1G1JA

Crystal structure of the oligomerization domain from rotavirus nsp4
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
43
structure length
43
Chain Sequence
IEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL GLYCOPROTEIN NSP4
publication title Crystal structure of the oligomerization domain of NSP4 from rotavirus reveals a core metal-binding site.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 18
structure length 43
sequence length 43
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.430 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1g1jA00
2WITA 4HH2A 4C7RA 1G1IA 1G1JA 4WB4A 4DOJA 4WBAA 3MIWA 2O1JA 3CI9A 2L5GB 2O1KA 4LLHA
chains in the Genus database with same CATH superfamily
2GUVA 1JCDA 3PHLA 3FX0A 1NWQA 1U7MA 1JM0A 1YIJP 3B4SA 4U3FG 1QVFO 2IFNA 3IAOA 3CX5E 3L72J 1PPJG 5AW7B 1DEEG 1L0NG 3RL0B 3L70E 2HPCB 1NTZJ 2QIWA 1BCCJ 3AEAC 3E7KA 3A0BE 1LTBC 3L4FA 3Q1MA 3MTUE 3U1AA 4YXDC 3RBXA 1S5LX 2E76C 2FXMA 3OAKA 3TF5A 1K8AQ 1KILE 5APTA 2V4HA 4DOJA 3CCMP 1LWUB 2A06G 2KUBA 2KOGA 5AVZB 2IBZE 1FZCC 4PJ0H 3G4SP 2SPZA 3AEBC 3R4YA 2Q9IA 1A02J 4C46A 2Q5UA 1KQSO 2FYUD 1N7SC 3VMYA 3HUSC 1BGYE 3KHUA 1IZNB 2KSJA 2KP8A 2Y0CA 2XDJA 2AEMA 2OYHB 3FGAD 4ZKUA 2M0BA 4WBAA 5AVTB 1FS0E 2K9JA 4D6TD 1U57A 2FY8A 3H1IE 1FZCA 3TGUD 1S5LH 4N6JA 2ZAEB 1PGJA 1SQPE 3V4QA 1L2PA 2CPSA 2KS1B 1N7SA 3JCUE 3HUSA 3Q2YA 4OH8B 2ZFCA 3M0DC 3TNUB 1L0NJ 2OQQA 3CD6P 1BSHA 2KYVA 2ZJSE 2OTJP 1X9VA 2KB7P 3KYQA 3CX5H 3CC2P 4QMAA 4ZKPA 2BCCG 1EZVD 3L72D 1SQPK 1NTZD 4WY4D 1AQ5A 2YO3A 1NO4A 2FYUE 1IFDA 3A0BH 1T2KC 1BCCD 5AVRB 1GZLA 5TISE 1YJ9P 1Q81Q 2LR2A 2NZ2A 1VQ9P 5CMZA 3CXHE 3M0DA 3CCQP 1R5LA 1SQXJ 3RK3D 2XNDH 3H1LE 2YNYA 1UIIA 1FZAA 2FYUK 4GODA 1MUUA 3L37A 2E42A 2J5UA 5KLVD 1KN7A 2W6BA 3AE4C 4TLFA 1LGHB 1VF5B 1ZP0C 3U59A 3A0HE 5AVQB 3RL0g 1KQGB 1JMMA 1BSNA 5B5EE 1M1KQ 1M57D 3GF3A 1JUNA 3E1RA 4YPCA 2QJYB 5AW2B 1EZVE 3L72E 1S2EA 3HD7C 1BE3G 1PZQA 3AEEC 1NTZE 2M5AA 3JCUH 1BCCE 1RF0C 2GM4A 1ZMEC 5AW3B 2FXOA 2P7JA 2WSSH 1DX7A 5AW0B 1L0ND 2E5TA 1VQ7P 1TU3F 1Q86Q 3CCVP 1YHQP 3AE6C 3I56P 3RK3C 2WPSA 2IYPA 2Y9ZA 3L70G 1NTZK 5AW8B 1UIXA 2IDBA 3HD7A 3PH0A 5TISH 4GT1A 3O8ZA 1GL2B 3P8MC 2A06D 4TT3H 4HJGH 1RF0A 5AVVB 2UWJE 3CXHH 2YKOA 1SVFA 4GIFA 1VQOP 1L4AC 2R3SA 2H43A 3GHGB 1SQXD 2W83C 1Q7YQ 1JY2O 2E75C 1EQ7A 4WB4A 1NVOA 2IBZG 4H44D 1KB9D 1SQVE 4LC1A 3SWYA 4RO0A 4I7ZB 1R5SA 2WMMA 2WSFJ 1BGYG 2JP3A 2P1JA 2WSCH 1AV1A 1ZR2A 2O1JA 2HG5D 1ZW0A 1HTLC 3L35A 1LTTC 3A0HH 3A2AA 1G1IA 2IBZI 2KK7A 4IFDK 1GU5A 1OW8A 2YKQA 1L4AA 1SQVK 4Y28J 3AE3C 4KHXA 5B5EH 1PGOA 1JTHA 1FBMA 3H1IG 2AXCA 2C0WA 2ZXEB 3MD0A 1Q82Q 4C7NA 2QA4P 1JO5A 1QGKB 1OW7A 1JY2N 5M1BA 3M9HA 2OYIB 1NU1E 2W90A 1AQTA 3RBZA 5KLIB 3SSUA 1W2BO 3FWNA 5CCHC 1N86A 3N7NA 3L70J 2BCCD 1QLED 1DD3A 1SQXE 3V2NA 1KB9E 1KQFB 4H44C 1T6AA 1OVVA 1NU1K 2FYUG 1OWAA 2ZT9D 1KYOE 1VQLP 2M5AB 1VQ5P 1NKZB 3CCUP 1SQQJ 3USSA 2KXPB 3Q5PA 5CCHA 1SQXK 2KSEA 3CMEP 3RK2C 2QJPB 3H6PA 3QH9A 2JKVA 1BGYJ 3H1LG 4BRYA 2B88A 4H13D 3WUVA 2PAJA 4K3AA 3HD7B 1M90Q 3CPWO 3AE1C 3H32A 2KZIA 3WUUA 5AVWB 1FZEA 2J58A 2R44A 4OVNF 1LNQA 3CCSP 4H0LB 3JC22 1SQPJ 2R5DA 3VMXA 3BRTB 3C1LA 1T8ZA 1EZVG 3L72G 3V4WA 1E79H 1NTZG 1LTJC 3GLMA 1BCCG 2Z5IA 4KJMA 1L0LK 2Q1KA 3MGNA 1HH0A 2MKVA 3L70D 1EXIA 1IK9A 1EZVI 1FDIA 3H1KE 5K5GB 2E75B 1HBWA 1KB9H 5AW6B 1X8YA 1J1DB 1RHZB 2Y0DA 3PP5A 4GOEA 1AVOA 1LTJA 3H1LJ 1NYHA 2E74B 3C8VA 2HLOA 2P2UA 1JY3O 1P84D 1SQQD 2GA1A 5DJTB 2YO2A 3B5NB 1USDA 1URQC 1CSBA 2WT7B 1BGYD 1SQVG 1RE3C 1SQBJ 2YKPA 3G3ZA 1HJ0A 1USEA 3GW6A 3WU2E 1AVYA 2OARA 1X22A 1N73B 2ZVOB 3H1ID 2ZYDA 1KTMA 3A5TA 2V7QJ 2HODB 5E79E 4NPDA 2JWDA 1SQPD 1URQA 1KC8Q 1HUCA 1H0TB 1JY3N 1RE3A 2B89A 2YXQB 1NU1G 2O3JA 2IFMA 1KILC 3MUDC 3H1JJ 1KFNA 1P84E 3G71P 1FOSF 1SQQE 3T97A 1MKMA 2QG4A 1SQXG 2QM7A 3L75J 3HE5B 3A7OA 1T3UA 4AUWA 1H8AA 4HKZH 2M3BA 3CXHD 2KLUA 4JF7A 1FU1A 2O1KA 1JB0J 2NPSD 2YIUB 5KJ7C 2WSFH 1LT9C 1YJNP 1SQQK 1OX3A 3D70A 3PJSK 1SQVJ 3H1LD 1MFZA 2KNCB 1KILA 3MUDA 2C9LY 1J1EC 2FYNB 4JYCA 1KB9I 3VN0A 2D2CB 2Q3IA 1WMKA 2JO1A 1D7MA 1SQBD 3M0AA 1ZOYC 2IZ0A 2N1TB 4L74A 1VQPP 1LP1A 3WU2H 4EYYQ 5KJ7A 3HTKB 4PV1D 1HGVA 1LT9A 3CCRP 5GTIE 4GOFA 4O9BA 2QEXP 4OGQB 3AEFC 5AVYB 1GW4A 1FJPA 2G3AA 2ZYAA 1NHLA 2QM8A 5L8RJ 1NU1J 3L36A 3GG2A 2JJLA 3AEDC 2B87A 1RF1B 1NGMB 5APWA 3L71J 2M3EA 1Q90D 1N7LA 3FXDA 4M3LA 1FE6A 2DW3A 1RE4C 1XTCC 2FKWB 2XV5A 1P84H 2NPSC 2YXRB 3KDPB 3E1IA 1S3JA 2KLVA 1KV4A 1Z56A 3VOPA 4PD4D 3H1KG 1G2CA 1JCCA 3CI9A 3L75D 5GTHE 2QJKC 1JOCA 3AE7C 2PGDA 1SQBE 1OVUA 3P8CE 3VMAA 5CBNA 1R8EA 3L74J 2M8RA 2YMKA 4Y99C 2ITAA 2BEQD 4JYBA 1RE4A 1SQVD 1ZRTD 4YXWH 2O01J 3MIWA 2NPSA 4PV1C 1YTZT 4RJTA 5AW5B 3KZIE 3LIDA 1ZLLA 2L91A 1SQBK 3AE8C 3IFMA 2JDIH 3H1HE 3ITKA 3AE2C 4WY4C 1EDLA 1VQ8P 1L0LJ 3BVHA 4IL6E 2E76B 1PGPA 3OJAB 4EDFA 1LTGC 3EFGA 2A45G 1FJKA 1PFIA 2K9JB 3O6QA 5GTIH 3CCJP 1N2DC 4U7JA 3D71A 1SFCD 1LTSC 3B5ND 1JY2P 3NFQA 1FZCB 3H1JE 1S1CX 3SFDC 1Y8AA 4PD4E 2WPQA 1CI6A 3CCLP 3N4XA 1NU1D 1ZXGA 2OYOA 3L75E 1N7SB 5AW4B 3HUSB 1Q2NA 1FZGA 5KKZC 4WY4A 1M1JC 1PL5A 1LP1B 3L71D 1EXJA 1K04A 3CX5I 3H1KJ 1RQUA 2B9BA 4IL6X 3RL0D 1SQQG 1ZRTE 1JMBA 1FDOA 1KD1Q 3BCCJ 1GK4A 2XZRA 2WQYC 3BATA 1KYOD 2W27A 3BASA 4AQRD 1K9MQ 1KQLA 2I8DA 4AYCA 1IJDB 1J2JB 4OWFA 4EIJA 3CWBJ 2FXPA 4DT0A 1M1JA 4XA4A 3G6EP 1AA0A 2ZVNB 5KAIE 3AECC 2H88C 1SFCC 1G2CB 2C0XA 4CPGA 1SQPG 2V7QH 3WUTA 3V2RA 2IYOA 2KI7B 3S1KA 1ZV8A 4LLHA 1MV8A 2KIKA 3OA7A 4IL6H 1L0LD 3L71E 4ASWA 5BVZA 5CCGD 2IPPA 2D2CD 3VP9A 2QRXA 5CJ0A 3RL0C 1GMJA 1YQ3C 4PD4H 1QVGO 1SFCA 3HE4A 1H88A 3MZWB 1YJWP 1VPCA 3II6A 2WWWA 3K5BA 4XFJA 2OTLP 4R4MA 2Z4EA 3L74E 1FAVA 4N3YB 3H1KD 1LWUC 4OGQD 3CMAP 1LT1A 1PP9J 3W68A 1K05A 4W7YA 2XNXA 1S72P 3L73J 1YBKA 3BCCD 3G9RA 4L73A 2HPCA 2AEFA 3CXHI 1OIPA 1SQBG 3VYIA 3W67A 4Z1MH 1K73Q 4XE5B 1GDTA 1L0LE 1FDMA 1VQMP 2OYHC 5B66E 3IF4A 3CC4P 2K37A 1LWUA 5KAIH 1NJIQ 1CZQA 5CCGC 2AXTE 3RK3B 1NTME 2RKLA 1JEKA 3H1HG 2QE7H 3TYYA 1VF5D 3NTNA 3OW2O 3JSVC 5KTBA 3EFFK 2ZT9C 1WRGA 1XTGB 1QX8A 1JY3P 1L4AB 2OYHA 3SFEC 3AEGC 1JTHB 1YYCA 2FYZA 1NAFA 3H1JG 4K35A 1NTMK 1AFOA 5H2FE 1FZBA 2OGUA 5AVSB 3FXEA 5AW1B 5CCGA 1Y47A 3BCCE 4C7NB 2LKMA 1KYOH 1PIXA 3L75G 4H13C 3ABVC 3Q5SA 1OFCX 2KS1A 2ZYGA 3LW5J 3F89A 2Y0EA 3TNUA 2HR3A 1EC5A 1DIPA 3CWBE 1VQ4P 5APYA 4ZNCA 4PD4I 1SLQA 1PP9D 2O01H 3L73D 1N7SD 1GL2D 1S5LE 3I55P 2AEJA 2RN0A 2Q7CA 1BDDA 4RESB 1VF5C 4YTPC 1H89A 4C7RA 5B66H 2RH0A 4LGDE 2LXBA 3B8EB 5CBOA 1ZR4A 2PFXA 3UIAA 4BRYB 3H1HJ 2POHA 3CL3D 1RH5B 2AXTH 2CK3H 2QJYC 2VRSA 4H44B 2K1AA 1HJBA 2ZXXA 3TSIA 4DZOA 1M7LA 1VQKP 3H32B 4WVZA 1NTKJ 3L71G 1OVRA 2RMZA 3V2PA 1FZFA 3RK2B 2K3RA 1GD2E 2O01N 4GDOA 1A02F 2C9NY 2H8PD 2N9YB 5H2FH 1PP9E 3QWOC 2W6JH 1S9KD 3L73E 4MN4C 2W6AA 1T2KD 1HGZA 1GTWA 5KLVJ 1GL2C 4DCKA 3IR9A 4IOIH 3L74G 3D6ZA 3A3YB 3GHGC 3CCEP 2NRGA 1FC2C 1ZN5A 2XU6A 3PTZA 5C39A 1KYOI 2IZ1A 1M56D 3P8CD 4I7ZC 2GUSA 1T3JA 5APSA 3V6IA 1LTJB 1VQ6P 3LIEA 2A45H 3ZDMA 3V2QA 5TJHA 4U3FJ 1L0LG 2ZT9B 1GL2A 2Z5HA 2MJZA 5CJ4A 2FBWC 3S4RA 3IN6A 5E79H 3VP8A 4B86A 3GHGA 5CHXA 3H1HD 3GF7A 2H89C 2CPBA 3HD7D 3MP7B 1NTMG 4IFFA 1S9KE 1U7JA 3FWLA 4EI2A 1YITP 2Q6QA 2WSEJ 1HVVA 4I1LA 2QSIA 4H13B 2OYIC 3Q3DA 5KLIC 4H0LD 3H1JD 1NTKD 3PRJA 3AE9C 1GK6A 5AVUB 1URQB 1RY3A 2R5BA 4D6TE 3BCCG 3RGUA 3TGUE 4IFMA 1EDJA 2OYIA 4RKUJ 3T97B 1L4AD 2FFDC 3NXSA 3CWBG 2E75D 2QJPC 1N8RQ 1IFNA 1IK7A 4W7ZA 1RQVA 1BDCA 1X79B 3AE5C 1X0TA 4A7PA 3PLNA 1MFTA 2BEZF 2I1JA 2E74D 2JWAA 2BASA 2WZ7A 4NPFX 1VDFA 4BXLA 1KMIZ 4I2LC 1W2EA 1KFMA 1LJ2A 1KILB 3KPEA 3U1CA 4U3FD 1NTMJ 1NTKE 2FFDA 2BCCJ 3EWKA 1PPJD 4H0LC 1IFPA 3M06A 1CW5A 4WWIA 3RK3E 1QL1A 1DEBA 4KT0J 1YI2P 1FOSE 3M9QA 2A45I 5BU8B 4DJGA 1HF9A 2HFED 1HWTC 5CCHD 1PV3A 1LT9B 3TK1A 1NTKK 5KLVE 1AJYA 2P58A 3LW5H 1PGQA 1J1EB 5APVA 1NAYA 2K88A 5GTHH 2B87B 1PP9G 1M8OB 4I6MC 3L73G 4EOTA 1LTIC 1J1DC 1S4XA 1NH4A 1MZ9A 4HB1A 1P84I 1WT6A 1JNMA 3L74D 5KLVK 2E74C 2WVRA 2E43A 5AVXB 1Y9BA 2KZJA 3RK2D 3GMAA 4U3FE 1GW3A 3P32A 3KQGA 3KZIH 1PPJE 3B5NC 1BE3J 1IC2A 1L0NE 4GKGA 4UB8E 5BU5A 1E5WA 3M9BA 1IFIA 2R3CA 3B71A 4JQ0D 5APUA 1GU4A 1N73C 1OW6A 2A06E 3WMM0 2NPSB 1L0NK 2WPVB 1NTMD 3S9OA 4JBZA 2JR8A 3M91A 3B5NA 1EDKA 3BRVB 2N1TD 5EFWB 2WT7A 4HH2A 1SS1A 2QJKB 1DD4A 3P7KA 5KAFE 2I1KA 4UB6E 1NKNA 2WITA 2PP6A 2OTKE 1DH3A 4BWNA 2W8ZA 3O6QB 4Y99B 1EDIA 4ASVA 1OZHA 3C9IA 1N73A 2FFDB 5APQA 4PV1B 1CI6B 1W5CE 2PRRA 1OMIA 2HODA 4D6TG 2Q3EA 4WY4B 1H0TA 3TGUG 3Q5RA 3NMDA 3VTPC 1LTAC 3CWBD 2YIUC 2Y9YA 3H25A 5AW9B 3KXDA 3EQ2A 3H1IJ 2H7HA 1URQD 2FYNC 1SP4A 2D2CC 2XKMA 5APXA 2G8YA 1QEXA 2BCCE 3I5CA 2QVAA 4UB8H 1BE3D 3F5HA 1NOHA 2N9BA 3HE5A 4R4LA 2L5GB 3TDKA 2HYNA 4JPZB 1G1JA 4N78D 2N1TC 5KKZB 3MHVA 1M1JB 2WSEH 4HYTB 1KORA 2K9YA 1NTKG 2JEEA 1OXZA 2KNCA 3CX5D 4OGQC 2LXCB 1QL2A 4PJ0E 3SWFA 3VMZA 3CLQA 2FYUJ 1VL2A 2J59M 3CC7P 2E76D 1RF1C 2WPRA 1VQNP 2IX7C 4W80A 3HRNA 3V5BA 5KAFH 4UB6H 2E5YA 2N1TA 1IFMA 1KILD 3SWKA 5KLVG 1KZUB 4NPEA 2P67A 4ZMDA 3HTKA 4D6TJ 5DJUB 2IBZD 2WTYA 3D6YA 1YQ4C 4L76A 3TGUJ 2P10A 1SFCB 2YMYA 3HE4B 1YTZI 1IO4A 1BE3E 1IFJA 2WSCJ 3R2PA 1RF1A 2R32A 4L75A 4N78E 5KJ7D
chains in the Genus database with same CATH topology
3GHGA 5CHXA 2GUVA 1M1JC 1JCDA 2CPBA 3HD7D 1NWQA 4IFFA 1S9KE 3RL0D 2PAJA 2IFNA 3HD7B 1HVVA 4I1LA 2OYIC 1GK4A 5AW7B 2XZRA 3RL0B 2HPCB 3BATA 2W27A 3BASA 3H32A 4AQRD 1KQLA 5AVWB 1FZEA 2J58A 4AYCA 1LTBC 3L4FA 3MTUE 3U1AA 1IJDB 1GK6A 5AVUB 1URQB 1J2JB 1RY3A 2FXMA 4EIJA 3OAKA 2R5BA 2R5DA 3VMXA 3BRTB 1T8ZA 5APTA 1M1JA 4XA4A 4DOJA 5KJ7D 3V4WA 1LWUB 4IFMA 2KOGA 5AVZB 1LTJC 1FZCC 2Z5IA 2OYIA 2Q9IA 1L0LK 1SFCC 1G2CB 2C0XA 3MGNA 1A02J 1L4AD 2FFDC 4C46A 3V2RA 2Q5UA 3NXSA 1N7SC 3VMYA 1HH0A 3HUSC 1ZV8A 2KSJA 4LLHA 1MV8A 2KP8A 1IK9A 3OA7A 1IFNA 2XDJA 1HBWA 5AW6B 4W7ZA 2OYHB 4B86A 1X79B 5BVZA 1X8YA 5CCGD 1J1DB 2I1JA 2BASA 4ZKUA 2IPPA 2WZ7A 4WBAA 5AVTB 1VDFA 3VP9A 3PP5A 1LTJA 4I2LC 1W2EA 5CJ0A 3RL0C 1FZCA 1KFMA 3KPEA 1KILB 2HLOA 2P2UA 1JY3O 3U1CA 4N6JA 1SFCA 3HE4A 1H88A 2FFDA 3V4QA 2CPSA 1N7SA 3HUSA 2YO2A 3B5NB 1CW5A 3M06A 1URQC 4OH8B 2ZFCA 3M0DC 1CSBA 1QL1A 1DEBA 1VPCA 3II6A 2WWWA 3TNUB 2WT7B 1RE3C 2YKPA 2Z4EA 1FOSE 1FAVA 3G3ZA 3M9QA 4N3YB 2A45I 1LWUC 2KYVA 5BU8B 1X9VA 4W7YA 2KB7P 2XNXA 3KYQA 2HFED 1HWTC 4ZKPA 5CCHD 1LT9B 3TK1A 2OARA 1NTKK 1SQPK 1N73B 2HPCA 4WY4D 1AQ5A 2YO3A 3LW5H 1NO4A 5APVA 1J1EB 1IFDA 1T2KC 5AVRB 1GZLA 3VYIA 3A5TA 4XE5B 2HODB 1GDTA 1FDMA 1URQA 4I6MC 5CMZA 2OYHC 3M0DA 1HUCA 1JY3N 1RE3A 4EOTA 1LTIC 1J1DC 3RK3D 1NH4A 1MZ9A 1LWUA 1WT6A 1JNMA 2YNYA 5KLVK 1CZQA 5CCGC 3RK3B 1FZAA 2E43A 5AVXB 2IFMA 1KILC 2FYUK 1MUUA 3L37A 3RK2D 1KFNA 2E42A 1FOSF 3T97A 3TYYA 3NTNA 1GW3A 3P32A 5KTBA 3KQGA 2W6BA 3B5NC 1WRGA 1IC2A 2QM7A 1LGHB 4GKGA 1XTGB 3HE5B 3A7OA 3U59A 1T3UA 1JY3P 5AVQB 5BU5A 1E5WA 3M9BA 4AUWA 1L4AB 1IFIA 1H8AA 2OYHA 2R3CA 1JTHB 1YYCA 2M3BA 1JMMA 2FYZA 4JF7A 1NAFA 1FU1A 1JUNA 1NTMK 2O1KA 5APUA 1AFOA 2NPSD 5KJ7C 1FZBA 2WSFH 1LT9C 5AVSB 1SQQK 5AW2B 5AW1B 5CCGA 1GU4A 4C7NB 1N73C 3HD7C 2LKMA 1MFZA 1KILA 3WMM0 2NPSB 3MUDA 2C9LY 1J1EC 1L0NK 4JYCA 3VN0A 2Q3IA 1RF0C 3M91A 2GM4A 5AW3B 3B5NA 3BRVB 2N1TD 2P7JA 2WT7A 3TNUA 1DX7A 4HH2A 5AW0B 3M0AA 5APYA 3P7KA 2N1TB 2I1KA 1SLQA 1NKNA 2WITA 2PP6A 3RK3C 2WPSA 1DH3A 2O01H 1NTZK 4Y99B 5KJ7A 3HTKB 1N7SD 1HGVA 1LT9A 1GL2D 3C9IA 5AW8B 1N73A 3HD7A 4O9BA 2FFDB 5AVYB 5APQA 1GW4A 1FJPA 4GT1A 3O8ZA 2Q7CA 1GL2B 3P8MC 1CI6B 1NHLA 2QM8A 1RF0A 4RESB 5AVVB 3L36A 2HODA 1H89A 2JJLA 4C7RA 2YKOA 1RF1B 1SVFA 4LGDE 4GIFA 1L4AC 3B8EB 1ZR4A 2H43A 3UIAA 4WY4B 3GHGB 1JY2O 5APWA 1EQ7A 2POHA 3NMDA 4WB4A 3VTPC 3CL3D 1LTAC 1N7LA 4M3LA 4LC1A 3SWYA 1RE4C 2VRSA 1XTCC 2FKWB 5AW9B 2XV5A 1HJBA 2NPSC 3EQ2A 2H7HA 3KDPB 3E1IA 2P1JA 3TSIA 1URQD 4DZOA 1SP4A 2KLVA 2XKMA 5APXA 1M7LA 1Z56A 3VOPA 2WSCH 3H32B 1G2CA 1JCCA 3I5CA 1ZR2A 2O1JA 3CI9A 2HG5D 3V2PA 1FZFA 1HTLC 1NOHA 1LTTC 3L35A 2N9BA 1JOCA 3HE5A 3A2AA 1G1IA 2L5GB 2HYNA 3RK2B 1GU5A 4IFDK 1GD2E 2YKQA 1G1JA 4N78D 1L4AA 1SQVK 3P8CE 1A02F 2N1TC 4KHXA 1JTHA 2C9NY 2H8PD 1M1JB 1FBMA 2M8RA 2WSEH 1S9KD 2C0WA 4Y99C 4HYTB 2ZXEB 2W6AA 4JYBA 1T2KD 1HGZA 1RE4A 3MD0A 4C7NA 2JEEA 1OXZA 1JO5A 1GTWA 1JY2N 3MIWA 2NPSA 1QL2A 3SWFA 3M9HA 3VMZA 2OYIB 1YTZT 1GL2C 3CLQA 5AW5B 3LIDA 1ZLLA 5CCHC 1SQBK 1N86A 3IR9A 3N7NA 2J59M 3IFMA 1RF1C 2WPRA 4WY4C 3A3YB 3GHGC 2IX7C 1ZN5A 4W80A 3HRNA 2XU6A 3V5BA 3BVHA 3OJAB 3V2NA 1LTGC 2N1TA 1IFMA 1KILD 3EFGA 2A45G 3P8CD 1KZUB 1FJKA 1PFIA 2P67A 2GUSA 1T3JA 3HTKA 5APSA 1NU1K 1N2DC 1SFCD 1OWAA 1LTSC 3B5ND 2WTYA 1JY2P 1LTJB 3NFQA 1NKZB 3LIEA 1FZCB 2A45H 3V2QA 1SFCB 2WPQA 3HE4B 2YMYA 1GL2A 1YTZI 1CI6A 2Z5HA 2MJZA 1IO4A 3N4XA 5CJ4A 5CCHA 1SQXK 1IFJA 1N7SB 5AW4B 3HUSB 3RK2C 3R2PA 3H6PA 1RF1A 3VP8A 1FZGA 2R32A 4N78E 4WY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WIT A;  4HH2 A;  4C7R A;  1G1I A;  1G1J A;  4WB4 A;  4DOJ A;  4WBA A;  3MIW A;  2O1J A;  3CI9 A;  2L5G B;  2O1K A;  4LLH A; 
#chains in the Genus database with same CATH topology
 2GUV A;  1JCD A;  3PHL A;  3FX0 A;  1NWQ A;  1U7M A;  1JM0 A;  1YIJ P;  3B4S A;  4U3F G;  1QVF O;  2IFN A;  3IAO A;  3CX5 E;  3L72 J;  1PPJ G;  5AW7 B;  1DEE G;  1L0N G;  3RL0 B;  3L70 E;  2HPC B;  1NTZ J;  2QIW A;  1BCC J;  3AEA C;  3E7K A;  3A0B E;  1LTB C;  3L4F A;  3Q1M A;  3MTU E;  3U1A A;  4YXD C;  3RBX A;  1S5L X;  2E76 C;  2FXM A;  3OAK A;  3TF5 A;  1K8A Q;  1KIL E;  5APT A;  2V4H A;  4DOJ A;  3CCM P;  1LWU B;  2A06 G;  2KUB A;  2KOG A;  5AVZ B;  2IBZ E;  1FZC C;  4PJ0 H;  3G4S P;  2SPZ A;  3AEB C;  3R4Y A;  2Q9I A;  1A02 J;  4C46 A;  2Q5U A;  1KQS O;  2FYU D;  1N7S C;  3VMY A;  3HUS C;  1BGY E;  3KHU A;  1IZN B;  2KSJ A;  2KP8 A;  2Y0C A;  2XDJ A;  2AEM A;  2OYH B;  3FGA D;  4ZKU A;  2M0B A;  4WBA A;  5AVT B;  1FS0 E;  2K9J A;  4D6T D;  1U57 A;  2FY8 A;  3H1I E;  1FZC A;  3TGU D;  1S5L H;  4N6J A;  2ZAE B;  1PGJ A;  1SQP E;  3V4Q A;  1L2P A;  2CPS A;  2KS1 B;  1N7S A;  3JCU E;  3HUS A;  3Q2Y A;  4OH8 B;  2ZFC A;  3M0D C;  3TNU B;  1L0N J;  2OQQ A;  3CD6 P;  1BSH A;  2KYV A;  2ZJS E;  2OTJ P;  1X9V A;  2KB7 P;  3KYQ A;  3CX5 H;  3CC2 P;  4QMA A;  4ZKP A;  2BCC G;  1EZV D;  3L72 D;  1SQP K;  1NTZ D;  4WY4 D;  1AQ5 A;  2YO3 A;  1NO4 A;  2FYU E;  1IFD A;  3A0B H;  1T2K C;  1BCC D;  5AVR B;  1GZL A;  5TIS E;  1YJ9 P;  1Q81 Q;  2LR2 A;  2NZ2 A;  1VQ9 P;  5CMZ A;  3CXH E;  3M0D A;  3CCQ P;  1R5L A;  1SQX J;  3RK3 D;  2XND H;  3H1L E;  2YNY A;  1UII A;  1FZA A;  2FYU K;  4GOD A;  1MUU A;  3L37 A;  2E42 A;  2J5U A;  5KLV D;  1KN7 A;  2W6B A;  3AE4 C;  4TLF A;  1LGH B;  1VF5 B;  1ZP0 C;  3U59 A;  3A0H E;  5AVQ B;  3RL0 g;  1KQG B;  1JMM A;  1BSN A;  5B5E E;  1M1K Q;  1M57 D;  3GF3 A;  1JUN A;  3E1R A;  4YPC A;  2QJY B;  5AW2 B;  1EZV E;  3L72 E;  1S2E A;  3HD7 C;  1BE3 G;  1PZQ A;  3AEE C;  1NTZ E;  2M5A A;  3JCU H;  1BCC E;  1RF0 C;  2GM4 A;  1ZME C;  5AW3 B;  2FXO A;  2P7J A;  2WSS H;  1DX7 A;  5AW0 B;  1L0N D;  2E5T A;  1VQ7 P;  1TU3 F;  1Q86 Q;  3CCV P;  1YHQ P;  3AE6 C;  3I56 P;  3RK3 C;  2WPS A;  2IYP A;  2Y9Z A;  3L70 G;  1NTZ K;  5AW8 B;  1UIX A;  2IDB A;  3HD7 A;  3PH0 A;  5TIS H;  4GT1 A;  3O8Z A;  1GL2 B;  3P8M C;  2A06 D;  4TT3 H;  4HJG H;  1RF0 A;  5AVV B;  2UWJ E;  3CXH H;  2YKO A;  1SVF A;  4GIF A;  1VQO P;  1L4A C;  2R3S A;  2H43 A;  3GHG B;  1SQX D;  2W83 C;  1Q7Y Q;  1JY2 O;  2E75 C;  1EQ7 A;  4WB4 A;  1NVO A;  2IBZ G;  4H44 D;  1KB9 D;  1SQV E;  4LC1 A;  3SWY A;  4RO0 A;  4I7Z B;  1R5S A;  2WMM A;  2WSF J;  1BGY G;  2JP3 A;  2P1J A;  2WSC H;  1AV1 A;  1ZR2 A;  2O1J A;  2HG5 D;  1ZW0 A;  1HTL C;  3L35 A;  1LTT C;  3A0H H;  3A2A A;  1G1I A;  2IBZ I;  2KK7 A;  4IFD K;  1GU5 A;  1OW8 A;  2YKQ A;  1L4A A;  1SQV K;  4Y28 J;  3AE3 C;  4KHX A;  5B5E H;  1PGO A;  1JTH A;  1FBM A;  3H1I G;  2AXC A;  2C0W A;  2ZXE B;  3MD0 A;  1Q82 Q;  4C7N A;  2QA4 P;  1JO5 A;  1QGK B;  1OW7 A;  1JY2 N;  5M1B A;  3M9H A;  2OYI B;  1NU1 E;  2W90 A;  1AQT A;  3RBZ A;  5KLI B;  3SSU A;  1W2B O;  3FWN A;  5CCH C;  1N86 A;  3N7N A;  3L70 J;  2BCC D;  1QLE D;  1DD3 A;  1SQX E;  3V2N A;  1KB9 E;  1KQF B;  4H44 C;  1T6A A;  1OVV A;  1NU1 K;  2FYU G;  1OWA A;  2ZT9 D;  1KYO E;  1VQL P;  2M5A B;  1VQ5 P;  1NKZ B;  3CCU P;  1SQQ J;  3USS A;  2KXP B;  3Q5P A;  5CCH A;  1SQX K;  2KSE A;  3CME P;  3RK2 C;  2QJP B;  3H6P A;  3QH9 A;  2JKV A;  1BGY J;  3H1L G;  4BRY A;  2B88 A;  4H13 D;  3WUV A;  2PAJ A;  4K3A A;  3HD7 B;  1M90 Q;  3CPW O;  3AE1 C;  3H32 A;  2KZI A;  3WUU A;  5AVW B;  1FZE A;  2J58 A;  2R44 A;  4OVN F;  1LNQ A;  3CCS P;  4H0L B;  3JC2 2;  1SQP J;  2R5D A;  3VMX A;  3BRT B;  3C1L A;  1T8Z A;  1EZV G;  3L72 G;  3V4W A;  1E79 H;  1NTZ G;  1LTJ C;  3GLM A;  1BCC G;  2Z5I A;  4KJM A;  1L0L K;  2Q1K A;  3MGN A;  1HH0 A;  2MKV A;  3L70 D;  1EXI A;  1IK9 A;  1EZV I;  1FDI A;  3H1K E;  5K5G B;  2E75 B;  1HBW A;  1KB9 H;  5AW6 B;  1X8Y A;  1J1D B;  1RHZ B;  2Y0D A;  3PP5 A;  4GOE A;  1AVO A;  1LTJ A;  3H1L J;  1NYH A;  2E74 B;  3C8V A;  2HLO A;  2P2U A;  1JY3 O;  1P84 D;  1SQQ D;  2GA1 A;  5DJT B;  2YO2 A;  3B5N B;  1USD A;  1URQ C;  1CSB A;  2WT7 B;  1BGY D;  1SQV G;  1RE3 C;  1SQB J;  2YKP A;  3G3Z A;  1HJ0 A;  1USE A;  3GW6 A;  3WU2 E;  1AVY A;  2OAR A;  1X22 A;  1N73 B;  2ZVO B;  3H1I D;  2ZYD A;  1KTM A;  3A5T A;  2V7Q J;  2HOD B;  5E79 E;  4NPD A;  2JWD A;  1SQP D;  1URQ A;  1KC8 Q;  1HUC A;  1H0T B;  1JY3 N;  1RE3 A;  2B89 A;  2YXQ B;  1NU1 G;  2O3J A;  2IFM A;  1KIL C;  3MUD C;  3H1J J;  1KFN A;  1P84 E;  3G71 P;  1FOS F;  1SQQ E;  3T97 A;  1MKM A;  2QG4 A;  1SQX G;  2QM7 A;  3L75 J;  3HE5 B;  3A7O A;  1T3U A;  4AUW A;  1H8A A;  4HKZ H;  2M3B A;  3CXH D;  2KLU A;  4JF7 A;  1FU1 A;  2O1K A;  1JB0 J;  2NPS D;  2YIU B;  5KJ7 C;  2WSF H;  1LT9 C;  1YJN P;  1SQQ K;  1OX3 A;  3D70 A;  3PJS K;  1SQV J;  3H1L D;  1MFZ A;  2KNC B;  1KIL A;  3MUD A;  2C9L Y;  1J1E C;  2FYN B;  4JYC A;  1KB9 I;  3VN0 A;  2D2C B;  2Q3I A;  1WMK A;  2JO1 A;  1D7M A;  1SQB D;  3M0A A;  1ZOY C;  2IZ0 A;  2N1T B;  4L74 A;  1VQP P;  1LP1 A;  3WU2 H;  4EYY Q;  5KJ7 A;  3HTK B;  4PV1 D;  1HGV A;  1LT9 A;  3CCR P;  5GTI E;  4GOF A;  4O9B A;  2QEX P;  4OGQ B;  3AEF C;  5AVY B;  1GW4 A;  1FJP A;  2G3A A;  2ZYA A;  1NHL A;  2QM8 A;  5L8R J;  1NU1 J;  3L36 A;  3GG2 A;  2JJL A;  3AED C;  2B87 A;  1RF1 B;  1NGM B;  5APW A;  3L71 J;  2M3E A;  1Q90 D;  1N7L A;  3FXD A;  4M3L A;  1FE6 A;  2DW3 A;  1RE4 C;  1XTC C;  2FKW B;  2XV5 A;  1P84 H;  2NPS C;  2YXR B;  3KDP B;  3E1I A;  1S3J A;  2KLV A;  1KV4 A;  1Z56 A;  3VOP A;  4PD4 D;  3H1K G;  1G2C A;  1JCC A;  3CI9 A;  3L75 D;  5GTH E;  2QJK C;  1JOC A;  3AE7 C;  2PGD A;  1SQB E;  1OVU A;  3P8C E;  3VMA A;  5CBN A;  1R8E A;  3L74 J;  2M8R A;  2YMK A;  4Y99 C;  2ITA A;  2BEQ D;  4JYB A;  1RE4 A;  1SQV D;  1ZRT D;  4YXW H;  2O01 J;  3MIW A;  2NPS A;  4PV1 C;  1YTZ T;  4RJT A;  5AW5 B;  3KZI E;  3LID A;  1ZLL A;  2L91 A;  1SQB K;  3AE8 C;  3IFM A;  2JDI H;  3H1H E;  3ITK A;  3AE2 C;  4WY4 C;  1EDL A;  1VQ8 P;  1L0L J;  3BVH A;  4IL6 E;  2E76 B;  1PGP A;  3OJA B;  4EDF A;  1LTG C;  3EFG A;  2A45 G;  1FJK A;  1PFI A;  2K9J B;  3O6Q A;  5GTI H;  3CCJ P;  1N2D C;  4U7J A;  3D71 A;  1SFC D;  1LTS C;  3B5N D;  1JY2 P;  3NFQ A;  1FZC B;  3H1J E;  1S1C X;  3SFD C;  1Y8A A;  4PD4 E;  2WPQ A;  1CI6 A;  3CCL P;  3N4X A;  1NU1 D;  1ZXG A;  2OYO A;  3L75 E;  1N7S B;  5AW4 B;  3HUS B;  1Q2N A;  1FZG A;  5KKZ C;  4WY4 A;  1M1J C;  1PL5 A;  1LP1 B;  3L71 D;  1EXJ A;  1K04 A;  3CX5 I;  3H1K J;  1RQU A;  2B9B A;  4IL6 X;  3RL0 D;  1SQQ G;  1ZRT E;  1JMB A;  1FDO A;  1KD1 Q;  3BCC J;  1GK4 A;  2XZR A;  2WQY C;  3BAT A;  1KYO D;  2W27 A;  3BAS A;  4AQR D;  1K9M Q;  1KQL A;  2I8D A;  4AYC A;  1IJD B;  1J2J B;  4OWF A;  4EIJ A;  3CWB J;  2FXP A;  4DT0 A;  1M1J A;  4XA4 A;  3G6E P;  1AA0 A;  2ZVN B;  5KAI E;  3AEC C;  2H88 C;  1SFC C;  1G2C B;  2C0X A;  4CPG A;  1SQP G;  2V7Q H;  3WUT A;  3V2R A;  2IYO A;  2KI7 B;  3S1K A;  1ZV8 A;  4LLH A;  1MV8 A;  2KIK A;  3OA7 A;  4IL6 H;  1L0L D;  3L71 E;  4ASW A;  5BVZ A;  5CCG D;  2IPP A;  2D2C D;  3VP9 A;  2QRX A;  5CJ0 A;  3RL0 C;  1GMJ A;  1YQ3 C;  4PD4 H;  1QVG O;  1SFC A;  3HE4 A;  1H88 A;  3MZW B;  1YJW P;  1VPC A;  3II6 A;  2WWW A;  3K5B A;  4XFJ A;  2OTL P;  4R4M A;  2Z4E A;  3L74 E;  1FAV A;  4N3Y B;  3H1K D;  1LWU C;  4OGQ D;  3CMA P;  1LT1 A;  1PP9 J;  3W68 A;  1K05 A;  4W7Y A;  2XNX A;  1S72 P;  3L73 J;  1YBK A;  3BCC D;  3G9R A;  4L73 A;  2HPC A;  2AEF A;  3CXH I;  1OIP A;  1SQB G;  3VYI A;  3W67 A;  4Z1M H;  1K73 Q;  4XE5 B;  1GDT A;  1L0L E;  1FDM A;  1VQM P;  2OYH C;  5B66 E;  3IF4 A;  3CC4 P;  2K37 A;  1LWU A;  5KAI H;  1NJI Q;  1CZQ A;  5CCG C;  2AXT E;  3RK3 B;  1NTM E;  2RKL A;  1JEK A;  3H1H G;  2QE7 H;  3TYY A;  1VF5 D;  3NTN A;  3OW2 O;  3JSV C;  5KTB A;  3EFF K;  2ZT9 C;  1WRG A;  1XTG B;  1QX8 A;  1JY3 P;  1L4A B;  2OYH A;  3SFE C;  3AEG C;  1JTH B;  1YYC A;  2FYZ A;  1NAF A;  3H1J G;  4K35 A;  1NTM K;  1AFO A;  5H2F E;  1FZB A;  2OGU A;  5AVS B;  3FXE A;  5AW1 B;  5CCG A;  1Y47 A;  3BCC E;  4C7N B;  2LKM A;  1KYO H;  1PIX A;  3L75 G;  4H13 C;  3ABV C;  3Q5S A;  1OFC X;  2KS1 A;  2ZYG A;  3LW5 J;  3F89 A;  2Y0E A;  3TNU A;  2HR3 A;  1EC5 A;  1DIP A;  3CWB E;  1VQ4 P;  5APY A;  4ZNC A;  4PD4 I;  1SLQ A;  1PP9 D;  2O01 H;  3L73 D;  1N7S D;  1GL2 D;  1S5L E;  3I55 P;  2AEJ A;  2RN0 A;  2Q7C A;  1BDD A;  4RES B;  1VF5 C;  4YTP C;  1H89 A;  4C7R A;  5B66 H;  2RH0 A;  4LGD E;  2LXB A;  3B8E B;  5CBO A;  1ZR4 A;  2PFX A;  3UIA A;  4BRY B;  3H1H J;  2POH A;  3CL3 D;  1RH5 B;  2AXT H;  2CK3 H;  2QJY C;  2VRS A;  4H44 B;  2K1A A;  1HJB A;  2ZXX A;  3TSI A;  4DZO A;  1M7L A;  1VQK P;  3H32 B;  4WVZ A;  1NTK J;  3L71 G;  1OVR A;  2RMZ A;  3V2P A;  1FZF A;  3RK2 B;  2K3R A;  1GD2 E;  2O01 N;  4GDO A;  1A02 F;  2C9N Y;  2H8P D;  2N9Y B;  5H2F H;  1PP9 E;  3QWO C;  2W6J H;  1S9K D;  3L73 E;  4MN4 C;  2W6A A;  1T2K D;  1HGZ A;  1GTW A;  5KLV J;  1GL2 C;  4DCK A;  3IR9 A;  4IOI H;  3L74 G;  3D6Z A;  3A3Y B;  3GHG C;  3CCE P;  2NRG A;  1FC2 C;  1ZN5 A;  2XU6 A;  3PTZ A;  5C39 A;  1KYO I;  2IZ1 A;  1M56 D;  3P8C D;  4I7Z C;  2GUS A;  1T3J A;  5APS A;  3V6I A;  1LTJ B;  1VQ6 P;  3LIE A;  2A45 H;  3ZDM A;  3V2Q A;  5TJH A;  4U3F J;  1L0L G;  2ZT9 B;  1GL2 A;  2Z5H A;  2MJZ A;  5CJ4 A;  2FBW C;  3S4R A;  3IN6 A;  5E79 H;  3VP8 A;  4B86 A;  3GHG A;  5CHX A;  3H1H D;  3GF7 A;  2H89 C;  2CPB A;  3HD7 D;  3MP7 B;  1NTM G;  4IFF A;  1S9K E;  1U7J A;  3FWL A;  4EI2 A;  1YIT P;  2Q6Q A;  2WSE J;  1HVV A;  4I1L A;  2QSI A;  4H13 B;  2OYI C;  3Q3D A;  5KLI C;  4H0L D;  3H1J D;  1NTK D;  3PRJ A;  3AE9 C;  1GK6 A;  5AVU B;  1URQ B;  1RY3 A;  2R5B A;  4D6T E;  3BCC G;  3RGU A;  3TGU E;  4IFM A;  1EDJ A;  2OYI A;  4RKU J;  3T97 B;  1L4A D;  2FFD C;  3NXS A;  3CWB G;  2E75 D;  2QJP C;  1N8R Q;  1IFN A;  1IK7 A;  4W7Z A;  1RQV A;  1BDC A;  1X79 B;  3AE5 C;  1X0T A;  4A7P A;  3PLN A;  1MFT A;  2BEZ F;  2I1J A;  2E74 D;  2JWA A;  2BAS A;  2WZ7 A;  4NPF X;  1VDF A;  4BXL A;  1KMI Z;  4I2L C;  1W2E A;  1KFM A;  1LJ2 A;  1KIL B;  3KPE A;  3U1C A;  4U3F D;  1NTM J;  1NTK E;  2FFD A;  2BCC J;  3EWK A;  1PPJ D;  4H0L C;  1IFP A;  3M06 A;  1CW5 A;  4WWI A;  3RK3 E;  1QL1 A;  1DEB A;  4KT0 J;  1YI2 P;  1FOS E;  3M9Q A;  2A45 I;  5BU8 B;  4DJG A;  1HF9 A;  2HFE D;  1HWT C;  5CCH D;  1PV3 A;  1LT9 B;  3TK1 A;  1NTK K;  5KLV E;  1AJY A;  2P58 A;  3LW5 H;  1PGQ A;  1J1E B;  5APV A;  1NAY A;  2K88 A;  5GTH H;  2B87 B;  1PP9 G;  1M8O B;  4I6M C;  3L73 G;  4EOT A;  1LTI C;  1J1D C;  1S4X A;  1NH4 A;  1MZ9 A;  4HB1 A;  1P84 I;  1WT6 A;  1JNM A;  3L74 D;  5KLV K;  2E74 C;  2WVR A;  2E43 A;  5AVX B;  1Y9B A;  2KZJ A;  3RK2 D;  3GMA A;  4U3F E;  1GW3 A;  3P32 A;  3KQG A;  3KZI H;  1PPJ E;  3B5N C;  1BE3 J;  1IC2 A;  1L0N E;  4GKG A;  4UB8 E;  5BU5 A;  1E5W A;  3M9B A;  1IFI A;  2R3C A;  3B71 A;  4JQ0 D;  5APU A;  1GU4 A;  1N73 C;  1OW6 A;  2A06 E;  3WMM 0;  2NPS B;  1L0N K;  2WPV B;  1NTM D;  3S9O A;  4JBZ A;  2JR8 A;  3M91 A;  3B5N A;  1EDK A;  3BRV B;  2N1T D;  5EFW B;  2WT7 A;  4HH2 A;  1SS1 A;  2QJK B;  1DD4 A;  3P7K A;  5KAF E;  2I1K A;  4UB6 E;  1NKN A;  2WIT A;  2PP6 A;  2OTK E;  1DH3 A;  4BWN A;  2W8Z A;  3O6Q B;  4Y99 B;  1EDI A;  4ASV A;  1OZH A;  3C9I A;  1N73 A;  2FFD B;  5APQ A;  4PV1 B;  1CI6 B;  1W5C E;  2PRR A;  1OMI A;  2HOD A;  4D6T G;  2Q3E A;  4WY4 B;  1H0T A;  3TGU G;  3Q5R A;  3NMD A;  3VTP C;  1LTA C;  3CWB D;  2YIU C;  2Y9Y A;  3H25 A;  5AW9 B;  3KXD A;  3EQ2 A;  3H1I J;  2H7H A;  1URQ D;  2FYN C;  1SP4 A;  2D2C C;  2XKM A;  5APX A;  2G8Y A;  1QEX A;  2BCC E;  3I5C A;  2QVA A;  4UB8 H;  1BE3 D;  3F5H A;  1NOH A;  2N9B A;  3HE5 A;  4R4L A;  2L5G B;  3TDK A;  2HYN A;  4JPZ B;  1G1J A;  4N78 D;  2N1T C;  5KKZ B;  3MHV A;  1M1J B;  2WSE H;  4HYT B;  1KOR A;  2K9Y A;  1NTK G;  2JEE A;  1OXZ A;  2KNC A;  3CX5 D;  4OGQ C;  2LXC B;  1QL2 A;  4PJ0 E;  3SWF A;  3VMZ A;  3CLQ A;  2FYU J;  1VL2 A;  2J59 M;  3CC7 P;  2E76 D;  1RF1 C;  2WPR A;  1VQN P;  2IX7 C;  4W80 A;  3HRN A;  3V5B A;  5KAF H;  4UB6 H;  2E5Y A;  2N1T A;  1IFM A;  1KIL D;  3SWK A;  5KLV G;  1KZU B;  4NPE A;  2P67 A;  4ZMD A;  3HTK A;  4D6T J;  5DJU B;  2IBZ D;  2WTY A;  3D6Y A;  1YQ4 C;  4L76 A;  3TGU J;  2P10 A;  1SFC B;  2YMY A;  3HE4 B;  1YTZ I;  1IO4 A;  1BE3 E;  1IFJ A;  2WSC J;  3R2P A;  1RF1 A;  2R32 A;  4L75 A;  4N78 E;  5KJ7 D; 
#chains in the Genus database with same CATH homology
 3GHG A;  5CHX A;  2GUV A;  1M1J C;  1JCD A;  2CPB A;  3HD7 D;  1NWQ A;  4IFF A;  1S9K E;  3RL0 D;  2PAJ A;  2IFN A;  3HD7 B;  1HVV A;  4I1L A;  2OYI C;  1GK4 A;  5AW7 B;  2XZR A;  3RL0 B;  2HPC B;  3BAT A;  2W27 A;  3BAS A;  3H32 A;  4AQR D;  1KQL A;  5AVW B;  1FZE A;  2J58 A;  4AYC A;  1LTB C;  3L4F A;  3MTU E;  3U1A A;  1IJD B;  1GK6 A;  5AVU B;  1URQ B;  1J2J B;  1RY3 A;  2FXM A;  4EIJ A;  3OAK A;  2R5B A;  2R5D A;  3VMX A;  3BRT B;  1T8Z A;  5APT A;  1M1J A;  4XA4 A;  4DOJ A;  5KJ7 D;  3V4W A;  1LWU B;  4IFM A;  2KOG A;  5AVZ B;  1LTJ C;  1FZC C;  2Z5I A;  2OYI A;  2Q9I A;  1L0L K;  1SFC C;  1G2C B;  2C0X A;  3MGN A;  1A02 J;  1L4A D;  2FFD C;  4C46 A;  3V2R A;  2Q5U A;  3NXS A;  1N7S C;  3VMY A;  1HH0 A;  3HUS C;  1ZV8 A;  2KSJ A;  4LLH A;  1MV8 A;  2KP8 A;  1IK9 A;  3OA7 A;  1IFN A;  2XDJ A;  1HBW A;  5AW6 B;  4W7Z A;  2OYH B;  4B86 A;  1X79 B;  5BVZ A;  1X8Y A;  5CCG D;  1J1D B;  2I1J A;  2BAS A;  4ZKU A;  2IPP A;  2WZ7 A;  4WBA A;  5AVT B;  1VDF A;  3VP9 A;  3PP5 A;  1LTJ A;  4I2L C;  1W2E A;  5CJ0 A;  3RL0 C;  1FZC A;  1KFM A;  3KPE A;  1KIL B;  2HLO A;  2P2U A;  1JY3 O;  3U1C A;  4N6J A;  1SFC A;  3HE4 A;  1H88 A;  2FFD A;  3V4Q A;  2CPS A;  1N7S A;  3HUS A;  2YO2 A;  3B5N B;  1CW5 A;  3M06 A;  1URQ C;  4OH8 B;  2ZFC A;  3M0D C;  1CSB A;  1QL1 A;  1DEB A;  1VPC A;  3II6 A;  2WWW A;  3TNU B;  2WT7 B;  1RE3 C;  2YKP A;  2Z4E A;  1FOS E;  1FAV A;  3G3Z A;  3M9Q A;  4N3Y B;  2A45 I;  1LWU C;  2KYV A;  5BU8 B;  1X9V A;  4W7Y A;  2KB7 P;  2XNX A;  3KYQ A;  2HFE D;  1HWT C;  4ZKP A;  5CCH D;  1LT9 B;  3TK1 A;  2OAR A;  1NTK K;  1SQP K;  1N73 B;  2HPC A;  4WY4 D;  1AQ5 A;  2YO3 A;  3LW5 H;  1NO4 A;  5APV A;  1J1E B;  1IFD A;  1T2K C;  5AVR B;  1GZL A;  3VYI A;  3A5T A;  4XE5 B;  2HOD B;  1GDT A;  1FDM A;  1URQ A;  4I6M C;  5CMZ A;  2OYH C;  3M0D A;  1HUC A;  1JY3 N;  1RE3 A;  4EOT A;  1LTI C;  1J1D C;  3RK3 D;  1NH4 A;  1MZ9 A;  1LWU A;  1WT6 A;  1JNM A;  2YNY A;  5KLV K;  1CZQ A;  5CCG C;  3RK3 B;  1FZA A;  2E43 A;  5AVX B;  2IFM A;  1KIL C;  2FYU K;  1MUU A;  3L37 A;  3RK2 D;  1KFN A;  2E42 A;  1FOS F;  3T97 A;  3TYY A;  3NTN A;  1GW3 A;  3P32 A;  5KTB A;  3KQG A;  2W6B A;  3B5N C;  1WRG A;  1IC2 A;  2QM7 A;  1LGH B;  4GKG A;  1XTG B;  3HE5 B;  3A7O A;  3U59 A;  1T3U A;  1JY3 P;  5AVQ B;  5BU5 A;  1E5W A;  3M9B A;  4AUW A;  1L4A B;  1IFI A;  1H8A A;  2OYH A;  2R3C A;  1JTH B;  1YYC A;  2M3B A;  1JMM A;  2FYZ A;  4JF7 A;  1NAF A;  1FU1 A;  1JUN A;  1NTM K;  2O1K A;  5APU A;  1AFO A;  2NPS D;  5KJ7 C;  1FZB A;  2WSF H;  1LT9 C;  5AVS B;  1SQQ K;  5AW2 B;  5AW1 B;  5CCG A;  1GU4 A;  4C7N B;  1N73 C;  3HD7 C;  2LKM A;  1MFZ A;  1KIL A;  3WMM 0;  2NPS B;  3MUD A;  2C9L Y;  1J1E C;  1L0N K;  4JYC A;  3VN0 A;  2Q3I A;  1RF0 C;  3M91 A;  2GM4 A;  5AW3 B;  3B5N A;  3BRV B;  2N1T D;  2P7J A;  2WT7 A;  3TNU A;  1DX7 A;  4HH2 A;  5AW0 B;  3M0A A;  5APY A;  3P7K A;  2N1T B;  2I1K A;  1SLQ A;  1NKN A;  2WIT A;  2PP6 A;  3RK3 C;  2WPS A;  1DH3 A;  2O01 H;  1NTZ K;  4Y99 B;  5KJ7 A;  3HTK B;  1N7S D;  1HGV A;  1LT9 A;  1GL2 D;  3C9I A;  5AW8 B;  1N73 A;  3HD7 A;  4O9B A;  2FFD B;  5AVY B;  5APQ A;  1GW4 A;  1FJP A;  4GT1 A;  3O8Z A;  2Q7C A;  1GL2 B;  3P8M C;  1CI6 B;  1NHL A;  2QM8 A;  1RF0 A;  4RES B;  5AVV B;  3L36 A;  2HOD A;  1H89 A;  2JJL A;  4C7R A;  2YKO A;  1RF1 B;  1SVF A;  4LGD E;  4GIF A;  1L4A C;  3B8E B;  1ZR4 A;  2H43 A;  3UIA A;  4WY4 B;  3GHG B;  1JY2 O;  5APW A;  1EQ7 A;  2POH A;  3NMD A;  4WB4 A;  3VTP C;  3CL3 D;  1LTA C;  1N7L A;  4M3L A;  4LC1 A;  3SWY A;  1RE4 C;  2VRS A;  1XTC C;  2FKW B;  5AW9 B;  2XV5 A;  1HJB A;  2NPS C;  3EQ2 A;  2H7H A;  3KDP B;  3E1I A;  2P1J A;  3TSI A;  1URQ D;  4DZO A;  1SP4 A;  2KLV A;  2XKM A;  5APX A;  1M7L A;  1Z56 A;  3VOP A;  2WSC H;  3H32 B;  1G2C A;  1JCC A;  3I5C A;  1ZR2 A;  2O1J A;  3CI9 A;  2HG5 D;  3V2P A;  1FZF A;  1HTL C;  1NOH A;  1LTT C;  3L35 A;  2N9B A;  1JOC A;  3HE5 A;  3A2A A;  1G1I A;  2L5G B;  2HYN A;  3RK2 B;  1GU5 A;  4IFD K;  1GD2 E;  2YKQ A;  1G1J A;  4N78 D;  1L4A A;  1SQV K;  3P8C E;  1A02 F;  2N1T C;  4KHX A;  1JTH A;  2C9N Y;  2H8P D;  1M1J B;  1FBM A;  2M8R A;  2WSE H;  1S9K D;  2C0W A;  4Y99 C;  4HYT B;  2ZXE B;  2W6A A;  4JYB A;  1T2K D;  1HGZ A;  1RE4 A;  3MD0 A;  4C7N A;  2JEE A;  1OXZ A;  1JO5 A;  1GTW A;  1JY2 N;  3MIW A;  2NPS A;  1QL2 A;  3SWF A;  3M9H A;  3VMZ A;  2OYI B;  1YTZ T;  1GL2 C;  3CLQ A;  5AW5 B;  3LID A;  1ZLL A;  5CCH C;  1SQB K;  1N86 A;  3IR9 A;  3N7N A;  2J59 M;  3IFM A;  1RF1 C;  2WPR A;  4WY4 C;  3A3Y B;  3GHG C;  2IX7 C;  1ZN5 A;  4W80 A;  3HRN A;  2XU6 A;  3V5B A;  3BVH A;  3OJA B;  3V2N A;  1LTG C;  2N1T A;  1IFM A;  1KIL D;  3EFG A;  2A45 G;  3P8C D;  1KZU B;  1FJK A;  1PFI A;  2P67 A;  2GUS A;  1T3J A;  3HTK A;  5APS A;  1NU1 K;  1N2D C;  1SFC D;  1OWA A;  1LTS C;  3B5N D;  2WTY A;  1JY2 P;  1LTJ B;  3NFQ A;  1NKZ B;  3LIE A;  1FZC B;  2A45 H;  3V2Q A;  1SFC B;  2WPQ A;  3HE4 B;  2YMY A;  1GL2 A;  1YTZ I;  1CI6 A;  2Z5H A;  2MJZ A;  1IO4 A;  3N4X A;  5CJ4 A;  5CCH A;  1SQX K;  1IFJ A;  1N7S B;  5AW4 B;  3HUS B;  3RK2 C;  3R2P A;  3H6P A;  1RF1 A;  3VP8 A;  1FZG A;  2R32 A;  4N78 E;  4WY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...