1G1JA

Crystal structure of the oligomerization domain from rotavirus nsp4
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
43
structure length
43
Chain Sequence
IEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the oligomerization domain of NSP4 from rotavirus reveals a core metal-binding site.
pubmed doi rcsb
molecule tags Metal binding protein
molecule keywords NON-STRUCTURAL GLYCOPROTEIN NSP4
total genus 18
structure length 43
sequence length 43
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.430 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1g1jA00
1G1IA 4HH2A 4WBAA 4WB4A 2O1KA 2WITA 4C7RA 4DOJA 3CI9A 1G1JA 3MIWA 4LLHA 2O1JA 2L5GB
chains in the Genus database with same CATH superfamily
2KXPB 2FXOA 2OYOA 5E79H 1SQPD 4IL6X 3KHUA 3VP8A 1EZVI 1SQPJ 4HKZH 5AVRB 1NTMG 3AE3C 3SFDC 4C7RA 4ZMDA 1SQBD 1EDJA 1GL2A 1OFCX 4GODA 1ZW0A 5KLVE 1BCCD 4EYYQ 5DJUB 4YXWH 3S1KA 2C0XA 4PJ0E 1NH4A 3IAOA 1AVYA 4I7ZB 3RBZA 1VQ8P 3CCLP 1CW5A 3BCCJ 3F89A 2VRSA 2Q7CA 4EOTA 3L70D 2NRGA 4TLFA 3CCJP 3H1JE 1KV4A 1L0NG 2ZYDA 3GW6A 3SWKA 1QGKB 1SQVD 2ZXEB 3Q5PA 3L73D 3Q3DA 3A3YB 3D71A 2PAJA 2QIWA 3F5HA 3B5ND 1ZOYC 2WWWA 3AE6C 1NTZK 1AQ5A 1OVVA 5GTHE 4OVNF 3OJAB 5AVWB 2KZJA 1OW7A 3CC4P 5APQA 2O01H 3SSUA 1GDTA 4YTPC 1S1CX 1FS0E 4K35A 3CX5I 3IFMA 3CCRP 2E42A 2KZIA 3M9HA 2JJLA 1JMMA 1E79H 1OMIA 1R5SA 1ZRTE 3L70G 1RF0C 1SFCA 3CL3D 4I6MC 4L74A 1GL2C 1KQFB 3V5BA 2M3EA 5TJHA 4DCKA 3CMEP 1NGMB 2RKLA 1LJ2A 4GDOA 5AVVB 3WU2E 4ASVA 1NAYA 1PPJE 2E76C 2Z5HA 2JR8A 2JWDA 3H1JG 5GTIE 2HFED 2M3BA 1LTJC 1SQVJ 2FYZA 1USDA 3FXDA 2WZ7A 3M91A 5GTIH 1KTMA 1AFOA 1P84E 3A5TA 1FOSE 2QEXP 1KILE 1PP9E 5AW6B 2B87A 3RL0B 2HODA 1Q82Q 2WPRA 2QRXA 2BASA 3TSIA 4U3FG 1FJPA 3A0BH 1FDOA 2JDIH 5APXA 3V4WA 1Q81Q 2WSCJ 3GG2A 2YIUC 3MD0A 3MZWB 4H0LC 3BVHA 3CC2P 4R4LA 1UIIA 2PFXA 2AEFA 3H1HG 1NYHA 3L71G 1FU1A 1ZP0C 3H1ID 1M1KQ 1PP9G 3SWYA 2N1TB 2OYHC 2WSFJ 1AJYA 1GD2E 1NWQA 4GOEA 4I7ZC 3H1KE 1SQQG 2QSIA 2Q9IA 2N9BA 1BGYG 3S4RA 3E1RA 3KYQA 4UB6E 2PP6A 3LW5J 4WVZA 3WU2H 1VQOP 2B9BA 2P67A 1A02J 1LWUB 1OWAA 1URQA 1W5CE 2KI7B 3GHGA 1FZFA 1ZMEC 1VQKP 2K9YA 3H1HJ 3PTZA 2D2CB 3P8MC 4Y99C 3C9IA 4XFJA 1RF0A 1M1JC 1SFCC 3BCCD 2ZVOB 3GF3A 3KXDA 3P8CE 3H1HD 1VQMP 1M8OB 4H44B 1NJIQ 3L74J 2GUSA 5EFWB 1KORA 1L2PA 2XV5A 2FFDB 1H0TB 1P84D 3MHVA 1VQ9P 2KP8A 4RO0A 3D70A 2QJKB 1BGYD 1KILB 1RH5B 2KIKA 2PRRA 1RE4A 1NKNA 1SQPG 1Y47A 1ZN5A 1M90Q 2E43A 2V4HA 1QVFO 2Q6QA 3PRJA 2N1TD 4EIJA 2ZT9B 1LWUC 4D6TJ 3IF4A 2FYUJ 5BU5A 4BXLA 2AXTH 2A45H 1YBKA 3FWLA 1ZV8A 2W8ZA 3L36A 3RL0C 1KQLA 3AE8C 3HD7C 1K05A 3CI9A 1L0NK 4WY4D 5B66E 1KYOH 2G8YA 3B5NA 3LIDA 4PD4E 3KDPB 3T97B 3TGUD 2H88C 2KLUA 3H32A 4JF7A 3BASA 3Q1MA 2MKVA 2MJZA 1SQBJ 2AEJA 3N7NA 4NPEA 3EFGA 4IL6H 3RK3B 3RK2C 3VOPA 5TISE 1NOHA 3O6QA 4XE5B 1NTZG 2FXMA 5APSA 1JO5A 3HUSC 1IFDA 2IX7C 2O1JA 1CI6A 5KAIH 1PFIA 1JEKA 1L4AD 1WT6A 2E74C 4H0LB 2YO2A 3L72E 3RL0g 1KFMA 2LR2A 1DH3A 1ZXGA 1JY3O 2BCCJ 3MUDA 1YIJP 2DW3A 3CWBE 2O3JA 3MUDC 4XA4A 1YJNP 1PIXA 2ZT9D 1NTKD 4C7NB 1YJ9P 3H1LD 1MFTA 1OIPA 1FZBA 3RK3C 1HUCA 1OXZA 1KMIZ 1JOCA 2W6JH 3AEBC 1JTHB 1OW6A 1J1EC 2KNCB 5APTA 1LNQA 4YXDC 2I1JA 2KOGA 1GL2B 2JKVA 3JSVC 1S5LX 1VQLP 1SQBG 1N73B 3PH0A 3L73J 1RQUA 3AEGC 1W2BO 1FZAA 5KTBA 2WQYC 1WRGA 1NU1K 3V2NA 1N7SC 1IFNA 5APWA 1EDKA 1NTKG 1S9KD 4PV1D 1Z56A 1KZUB 2QJKC 2QVAA 2R3SA 3AE4C 4H13D 4KHXA 5KAFH 2OYIC 3L75J 4H44C 1HWTC 1PGQA 2ZYGA 1FOSF 5CBNA 3EWKA 3GHGC 5AVZB 4WWIA 1EQ7A 2YIUB 4JYCA 1VPCA 4Y28J 4AQRD 3RGUA 1YJWP 2WPQA 1L0NE 1HTLC 1QX8A 1X8YA 1M7LA 3JCUE 2IBZD 2IFNA 2KLVA 1N7SA 3L74G 3WUTA 2R32A 1BE3D 3II6A 5DJTB 2WVRA 1IK9A 3CX5H 5GTHH 3BATA 4M3LA 3TF5A 1T8ZA 2FYUK 1Q86Q 3H1LE 1N2DC 1HGVA 4JPZB 1KB9D 1YQ3C 1JCDA 1DD3A 3BCCG 3GHGB 1ZR2A 1AQTA 4D6TE 3ITKA 2OYHA 4H13B 1G1IA 4HH2A 3RK2B 3V2QA 2XNDH 4O9BA 2V7QH 4ZNCA 1SQPE 2WPVB 3CXHE 2I1KA 4JYBA 1LTIC 1M1JB 3GF7A 1IFJA 1LTJA 2CK3H 2JWAA 2Q3EA 2HYNA 2YKQA 1GTWA 3CC7P 1EZVD 3L74E 3L35A 2BEZF 3FWNA 3LW5H 4ZKUA 1LTJB 2K37A 3M0DC 1FC2C 2KB7P 1VF5D 3BRVB 2HG5D 1M57D 3HUSA 3H1KJ 2M5AA 2R3CA 1RE3C 4JBZA 5KAFE 5CJ4A 2N9YB 1NU1E 1N73C 2N1TA 2WTYA 2FYUG 1LTTC 1RF1A 3AE9C 3PHLA 2HLOA 1JY2O 1PP9D 1IK7A 2BEQD 1BCCJ 2NPSB 2WMMA 2WITA 3B5NC 1YTZT 3KQGA 2XU6A 1TU3F 1SLQA 2IBZE 3N4XA 3CCQP 2O1KA 1QVGO 2W6AA 1DX7A 5AVXB 4GT1A 4RKUJ 1PPJD 2FY8A 4OWFA 4RJTA 5CCGC 3AEFC 3K5BA 4DJGA 2G3AA 1RE4C 1CI6B 1J1DC 1KYOE 2FXPA 2WSEH 1USEA 2A06D 2R5DA 2W90A 4UB8H 2K9JB 3L72J 5BU8B 2O01N 3HUSB 1VQPP 1YHQP 3AECC 3OW2O 1DIPA 3H1LG 4KJMA 1A02F 1E5WA 4PV1B 4ASWA 1RF1C 1JM0A 5APVA 4OGQC 4PD4D 1S72P 1RE3A 1JB0J 3B5NB 1L0NJ 1PPJG 2LXBA 2OQQA 3P8CD 3T97A 3G71P 3L71J 2ZFCA 3V2PA 4IFFA 2D2CD 2Q5UA 5AW1B 2L91A 1VDFA 5KLVJ 3MP7B 1NU1D 1N73A 1VQ7P 3L72D 2R5BA 1VQNP 2P58A 2LKMA 1QEXA 2GA1A 5AW4B 5H2FE 5KKZB 1EC5A 3CPWO 1D7MA 1OZHA 3AE2C 3KPEA 3M0DA 1Q7YQ 1K04A 3AEEC 3HTKA 2C9NY 1IJDB 2KYVA 3WUVA 3WUUA 2OTLP 1KILD 1SQXK 1SQXG 3NTNA 1NTZD 1MUUA 2KUBA 4YPCA 2Q3IA 1LT9B 1T3UA 1PGOA 1NTMD 2L5GB 2J58A 1SQVE 3H1HE 2KS1A 1MKMA 3HE5A 1IC2A 1JCCA 1QL2A 2Y0CA 3H25A 5H2FH 1LTGC 1Y9BA 3ABVC 4GKGA 3BRTB 4I1LA 1SFCD 2AXTE 5AVTB 5AW5B 1OVUA 2V7QJ 1NO4A 2R44A 3MIWA 1HJBA 2H43A 1JY2N 1KC8Q 5AW2B 4HB1A 1KQGB 1JY3P 2E75C 1QL1A 2M0BA 3H32B 4UB8E 3CXHH 3M0AA 4LLHA 1S3JA 3RK3E 2Q1KA 5KJ7D 1NU1J 5KJ7A 1M56D 1Y8AA 2B89A 2BCCE 2UWJE 5CHXA 3W68A 4DOJA 2FYUE 1LT9C 1S2EA 3VP9A 1NVOA 3IR9A 1RHZB 1HVVA 1L0LD 1SQQJ 2WPSA 2WSFH 3LIEA 5L8RJ 3Q5RA 1HH0A 3AE1C 1HBWA 3RL0D 1SQVG 1LT9A 1SQXJ 2HODB 3PLNA 2IYPA 2FBWC 5M1BA 2OYIB 1XTCC 3U1CA 3L75E 1GU5A 4QMAA 2E75B 1BCCE 1UIXA 1URQC 1FZGA 3PJSK 1SQPK 1EZVG 2QG4A 3H1KG 2OYIA 1JY2P 1JMBA 1X22A 2P2UA 1JTHA 2XZRA 2K3RA 2RH0A 3RK2D 3OAKA 4WBAA 4Z1MH 2XKMA 1NTME 3H1JD 2E74D 1OVRA 1ZLLA 4CPGA 4OGQB 3UIAA 1KD1Q 1FDMA 3CCMP 1T2KC 1DD4A 1L0LJ 1R5LA 5C39A 3QH9A 2Z5IA 3VMAA 5TISH 1SQXE 2ZT9C 1URQB 1W2EA 3E7KA 1HGZA 1VQ5P 3C1LA 1KB9I 1SQVK 2K88A 4U3FD 1U57A 2NPSD 1BDDA 5CCHA 3VMZA 3ZDMA 5AVYB 1BSNA 3S9OA 1JNMA 1BDCA 3VTPC 2IBZI 3H1IG 3EFFK 1NHLA 3L4FA 4EDFA 2ZJSE 2KK7A 5AVQB 1U7JA 1AVOA 5CCHC 5K5GB 1KILA 4JQ0D 2YXQB 3TNUA 2H7HA 1P84H 3JCUH 4N78D 3L71D 3D6ZA 1FE6A 3PP5A 4OH8B 5KAIE 1BGYE 2OARA 2QJPB 2O01J 4R4MA 3TNUB 2HR3A 3M9BA 2QM8A 2ZXXA 3FGAD 3L71E 1IFMA 3CWBG 3CXHI 2W83C 3B4SA 3H1LJ 3O8ZA 4GOFA 4RESB 5KJ7C 4PD4H 2WSCH 2NPSA 4WY4B 1FZCC 3HD7A 3V2RA 2PGDA 3R2PA 1YI2P 1GZLA 1YYCA 2AXCA 2JEEA 1PGPA 1T6AA 2CPSA 4L75A 1KYOD 4TT3H 1PL5A 4W7YA 5CBOA 3L70E 1FDIA 4HJGH 1LP1A 5CJ0A 1M1JA 1PGJA 2FFDC 2K9JA 1SQXD 2ZVNB 3IN6A 1G2CA 1LGHB 1NKZB 3EQ2A 3L73E 1SQQK 1NTMK 1OX3A 3P32A 3CCEP 2HPCA 5KKZC 3D6YA 2YMKA 1G2CB 1NTKK 1Q90D 1YITP 2KSJA 3L37A 1NTZJ 3HE5B 1PP9J 1FZCB 2NZ2A 1X9VA 2IYOA 3NMDA 1IFPA 4U7JA 3P7KA 1J1EB 3TGUG 2W6BA 2IFMA 2BCCG 2KNCA 4PJ0H 5AW7B 5AW9B 1RY3A 2OGUA 1KYOI 1LT1A 3QWOC 5APYA 3G6EP 3Q2YA 4N78E 1LTBC 4L76A 5AW3B 3VYIA 2Y9YA 1HF9A 2M8RA 5KLVD 2Y9ZA 3CX5D 3U1AA 2YMYA 3HTKB 3CD6P 1VF5C 3CXHD 4L73A 1GL2D 2Y0DA 1L0LK 3O6QB 2KSEA 2C9LY 3CX5E 3A2AA 4BWNA 4I2LC 2E76D 3FX0A 1ZRTD 3H1JJ 4UB6H 3CMAP 3CLQA 3H6PA 3CCVP 4K3AA 5B66H 1S9KE 1NTKJ 3H1KD 3NXSA 2QJPC 3A7OA 3U59A 3JC22 2Z4EA 4IL6E 5B5EH 4KT0J 5KLVG 1SS1A 1SVFA 3Q5SA 3GLMA 1K8AQ 3H1IE 1P84I 2CPBA 5CCGD 2YO3A 2K1AA 1L4AB 1L0ND 4H0LD 2JO1A 3BCCE 1J1DB 3M9QA 3HE4A 4B86A 4AYCA 1QLED 2QE7H 1YQ4C 2YKPA 1EDLA 2POHA 2A45G 1BE3E 2WT7B 3TGUJ 1CSBA 1SQQE 3MTUE 3RBXA 2Y0EA 3L75D 1GK6A 1J2JB 1KFNA 1NTKE 1RQVA 1KB9H 2A06E 2FYNC 3I5CA 4OGQD 5CMZA 1S5LH 2WT7A 5KLIC 3AEDC 1AV1A 3SFEC 3KZIE 2P7JA 4C7NA 4IFDK 1MFZA 4D6TD 2AEMA 3R4YA 1L0LG 4U3FJ 4Y99B 3TK1A 1H8AA 2D2CC 1GK4A 3AE5C 4IFMA 5CCGA 2XNXA 3FXEA 1SFCB 1SQBK 1ZR4A 3C8VA 1R8EA 2ITAA 1NTMJ 2SPZA 1L4AA 3OA7A 2IPPA 1BCCG 5AVUB 2IBZG 1EZVE 3L74D 3L75G 1CZQA 1KILC 1SP4A 1WMKA 1BE3G 3KZIH 1T3JA 3MGNA 3G3ZA 4GIFA 4W80A 1N7LA 1VQ4P 2J59M 4EI2A 4NPFX 2IZ1A 4LC1A 2N1TC 5AW8B 3USSA 2OYHB 2B87B 4W7ZA 4D6TG 4WY4A 4PD4I 2XDJA 4DT0A 3TYYA 1GMJA 1JY3N 1NTZE 2RMZA 3HD7D 3TDKA 3VMXA 1OW8A 2QJYB 3L73G 1FZEA 5KLIB 1H89A 3A0HE 2IDBA 4WY4C 5AVSB 1AA0A 3A0BE 4AUWA 2P10A 2E75D 1K9MQ 4BRYB 2I8DA 1SQQD 2YKOA 1XTGB 3L70J 3G9RA 3NFQA 4BRYA 3W67A 1PV3A 1N7SB 1FAVA 5B5EE 3TGUE 1MV8A 5AW0B 2E74B 1KB9E 1L4AC 3M06A 1H88A 2J5UA 3AE7C 1IO4A 2E76B 3A0HH 2M5AB 1YTZI 1HJ0A 1LWUA 1N8RQ 2BCCD 1G1JA 1PZQA 2RN0A 4HYTB 3VMYA 2ZAEB 2FYUD 3CCSP 2ZYAA 1U7MA 2JP3A 1VL2A 1URQD 1KQSO 5KLVK 2QA4P 2FYNB 4N3YB 2P1JA 3RK3D 2OTJP 1X0TA 2H89C 1LP1B 2YXRB 3CWBD 3HD7B 3HRNA 1IFIA 4MN4C 2FKWB 4NPDA 3CCUP 2GM4A 1X79B 1DEBA 1MZ9A 3V4QA 1FBMA 2QM7A 2H8PD 1SQBE 1GW4A 3I56P 1VQ6P 2YNYA 4N6JA 1GW3A 1L0LE 2C0WA 1DEEG 4A7PA 5E79E 3SWFA 2FFDA 1T2KD 1H0TA 1VF5B 1S4XA 1N7SD 1BSHA 2A06G 2GUVA 3GMAA 2B88A 2KS1B 5BVZA 4PV1C 4C46A 4DZOA 1GU4A 1RF1B 4H13C 1BGYJ 4WB4A 1LTSC 3I55P 3G4SP 1Q2NA 2E5YA 1S5LE 2E5TA 2NPSC 4H44D 3VN0A 1FZCA 1KN7A 1EXJA 2LXCB 2WSEJ 2WSSH 1NU1G 3WMM0 3L72G 3H1IJ 1K73Q 1IZNB 1NAFA 4U3FE 1N86A 5CCHD 3HE4B 2A45I 2W27A 2OTKE 1EDIA 4IOIH 1FJKA 5APUA 1JUNA 3B71A 4ZKPA 3B8EB 1LTAC 3AEAC 2HPCB 1BE3J 3CWBJ 4LGDE 3E1IA 2QJYC 1EXIA 2IZ0A 3V6IA
chains in the Genus database with same CATH topology
3VP8A 4C7RA 5AVRB 1GL2A 2C0XA 1NH4A 1CW5A 2Q7CA 4EOTA 2VRSA 2ZXEB 3A3YB 2PAJA 3B5ND 2WWWA 1AQ5A 1NTZK 3OJAB 5AVWB 5APQA 2O01H 1GDTA 3IFMA 2E42A 3M9HA 2JJLA 1JMMA 4C46A 1RF0C 1SFCA 3CL3D 4I6MC 1GL2C 3V5BA 5AVVB 2Z5HA 2HFED 2M3BA 1LTJC 3M91A 2FYZA 2WZ7A 1AFOA 1FOSE 3A5TA 5AW6B 3RL0B 2HODA 2WPRA 2BASA 3TSIA 1FJPA 5APXA 3V4WA 3BVHA 3MD0A 1FU1A 3SWYA 2N1TB 2OYHC 1GD2E 1NWQA 2Q9IA 2N9BA 3KYQA 1A02J 2PP6A 2P67A 1LWUB 1OWAA 1URQA 1FZFA 3GHGA 3P8MC 4Y99C 3C9IA 1RF0A 1M1JC 1SFCC 3P8CE 2GUSA 2XV5A 2FFDB 2KP8A 1KILB 5KJ7C 2E43A 1RE4A 1NKNA 1ZN5A 2N1TD 4EIJA 1LWUC 5BU5A 2A45H 1ZV8A 3L36A 3RL0C 1KQLA 3HD7C 3CI9A 1L0NK 4WY4D 3B5NA 3LIDA 3KDPB 4JF7A 3H32A 3BASA 2MJZA 3RK3B 3N7NA 3VOPA 3EFGA 3RK2C 1JO5A 1NOHA 4XE5B 5APSA 2FXMA 3HUSC 1IFDA 2IX7C 2O1JA 1CI6A 1PFIA 1L4AD 1WT6A 2YO2A 1KFMA 1DH3A 1JY3O 3MUDA 4XA4A 4C7NB 1FZBA 3RK3C 1HUCA 1OXZA 1JOCA 1JTHB 5APTA 1J1EC 2I1JA 2KOGA 1GL2B 1N73B 1FZAA 5KTBA 1WRGA 1NU1K 3V2NA 1N7SC 1IFNA 5APWA 1S9KD 1Z56A 1KZUB 4KHXA 2OYIC 1HWTC 1FOSF 3GHGC 5AVZB 1EQ7A 4JYCA 1VPCA 4AQRD 2WPQA 1HTLC 1X8YA 1M7LA 2IFNA 2KLVA 1N7SA 2R32A 3II6A 1IK9A 3BATA 4M3LA 1T8ZA 2FYUK 1N2DC 1HGVA 1JCDA 3GHGB 1ZR2A 2OYHA 1G1IA 4HH2A 3RK2B 3V2QA 4O9BA 2I1KA 4JYBA 1LTIC 1M1JB 1GTWA 1IFJA 1LTJA 2YKQA 2HYNA 3L35A 3LW5H 4ZKUA 1LTJB 3M0DC 2KB7P 3BRVB 2HG5D 3HUSA 5CJ4A 2R3CA 1RE3C 1N73C 2N1TA 2WTYA 1RF1A 1LTTC 2HLOA 1JY2O 2NPSB 3B5NC 5AW1B 3N4XA 2WITA 3KQGA 1YTZT 2XU6A 1SLQA 2O1KA 2W6AA 1DX7A 5AVXB 4GT1A 5CCGC 1RE4C 1CI6B 1J1DC 2WSEH 2R5DA 5BU8B 3HUSB 1A02F 1E5WA 1RF1C 5APVA 1RE3A 3B5NB 3T97A 3P8CD 2ZFCA 3V2PA 4IFFA 2Q5UA 1VDFA 1N73A 2R5BA 2LKMA 5AW4B 3M0DA 2C9NY 3KPEA 3HTKA 1IJDB 2KYVA 1KILD 1SQXK 3NTNA 1MUUA 2Q3IA 2L5GB 1LT9B 1T3UA 2J58A 3HE5A 1IC2A 1JCCA 1QL2A 1LTGC 5AW5B 4I1LA 4GKGA 3BRTB 1SFCD 5AVTB 1HJBA 3MIWA 1NO4A 2H43A 1JY2N 5AW2B 1JY3P 3H32B 1QL1A 3M0AA 4LLHA 5KJ7D 5KJ7A 5CHXA 4DOJA 1LT9C 3VP9A 3IR9A 1HVVA 2WPSA 3LIEA 2WSFH 1HBWA 1HH0A 3RL0D 1LT9A 2HODB 2OYIB 1XTCC 3U1CA 1GU5A 1URQC 1FZGA 2OYIA 1SQPK 1JY2P 2P2UA 1JTHA 2XZRA 3RK2D 3OAKA 4WBAA 2XKMA 1ZLLA 3UIAA 1FDMA 1T2KC 2Z5IA 1URQB 1W2EA 1HGZA 1SQVK 2NPSD 5CCHA 3VMZA 5AVYB 1JNMA 3VTPC 3L4FA 1NHLA 5CCHC 5AVQB 1KILA 2H7HA 3TNUA 4N78D 3PP5A 4OH8B 2OARA 3TNUB 3M9BA 2QM8A 1IFMA 3O8ZA 4RESB 4WY4B 2WSCH 2NPSA 1FZCC 3HD7A 3V2RA 3R2PA 1GZLA 1YYCA 2JEEA 2CPSA 4W7YA 5CJ0A 1M1JA 2FFDC 1LGHB 1G2CA 1NKZB 3EQ2A 1SQQK 1NTMK 3P32A 2HPCA 1G2CB 1NTKK 2KSJA 3L37A 3HE5B 1FZCB 1X9VA 3NMDA 3P7KA 1J1EB 2W6BA 2IFMA 5AW9B 5AW7B 1RY3A 5APYA 4N78E 1LTBC 5AW3B 3VYIA 2M8RA 3U1AA 2YMYA 3HTKB 1GL2D 1L0LK 2C9LY 3A2AA 4I2LC 3CLQA 3H6PA 1S9KE 3NXSA 2Z4EA 3A7OA 3U59A 1SVFA 2CPBA 5CCGD 2YO3A 1L4AB 1J1DB 3M9QA 3HE4A 4B86A 4AYCA 2YKPA 2POHA 2A45G 2WT7B 1CSBA 3MTUE 1GK6A 1J2JB 1KFNA 3I5CA 2WT7A 5CMZA 2P7JA 4C7NA 4IFDK 1MFZA 1H8AA 3TK1A 4Y99B 1GK4A 4IFMA 5CCGA 2XNXA 1SFCB 1SQBK 1ZR4A 1L4AA 3OA7A 2IPPA 5AVUB 1CZQA 1KILC 1SP4A 3MGNA 4GIFA 4W80A 1T3JA 3G3ZA 1N7LA 2J59M 4LC1A 2N1TC 5AW8B 2OYHB 4W7ZA 4WY4A 2XDJA 3TYYA 1JY3N 3HD7D 3VMXA 1H89A 1FZEA 4WY4C 5AVSB 4AUWA 2YKOA 1XTGB 3NFQA 1N7SB 1FAVA 1MV8A 5AW0B 1L4AC 3M06A 1H88A 1IO4A 1YTZI 1LWUA 1G1JA 4HYTB 3VMYA 1URQD 5KLVK 4N3YB 2P1JA 3RK3D 3HD7B 3HRNA 2GM4A 1IFIA 2FKWB 1X79B 1DEBA 1MZ9A 3V4QA 1FBMA 2QM7A 2H8PD 1GW4A 2YNYA 4N6JA 1GW3A 2C0WA 3SWFA 2FFDA 1T2KD 1N7SD 2GUVA 5BVZA 1GU4A 4DZOA 1RF1B 4WB4A 1LTSC 1FZCA 2NPSC 3VN0A 3WMM0 1NAFA 1N86A 5CCHD 3HE4B 2A45I 2W27A 1FJKA 5APUA 1JUNA 4ZKPA 3B8EB 1LTAC 2HPCB 4LGDE 3E1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G1I A;  4HH2 A;  4WBA A;  4WB4 A;  2O1K A;  2WIT A;  4C7R A;  4DOJ A;  3CI9 A;  1G1J A;  3MIW A;  4LLH A;  2O1J A;  2L5G B; 
#chains in the Genus database with same CATH topology
 2KXP B;  2FXO A;  2OYO A;  5E79 H;  1SQP D;  4IL6 X;  3KHU A;  3VP8 A;  1EZV I;  1SQP J;  4HKZ H;  5AVR B;  1NTM G;  3AE3 C;  3SFD C;  4C7R A;  4ZMD A;  1SQB D;  1EDJ A;  1GL2 A;  1OFC X;  4GOD A;  1ZW0 A;  5KLV E;  1BCC D;  4EYY Q;  5DJU B;  4YXW H;  3S1K A;  2C0X A;  4PJ0 E;  1NH4 A;  3IAO A;  1AVY A;  4I7Z B;  3RBZ A;  1VQ8 P;  3CCL P;  1CW5 A;  3BCC J;  3F89 A;  2VRS A;  2Q7C A;  4EOT A;  3L70 D;  2NRG A;  4TLF A;  3CCJ P;  3H1J E;  1KV4 A;  1L0N G;  2ZYD A;  3GW6 A;  3SWK A;  1QGK B;  1SQV D;  2ZXE B;  3Q5P A;  3L73 D;  3Q3D A;  3A3Y B;  3D71 A;  2PAJ A;  2QIW A;  3F5H A;  3B5N D;  1ZOY C;  2WWW A;  3AE6 C;  1NTZ K;  1AQ5 A;  1OVV A;  5GTH E;  4OVN F;  3OJA B;  5AVW B;  2KZJ A;  1OW7 A;  3CC4 P;  5APQ A;  2O01 H;  3SSU A;  1GDT A;  4YTP C;  1S1C X;  1FS0 E;  4K35 A;  3CX5 I;  3IFM A;  3CCR P;  2E42 A;  2KZI A;  3M9H A;  2JJL A;  1JMM A;  1E79 H;  1OMI A;  1R5S A;  1ZRT E;  3L70 G;  1RF0 C;  1SFC A;  3CL3 D;  4I6M C;  4L74 A;  1GL2 C;  1KQF B;  3V5B A;  2M3E A;  5TJH A;  4DCK A;  3CME P;  1NGM B;  2RKL A;  1LJ2 A;  4GDO A;  5AVV B;  3WU2 E;  4ASV A;  1NAY A;  1PPJ E;  2E76 C;  2Z5H A;  2JR8 A;  2JWD A;  3H1J G;  5GTI E;  2HFE D;  2M3B A;  1LTJ C;  1SQV J;  2FYZ A;  1USD A;  3FXD A;  2WZ7 A;  3M91 A;  5GTI H;  1KTM A;  1AFO A;  1P84 E;  3A5T A;  1FOS E;  2QEX P;  1KIL E;  1PP9 E;  5AW6 B;  2B87 A;  3RL0 B;  2HOD A;  1Q82 Q;  2WPR A;  2QRX A;  2BAS A;  3TSI A;  4U3F G;  1FJP A;  3A0B H;  1FDO A;  2JDI H;  5APX A;  3V4W A;  1Q81 Q;  2WSC J;  3GG2 A;  2YIU C;  3MD0 A;  3MZW B;  4H0L C;  3BVH A;  3CC2 P;  4R4L A;  1UII A;  2PFX A;  2AEF A;  3H1H G;  1NYH A;  3L71 G;  1FU1 A;  1ZP0 C;  3H1I D;  1M1K Q;  1PP9 G;  3SWY A;  2N1T B;  2OYH C;  2WSF J;  1AJY A;  1GD2 E;  1NWQ A;  4GOE A;  4I7Z C;  3H1K E;  1SQQ G;  2QSI A;  2Q9I A;  2N9B A;  1BGY G;  3S4R A;  3E1R A;  3KYQ A;  4UB6 E;  2PP6 A;  3LW5 J;  4WVZ A;  3WU2 H;  1VQO P;  2B9B A;  2P67 A;  1A02 J;  1LWU B;  1OWA A;  1URQ A;  1W5C E;  2KI7 B;  3GHG A;  1FZF A;  1ZME C;  1VQK P;  2K9Y A;  3H1H J;  3PTZ A;  2D2C B;  3P8M C;  4Y99 C;  3C9I A;  4XFJ A;  1RF0 A;  1M1J C;  1SFC C;  3BCC D;  2ZVO B;  3GF3 A;  3KXD A;  3P8C E;  3H1H D;  1VQM P;  1M8O B;  4H44 B;  1NJI Q;  3L74 J;  2GUS A;  5EFW B;  1KOR A;  1L2P A;  2XV5 A;  2FFD B;  1H0T B;  1P84 D;  3MHV A;  1VQ9 P;  2KP8 A;  4RO0 A;  3D70 A;  2QJK B;  1BGY D;  1KIL B;  1RH5 B;  2KIK A;  2PRR A;  1RE4 A;  1NKN A;  1SQP G;  1Y47 A;  1ZN5 A;  1M90 Q;  2E43 A;  2V4H A;  1QVF O;  2Q6Q A;  3PRJ A;  2N1T D;  4EIJ A;  2ZT9 B;  1LWU C;  4D6T J;  3IF4 A;  2FYU J;  5BU5 A;  4BXL A;  2AXT H;  2A45 H;  1YBK A;  3FWL A;  1ZV8 A;  2W8Z A;  3L36 A;  3RL0 C;  1KQL A;  3AE8 C;  3HD7 C;  1K05 A;  3CI9 A;  1L0N K;  4WY4 D;  5B66 E;  1KYO H;  2G8Y A;  3B5N A;  3LID A;  4PD4 E;  3KDP B;  3T97 B;  3TGU D;  2H88 C;  2KLU A;  3H32 A;  4JF7 A;  3BAS A;  3Q1M A;  2MKV A;  2MJZ A;  1SQB J;  2AEJ A;  3N7N A;  4NPE A;  3EFG A;  4IL6 H;  3RK3 B;  3RK2 C;  3VOP A;  5TIS E;  1NOH A;  3O6Q A;  4XE5 B;  1NTZ G;  2FXM A;  5APS A;  1JO5 A;  3HUS C;  1IFD A;  2IX7 C;  2O1J A;  1CI6 A;  5KAI H;  1PFI A;  1JEK A;  1L4A D;  1WT6 A;  2E74 C;  4H0L B;  2YO2 A;  3L72 E;  3RL0 g;  1KFM A;  2LR2 A;  1DH3 A;  1ZXG A;  1JY3 O;  2BCC J;  3MUD A;  1YIJ P;  2DW3 A;  3CWB E;  2O3J A;  3MUD C;  4XA4 A;  1YJN P;  1PIX A;  2ZT9 D;  1NTK D;  4C7N B;  1YJ9 P;  3H1L D;  1MFT A;  1OIP A;  1FZB A;  3RK3 C;  1HUC A;  1OXZ A;  1KMI Z;  1JOC A;  2W6J H;  3AEB C;  1JTH B;  1OW6 A;  1J1E C;  2KNC B;  5APT A;  1LNQ A;  4YXD C;  2I1J A;  2KOG A;  1GL2 B;  2JKV A;  3JSV C;  1S5L X;  1VQL P;  1SQB G;  1N73 B;  3PH0 A;  3L73 J;  1RQU A;  3AEG C;  1W2B O;  1FZA A;  5KTB A;  2WQY C;  1WRG A;  1NU1 K;  3V2N A;  1N7S C;  1IFN A;  5APW A;  1EDK A;  1NTK G;  1S9K D;  4PV1 D;  1Z56 A;  1KZU B;  2QJK C;  2QVA A;  2R3S A;  3AE4 C;  4H13 D;  4KHX A;  5KAF H;  2OYI C;  3L75 J;  4H44 C;  1HWT C;  1PGQ A;  2ZYG A;  1FOS F;  5CBN A;  3EWK A;  3GHG C;  5AVZ B;  4WWI A;  1EQ7 A;  2YIU B;  4JYC A;  1VPC A;  4Y28 J;  4AQR D;  3RGU A;  1YJW P;  2WPQ A;  1L0N E;  1HTL C;  1QX8 A;  1X8Y A;  1M7L A;  3JCU E;  2IBZ D;  2IFN A;  2KLV A;  1N7S A;  3L74 G;  3WUT A;  2R32 A;  1BE3 D;  3II6 A;  5DJT B;  2WVR A;  1IK9 A;  3CX5 H;  5GTH H;  3BAT A;  4M3L A;  3TF5 A;  1T8Z A;  2FYU K;  1Q86 Q;  3H1L E;  1N2D C;  1HGV A;  4JPZ B;  1KB9 D;  1YQ3 C;  1JCD A;  1DD3 A;  3BCC G;  3GHG B;  1ZR2 A;  1AQT A;  4D6T E;  3ITK A;  2OYH A;  4H13 B;  1G1I A;  4HH2 A;  3RK2 B;  3V2Q A;  2XND H;  4O9B A;  2V7Q H;  4ZNC A;  1SQP E;  2WPV B;  3CXH E;  2I1K A;  4JYB A;  1LTI C;  1M1J B;  3GF7 A;  1IFJ A;  1LTJ A;  2CK3 H;  2JWA A;  2Q3E A;  2HYN A;  2YKQ A;  1GTW A;  3CC7 P;  1EZV D;  3L74 E;  3L35 A;  2BEZ F;  3FWN A;  3LW5 H;  4ZKU A;  1LTJ B;  2K37 A;  3M0D C;  1FC2 C;  2KB7 P;  1VF5 D;  3BRV B;  2HG5 D;  1M57 D;  3HUS A;  3H1K J;  2M5A A;  2R3C A;  1RE3 C;  4JBZ A;  5KAF E;  5CJ4 A;  2N9Y B;  1NU1 E;  1N73 C;  2N1T A;  2WTY A;  2FYU G;  1LTT C;  1RF1 A;  3AE9 C;  3PHL A;  2HLO A;  1JY2 O;  1PP9 D;  1IK7 A;  2BEQ D;  1BCC J;  2NPS B;  2WMM A;  2WIT A;  3B5N C;  1YTZ T;  3KQG A;  2XU6 A;  1TU3 F;  1SLQ A;  2IBZ E;  3N4X A;  3CCQ P;  2O1K A;  1QVG O;  2W6A A;  1DX7 A;  5AVX B;  4GT1 A;  4RKU J;  1PPJ D;  2FY8 A;  4OWF A;  4RJT A;  5CCG C;  3AEF C;  3K5B A;  4DJG A;  2G3A A;  1RE4 C;  1CI6 B;  1J1D C;  1KYO E;  2FXP A;  2WSE H;  1USE A;  2A06 D;  2R5D A;  2W90 A;  4UB8 H;  2K9J B;  3L72 J;  5BU8 B;  2O01 N;  3HUS B;  1VQP P;  1YHQ P;  3AEC C;  3OW2 O;  1DIP A;  3H1L G;  4KJM A;  1A02 F;  1E5W A;  4PV1 B;  4ASW A;  1RF1 C;  1JM0 A;  5APV A;  4OGQ C;  4PD4 D;  1S72 P;  1RE3 A;  1JB0 J;  3B5N B;  1L0N J;  1PPJ G;  2LXB A;  2OQQ A;  3P8C D;  3T97 A;  3G71 P;  3L71 J;  2ZFC A;  3V2P A;  4IFF A;  2D2C D;  2Q5U A;  5AW1 B;  2L91 A;  1VDF A;  5KLV J;  3MP7 B;  1NU1 D;  1N73 A;  1VQ7 P;  3L72 D;  2R5B A;  1VQN P;  2P58 A;  2LKM A;  1QEX A;  2GA1 A;  5AW4 B;  5H2F E;  5KKZ B;  1EC5 A;  3CPW O;  1D7M A;  1OZH A;  3AE2 C;  3KPE A;  3M0D A;  1Q7Y Q;  1K04 A;  3AEE C;  3HTK A;  2C9N Y;  1IJD B;  2KYV A;  3WUV A;  3WUU A;  2OTL P;  1KIL D;  1SQX K;  1SQX G;  3NTN A;  1NTZ D;  1MUU A;  2KUB A;  4YPC A;  2Q3I A;  1LT9 B;  1T3U A;  1PGO A;  1NTM D;  2L5G B;  2J58 A;  1SQV E;  3H1H E;  2KS1 A;  1MKM A;  3HE5 A;  1IC2 A;  1JCC A;  1QL2 A;  2Y0C A;  3H25 A;  5H2F H;  1LTG C;  1Y9B A;  3ABV C;  4GKG A;  3BRT B;  4I1L A;  1SFC D;  2AXT E;  5AVT B;  5AW5 B;  1OVU A;  2V7Q J;  1NO4 A;  2R44 A;  3MIW A;  1HJB A;  2H43 A;  1JY2 N;  1KC8 Q;  5AW2 B;  4HB1 A;  1KQG B;  1JY3 P;  2E75 C;  1QL1 A;  2M0B A;  3H32 B;  4UB8 E;  3CXH H;  3M0A A;  4LLH A;  1S3J A;  3RK3 E;  2Q1K A;  5KJ7 D;  1NU1 J;  5KJ7 A;  1M56 D;  1Y8A A;  2B89 A;  2BCC E;  2UWJ E;  5CHX A;  3W68 A;  4DOJ A;  2FYU E;  1LT9 C;  1S2E A;  3VP9 A;  1NVO A;  3IR9 A;  1RHZ B;  1HVV A;  1L0L D;  1SQQ J;  2WPS A;  2WSF H;  3LIE A;  5L8R J;  3Q5R A;  1HH0 A;  3AE1 C;  1HBW A;  3RL0 D;  1SQV G;  1LT9 A;  1SQX J;  2HOD B;  3PLN A;  2IYP A;  2FBW C;  5M1B A;  2OYI B;  1XTC C;  3U1C A;  3L75 E;  1GU5 A;  4QMA A;  2E75 B;  1BCC E;  1UIX A;  1URQ C;  1FZG A;  3PJS K;  1SQP K;  1EZV G;  2QG4 A;  3H1K G;  2OYI A;  1JY2 P;  1JMB A;  1X22 A;  2P2U A;  1JTH A;  2XZR A;  2K3R A;  2RH0 A;  3RK2 D;  3OAK A;  4WBA A;  4Z1M H;  2XKM A;  1NTM E;  3H1J D;  2E74 D;  1OVR A;  1ZLL A;  4CPG A;  4OGQ B;  3UIA A;  1KD1 Q;  1FDM A;  3CCM P;  1T2K C;  1DD4 A;  1L0L J;  1R5L A;  5C39 A;  3QH9 A;  2Z5I A;  3VMA A;  5TIS H;  1SQX E;  2ZT9 C;  1URQ B;  1W2E A;  3E7K A;  1HGZ A;  1VQ5 P;  3C1L A;  1KB9 I;  1SQV K;  2K88 A;  4U3F D;  1U57 A;  2NPS D;  1BDD A;  5CCH A;  3VMZ A;  3ZDM A;  5AVY B;  1BSN A;  3S9O A;  1JNM A;  1BDC A;  3VTP C;  2IBZ I;  3H1I G;  3EFF K;  1NHL A;  3L4F A;  4EDF A;  2ZJS E;  2KK7 A;  5AVQ B;  1U7J A;  1AVO A;  5CCH C;  5K5G B;  1KIL A;  4JQ0 D;  2YXQ B;  3TNU A;  2H7H A;  1P84 H;  3JCU H;  4N78 D;  3L71 D;  3D6Z A;  1FE6 A;  3PP5 A;  4OH8 B;  5KAI E;  1BGY E;  2OAR A;  2QJP B;  2O01 J;  4R4M A;  3TNU B;  2HR3 A;  3M9B A;  2QM8 A;  2ZXX A;  3FGA D;  3L71 E;  1IFM A;  3CWB G;  3CXH I;  2W83 C;  3B4S A;  3H1L J;  3O8Z A;  4GOF A;  4RES B;  5KJ7 C;  4PD4 H;  2WSC H;  2NPS A;  4WY4 B;  1FZC C;  3HD7 A;  3V2R A;  2PGD A;  3R2P A;  1YI2 P;  1GZL A;  1YYC A;  2AXC A;  2JEE A;  1PGP A;  1T6A A;  2CPS A;  4L75 A;  1KYO D;  4TT3 H;  1PL5 A;  4W7Y A;  5CBO A;  3L70 E;  1FDI A;  4HJG H;  1LP1 A;  5CJ0 A;  1M1J A;  1PGJ A;  2FFD C;  2K9J A;  1SQX D;  2ZVN B;  3IN6 A;  1G2C A;  1LGH B;  1NKZ B;  3EQ2 A;  3L73 E;  1SQQ K;  1NTM K;  1OX3 A;  3P32 A;  3CCE P;  2HPC A;  5KKZ C;  3D6Y A;  2YMK A;  1G2C B;  1NTK K;  1Q90 D;  1YIT P;  2KSJ A;  3L37 A;  1NTZ J;  3HE5 B;  1PP9 J;  1FZC B;  2NZ2 A;  1X9V A;  2IYO A;  3NMD A;  1IFP A;  4U7J A;  3P7K A;  1J1E B;  3TGU G;  2W6B A;  2IFM A;  2BCC G;  2KNC A;  4PJ0 H;  5AW7 B;  5AW9 B;  1RY3 A;  2OGU A;  1KYO I;  1LT1 A;  3QWO C;  5APY A;  3G6E P;  3Q2Y A;  4N78 E;  1LTB C;  4L76 A;  5AW3 B;  3VYI A;  2Y9Y A;  1HF9 A;  2M8R A;  5KLV D;  2Y9Z A;  3CX5 D;  3U1A A;  2YMY A;  3HTK B;  3CD6 P;  1VF5 C;  3CXH D;  4L73 A;  1GL2 D;  2Y0D A;  1L0L K;  3O6Q B;  2KSE A;  2C9L Y;  3CX5 E;  3A2A A;  4BWN A;  4I2L C;  2E76 D;  3FX0 A;  1ZRT D;  3H1J J;  4UB6 H;  3CMA P;  3CLQ A;  3H6P A;  3CCV P;  4K3A A;  5B66 H;  1S9K E;  1NTK J;  3H1K D;  3NXS A;  2QJP C;  3A7O A;  3U59 A;  3JC2 2;  2Z4E A;  4IL6 E;  5B5E H;  4KT0 J;  5KLV G;  1SS1 A;  1SVF A;  3Q5S A;  3GLM A;  1K8A Q;  3H1I E;  1P84 I;  2CPB A;  5CCG D;  2YO3 A;  2K1A A;  1L4A B;  1L0N D;  4H0L D;  2JO1 A;  3BCC E;  1J1D B;  3M9Q A;  3HE4 A;  4B86 A;  4AYC A;  1QLE D;  2QE7 H;  1YQ4 C;  2YKP A;  1EDL A;  2POH A;  2A45 G;  1BE3 E;  2WT7 B;  3TGU J;  1CSB A;  1SQQ E;  3MTU E;  3RBX A;  2Y0E A;  3L75 D;  1GK6 A;  1J2J B;  1KFN A;  1NTK E;  1RQV A;  1KB9 H;  2A06 E;  2FYN C;  3I5C A;  4OGQ D;  5CMZ A;  1S5L H;  2WT7 A;  5KLI C;  3AED C;  1AV1 A;  3SFE C;  3KZI E;  2P7J A;  4C7N A;  4IFD K;  1MFZ A;  4D6T D;  2AEM A;  3R4Y A;  1L0L G;  4U3F J;  4Y99 B;  3TK1 A;  1H8A A;  2D2C C;  1GK4 A;  3AE5 C;  4IFM A;  5CCG A;  2XNX A;  3FXE A;  1SFC B;  1SQB K;  1ZR4 A;  3C8V A;  1R8E A;  2ITA A;  1NTM J;  2SPZ A;  1L4A A;  3OA7 A;  2IPP A;  1BCC G;  5AVU B;  2IBZ G;  1EZV E;  3L74 D;  3L75 G;  1CZQ A;  1KIL C;  1SP4 A;  1WMK A;  1BE3 G;  3KZI H;  1T3J A;  3MGN A;  3G3Z A;  4GIF A;  4W80 A;  1N7L A;  1VQ4 P;  2J59 M;  4EI2 A;  4NPF X;  2IZ1 A;  4LC1 A;  2N1T C;  5AW8 B;  3USS A;  2OYH B;  2B87 B;  4W7Z A;  4D6T G;  4WY4 A;  4PD4 I;  2XDJ A;  4DT0 A;  3TYY A;  1GMJ A;  1JY3 N;  1NTZ E;  2RMZ A;  3HD7 D;  3TDK A;  3VMX A;  1OW8 A;  2QJY B;  3L73 G;  1FZE A;  5KLI B;  1H89 A;  3A0H E;  2IDB A;  4WY4 C;  5AVS B;  1AA0 A;  3A0B E;  4AUW A;  2P10 A;  2E75 D;  1K9M Q;  4BRY B;  2I8D A;  1SQQ D;  2YKO A;  1XTG B;  3L70 J;  3G9R A;  3NFQ A;  4BRY A;  3W67 A;  1PV3 A;  1N7S B;  1FAV A;  5B5E E;  3TGU E;  1MV8 A;  5AW0 B;  2E74 B;  1KB9 E;  1L4A C;  3M06 A;  1H88 A;  2J5U A;  3AE7 C;  1IO4 A;  2E76 B;  3A0H H;  2M5A B;  1YTZ I;  1HJ0 A;  1LWU A;  1N8R Q;  2BCC D;  1G1J A;  1PZQ A;  2RN0 A;  4HYT B;  3VMY A;  2ZAE B;  2FYU D;  3CCS P;  2ZYA A;  1U7M A;  2JP3 A;  1VL2 A;  1URQ D;  1KQS O;  5KLV K;  2QA4 P;  2FYN B;  4N3Y B;  2P1J A;  3RK3 D;  2OTJ P;  1X0T A;  2H89 C;  1LP1 B;  2YXR B;  3CWB D;  3HD7 B;  3HRN A;  1IFI A;  4MN4 C;  2FKW B;  4NPD A;  3CCU P;  2GM4 A;  1X79 B;  1DEB A;  1MZ9 A;  3V4Q A;  1FBM A;  2QM7 A;  2H8P D;  1SQB E;  1GW4 A;  3I56 P;  1VQ6 P;  2YNY A;  4N6J A;  1GW3 A;  1L0L E;  2C0W A;  1DEE G;  4A7P A;  5E79 E;  3SWF A;  2FFD A;  1T2K D;  1H0T A;  1VF5 B;  1S4X A;  1N7S D;  1BSH A;  2A06 G;  2GUV A;  3GMA A;  2B88 A;  2KS1 B;  5BVZ A;  4PV1 C;  4C46 A;  4DZO A;  1GU4 A;  1RF1 B;  4H13 C;  1BGY J;  4WB4 A;  1LTS C;  3I55 P;  3G4S P;  1Q2N A;  2E5Y A;  1S5L E;  2E5T A;  2NPS C;  4H44 D;  3VN0 A;  1FZC A;  1KN7 A;  1EXJ A;  2LXC B;  2WSE J;  2WSS H;  1NU1 G;  3WMM 0;  3L72 G;  3H1I J;  1K73 Q;  1IZN B;  1NAF A;  4U3F E;  1N86 A;  5CCH D;  3HE4 B;  2A45 I;  2W27 A;  2OTK E;  1EDI A;  4IOI H;  1FJK A;  5APU A;  1JUN A;  3B71 A;  4ZKP A;  3B8E B;  1LTA C;  3AEA C;  2HPC B;  1BE3 J;  3CWB J;  4LGD E;  3E1I A;  2QJY C;  1EXI A;  2IZ0 A;  3V6I A; 
#chains in the Genus database with same CATH homology
 3VP8 A;  4C7R A;  5AVR B;  1GL2 A;  2C0X A;  1NH4 A;  1CW5 A;  2Q7C A;  4EOT A;  2VRS A;  2ZXE B;  3A3Y B;  2PAJ A;  3B5N D;  2WWW A;  1AQ5 A;  1NTZ K;  3OJA B;  5AVW B;  5APQ A;  2O01 H;  1GDT A;  3IFM A;  2E42 A;  3M9H A;  2JJL A;  1JMM A;  4C46 A;  1RF0 C;  1SFC A;  3CL3 D;  4I6M C;  1GL2 C;  3V5B A;  5AVV B;  2Z5H A;  2HFE D;  2M3B A;  1LTJ C;  3M91 A;  2FYZ A;  2WZ7 A;  1AFO A;  1FOS E;  3A5T A;  5AW6 B;  3RL0 B;  2HOD A;  2WPR A;  2BAS A;  3TSI A;  1FJP A;  5APX A;  3V4W A;  3BVH A;  3MD0 A;  1FU1 A;  3SWY A;  2N1T B;  2OYH C;  1GD2 E;  1NWQ A;  2Q9I A;  2N9B A;  3KYQ A;  1A02 J;  2PP6 A;  2P67 A;  1LWU B;  1OWA A;  1URQ A;  1FZF A;  3GHG A;  3P8M C;  4Y99 C;  3C9I A;  1RF0 A;  1M1J C;  1SFC C;  3P8C E;  2GUS A;  2XV5 A;  2FFD B;  2KP8 A;  1KIL B;  5KJ7 C;  2E43 A;  1RE4 A;  1NKN A;  1ZN5 A;  2N1T D;  4EIJ A;  1LWU C;  5BU5 A;  2A45 H;  1ZV8 A;  3L36 A;  3RL0 C;  1KQL A;  3HD7 C;  3CI9 A;  1L0N K;  4WY4 D;  3B5N A;  3LID A;  3KDP B;  4JF7 A;  3H32 A;  3BAS A;  2MJZ A;  3RK3 B;  3N7N A;  3VOP A;  3EFG A;  3RK2 C;  1JO5 A;  1NOH A;  4XE5 B;  5APS A;  2FXM A;  3HUS C;  1IFD A;  2IX7 C;  2O1J A;  1CI6 A;  1PFI A;  1L4A D;  1WT6 A;  2YO2 A;  1KFM A;  1DH3 A;  1JY3 O;  3MUD A;  4XA4 A;  4C7N B;  1FZB A;  3RK3 C;  1HUC A;  1OXZ A;  1JOC A;  1JTH B;  5APT A;  1J1E C;  2I1J A;  2KOG A;  1GL2 B;  1N73 B;  1FZA A;  5KTB A;  1WRG A;  1NU1 K;  3V2N A;  1N7S C;  1IFN A;  5APW A;  1S9K D;  1Z56 A;  1KZU B;  4KHX A;  2OYI C;  1HWT C;  1FOS F;  3GHG C;  5AVZ B;  1EQ7 A;  4JYC A;  1VPC A;  4AQR D;  2WPQ A;  1HTL C;  1X8Y A;  1M7L A;  2IFN A;  2KLV A;  1N7S A;  2R32 A;  3II6 A;  1IK9 A;  3BAT A;  4M3L A;  1T8Z A;  2FYU K;  1N2D C;  1HGV A;  1JCD A;  3GHG B;  1ZR2 A;  2OYH A;  1G1I A;  4HH2 A;  3RK2 B;  3V2Q A;  4O9B A;  2I1K A;  4JYB A;  1LTI C;  1M1J B;  1GTW A;  1IFJ A;  1LTJ A;  2YKQ A;  2HYN A;  3L35 A;  3LW5 H;  4ZKU A;  1LTJ B;  3M0D C;  2KB7 P;  3BRV B;  2HG5 D;  3HUS A;  5CJ4 A;  2R3C A;  1RE3 C;  1N73 C;  2N1T A;  2WTY A;  1RF1 A;  1LTT C;  2HLO A;  1JY2 O;  2NPS B;  3B5N C;  5AW1 B;  3N4X A;  2WIT A;  3KQG A;  1YTZ T;  2XU6 A;  1SLQ A;  2O1K A;  2W6A A;  1DX7 A;  5AVX B;  4GT1 A;  5CCG C;  1RE4 C;  1CI6 B;  1J1D C;  2WSE H;  2R5D A;  5BU8 B;  3HUS B;  1A02 F;  1E5W A;  1RF1 C;  5APV A;  1RE3 A;  3B5N B;  3T97 A;  3P8C D;  2ZFC A;  3V2P A;  4IFF A;  2Q5U A;  1VDF A;  1N73 A;  2R5B A;  2LKM A;  5AW4 B;  3M0D A;  2C9N Y;  3KPE A;  3HTK A;  1IJD B;  2KYV A;  1KIL D;  1SQX K;  3NTN A;  1MUU A;  2Q3I A;  2L5G B;  1LT9 B;  1T3U A;  2J58 A;  3HE5 A;  1IC2 A;  1JCC A;  1QL2 A;  1LTG C;  5AW5 B;  4I1L A;  4GKG A;  3BRT B;  1SFC D;  5AVT B;  1HJB A;  3MIW A;  1NO4 A;  2H43 A;  1JY2 N;  5AW2 B;  1JY3 P;  3H32 B;  1QL1 A;  3M0A A;  4LLH A;  5KJ7 D;  5KJ7 A;  5CHX A;  4DOJ A;  1LT9 C;  3VP9 A;  3IR9 A;  1HVV A;  2WPS A;  3LIE A;  2WSF H;  1HBW A;  1HH0 A;  3RL0 D;  1LT9 A;  2HOD B;  2OYI B;  1XTC C;  3U1C A;  1GU5 A;  1URQ C;  1FZG A;  2OYI A;  1SQP K;  1JY2 P;  2P2U A;  1JTH A;  2XZR A;  3RK2 D;  3OAK A;  4WBA A;  2XKM A;  1ZLL A;  3UIA A;  1FDM A;  1T2K C;  2Z5I A;  1URQ B;  1W2E A;  1HGZ A;  1SQV K;  2NPS D;  5CCH A;  3VMZ A;  5AVY B;  1JNM A;  3VTP C;  3L4F A;  1NHL A;  5CCH C;  5AVQ B;  1KIL A;  2H7H A;  3TNU A;  4N78 D;  3PP5 A;  4OH8 B;  2OAR A;  3TNU B;  3M9B A;  2QM8 A;  1IFM A;  3O8Z A;  4RES B;  4WY4 B;  2WSC H;  2NPS A;  1FZC C;  3HD7 A;  3V2R A;  3R2P A;  1GZL A;  1YYC A;  2JEE A;  2CPS A;  4W7Y A;  5CJ0 A;  1M1J A;  2FFD C;  1LGH B;  1G2C A;  1NKZ B;  3EQ2 A;  1SQQ K;  1NTM K;  3P32 A;  2HPC A;  1G2C B;  1NTK K;  2KSJ A;  3L37 A;  3HE5 B;  1FZC B;  1X9V A;  3NMD A;  3P7K A;  1J1E B;  2W6B A;  2IFM A;  5AW9 B;  5AW7 B;  1RY3 A;  5APY A;  4N78 E;  1LTB C;  5AW3 B;  3VYI A;  2M8R A;  3U1A A;  2YMY A;  3HTK B;  1GL2 D;  1L0L K;  2C9L Y;  3A2A A;  4I2L C;  3CLQ A;  3H6P A;  1S9K E;  3NXS A;  2Z4E A;  3A7O A;  3U59 A;  1SVF A;  2CPB A;  5CCG D;  2YO3 A;  1L4A B;  1J1D B;  3M9Q A;  3HE4 A;  4B86 A;  4AYC A;  2YKP A;  2POH A;  2A45 G;  2WT7 B;  1CSB A;  3MTU E;  1GK6 A;  1J2J B;  1KFN A;  3I5C A;  2WT7 A;  5CMZ A;  2P7J A;  4C7N A;  4IFD K;  1MFZ A;  1H8A A;  3TK1 A;  4Y99 B;  1GK4 A;  4IFM A;  5CCG A;  2XNX A;  1SFC B;  1SQB K;  1ZR4 A;  1L4A A;  3OA7 A;  2IPP A;  5AVU B;  1CZQ A;  1KIL C;  1SP4 A;  3MGN A;  4GIF A;  4W80 A;  1T3J A;  3G3Z A;  1N7L A;  2J59 M;  4LC1 A;  2N1T C;  5AW8 B;  2OYH B;  4W7Z A;  4WY4 A;  2XDJ A;  3TYY A;  1JY3 N;  3HD7 D;  3VMX A;  1H89 A;  1FZE A;  4WY4 C;  5AVS B;  4AUW A;  2YKO A;  1XTG B;  3NFQ A;  1N7S B;  1FAV A;  1MV8 A;  5AW0 B;  1L4A C;  3M06 A;  1H88 A;  1IO4 A;  1YTZ I;  1LWU A;  1G1J A;  4HYT B;  3VMY A;  1URQ D;  5KLV K;  4N3Y B;  2P1J A;  3RK3 D;  3HD7 B;  3HRN A;  2GM4 A;  1IFI A;  2FKW B;  1X79 B;  1DEB A;  1MZ9 A;  3V4Q A;  1FBM A;  2QM7 A;  2H8P D;  1GW4 A;  2YNY A;  4N6J A;  1GW3 A;  2C0W A;  3SWF A;  2FFD A;  1T2K D;  1N7S D;  2GUV A;  5BVZ A;  1GU4 A;  4DZO A;  1RF1 B;  4WB4 A;  1LTS C;  1FZC A;  2NPS C;  3VN0 A;  3WMM 0;  1NAF A;  1N86 A;  5CCH D;  3HE4 B;  2A45 I;  2W27 A;  1FJK A;  5APU A;  1JUN A;  4ZKP A;  3B8E B;  1LTA C;  2HPC B;  4LGD E;  3E1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...