1G1JA

Crystal structure of the oligomerization domain from rotavirus nsp4
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
43
structure length
43
Chain Sequence
IEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords NON-STRUCTURAL GLYCOPROTEIN NSP4
publication title Crystal structure of the oligomerization domain of NSP4 from rotavirus reveals a core metal-binding site.
pubmed doi rcsb
total genus 18
structure length 43
sequence length 43
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.430 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1g1jA00
2WITA 4C7RA 4WB4A 2O1JA 3MIWA 3CI9A 2L5GB 1G1JA 2O1KA 4HH2A 4DOJA 4WBAA 1G1IA 4LLHA
chains in the Genus database with same CATH superfamily
1Q82Q 4M3LA 2AEMA 3P8CE 1JEKA 3W67A 3N7NA 3H32A 2J58A 1OXZA 2H89C 1G2CB 1ZRTD 2IBZG 1SQBJ 3RL0D 1Y47A 4BWNA 2KP8A 1EDIA 3AE5C 2OTKE 3N4XA 3OW2O 1LWUA 5AW4B 2OYHA 1IFPA 3TYYA 1A02F 4N6JA 2QM8A 2N1TC 3H1HG 1EXJA 4H0LB 2A45H 3UIAA 1IK9A 2Q3IA 3U1CA 2C0XA 1W5CE 3RL0g 3CX5D 1H89A 3CXHH 1N7SC 1EDJA 4H44D 1QL1A 1PP9D 3RGUA 1SQVD 1S1CX 3H32B 1UIXA 4RESB 1IFDA 2JJLA 2YNYA 4QMAA 1GTWA 3D71A 1P84D 4DJGA 2E74C 2BASA 1BE3G 1SVFA 1YIJP 3C1LA 1NU1G 3CPWO 2R3CA 3VTPC 4GOFA 1ZRTE 1LWUB 2OYHB 2WPQA 5CCGC 2BCCJ 1LTIC 2O01J 4WY4D 2KI7B 2E75B 3Q2YA 2WWWA 3AEFC 4OH8B 1NTKD 3CI9A 3TGUD 1LT9A 1N7LA 4O9BA 1MUUA 1QEXA 2PP6A 2FYNB 1CI6A 2PRRA 1M1JC 3BASA 2WQYC 1N7SD 3CX5E 3L71J 1HJBA 3H1KJ 3H1ID 1PP9E 2WSSH 1EXIA 2W6JH 3V2RA 1CZQA 2E74D 1USDA 2HFED 1SQXG 1IFMA 2LKMA 2OYIC 2QA4P 1GK4A 3AEAC 5TISE 1S5LX 1LT9B 3H25A 3FXDA 5CHXA 3M9HA 1NTMG 3U1AA 1KB9I 1CI6B 3V6IA 2Q9IA 5K5GB 2ZYDA 2QJYB 2PAJA 1OIPA 1HJ0A 2K1AA 1KORA 1RE4C 3IF4A 4AUWA 3PHLA 1PGOA 3CX5H 2D2CB 3AE7C 3BCCD 2H8PD 5BU8B 2LR2A 2WSCJ 3A0BE 4XE5B 3V5BA 1BGYD 3H1IE 4L74A 2Q6QA 3MTUE 4N78D 4U3FD 2KLVA 3MGNA 1M1KQ 2KUBA 3SFEC 1P84H 2CPSA 1NTME 3AEDC 3VOPA 1H0TA 1JO5A 1KN7A 1QGKB 4GT1A 5TJHA 3AEEC 1GL2C 3AECC 4JYBA 3B8EB 4UB6E 3V4QA 2QIWA 1DEEG 3Q5SA 1ZR2A 2O1KA 2K9YA 4IFMA 2IPPA 1JUNA 1LTAC 1QL2A 1IFIA 3VP8A 4WVZA 1WT6A 1N8RQ 2QJKB 2P1JA 1PFIA 3V4WA 3ITKA 3EQ2A 2O1JA 3PTZA 1FC2C 2QJPB 2W83C 3BCCE 3KQGA 3L74J 1DD3A 1HTLC 3L75J 4DT0A 1JY3P 5KKZC 1BGYE 5H2FE 4PV1D 2RMZA 1H0TB 3PJSK 1FDOA 4N78E 3F89A 1L0NJ 2HPCA 1GD2E 1BCCD 3TDKA 2IX7C 4GDOA 4PJ0E 2Z5IA 1ZP0C 1FJPA 1XTCC 1X9VA 1MFZA 3L72J 3LIDA 3AE2C 3AE6C 3HD7A 2WZ7A 3CCUP 3L70G 1M57D 1T3UA 1VF5C 2FYUD 1FAVA 3PRJA 4Z1MH 1Q86Q 1S5LH 5AVYB 2HLOA 2FXOA 1VQMP 4H13D 2HPCB 1LTGC 3KPEA 1G1IA 2KNCA 1N73A 1JMMA 1M7LA 3QWOC 1BCCE 3G9RA 1SQQD 1OVRA 3H6PA 2KXPB 2NPSA 1OX3A 3HD7B 3D6YA 1SQPG 1K8AQ 3G3ZA 1IC2A 3H1JG 1VDFA 1ZMEC 1FE6A 2JWAA 1JCCA 2XU6A 3TNUB 3BVHA 2KOGA 3FWNA 2FYUE 2KS1A 3CC2P 1YQ4C 1QVGO 1L4AC 4L75A 2KNCB 1N73B 1LTTC 3CCMP 2GM4A 2YO3A 1XTGB 4GODA 1FZGA 1NTZD 5KLIC 2NPSB 3CL3D 1GZLA 3CLQA 4A7PA 2JO1A 3H1JE 2FFDC 5CMZA 1SQQE 2B89A 1JTHA 2A06D 1TU3F 1GW4A 1X8YA 3M9BA 2ZJSE 5APSA 1PP9J 3G6EP 2YO2A 1SQVJ 1JOCA 2KS1B 3WUUA 1SQXK 2O01N 1VQ6P 1W2EA 1L0NG 1H8AA 2C0WA 2JR8A 4GIFA 4HB1A 3KHUA 4NPFX 1L4AD 1YQ3C 1SFCA 2PFXA 1ZLLA 3L72G 1NTMK 3A5TA 2GUSA 4UB8E 3RK2C 5KLVD 1KFNA 1NTKJ 1J1DB 1NTZE 3TGUJ 2JEEA 2NZ2A 4CPGA 3S1KA 1JTHB 1Y9BA 2V4HA 3V2QA 5AVRB 1KILC 2P10A 1KD1Q 2IFMA 2VRSA 3L73J 3CWBJ 4DCKA 1RF0C 1VQNP 4OGQC 4WY4A 3BRVB 5CCHC 2IBZD 3B4SA 3H1IJ 3JSVC 5KJ7D 3D70A 3SWYA 1KB9D 1URQD 2LXCB 1LJ2A 1SFCC 1S9KE 3L37A 1SFCB 5APXA 1OMIA 2HODA 2MKVA 1HGZA 1SLQA 3LW5H 3A0HE 1J2JB 1VQ8P 1LTJA 4H0LC 3HUSA 1SP4A 1ZW0A 3HE5A 4UB8H 4YXDC 5KLVE 1LP1A 2JWDA 2P58A 2E76D 2IZ0A 5M1BA 2W6AA 3R2PA 2Y0EA 4WY4B 3I5CA 5E79H 1YHQP 3CCEP 3D6ZA 1BE3D 2IYPA 2NRGA 2ZYGA 1NU1D 2XNXA 5CCHD 4IL6X 3BCCJ 3KZIE 3A7OA 2IBZE 4GOEA 1EQ7A 2HODB 3JCUE 3NXSA 3GF3A 1KB9E 4U3FJ 2ZXXA 1JY3N 1LWUC 2OYHC 3H1HE 1KMIZ 1FOSF 1LTJB 2E75C 3HUSB 4Y99B 3HE5B 2WSEH 1LP1B 1R8EA 2P67A 2N1TD 3OJAB 1YI2P 3VMXA 4RJTA 3P7KA 5GTHE 3C9IA 2FYNC 5AW0B 1OZHA 3AEBC 2K37A 3O6QA 1VQ7P 1KILE 3SWFA 1YJWP 4Y28J 2YXRB 2M0BA 1SQXD 1BE3E 1FZCA 1NU1E 1L0LG 1PZQA 3IN6A 2AXCA 4U7JA 2E5TA 1T3JA 1NTMD 2FYUK 3JCUH 3TGUG 3PLNA 2IYOA 1KB9H 2K9JA 1OW6A 1NYHA 5CCGD 1K9MQ 5KAIE 3L73G 1LT9C 3CWBG 4NPDA 1BCCJ 1OVUA 4EYYQ 2IBZI 1PV3A 5DJTB 3AE9C 3QH9A 1J1EB 3O6QB 4IL6E 3EFFK 1M90Q 1LGHB 2QJYC 3TSIA 2YKPA 2ZVOB 5GTHH 1SQQK 2QE7H 1FZCB 2W27A 2DW3A 2RN0A 2MJZA 1PGJA 3H1LJ 1U57A 2D2CC 1SQXE 2Z4EA 1SQBG 1NHLA 2IZ1A 2R32A 2FYUJ 1YJ9P 1JMBA 2B87A 4K3AA 1IFJA 3CMAP 2L5GB 1FDMA 3CCSP 2K9JB 1VQ4P 2Y0CA 1H88A 2M3BA 3CD6P 1Y8AA 3RK3B 3B71A 1KZUB 1K73Q 2ITAA 2WPRA 3E1RA 5AVTB 5BU5A 1EC5A 1EZVG 4HKZH 2XKMA 3I56P 1AFOA 1NAFA 1Q7YQ 4PD4I 3NTNA 5TISH 1Q81Q 4PV1B 1NGMB 1NVOA 1NTZK 4D6TJ 2V7QH 5AW6B 2QJKC 4U3FG 2B87B 2D2CD 1KC8Q 2YMKA 5KAFE 1VQKP 1RF1A 2BCCG 2QJPC 2XNDH 3LW5J 1ZV8A 3A0BH 1HUCA 2WPVB 1QX8A 3FWLA 4KHXA 1K05A 1YBKA 3M91A 3MZWB 5C39A 2R5BA 5AW7B 3B5NA 3L70D 1PGPA 4EI2A 1YTZI 4I6MC 1GL2D 2J5UA 3L71G 2Y0DA 4H13B 1JY2O 3CMEP 2RH0A 3WU2E 3H1KG 5KLVK 5AVVB 2ZXEB 2WTYA 1OVVA 2BCCE 4UB6H 1GW3A 2YIUC 2WMMA 4BRYA 4I7ZB 2YIUB 1W2BO 1RF1B 2B9BA 2ZAEB 5AW9B 2M8RA 4C7NB 1MFTA 3IFMA 5KAFH 1HBWA 3TNUA 5B5EE 3RBZA 4JQ0D 3M9QA 2OYOA 2WSEJ 1AQ5A 5APQA 1KYOD 5H2FH 1RHZB 1YJNP 3F5HA 3B5NB 1MZ9A 1SQPD 3MUDA 3H1KE 3SFDC 5AW8B 2FKWB 2XV5A 5KLVJ 5B66E 3H1JD 4ZNCA 3LIEA 3H1LG 3HD7C 1FS0E 1PL5A 3L70E 4PJ0H 5KTBA 2OTJP 1BSHA 1YITP 4BRYB 1RE3A 3WU2H 2QSIA 3HTKA 1MKMA 2ZT9B 3CCVP 1RQUA 1VF5D 1NU1K 1ZXGA 1LT1A 1USEA 1U7MA 1G1JA 1N73C 5B5EH 2WSFH 1YYCA 2Y9ZA 1QVFO 2KZIA 1HWTC 4XA4A 1KYOE 4D6TG 3CC4P 2NPSC 1DH3A 1OWAA 1SQPE 1DX7A 5KJ7A 1IFNA 2Y9YA 2QEXP 1URQA 5B66H 3HD7D 5APUA 4ZMDA 1T6AA 2CK3H 4HJGH 3HTKB 3CCRP 1FOSE 2OGUA 1BE3J 1NWQA 3L74G 3L75G 1L0LK 1NU1J 3HE4A 4KT0J 3M0DA 3U59A 3SWKA 2RKLA 1S9KD 2KIKA 2A45G 5BVZA 3E1IA 2QM7A 4OVNF 1S72P 2BEQD 3VYIA 3WUTA 3VMAA 1AVYA 2KSEA 1Q90D 3M06A 5AW1B 4DZOA 4JF7A 2A06G 3A2AA 1URQB 4K35A 3A3YB 5AVWB 1J1DC 4ZKPA 2SPZA 5APWA 4N3YB 2V7QJ 2H43A 3PH0A 2IFNA 3RL0B 2B88A 2W8ZA 1LTBC 3HE4B 1DD4A 1KYOI 1SQBK 2BEZF 1L0NE 1WRGA 1VQLP 3Q1MA 1SQXJ 3T97A 1CSBA 2GA1A 1Q2NA 5AVUB 2N9YB 1EDLA 4W80A 5APVA 1MV8A 2E76B 2WPSA 3CXHE 3V2NA 5GTIE 3L72E 4LLHA 3H1HD 1NTMJ 1GU4A 4H44B 1N7SA 4YXWH 2Q3EA 5EFWB 1N86A 3VP9A 3WMM0 4JPZB 1PPJG 5L8RJ 3RK2D 4WBAA 2P2UA 2R44A 3GLMA 4WY4C 1FDIA 1KILD 3L35A 3HRNA 3NMDA 3T97B 3E7KA 2WT7A 2Q7CA 3VMZA 1IO4A 2Q5UA 5AVSB 5CCGA 3W68A 1RQVA 4OGQD 2N1TB 1VQ9P 3MIWA 4PD4D 1BGYJ 1JY2P 5GTIH 1SFCD 1JNMA 3C8VA 2E42A 2A45I 1N7SB 3KXDA 1PPJE 1LTJC 1NO4A 2PGDA 1M1JA 4JBZA 3HUSC 3ZDMA 2XDJA 4KJMA 2I8DA 4HH2A 1AA0A 1NKZB 4Y99C 4XFJA 3A0HH 1BDDA 3CXHI 3FX0A 2G8YA 4ASVA 2E74B 1CW5A 1AV1A 4H0LD 3EFGA 5CBOA 1PP9G 1SQVG 2WT7B 4B86A 1AVOA 2O3JA 4GKGA 3V2PA 1E5WA 1L0LD 1KFMA 2KB7P 2OYIA 5APYA 3Q5PA 2JDIH 2KZJA 4IFFA 3AE1C 1D7MA 4R4MA 1E79H 5AW5B 1Z56A 3L73D 4PD4E 3CWBD 2WSFJ 3KZIH 1VQ5P 1M1JB 1L2PA 4YTPC 3OAKA 1NTKG 3TK1A 2ZVNB 1KQFB 2FYZA 1KV4A 3Q5RA 4RKUJ 1M8OB 1SQVE 4WB4A 1HH0A 1U7JA 1RE4A 1X22A 2E75D 2KSJA 4JYCA 2CPBA 2WITA 5AVXB 2GUVA 1P84E 3L70J 4OWFA 1J1EC 2IDBA 3MP7B 1SQPK 2AXTE 4WWIA 2J59M 1SQBD 3AE8C 2OYIB 3H1IG 5AVZB 2YMYA 1NOHA 1A02J 1FZCC 1L0LE 3CCJP 1AQTA 1K04A 5APTA 3P8MC 3SSUA 3GF7A 4TT3H 1NTKE 5CJ0A 3TGUE 2FXMA 2HYNA 4AYCA 1EZVD 1NJIQ 1GL2A 3KDPB 1AJYA 3L73E 4PD4H 1BDCA 3S9OA 3CWBE 3RK3C 2UWJE 4IOIH 2OTLP 4W7ZA 1SQPJ 5AW3B 1KQSO 5DJUB 1PIXA 5KAIH 4PV1C 4L73A 3H1JJ 5CBNA 3P32A 1SQQJ 3MHVA 1SS1A 1LTSC 2R5DA 3CX5I 2ZFCA 3BCCG 2AXTH 2BCCD 4IL6H 3GW6A 2E5YA 1RH5B 3FXEA 2ZYAA 1FZBA 1SQBE 1BGYG 1OFCX 2XZRA 1RY3A 1QLED 1VL2A 2QRXA 3GMAA 3OA7A 1BSNA 3PP5A 1L0NK 1P84I 3L4FA 2R3SA 3II6A 1GL2B 1LNQA 1OW7A 1S3JA 2OARA 1KQLA 4RO0A 4AQRD 2YXQB 1EZVE 1GK6A 4C7NA 1OW8A 4ZKUA 5AVQB 4EDFA 3RK3D 3L71D 1HGVA 2H88C 3H1KD 2OQQA 2W6BA 1FJKA 1S5LE 1NTZJ 1KQGB 3JC22 2M5AA 2K3RA 2JKVA 4H13C 4I1LA 5KKZB 4U3FE 3G71P 4LGDE 2KLUA 2Z5HA 1FZEA 3EWKA 4I7ZC 1RF1C 2KYVA 4TLFA 1JB0J 4BXLA 4L76A 3M0AA 3Q3DA 3AE4C 1X79B 4EIJA 4MN4C 3S4RA 2LXBA 1BCCG 1R5LA 2N9BA 3AEGC 1VQOP 2E43A 3GG2A 3H1LD 1HF9A 1NH4A 3RK3E 3B5NC 3IR9A 3L71E 1VPCA 4YPCA 2M5AB 1T2KC 1VF5B 2FY8A 3CCQP 3WUVA 2AEJA 1EZVI 1M56D 2P7JA 2C9NY 2WVRA 2FYUG 1WMKA 1L4AA 1FZFA 3GHGA 1GDTA 1FZAA 4EOTA 3NFQA 3CCLP 2O01H 2Q1KA 2ZT9C 1HVVA 2C9LY 1IK7A 4D6TD 3K5BA 1EDKA 2FFDA 1JY2N 3H1HJ 3VMYA 4NPEA 3MUDC 1JM0A 1ZOYC 2W90A 1SQQG 1FBMA 4R4LA 3O8ZA 3H1LE 4LC1A 3B5ND 1S4XA 1T2KD 2HR3A 1SQVK 2AEFA 2HG5D 2L91A 3L74D 3L75D 4DOJA 1RE3C 2KK7A 1L4AB 3GHGC 3RBXA 3GHGB 4C46A 3AE3C 3CC7P 1L0ND 3I55P 3MD0A 3G4SP 2M3EA 4W7YA 5CJ4A 2QG4A 5KLIB 2JP3A 1X0TA 1R5SA 2ZT9D 3CXHD 2FFDB 3L72D 3USSA 1NTKK 3FGAD 1T8ZA 4I2LC 1NTZG 1N2DC 1ZR4A 1JCDA 2POHA 4D6TE 1KILA 3P8CD 1NAYA 1RF0A 5KJ7C 3L36A 5AW2B 3TF5A 2FXPA 4C7RA 1URQC 1KTMA 5CCHA 2NPSD 1UIIA 1KYOH 2YKQA 1IZNB 4IFDK 3L74E 1IJDB 2WSCH 2YKOA 3L75E 3KYQA 2FBWC 3IAOA 3RL0C 3BATA 3VN0A 1DEBA 1G2CA 1L0LJ 3BRTB 2I1JA 2H7HA 4HYTB 3M0DC 2I1KA 2K88A 1ZN5A 2QVAA 1S2EA 1GU5A 3R4YA 1PGQA 1GMJA 3RK2B 1NKNA 2E76C 5E79E 1FU1A 4ASWA 1JY3O 1KILB 2N1TA 2G3AA 1YTZT 2A06E 1PPJD 3ABVC 5KLVG 4H44C 1DIPA 1VQPP 4OGQB
chains in the Genus database with same CATH topology
1M1JB 3TNUB 3BVHA 2KOGA 3OAKA 1ZV8A 4M3LA 1HUCA 3P8CE 3TK1A 2FYZA 3N7NA 4KHXA 3H32A 2J58A 4WB4A 1HH0A 1OXZA 1RE4A 1L4AC 2KSJA 4JYCA 2CPBA 2WITA 1G2CB 5AVXB 1N73B 1LTTC 2GM4A 2YO3A 2GUVA 3M91A 2R5BA 1J1EC 5AW7B 1XTGB 1SQPK 3RL0D 1FZGA 3B5NA 2KP8A 2J59M 2NPSB 3CL3D 3N4XA 1GZLA 3CLQA 1YTZI 2OYIB 4I6MC 1GL2D 1LWUA 5AW4B 2OYHA 1JY2O 5AVZB 3TYYA 2YMYA 1A02F 4N6JA 2QM8A 2N1TC 1NOHA 5KLVK 1A02J 1FZCC 5AVVB 2FFDC 2A45H 5CMZA 2ZXEB 3UIAA 2WTYA 1GW3A 1IK9A 1JTHA 5APTA 2Q3IA 3P8MC 3U1CA 1GW4A 1RF1B 2C0XA 1X8YA 5CJ0A 3M9BA 2FXMA 2HYNA 5AW9B 4AYCA 2M8RA 1H89A 5APSA 2YO2A 4C7NB 1GL2A 1JOCA 1N7SC 3KDPB 1QL1A 3IFMA 3H32B 1HBWA 3RK3C 1SQXK 3TNUA 1W2EA 4RESB 1IFDA 2JJLA 1H8AA 2YNYA 4W7ZA 2C0WA 3M9QA 1GTWA 4GIFA 1AQ5A 5APQA 5AW3B 2BASA 1SVFA 1L4AD 3B5NB 1MZ9A 1SFCA 3MUDA 1ZLLA 2R3CA 3VTPC 1NTMK 2FKWB 1LWUB 3P32A 5AW8B 2OYHB 2WPQA 2XV5A 5CCGC 1LTIC 1LTSC 3A5TA 4WY4D 2R5DA 3LIEA 2GUSA 2ZFCA 3RK2C 3HD7C 1KFNA 1J1DB 2JEEA 5KTBA 1JTHB 1FZBA 2WWWA 3V2QA 5AVRB 4OH8B 2XZRA 1RY3A 3CI9A 1KILC 1RE3A 1LT9A 1N7LA 2IFMA 4O9BA 2VRSA 1MUUA 3OA7A 3PP5A 1L0NK 3HTKA 1RF0C 3L4FA 3II6A 1GL2B 2PP6A 2OARA 1CI6A 1KQLA 4WY4A 1M1JC 3BASA 3BRVB 4AQRD 5CCHC 1N7SD 1GK6A 1NU1K 4C7NA 4ZKUA 5KJ7D 1HJBA 5AVQB 3RK3D 3SWYA 1URQD 1HGVA 1SFCC 1S9KE 1G1JA 3L37A 1N73C 1SFCB 2WSFH 3V2RA 5APXA 1CZQA 1YYCA 2W6BA 2HFED 1FJKA 2HODA 1HWTC 1HGZA 4XA4A 1SLQA 3LW5H 2NPSC 1J2JB 1IFMA 2LKMA 2OYIC 1OWAA 1DH3A 4I1LA 1DX7A 1GK4A 5KJ7A 1IFNA 1LTJA 3HUSA 1URQA 1LT9B 4LGDE 3HD7D 1SP4A 5APUA 2Z5HA 1FZEA 3HE5A 5CHXA 3M9HA 3HTKB 1FOSE 1RF1C 3U1AA 2KYVA 1CI6B 2W6AA 3R2PA 4WY4B 3M0AA 3I5CA 1NWQA 2Q9IA 1L0LK 3HE4A 3M0DA 3U59A 2PAJA 1X79B 2XNXA 4EIJA 5CCHD 1RE4C 4AUWA 1S9KD 2A45G 5BVZA 3E1IA 2N9BA 2QM7A 2E43A 3A7OA 3VYIA 2H8PD 1EQ7A 2HODB 5BU8B 3NXSA 4XE5B 3V5BA 1NH4A 3B5NC 3IR9A 1VPCA 1T2KC 1JY3N 3M06A 1LWUC 2OYHC 3MTUE 4N78D 5AW1B 4DZOA 4JF7A 1FOSF 1LTJB 2KLVA 3MGNA 3A2AA 2CPSA 3HUSB 1URQB 3A3YB 5AVWB 1J1DC 3VOPA 4Y99B 3HE5B 4ZKPA 2P7JA 5APWA 2WSEH 4N3YB 2C9NY 2P67A 1JO5A 2H43A 2N1TD 3OJAB 1L4AA 2IFNA 4GT1A 3RL0B 3VMXA 1FZFA 3GHGA 3P7KA 1GDTA 1LTBC 1GL2C 3HE4B 3C9IA 1FZAA 5AW0B 4EOTA 3NFQA 2O01H 4JYBA 1SQBK 3B8EB 1WRGA 3V4QA 3SWFA 3T97A 1CSBA 1ZR2A 2O1KA 4IFMA 1HVVA 5AVUB 2IPPA 2C9LY 4W80A 5APVA 1JUNA 1LTAC 1MV8A 1QL2A 1IFIA 2WPSA 3VP8A 3V2NA 1FZCA 2FFDA 1JY2N 1WT6A 3VMYA 2P1JA 1PFIA 4LLHA 3V4WA 3EQ2A 2O1JA 1FBMA 1GU4A 3O8ZA 1T3JA 4LC1A 3B5ND 3KQGA 2FYUK 1HTLC 1T2KD 1SQVK 1JY3P 2HG5D 1N7SA 1N86A 4DOJA 5CCGD 3VP9A 3WMM0 1RE3C 4N78E 1LT9C 1L4AB 3GHGC 3RK2D 3GHGB 2HPCA 4C46A 1GD2E 4WBAA 2IX7C 1J1EB 2P2UA 4WY4C 1KILD 3MD0A 3L35A 3HRNA 3NMDA 4W7YA 5CJ4A 2Z5IA 2WT7A 1FJPA 1LGHB 1XTCC 3TSIA 1X9VA 2YKPA 2Q7CA 3VMZA 1MFZA 1IO4A 1SQQK 2Q5UA 5AVSB 5CCGA 3LIDA 2N1TB 1FZCB 2FFDB 2W27A 2MJZA 3HD7A 3MIWA 1NTKK 2WZ7A 1T8ZA 4I2LC 1N2DC 1ZR4A 1JCDA 2POHA 2Z4EA 1T3UA 1KILA 1NHLA 2R32A 1JY2P 1SFCD 1IFJA 3P8CD 2L5GB 1JNMA 1FDMA 2E42A 1RF0A 1FAVA 2A45I 1N7SB 5KJ7C 3L36A 5AW2B 1H88A 1LTJC 1NO4A 2M3BA 4C7RA 1M1JA 3HUSC 1URQC 5CCHA 3RK3B 2XDJA 2NPSD 4HH2A 1KZUB 1NKZB 4Y99C 5AVYB 2HLOA 2YKQA 2WPRA 5AVTB 5BU5A 2HPCB 1LTGC 3KPEA 4IFDK 1G1IA 1IJDB 2XKMA 2WSCH 2YKOA 1CW5A 1AFOA 1NAFA 3KYQA 3EFGA 3RL0C 3BATA 3NTNA 3VN0A 1DEBA 1G2CA 1N73A 3BRTB 4B86A 1JMMA 2I1JA 2WT7B 1M7LA 2H7HA 4HYTB 3M0DC 4GKGA 3V2PA 1E5WA 2I1KA 1ZN5A 1NTZK 1GU5A 3H6PA 2NPSA 1KFMA 2KB7P 3RK2B 1NKNA 3HD7B 2OYIA 5APYA 4IFFA 5AW6B 1FU1A 1JY3O 1KILB 2N1TA 5AW5B 3G3ZA 1Z56A 1YTZT 1IC2A 1VDFA 1RF1A 1JCCA 2XU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WIT A;  4C7R A;  4WB4 A;  2O1J A;  3MIW A;  3CI9 A;  2L5G B;  1G1J A;  2O1K A;  4HH2 A;  4DOJ A;  4WBA A;  1G1I A;  4LLH A; 
#chains in the Genus database with same CATH topology
 1Q82 Q;  4M3L A;  2AEM A;  3P8C E;  1JEK A;  3W67 A;  3N7N A;  3H32 A;  2J58 A;  1OXZ A;  2H89 C;  1G2C B;  1ZRT D;  2IBZ G;  1SQB J;  3RL0 D;  1Y47 A;  4BWN A;  2KP8 A;  1EDI A;  3AE5 C;  2OTK E;  3N4X A;  3OW2 O;  1LWU A;  5AW4 B;  2OYH A;  1IFP A;  3TYY A;  1A02 F;  4N6J A;  2QM8 A;  2N1T C;  3H1H G;  1EXJ A;  4H0L B;  2A45 H;  3UIA A;  1IK9 A;  2Q3I A;  3U1C A;  2C0X A;  1W5C E;  3RL0 g;  3CX5 D;  1H89 A;  3CXH H;  1N7S C;  1EDJ A;  4H44 D;  1QL1 A;  1PP9 D;  3RGU A;  1SQV D;  1S1C X;  3H32 B;  1UIX A;  4RES B;  1IFD A;  2JJL A;  2YNY A;  4QMA A;  1GTW A;  3D71 A;  1P84 D;  4DJG A;  2E74 C;  2BAS A;  1BE3 G;  1SVF A;  1YIJ P;  3C1L A;  1NU1 G;  3CPW O;  2R3C A;  3VTP C;  4GOF A;  1ZRT E;  1LWU B;  2OYH B;  2WPQ A;  5CCG C;  2BCC J;  1LTI C;  2O01 J;  4WY4 D;  2KI7 B;  2E75 B;  3Q2Y A;  2WWW A;  3AEF C;  4OH8 B;  1NTK D;  3CI9 A;  3TGU D;  1LT9 A;  1N7L A;  4O9B A;  1MUU A;  1QEX A;  2PP6 A;  2FYN B;  1CI6 A;  2PRR A;  1M1J C;  3BAS A;  2WQY C;  1N7S D;  3CX5 E;  3L71 J;  1HJB A;  3H1K J;  3H1I D;  1PP9 E;  2WSS H;  1EXI A;  2W6J H;  3V2R A;  1CZQ A;  2E74 D;  1USD A;  2HFE D;  1SQX G;  1IFM A;  2LKM A;  2OYI C;  2QA4 P;  1GK4 A;  3AEA C;  5TIS E;  1S5L X;  1LT9 B;  3H25 A;  3FXD A;  5CHX A;  3M9H A;  1NTM G;  3U1A A;  1KB9 I;  1CI6 B;  3V6I A;  2Q9I A;  5K5G B;  2ZYD A;  2QJY B;  2PAJ A;  1OIP A;  1HJ0 A;  2K1A A;  1KOR A;  1RE4 C;  3IF4 A;  4AUW A;  3PHL A;  1PGO A;  3CX5 H;  2D2C B;  3AE7 C;  3BCC D;  2H8P D;  5BU8 B;  2LR2 A;  2WSC J;  3A0B E;  4XE5 B;  3V5B A;  1BGY D;  3H1I E;  4L74 A;  2Q6Q A;  3MTU E;  4N78 D;  4U3F D;  2KLV A;  3MGN A;  1M1K Q;  2KUB A;  3SFE C;  1P84 H;  2CPS A;  1NTM E;  3AED C;  3VOP A;  1H0T A;  1JO5 A;  1KN7 A;  1QGK B;  4GT1 A;  5TJH A;  3AEE C;  1GL2 C;  3AEC C;  4JYB A;  3B8E B;  4UB6 E;  3V4Q A;  2QIW A;  1DEE G;  3Q5S A;  1ZR2 A;  2O1K A;  2K9Y A;  4IFM A;  2IPP A;  1JUN A;  1LTA C;  1QL2 A;  1IFI A;  3VP8 A;  4WVZ A;  1WT6 A;  1N8R Q;  2QJK B;  2P1J A;  1PFI A;  3V4W A;  3ITK A;  3EQ2 A;  2O1J A;  3PTZ A;  1FC2 C;  2QJP B;  2W83 C;  3BCC E;  3KQG A;  3L74 J;  1DD3 A;  1HTL C;  3L75 J;  4DT0 A;  1JY3 P;  5KKZ C;  1BGY E;  5H2F E;  4PV1 D;  2RMZ A;  1H0T B;  3PJS K;  1FDO A;  4N78 E;  3F89 A;  1L0N J;  2HPC A;  1GD2 E;  1BCC D;  3TDK A;  2IX7 C;  4GDO A;  4PJ0 E;  2Z5I A;  1ZP0 C;  1FJP A;  1XTC C;  1X9V A;  1MFZ A;  3L72 J;  3LID A;  3AE2 C;  3AE6 C;  3HD7 A;  2WZ7 A;  3CCU P;  3L70 G;  1M57 D;  1T3U A;  1VF5 C;  2FYU D;  1FAV A;  3PRJ A;  4Z1M H;  1Q86 Q;  1S5L H;  5AVY B;  2HLO A;  2FXO A;  1VQM P;  4H13 D;  2HPC B;  1LTG C;  3KPE A;  1G1I A;  2KNC A;  1N73 A;  1JMM A;  1M7L A;  3QWO C;  1BCC E;  3G9R A;  1SQQ D;  1OVR A;  3H6P A;  2KXP B;  2NPS A;  1OX3 A;  3HD7 B;  3D6Y A;  1SQP G;  1K8A Q;  3G3Z A;  1IC2 A;  3H1J G;  1VDF A;  1ZME C;  1FE6 A;  2JWA A;  1JCC A;  2XU6 A;  3TNU B;  3BVH A;  2KOG A;  3FWN A;  2FYU E;  2KS1 A;  3CC2 P;  1YQ4 C;  1QVG O;  1L4A C;  4L75 A;  2KNC B;  1N73 B;  1LTT C;  3CCM P;  2GM4 A;  2YO3 A;  1XTG B;  4GOD A;  1FZG A;  1NTZ D;  5KLI C;  2NPS B;  3CL3 D;  1GZL A;  3CLQ A;  4A7P A;  2JO1 A;  3H1J E;  2FFD C;  5CMZ A;  1SQQ E;  2B89 A;  1JTH A;  2A06 D;  1TU3 F;  1GW4 A;  1X8Y A;  3M9B A;  2ZJS E;  5APS A;  1PP9 J;  3G6E P;  2YO2 A;  1SQV J;  1JOC A;  2KS1 B;  3WUU A;  1SQX K;  2O01 N;  1VQ6 P;  1W2E A;  1L0N G;  1H8A A;  2C0W A;  2JR8 A;  4GIF A;  4HB1 A;  3KHU A;  4NPF X;  1L4A D;  1YQ3 C;  1SFC A;  2PFX A;  1ZLL A;  3L72 G;  1NTM K;  3A5T A;  2GUS A;  4UB8 E;  3RK2 C;  5KLV D;  1KFN A;  1NTK J;  1J1D B;  1NTZ E;  3TGU J;  2JEE A;  2NZ2 A;  4CPG A;  3S1K A;  1JTH B;  1Y9B A;  2V4H A;  3V2Q A;  5AVR B;  1KIL C;  2P10 A;  1KD1 Q;  2IFM A;  2VRS A;  3L73 J;  3CWB J;  4DCK A;  1RF0 C;  1VQN P;  4OGQ C;  4WY4 A;  3BRV B;  5CCH C;  2IBZ D;  3B4S A;  3H1I J;  3JSV C;  5KJ7 D;  3D70 A;  3SWY A;  1KB9 D;  1URQ D;  2LXC B;  1LJ2 A;  1SFC C;  1S9K E;  3L37 A;  1SFC B;  5APX A;  1OMI A;  2HOD A;  2MKV A;  1HGZ A;  1SLQ A;  3LW5 H;  3A0H E;  1J2J B;  1VQ8 P;  1LTJ A;  4H0L C;  3HUS A;  1SP4 A;  1ZW0 A;  3HE5 A;  4UB8 H;  4YXD C;  5KLV E;  1LP1 A;  2JWD A;  2P58 A;  2E76 D;  2IZ0 A;  5M1B A;  2W6A A;  3R2P A;  2Y0E A;  4WY4 B;  3I5C A;  5E79 H;  1YHQ P;  3CCE P;  3D6Z A;  1BE3 D;  2IYP A;  2NRG A;  2ZYG A;  1NU1 D;  2XNX A;  5CCH D;  4IL6 X;  3BCC J;  3KZI E;  3A7O A;  2IBZ E;  4GOE A;  1EQ7 A;  2HOD B;  3JCU E;  3NXS A;  3GF3 A;  1KB9 E;  4U3F J;  2ZXX A;  1JY3 N;  1LWU C;  2OYH C;  3H1H E;  1KMI Z;  1FOS F;  1LTJ B;  2E75 C;  3HUS B;  4Y99 B;  3HE5 B;  2WSE H;  1LP1 B;  1R8E A;  2P67 A;  2N1T D;  3OJA B;  1YI2 P;  3VMX A;  4RJT A;  3P7K A;  5GTH E;  3C9I A;  2FYN C;  5AW0 B;  1OZH A;  3AEB C;  2K37 A;  3O6Q A;  1VQ7 P;  1KIL E;  3SWF A;  1YJW P;  4Y28 J;  2YXR B;  2M0B A;  1SQX D;  1BE3 E;  1FZC A;  1NU1 E;  1L0L G;  1PZQ A;  3IN6 A;  2AXC A;  4U7J A;  2E5T A;  1T3J A;  1NTM D;  2FYU K;  3JCU H;  3TGU G;  3PLN A;  2IYO A;  1KB9 H;  2K9J A;  1OW6 A;  1NYH A;  5CCG D;  1K9M Q;  5KAI E;  3L73 G;  1LT9 C;  3CWB G;  4NPD A;  1BCC J;  1OVU A;  4EYY Q;  2IBZ I;  1PV3 A;  5DJT B;  3AE9 C;  3QH9 A;  1J1E B;  3O6Q B;  4IL6 E;  3EFF K;  1M90 Q;  1LGH B;  2QJY C;  3TSI A;  2YKP A;  2ZVO B;  5GTH H;  1SQQ K;  2QE7 H;  1FZC B;  2W27 A;  2DW3 A;  2RN0 A;  2MJZ A;  1PGJ A;  3H1L J;  1U57 A;  2D2C C;  1SQX E;  2Z4E A;  1SQB G;  1NHL A;  2IZ1 A;  2R32 A;  2FYU J;  1YJ9 P;  1JMB A;  2B87 A;  4K3A A;  1IFJ A;  3CMA P;  2L5G B;  1FDM A;  3CCS P;  2K9J B;  1VQ4 P;  2Y0C A;  1H88 A;  2M3B A;  3CD6 P;  1Y8A A;  3RK3 B;  3B71 A;  1KZU B;  1K73 Q;  2ITA A;  2WPR A;  3E1R A;  5AVT B;  5BU5 A;  1EC5 A;  1EZV G;  4HKZ H;  2XKM A;  3I56 P;  1AFO A;  1NAF A;  1Q7Y Q;  4PD4 I;  3NTN A;  5TIS H;  1Q81 Q;  4PV1 B;  1NGM B;  1NVO A;  1NTZ K;  4D6T J;  2V7Q H;  5AW6 B;  2QJK C;  4U3F G;  2B87 B;  2D2C D;  1KC8 Q;  2YMK A;  5KAF E;  1VQK P;  1RF1 A;  2BCC G;  2QJP C;  2XND H;  3LW5 J;  1ZV8 A;  3A0B H;  1HUC A;  2WPV B;  1QX8 A;  3FWL A;  4KHX A;  1K05 A;  1YBK A;  3M91 A;  3MZW B;  5C39 A;  2R5B A;  5AW7 B;  3B5N A;  3L70 D;  1PGP A;  4EI2 A;  1YTZ I;  4I6M C;  1GL2 D;  2J5U A;  3L71 G;  2Y0D A;  4H13 B;  1JY2 O;  3CME P;  2RH0 A;  3WU2 E;  3H1K G;  5KLV K;  5AVV B;  2ZXE B;  2WTY A;  1OVV A;  2BCC E;  4UB6 H;  1GW3 A;  2YIU C;  2WMM A;  4BRY A;  4I7Z B;  2YIU B;  1W2B O;  1RF1 B;  2B9B A;  2ZAE B;  5AW9 B;  2M8R A;  4C7N B;  1MFT A;  3IFM A;  5KAF H;  1HBW A;  3TNU A;  5B5E E;  3RBZ A;  4JQ0 D;  3M9Q A;  2OYO A;  2WSE J;  1AQ5 A;  5APQ A;  1KYO D;  5H2F H;  1RHZ B;  1YJN P;  3F5H A;  3B5N B;  1MZ9 A;  1SQP D;  3MUD A;  3H1K E;  3SFD C;  5AW8 B;  2FKW B;  2XV5 A;  5KLV J;  5B66 E;  3H1J D;  4ZNC A;  3LIE A;  3H1L G;  3HD7 C;  1FS0 E;  1PL5 A;  3L70 E;  4PJ0 H;  5KTB A;  2OTJ P;  1BSH A;  1YIT P;  4BRY B;  1RE3 A;  3WU2 H;  2QSI A;  3HTK A;  1MKM A;  2ZT9 B;  3CCV P;  1RQU A;  1VF5 D;  1NU1 K;  1ZXG A;  1LT1 A;  1USE A;  1U7M A;  1G1J A;  1N73 C;  5B5E H;  2WSF H;  1YYC A;  2Y9Z A;  1QVF O;  2KZI A;  1HWT C;  4XA4 A;  1KYO E;  4D6T G;  3CC4 P;  2NPS C;  1DH3 A;  1OWA A;  1SQP E;  1DX7 A;  5KJ7 A;  1IFN A;  2Y9Y A;  2QEX P;  1URQ A;  5B66 H;  3HD7 D;  5APU A;  4ZMD A;  1T6A A;  2CK3 H;  4HJG H;  3HTK B;  3CCR P;  1FOS E;  2OGU A;  1BE3 J;  1NWQ A;  3L74 G;  3L75 G;  1L0L K;  1NU1 J;  3HE4 A;  4KT0 J;  3M0D A;  3U59 A;  3SWK A;  2RKL A;  1S9K D;  2KIK A;  2A45 G;  5BVZ A;  3E1I A;  2QM7 A;  4OVN F;  1S72 P;  2BEQ D;  3VYI A;  3WUT A;  3VMA A;  1AVY A;  2KSE A;  1Q90 D;  3M06 A;  5AW1 B;  4DZO A;  4JF7 A;  2A06 G;  3A2A A;  1URQ B;  4K35 A;  3A3Y B;  5AVW B;  1J1D C;  4ZKP A;  2SPZ A;  5APW A;  4N3Y B;  2V7Q J;  2H43 A;  3PH0 A;  2IFN A;  3RL0 B;  2B88 A;  2W8Z A;  1LTB C;  3HE4 B;  1DD4 A;  1KYO I;  1SQB K;  2BEZ F;  1L0N E;  1WRG A;  1VQL P;  3Q1M A;  1SQX J;  3T97 A;  1CSB A;  2GA1 A;  1Q2N A;  5AVU B;  2N9Y B;  1EDL A;  4W80 A;  5APV A;  1MV8 A;  2E76 B;  2WPS A;  3CXH E;  3V2N A;  5GTI E;  3L72 E;  4LLH A;  3H1H D;  1NTM J;  1GU4 A;  4H44 B;  1N7S A;  4YXW H;  2Q3E A;  5EFW B;  1N86 A;  3VP9 A;  3WMM 0;  4JPZ B;  1PPJ G;  5L8R J;  3RK2 D;  4WBA A;  2P2U A;  2R44 A;  3GLM A;  4WY4 C;  1FDI A;  1KIL D;  3L35 A;  3HRN A;  3NMD A;  3T97 B;  3E7K A;  2WT7 A;  2Q7C A;  3VMZ A;  1IO4 A;  2Q5U A;  5AVS B;  5CCG A;  3W68 A;  1RQV A;  4OGQ D;  2N1T B;  1VQ9 P;  3MIW A;  4PD4 D;  1BGY J;  1JY2 P;  5GTI H;  1SFC D;  1JNM A;  3C8V A;  2E42 A;  2A45 I;  1N7S B;  3KXD A;  1PPJ E;  1LTJ C;  1NO4 A;  2PGD A;  1M1J A;  4JBZ A;  3HUS C;  3ZDM A;  2XDJ A;  4KJM A;  2I8D A;  4HH2 A;  1AA0 A;  1NKZ B;  4Y99 C;  4XFJ A;  3A0H H;  1BDD A;  3CXH I;  3FX0 A;  2G8Y A;  4ASV A;  2E74 B;  1CW5 A;  1AV1 A;  4H0L D;  3EFG A;  5CBO A;  1PP9 G;  1SQV G;  2WT7 B;  4B86 A;  1AVO A;  2O3J A;  4GKG A;  3V2P A;  1E5W A;  1L0L D;  1KFM A;  2KB7 P;  2OYI A;  5APY A;  3Q5P A;  2JDI H;  2KZJ A;  4IFF A;  3AE1 C;  1D7M A;  4R4M A;  1E79 H;  5AW5 B;  1Z56 A;  3L73 D;  4PD4 E;  3CWB D;  2WSF J;  3KZI H;  1VQ5 P;  1M1J B;  1L2P A;  4YTP C;  3OAK A;  1NTK G;  3TK1 A;  2ZVN B;  1KQF B;  2FYZ A;  1KV4 A;  3Q5R A;  4RKU J;  1M8O B;  1SQV E;  4WB4 A;  1HH0 A;  1U7J A;  1RE4 A;  1X22 A;  2E75 D;  2KSJ A;  4JYC A;  2CPB A;  2WIT A;  5AVX B;  2GUV A;  1P84 E;  3L70 J;  4OWF A;  1J1E C;  2IDB A;  3MP7 B;  1SQP K;  2AXT E;  4WWI A;  2J59 M;  1SQB D;  3AE8 C;  2OYI B;  3H1I G;  5AVZ B;  2YMY A;  1NOH A;  1A02 J;  1FZC C;  1L0L E;  3CCJ P;  1AQT A;  1K04 A;  5APT A;  3P8M C;  3SSU A;  3GF7 A;  4TT3 H;  1NTK E;  5CJ0 A;  3TGU E;  2FXM A;  2HYN A;  4AYC A;  1EZV D;  1NJI Q;  1GL2 A;  3KDP B;  1AJY A;  3L73 E;  4PD4 H;  1BDC A;  3S9O A;  3CWB E;  3RK3 C;  2UWJ E;  4IOI H;  2OTL P;  4W7Z A;  1SQP J;  5AW3 B;  1KQS O;  5DJU B;  1PIX A;  5KAI H;  4PV1 C;  4L73 A;  3H1J J;  5CBN A;  3P32 A;  1SQQ J;  3MHV A;  1SS1 A;  1LTS C;  2R5D A;  3CX5 I;  2ZFC A;  3BCC G;  2AXT H;  2BCC D;  4IL6 H;  3GW6 A;  2E5Y A;  1RH5 B;  3FXE A;  2ZYA A;  1FZB A;  1SQB E;  1BGY G;  1OFC X;  2XZR A;  1RY3 A;  1QLE D;  1VL2 A;  2QRX A;  3GMA A;  3OA7 A;  1BSN A;  3PP5 A;  1L0N K;  1P84 I;  3L4F A;  2R3S A;  3II6 A;  1GL2 B;  1LNQ A;  1OW7 A;  1S3J A;  2OAR A;  1KQL A;  4RO0 A;  4AQR D;  2YXQ B;  1EZV E;  1GK6 A;  4C7N A;  1OW8 A;  4ZKU A;  5AVQ B;  4EDF A;  3RK3 D;  3L71 D;  1HGV A;  2H88 C;  3H1K D;  2OQQ A;  2W6B A;  1FJK A;  1S5L E;  1NTZ J;  1KQG B;  3JC2 2;  2M5A A;  2K3R A;  2JKV A;  4H13 C;  4I1L A;  5KKZ B;  4U3F E;  3G71 P;  4LGD E;  2KLU A;  2Z5H A;  1FZE A;  3EWK A;  4I7Z C;  1RF1 C;  2KYV A;  4TLF A;  1JB0 J;  4BXL A;  4L76 A;  3M0A A;  3Q3D A;  3AE4 C;  1X79 B;  4EIJ A;  4MN4 C;  3S4R A;  2LXB A;  1BCC G;  1R5L A;  2N9B A;  3AEG C;  1VQO P;  2E43 A;  3GG2 A;  3H1L D;  1HF9 A;  1NH4 A;  3RK3 E;  3B5N C;  3IR9 A;  3L71 E;  1VPC A;  4YPC A;  2M5A B;  1T2K C;  1VF5 B;  2FY8 A;  3CCQ P;  3WUV A;  2AEJ A;  1EZV I;  1M56 D;  2P7J A;  2C9N Y;  2WVR A;  2FYU G;  1WMK A;  1L4A A;  1FZF A;  3GHG A;  1GDT A;  1FZA A;  4EOT A;  3NFQ A;  3CCL P;  2O01 H;  2Q1K A;  2ZT9 C;  1HVV A;  2C9L Y;  1IK7 A;  4D6T D;  3K5B A;  1EDK A;  2FFD A;  1JY2 N;  3H1H J;  3VMY A;  4NPE A;  3MUD C;  1JM0 A;  1ZOY C;  2W90 A;  1SQQ G;  1FBM A;  4R4L A;  3O8Z A;  3H1L E;  4LC1 A;  3B5N D;  1S4X A;  1T2K D;  2HR3 A;  1SQV K;  2AEF A;  2HG5 D;  2L91 A;  3L74 D;  3L75 D;  4DOJ A;  1RE3 C;  2KK7 A;  1L4A B;  3GHG C;  3RBX A;  3GHG B;  4C46 A;  3AE3 C;  3CC7 P;  1L0N D;  3I55 P;  3MD0 A;  3G4S P;  2M3E A;  4W7Y A;  5CJ4 A;  2QG4 A;  5KLI B;  2JP3 A;  1X0T A;  1R5S A;  2ZT9 D;  3CXH D;  2FFD B;  3L72 D;  3USS A;  1NTK K;  3FGA D;  1T8Z A;  4I2L C;  1NTZ G;  1N2D C;  1ZR4 A;  1JCD A;  2POH A;  4D6T E;  1KIL A;  3P8C D;  1NAY A;  1RF0 A;  5KJ7 C;  3L36 A;  5AW2 B;  3TF5 A;  2FXP A;  4C7R A;  1URQ C;  1KTM A;  5CCH A;  2NPS D;  1UII A;  1KYO H;  2YKQ A;  1IZN B;  4IFD K;  3L74 E;  1IJD B;  2WSC H;  2YKO A;  3L75 E;  3KYQ A;  2FBW C;  3IAO A;  3RL0 C;  3BAT A;  3VN0 A;  1DEB A;  1G2C A;  1L0L J;  3BRT B;  2I1J A;  2H7H A;  4HYT B;  3M0D C;  2I1K A;  2K88 A;  1ZN5 A;  2QVA A;  1S2E A;  1GU5 A;  3R4Y A;  1PGQ A;  1GMJ A;  3RK2 B;  1NKN A;  2E76 C;  5E79 E;  1FU1 A;  4ASW A;  1JY3 O;  1KIL B;  2N1T A;  2G3A A;  1YTZ T;  2A06 E;  1PPJ D;  3ABV C;  5KLV G;  4H44 C;  1DIP A;  1VQP P;  4OGQ B; 
#chains in the Genus database with same CATH homology
 1M1J B;  3TNU B;  3BVH A;  2KOG A;  3OAK A;  1ZV8 A;  4M3L A;  1HUC A;  3P8C E;  3TK1 A;  2FYZ A;  3N7N A;  4KHX A;  3H32 A;  2J58 A;  4WB4 A;  1HH0 A;  1OXZ A;  1RE4 A;  1L4A C;  2KSJ A;  4JYC A;  2CPB A;  2WIT A;  1G2C B;  5AVX B;  1N73 B;  1LTT C;  2GM4 A;  2YO3 A;  2GUV A;  3M91 A;  2R5B A;  1J1E C;  5AW7 B;  1XTG B;  1SQP K;  3RL0 D;  1FZG A;  3B5N A;  2KP8 A;  2J59 M;  2NPS B;  3CL3 D;  3N4X A;  1GZL A;  3CLQ A;  1YTZ I;  2OYI B;  4I6M C;  1GL2 D;  1LWU A;  5AW4 B;  2OYH A;  1JY2 O;  5AVZ B;  3TYY A;  2YMY A;  1A02 F;  4N6J A;  2QM8 A;  2N1T C;  1NOH A;  5KLV K;  1A02 J;  1FZC C;  5AVV B;  2FFD C;  2A45 H;  5CMZ A;  2ZXE B;  3UIA A;  2WTY A;  1GW3 A;  1IK9 A;  1JTH A;  5APT A;  2Q3I A;  3P8M C;  3U1C A;  1GW4 A;  1RF1 B;  2C0X A;  1X8Y A;  5CJ0 A;  3M9B A;  2FXM A;  2HYN A;  5AW9 B;  4AYC A;  2M8R A;  1H89 A;  5APS A;  2YO2 A;  4C7N B;  1GL2 A;  1JOC A;  1N7S C;  3KDP B;  1QL1 A;  3IFM A;  3H32 B;  1HBW A;  3RK3 C;  1SQX K;  3TNU A;  1W2E A;  4RES B;  1IFD A;  2JJL A;  1H8A A;  2YNY A;  4W7Z A;  2C0W A;  3M9Q A;  1GTW A;  4GIF A;  1AQ5 A;  5APQ A;  5AW3 B;  2BAS A;  1SVF A;  1L4A D;  3B5N B;  1MZ9 A;  1SFC A;  3MUD A;  1ZLL A;  2R3C A;  3VTP C;  1NTM K;  2FKW B;  1LWU B;  3P32 A;  5AW8 B;  2OYH B;  2WPQ A;  2XV5 A;  5CCG C;  1LTI C;  1LTS C;  3A5T A;  4WY4 D;  2R5D A;  3LIE A;  2GUS A;  2ZFC A;  3RK2 C;  3HD7 C;  1KFN A;  1J1D B;  2JEE A;  5KTB A;  1JTH B;  1FZB A;  2WWW A;  3V2Q A;  5AVR B;  4OH8 B;  2XZR A;  1RY3 A;  3CI9 A;  1KIL C;  1RE3 A;  1LT9 A;  1N7L A;  2IFM A;  4O9B A;  2VRS A;  1MUU A;  3OA7 A;  3PP5 A;  1L0N K;  3HTK A;  1RF0 C;  3L4F A;  3II6 A;  1GL2 B;  2PP6 A;  2OAR A;  1CI6 A;  1KQL A;  4WY4 A;  1M1J C;  3BAS A;  3BRV B;  4AQR D;  5CCH C;  1N7S D;  1GK6 A;  1NU1 K;  4C7N A;  4ZKU A;  5KJ7 D;  1HJB A;  5AVQ B;  3RK3 D;  3SWY A;  1URQ D;  1HGV A;  1SFC C;  1S9K E;  1G1J A;  3L37 A;  1N73 C;  1SFC B;  2WSF H;  3V2R A;  5APX A;  1CZQ A;  1YYC A;  2W6B A;  2HFE D;  1FJK A;  2HOD A;  1HWT C;  1HGZ A;  4XA4 A;  1SLQ A;  3LW5 H;  2NPS C;  1J2J B;  1IFM A;  2LKM A;  2OYI C;  1OWA A;  1DH3 A;  4I1L A;  1DX7 A;  1GK4 A;  5KJ7 A;  1IFN A;  1LTJ A;  3HUS A;  1URQ A;  1LT9 B;  4LGD E;  3HD7 D;  1SP4 A;  5APU A;  2Z5H A;  1FZE A;  3HE5 A;  5CHX A;  3M9H A;  3HTK B;  1FOS E;  1RF1 C;  3U1A A;  2KYV A;  1CI6 B;  2W6A A;  3R2P A;  4WY4 B;  3M0A A;  3I5C A;  1NWQ A;  2Q9I A;  1L0L K;  3HE4 A;  3M0D A;  3U59 A;  2PAJ A;  1X79 B;  2XNX A;  4EIJ A;  5CCH D;  1RE4 C;  4AUW A;  1S9K D;  2A45 G;  5BVZ A;  3E1I A;  2N9B A;  2QM7 A;  2E43 A;  3A7O A;  3VYI A;  2H8P D;  1EQ7 A;  2HOD B;  5BU8 B;  3NXS A;  4XE5 B;  3V5B A;  1NH4 A;  3B5N C;  3IR9 A;  1VPC A;  1T2K C;  1JY3 N;  3M06 A;  1LWU C;  2OYH C;  3MTU E;  4N78 D;  5AW1 B;  4DZO A;  4JF7 A;  1FOS F;  1LTJ B;  2KLV A;  3MGN A;  3A2A A;  2CPS A;  3HUS B;  1URQ B;  3A3Y B;  5AVW B;  1J1D C;  3VOP A;  4Y99 B;  3HE5 B;  4ZKP A;  2P7J A;  5APW A;  2WSE H;  4N3Y B;  2C9N Y;  2P67 A;  1JO5 A;  2H43 A;  2N1T D;  3OJA B;  1L4A A;  2IFN A;  4GT1 A;  3RL0 B;  3VMX A;  1FZF A;  3GHG A;  3P7K A;  1GDT A;  1LTB C;  1GL2 C;  3HE4 B;  3C9I A;  1FZA A;  5AW0 B;  4EOT A;  3NFQ A;  2O01 H;  4JYB A;  1SQB K;  3B8E B;  1WRG A;  3V4Q A;  3SWF A;  3T97 A;  1CSB A;  1ZR2 A;  2O1K A;  4IFM A;  1HVV A;  5AVU B;  2IPP A;  2C9L Y;  4W80 A;  5APV A;  1JUN A;  1LTA C;  1MV8 A;  1QL2 A;  1IFI A;  2WPS A;  3VP8 A;  3V2N A;  1FZC A;  2FFD A;  1JY2 N;  1WT6 A;  3VMY A;  2P1J A;  1PFI A;  4LLH A;  3V4W A;  3EQ2 A;  2O1J A;  1FBM A;  1GU4 A;  3O8Z A;  1T3J A;  4LC1 A;  3B5N D;  3KQG A;  2FYU K;  1HTL C;  1T2K D;  1SQV K;  1JY3 P;  2HG5 D;  1N7S A;  1N86 A;  4DOJ A;  5CCG D;  3VP9 A;  3WMM 0;  1RE3 C;  4N78 E;  1LT9 C;  1L4A B;  3GHG C;  3RK2 D;  3GHG B;  2HPC A;  4C46 A;  1GD2 E;  4WBA A;  2IX7 C;  1J1E B;  2P2U A;  4WY4 C;  1KIL D;  3MD0 A;  3L35 A;  3HRN A;  3NMD A;  4W7Y A;  5CJ4 A;  2Z5I A;  2WT7 A;  1FJP A;  1LGH B;  1XTC C;  3TSI A;  1X9V A;  2YKP A;  2Q7C A;  3VMZ A;  1MFZ A;  1IO4 A;  1SQQ K;  2Q5U A;  5AVS B;  5CCG A;  3LID A;  2N1T B;  1FZC B;  2FFD B;  2W27 A;  2MJZ A;  3HD7 A;  3MIW A;  1NTK K;  2WZ7 A;  1T8Z A;  4I2L C;  1N2D C;  1ZR4 A;  1JCD A;  2POH A;  2Z4E A;  1T3U A;  1KIL A;  1NHL A;  2R32 A;  1JY2 P;  1SFC D;  1IFJ A;  3P8C D;  2L5G B;  1JNM A;  1FDM A;  2E42 A;  1RF0 A;  1FAV A;  2A45 I;  1N7S B;  5KJ7 C;  3L36 A;  5AW2 B;  1H88 A;  1LTJ C;  1NO4 A;  2M3B A;  4C7R A;  1M1J A;  3HUS C;  1URQ C;  5CCH A;  3RK3 B;  2XDJ A;  2NPS D;  4HH2 A;  1KZU B;  1NKZ B;  4Y99 C;  5AVY B;  2HLO A;  2YKQ A;  2WPR A;  5AVT B;  5BU5 A;  2HPC B;  1LTG C;  3KPE A;  4IFD K;  1G1I A;  1IJD B;  2XKM A;  2WSC H;  2YKO A;  1CW5 A;  1AFO A;  1NAF A;  3KYQ A;  3EFG A;  3RL0 C;  3BAT A;  3NTN A;  3VN0 A;  1DEB A;  1G2C A;  1N73 A;  3BRT B;  4B86 A;  1JMM A;  2I1J A;  2WT7 B;  1M7L A;  2H7H A;  4HYT B;  3M0D C;  4GKG A;  3V2P A;  1E5W A;  2I1K A;  1ZN5 A;  1NTZ K;  1GU5 A;  3H6P A;  2NPS A;  1KFM A;  2KB7 P;  3RK2 B;  1NKN A;  3HD7 B;  2OYI A;  5APY A;  4IFF A;  5AW6 B;  1FU1 A;  1JY3 O;  1KIL B;  2N1T A;  5AW5 B;  3G3Z A;  1Z56 A;  1YTZ T;  1IC2 A;  1VDF A;  1RF1 A;  1JCC A;  2XU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...