A;  4WY4 C;  1GL2 A;  1JUN A;  2N1T A;  2FFD B;  2UWJ E;  4GIF A;  3H32 A;  2QJY C;  4I6M C;  2K37 A;  3CXH I;  3JCU H;  1PGQ A;  3H1J G;  1T3J A;  1VF5 C;  1YQ4 C;  3BRV B;  1PIX A;  3H1K J;  1N2D C;  3L70 G;  4D6T E;  1Q86 Q;  2ZJS E;  1ZV8 A;  1N8R Q;  1T8Z A;  2KLU A;  3CME P;  2YXQ B;  1KIL D;  4AQR D;  1J2J B;  1VQL P;  1KN7 A;  2PAJ A;  4YXD C;  3MD0 A;  2KLV A;  2ITA A;  3L72 E;  1KFM A;  1VQO P;  3H1J D;  5E79 H;  3A5T A;  3EFF K;  1HGV A;  3L70 D;  3M9B A;  2Q3I A;  2QM7 A;  3AE9 C;  2BAS A;  3CXH H;  1BE3 J;  2JDI H;  1LT9 A;  3CCV P;  2OQQ A;  2RN0 A;  5AVZ B;  5AVX B;  1X0T A;  1FJP A;  3CCL P;  4WB4 A;  3CX5 H;  1CZQ A;  1L0L G;  2LKM A;  3I5C A;  2YXR B;  1GW3 A;  2Q7C A;  1SQP E;  5BVZ A;  3IN6 A;  1L0N K;  4B86 A;  4IFM A;  3SFD C;  2WSC H;  1VQN P;  2E74 B;  4H44 B;  1L4A C;  4MN4 C;  3AEF C;  4CPG A;  5TIS H;  1P84 E;  2QJP C;  2BCC G;  3G71 P;  1N7S B;  1HUC A;  1M1K Q;  1YIT P;  3RK3 C;  1RY3 A;  1KB9 E;  2OGU A;  1G2C A;  2KIK A;  1VQ4 P;  2A06 E;  1URQ B;  3AEC C;  2ZXX A;  3JCU E;  3TNU B;  1NAY A;  3UIA A;  1YTZ T;  1S72 P;  3H1I G;  1DD4 A;  4AUW A;  1SQQ J;  3ITK A;  1IFN A;  2H7H A;  1NTM D;  3WMM 0;  4DT0 A;  2P1J A;  3KHU A;  5E79 E;  3H1I D;  1JTH A;  5APW A;  3TDK A;  3L71 J;  2R3S A;  3CCR P;  3CXH E;  1FDM A;  1CI6 B;  3MHV A;  3BCC D;  2I1K A;  2KXP B;  4JQ0 D;  2D2C B;  2E74 D;  2M3B A;  2ZVN B;  3AE6 C;  4H44 D;  4I7Z C;  2O3J A;  3O6Q A;  3AEB C;  3L74 D;  1S2E A;  1N73 C;  1X9V A;  2IFN A;  3WUU A;  5KLV K;  1N7S D;  1KYO I;  2WSF J;  3I55 P;  2H43 A;  3PRJ A;  4H13 C;  2K3R A;  3QH9 A;  2YKP A;  1SQQ K;  1BGY J;  2P7J A;  1M57 D;  5C39 A;  1VQK P;  2C0W A;  3CCJ P;  1LGH B;  1URQ D;  1AV1 A;  1PFI A;  4A7P A;  3G3Z A;  1NU1 K;  1DD3 A;  1BE3 G;  1SQB J;  5EFW B;  2O1J A;  3M0D C;  1T2K D;  1IFD A;  3H1L E;  3TGU G;  1U7M A;  3CCU P;  3S4R A;  1PP9 D;  2IBZ E;  2XU6 A;  2XNX A;  3T97 A;  2NZ2 A;  4IL6 H;  2I1J A;  4EDF A;  2B87 A;  2Q6Q A;  2XND H;  1BSH A;  2A45 I;  5B5E H;  1AFO A;  1OVU A;  3KDP B;  4WY4 B;  2YKO A;  3V2Q A;  1R5S A;  2HG5 D;  2KI7 B;  2FXP A;  3F5H A;  3U1A A;  3MIW A;  3V5B A;  2QJY B;  2Y0D A;  3FWL A;  1LTT C;  4PD4 I;  1UII A;  2OYI A;  1EZV I;  3KQG A;  1GU4 A;  5AVQ B;  1VF5 B;  1RE4 C;  1RE3 C;  2D2C D;  1SQX E;  3P8M C;  1VL2 A;  1X79 B;  1FC2 C;  4JBZ A;  2W6J H;  1OWA A;  1SQB K;  3V4W A;  4IFD K;  1KD1 Q;  1LTB C;  1YIJ P;  4OVN F;  4ZNC A;  4YPC A;  3RK2 B;  1K8A Q;  2HR3 A;  1MKM A;  1OMI A;  3FXD A;  2AEF A;  1SP4 A;  1LTJ B;  3KYQ A;  1LTI C;  3A0B H;  1OW6 A;  1VPC A;  3GW6 A;  1NTZ E;  2E74 C;  4W7Z A;  1SQV D;  2IFM A;  1FZC C;  3Q5R A;  2QEX P;  2LXC B;  2OYH A;  1SS1 A;  3NXS A;  2H88 C;  1N7S C;  2P10 A;  1M1J C;  1USE A;  3IR9 A;  3VMY A;  1Y47 A;  2HYN A;  3PP5 A;  4D6T G;  1J1E B;  3GHG A;  3B8E B;  3S1K A;  4UB6 H;  1YJN P;  1VQ7 P;  5KAF H;  1RF1 A;  1DH3 A;  1URQ C;  2O01 N;  5CBO A;  4RES B;  4WY4 D;  1ZOY C;  3MP7 B;  2XKM A;  1H0T A;  3L36 A;  2KK7 A;  3L72 G;  1VDF A;  3H1K E;  1EXI A;  1JMB A;  5L8R J;  1L0N E;  5CJ4 A;  1T2K C;  4EOT A;  3Q1M A;  3CWB J;  1L4A B;  1OFC X;  4D6T D;  4IL6 E;  3VP9 A;  4UB8 E;  3P32 A;  2K88 A;  1VF5 D;  2QJP B;  3IAO A;  1ZW0 A;  5APQ A;  3MZW B;  5B5E E;  2E5T A;  2RMZ A;  2L5G B;  3H1L J;  2HOD B;  3ZDM A;  3L72 D;  3AEA C;  1YJ9 P;  2Y9Y A;  1FBM A;  3RK2 D;  4TT3 H;  4OWF A;  1D7M A;  2YMY A;  2M5A B;  1NAF A;  3RL0 B;  1SQP G;  3B4S A;  3MUD A;  2WPS A;  3FWN A;  3HE4 A;  2FY8 A;  2JJL A;  1PGJ A;  1QEX A;  2ZYA A;  4BRY A;  3PTZ A;  2OAR A;  3SWY A;  3SWK A;  1WRG A;  1LWU A;  1KIL A;  2WSF H;  3PJS K;  2P67 A;  1K05 A;  1FZB A;  1SQX J;  2HFE D;  3Q3D A;  4O9B A;  1SQP D;  3E1R A;  2W27 A;  3C1L A;  5H2F H;  2JP3 A;  3OW2 O;  2FKW B;  3A0B E;  4GKG A;  2FYN C;  1IK9 A;  4HJG H;  2QIW A;  2A06 G;  4PD4 E;  5CCH A;  5KJ7 D;  2QE7 H;  2FYU E;  4RJT A;  1EZV E;  2XDJ A;  3II6 A;  1S4X A;  1ZME C;  4JYB A;  5DJT B;  4N6J A;  1L4A D;  1RF0 C;  1JB0 J;  1NTZ J;  4UB6 E;  3HTK A;  1N73 A;  1M56 D;  3N7N A;  1P84 H;  4U3F D;  5KAF E;  2CPS A;  1BCC D;  1ZRT E;  5KLV E;  4H13 B;  1KB9 H;  3KZI E;  2IPP A;  1N7L A;  5BU5 A;  2OTJ P;  1PGO A;  2FFD A;  4WVZ A;  4AYC A;  3JSV C;  2E75 C;  4YTP C;  1SQQ E;  3V2R A;  4XA4 A;  3B5N A;  1SQX K;  4XFJ A;  1BDC A;  3RL0 D;  2KS1 B;  1GL2 B;  3GLM A;  2GA1 A;  3H1H E;  1KQL A;  1GTW A;  1NU1 E;  3C8V A;  2RKL A;  5CJ0 A;  5GTI E;  4M3L A;  2JR8 A;  3TSI A;  1L0N J;  2HPC A;  3L71 E;  1OVV A;  2E43 A;  1DEB A;  2GUV A;  3U59 A;  3SWF A;  3Q5S A;  2O1K A;  1LTS C;  2W90 A;  3RK2 C;  2K9J A;  1DIP A;  2MKV A;  1Q2N A;  1NTZ K;  3HUS A;  2WZ7 A;  1NTK E;  1LTJ C;  3D70 A;  1X8Y A;  3QWO C;  4HB1 A;  2Q5U A;  3OAK A;  1OIP A;  3RBZ A;  2WIT A;  1PP9 J;  3A0H H;  5KTB A; 
#chains in the Genus database with same CATH homology
 3HE4 B;  1RE3 A;  1J1D B;  5AVY B;  1SQP K;  3VMZ A;  1FDM A;  1CI6 B;  1NH4 A;  5AW2 B;  4DZO A;  1JO5 A;  2KB7 P;  2YKQ A;  3L37 A;  1J1E C;  1LWU B;  4HH2 A;  3EQ2 A;  2I1K A;  2NPS C;  5AW9 B;  2C0X A;  2M3B A;  2WPQ A;  1IFI A;  1IC2 A;  5AW7 B;  4ZKP A;  3VN0 A;  2ZXE B;  1HVV A;  2P2U A;  1ZR2 A;  4ZKU A;  1N73 C;  1X9V A;  2IFN A;  5KLV K;  2NPS A;  5KJ7 C;  1N7S D;  4DOJ A;  4KHX A;  4N3Y B;  2H43 A;  2MJZ A;  2Z5H A;  3L4F A;  1HJB A;  2WTY A;  2YKP A;  1FJK A;  1JY2 P;  1SQQ K;  2P7J A;  4LGD E;  3CLQ A;  5APY A;  2C0W A;  1NHL A;  1FZC B;  1LGH B;  1URQ D;  1GL2 D;  3TYY A;  1NKZ B;  1PFI A;  1MZ9 A;  2R5D A;  2KOG A;  4W7Y A;  3H6P A;  3G3Z A;  1NU1 K;  3HD7 B;  1M1J B;  1L0L K;  4OH8 B;  3HTK B;  5APT A;  5CMZ A;  4W80 A;  2XZR A;  3P7K A;  2O1J A;  3M0D C;  1T2K D;  3CI9 A;  1IFD A;  1IJD B;  2XU6 A;  2XNX A;  3T97 A;  1JOC A;  3A3Y B;  2I1J A;  1CW5 A;  1HBW A;  3N4X A;  2HOD A;  1WT6 A;  2N1T B;  3M0D A;  1SFC C;  1T3U A;  2A45 I;  2XV5 A;  3LIE A;  3V2P A;  3U1C A;  1GDT A;  3RL0 C;  1AFO A;  1FZG A;  4C7N B;  1JY3 P;  3H32 B;  3KDP B;  4WY4 B;  2YKO A;  3L35 A;  3B5N B;  3V2Q A;  2HG5 D;  4I2L C;  3RK3 B;  1GZL A;  2OYI C;  2GUS A;  1SFC A;  4I1L A;  3U1A A;  2FYZ A;  3BRT B;  3MIW A;  5CCG D;  4LC1 A;  1GK4 A;  3V5B A;  3KPE A;  4N78 D;  1NOH A;  1JCC A;  1G1I A;  3VMX A;  2Q9I A;  1OXZ A;  1QL1 A;  1LTT C;  3VOP A;  3O8Z A;  3V2N A;  3BAT A;  1JCD A;  2OYI A;  3KQG A;  5CCG C;  1GU4 A;  1NTM K;  5AVQ B;  1GD2 E;  2M8R A;  3MTU E;  2H8P D;  2HPC B;  1RE4 C;  1RE3 C;  1HH0 A;  4Y99 B;  1ZN5 A;  3P8M C;  5AVV B;  1X79 B;  3HE5 A;  5AW0 B;  1EQ7 A;  2HLO A;  2FYU K;  3A2A A;  5CCG A;  4WBA A;  1OWA A;  2W6A A;  2J58 A;  3VYI A;  1MV8 A;  1RE4 A;  1SQB K;  3HUS B;  3M0A A;  3V4W A;  4IFD K;  3VTP C;  3M9H A;  1CI6 A;  1LTB C;  2YO2 A;  2Z4E A;  3RK2 B;  5CCH D;  1KIL B;  2JEE A;  1A02 F;  1IO4 A;  1JNM A;  2YO3 A;  1NWQ A;  2OYH C;  1SP4 A;  1LTJ B;  5AW3 B;  3KYQ A;  1LT9 B;  1LTI C;  1VPC A;  4W7Z A;  1SQV K;  1H89 A;  2WT7 A;  3HD7 D;  5AVR B;  2IFM A;  1E5W A;  1LTG C;  1FZC C;  3GHG C;  2WWW A;  2OYH A;  3NXS A;  3TK1 A;  1N7S C;  3HD7 C;  3NMD A;  1M1J C;  3IR9 A;  1FZE A;  3VMY A;  5AW4 B;  3A7O A;  3OJA B;  1RF1 C;  2HYN A;  3PP5 A;  5AW8 B;  1J1E B;  1FZC A;  3GHG A;  1H88 A;  3B8E B;  5APX A;  2NPS B;  1JMM A;  2E42 A;  1SVF A;  1N7S A;  2N1T D;  3HD7 A;  1JY2 N;  1JY2 O;  1M1J A;  3R2P A;  1IFJ A;  1A02 J;  1RF1 A;  1DH3 A;  1URQ C;  2W6B A;  1GL2 C;  1N73 B;  1GU5 A;  4RES B;  4WY4 D;  2O01 H;  2XKM A;  2VRS A;  5AVT B;  3L36 A;  2KYV A;  2N1T C;  3B5N D;  5APV A;  5AVW B;  1N86 A;  1QL2 A;  3RK3 D;  1VDF A;  1RF0 A;  5BU8 B;  1ZLL A;  1URQ A;  4WY4 C;  1GL2 A;  1JUN A;  3HRN A;  1GW4 A;  3M06 A;  5CJ4 A;  3TNU A;  2WPR A;  1MUU A;  1T2K C;  4EOT A;  2N1T A;  2QM8 A;  3LID A;  1L4A B;  1FOS E;  4GT1 A;  3VP9 A;  2FFD B;  3NTN A;  3P32 A;  4GIF A;  1G2C B;  4C7N A;  3H32 A;  1NTK K;  4I6M C;  4WY4 A;  3LW5 H;  5APQ A;  3BAS A;  1T3J A;  1JY3 N;  1HWT C;  1JY3 O;  3BRV B;  3E1I A;  4IFF A;  2L5G B;  2HOD B;  1N2D C;  2R32 A;  4Y99 C;  4C46 A;  1MFZ A;  1ZV8 A;  1T8Z A;  5AW1 B;  3BVH A;  5APU A;  2CPB A;  1W2E A;  1FBM A;  3RK2 D;  1KIL D;  4JYC A;  1J1D C;  2R3C A;  4AQR D;  1J2J B;  1SFC B;  2YMY A;  2FXM A;  1NAF A;  2PAJ A;  3CL3 D;  3RL0 B;  1FU1 A;  3MD0 A;  3MUD A;  2KLV A;  1LWU C;  1KIL C;  2WPS A;  2PP6 A;  1KFM A;  3HE4 A;  2JJL A;  2OAR A;  1G1J A;  3A5T A;  3SWY A;  1HGV A;  2A45 H;  3MGN A;  1AQ5 A;  1LT9 C;  1H8A A;  3M9B A;  4XE5 B;  1CSB A;  1WRG A;  1LWU A;  1KIL A;  2Q3I A;  2QM7 A;  2WSF H;  1JTH B;  1FZA A;  1HGZ A;  2KP8 A;  2BAS A;  3OA7 A;  2P67 A;  1NKN A;  5AVU B;  1FZB A;  1LTJ A;  2HFE D;  4O9B A;  5APS A;  3VP8 A;  1LT9 A;  5CCH C;  4HYT B;  2NPS D;  2W27 A;  1KFN A;  2FKW B;  2GM4 A;  4GKG A;  5AVZ B;  5AVX B;  5CHX A;  1IK9 A;  1YYC A;  3P8C D;  5CCH A;  1FJP A;  5KJ7 D;  5AW5 B;  4WB4 A;  3C9I A;  1CZQ A;  2XDJ A;  3II6 A;  4EIJ A;  4C7R A;  4JYB A;  1IFM A;  2LKM A;  3I5C A;  5AVS B;  1XTC C;  2WT7 B;  2Q7C A;  1GW3 A;  5BVZ A;  1NO4 A;  1L0N K;  4N6J A;  1GK6 A;  1L4A D;  1RF0 C;  2OYH B;  4B86 A;  1LTA C;  4IFM A;  3P8C E;  3HTK A;  2WSC H;  1N73 A;  3N7N A;  5KJ7 A;  1DX7 A;  1L4A C;  3NFQ A;  2FFD C;  3GHG B;  3IFM A;  2CPS A;  1FOS F;  3M9Q A;  1N7S B;  3B5N C;  1HUC A;  2IPP A;  1N7L A;  5BU5 A;  1ZR4 A;  1L4A A;  3RK3 C;  4LLH A;  2C9N Y;  1RF1 B;  1RY3 A;  2FFD A;  1YTZ I;  1G2C A;  4AYC A;  1XTG B;  2A45 G;  2C9L Y;  3V4Q A;  2J59 M;  3V2R A;  4XA4 A;  1SLQ A;  2N9B A;  3B5N A;  1SFC D;  1SQX K;  2WSE H;  3RL0 D;  1URQ B;  1GL2 B;  1KQL A;  3TNU B;  1FAV A;  5AW6 B;  1S9K D;  1GTW A;  1FZF A;  3UIA A;  5CJ0 A;  1M7L A;  1YTZ T;  4M3L A;  1HTL C;  3M91 A;  3TSI A;  4AUW A;  3EFG A;  2IX7 C;  1Z56 A;  2HPC A;  2E43 A;  1DEB A;  3HUS C;  2GUV A;  3U59 A;  3SWF A;  1KZU B;  2Z5I A;  2O1K A;  1LTS C;  1S9K E;  1IFN A;  2POH A;  2R5B A;  3RK2 C;  1NTZ K;  2H7H A;  2OYI B;  3HUS A;  2WZ7 A;  3WMM 0;  1LTJ C;  1X8Y A;  2P1J A;  2ZFC A;  2Q5U A;  3OAK A;  2YNY A;  1JTH A;  4JF7 A;  3HE5 B;  4N78 E;  5APW A;  2WIT A;  5KTB A;  2KSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...