1RE3A

Crystal structure of fragment d of bbetad398a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
60
structure length
60
Chain Sequence
QHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
publication title BbetaGlu397 and BbetaAsp398 but not BbetaAsp432 are required for "B:b" interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1re3A00
1FZEA 2Z4EA 2OYIB 1N73C 1JY2N 1LTJC 3E1IA 2Q9IA 1RF1C 1LWUC 1RE4C 1N73A 1JY3P 2HODB 1RE3C 2FFDC 1LTJA 3GHGB 1FZFA 1LT9C 1RF1A 1LWUA 1RE4A 3HUSC 1FZCB 2A45G 1JY2P 1M1JB 1N86A 1RE3A 3H32A 2FFDA 1LT9A 2OYIC 3HUSA 2OYHB 2HLOA 2HPCA 1RF0C 2OYIA 1JY3O 1W2EA 1N73B 1FZAA 2A45I 2XNXA 3GHGC 1T3UA 1LTJB 1RF0A 1M1JC 2HODA 1RF1B 1JY2O 1FZCC 1LWUB 2H43A 3GHGA 2FFDB 3BVHA 2OYHC 1FZBA 1M1JA 1FZGA 3H32B 1JY3N 3HUSB 1LT9B 1FZCA 2A45H 2HPCB 2OYHA
chains in the Genus database with same CATH superfamily
2V7QJ 3TF5A 4IL6E 1NTMD 3L73G 1NYHA 1FZFA 3U59A 1OW6A 1USEA 3PH0A 4H44D 2KB7P 2KZIA 3RK3D 5H2FE 3RGUA 1LT1A 1JMBA 2HPCB 2V4HA 1L0LJ 5H2FH 1NTKD 4JF7A 2Q7CA 4IOIH 1JM0A 1FZCB 1T2KC 2HG5D 2G8YA 3M9HA 2AXCA 5APYA 1GU5A 2A06G 1USDA 3Q5PA 1PGOA 3VYIA 2WMMA 4ASWA 2N1TD 3L74J 1KILB 3JSVC 4PD4E 2IFMA 3HD7C 4I7ZB 1Q86Q 4PD4H 2PRRA 2YNYA 4ASVA 3AE7C 1AVOA 3WUTA 1Q2NA 2K9YA 2WZ7A 1OX3A 1S72P 4H0LB 1JY2N 1QEXA 3L75E 4EOTA 4Z1MH 1HH0A 2KUBA 2XNDH 2JO1A 1EDLA 3FXEA 5CCGA 4IFFA 1AJYA 3TNUB 4Y99B 2IBZI 3W68A 4DCKA 1GU4A 2E5TA 1L0LK 4H13B 2YMKA 4WY4C 3KYQA 4RESB 1KILE 1J1EB 1P84I 2AEMA 3NTNA 2HPCA 1S5LE 2J59M 2GA1A 1G2CB 3L71G 1WT6A 1FZCA 2LKMA 1T2KD 1ZW0A 3MD0A 1SQXK 1LGHB 1NAFA 1SFCA 3L73E 1VDFA 2N9YB 1X8YA 4GOFA 3PRJA 4XA4A 1KILA 3AEEC 2BCCD 5AW4B 2KK7A 2WVRA 1S2EA 2XDJA 5AVRB 1SQVG 1RF0C 3A7OA 1RQUA 3CC7P 1L0LD 2FFDB 2IZ1A 4A7PA 2A06E 2N1TB 3CC4P 1LT9C 3EWKA 2A45G 4LC1A 3TNUA 3JCUE 3P8CD 2E74C 1CSBA 1SQXD 3JCUH 1AV1A 1JY2O 2OGUA 4WY4D 3RK3E 1ZR4A 3GLMA 1VQMP 2BCCG 1RE4A 4U3FG 1G2CA 3HUSC 5EFWB 5KLIC 1SQQK 2CPBA 3QWOC 1NJIQ 3LW5J 4UB8E 1IC2A 5TJHA 2FXMA 4UB8H 1NH4A 1GW4A 1QL2A 3P7KA 3RBZA 4OH8B 2QM8A 2QRXA 3KQGA 5BVZA 5AVVB 4KHXA 3TDKA 1KYOD 1BGYD 1SQXG 2KIKA 3MUDA 3KDPB 2JEEA 3VTPC 4D6TD 4UB6E 1JEKA 3L71E 2KSEA 1U57A 1PL5A 3CCSP 3GHGB 3WUVA 3CXHD 2FFDA 1LTIC 4CPGA 1VL2A 1YI2P 4R4MA 2H7HA 1LP1A 2K9JB 3G9RA 1W2EA 2XNXA 1RF1B 3CX5D 3SSUA 1SQQD 4PJ0E 3HD7B 2BEZF 1KV4A 4B86A 3L75J 1ZMEC 1S1CX 3AE2C 1EZVG 3IN6A 4PJ0H 1OMIA 1PPJD 3TSIA 1AA0A 1HGZA 5AW6B 1ZV8A 2NPSD 4M3LA 1BGYG 1SQVE 4D6TG 1NTZG 2C0WA 2YO3A 1MKMA 2YXRB 4QMAA 5CCGC 3IF4A 2B87A 1Q81Q 5AVQB 5AW5B 3BRVB 1IK9A 1SQQG 2Z4EA 1KZUB 5B66E 1N86A 3W67A 1M90Q 3S9OA 3L73J 2BCCE 3N4XA 4U3FE 2QSIA 4AUWA 1IFJA 3CWBG 1FZCC 5AW0B 3GHGA 3BVHA 2OYHA 1M56D 2K9JA 3I56P 1CI6B 1JY3P 1RF1A 1SFCC 3D71A 3CLQA 3FGAD 2QJKB 2QA4P 1KILC 1N7SB 5CBNA 4W80A 1KYOI 3L35A 1E5WA 2OYOA 1SQXE 2Q3IA 5AW3B 1FDIA 4GIFA 2E42A 2WSEH 3B5NB 1DIPA 4H0LC 1NTMJ 2Y9YA 4HJGH 5APUA 3TYYA 1NU1G 2H43A 1KC8Q 1LT9B 2PP6A 2K37A 4PD4D 3S4RA 3CX5I 5CCGD 4JYCA 2E74B 1LWUA 1SLQA 1X9VA 4Y99C 1JMMA 3MTUE 1EZVE 1JTHB 2C9LY 4H13C 3NMDA 2LR2A 5GTHE 1KMIZ 3JC22 1BGYE 1LTAC 5KLIB 5GTHH 1NGMB 2G3AA 1KYOH 3L70G 3VMXA 3ZDMA 1RE4C 4MN4C 4O9BA 3VN0A 1KB9I 4D6TE 1NTZE 2YKPA 1FZAA 1CZQA 5AVSB 2D2CB 3CXHE 1X79B 2HFED 2Q3EA 1SFCD 1J2JB 1W2BO 4KJMA 3IFMA 3CXHH 3L71J 2XV5A 2WITA 1A02J 1KILD 4XE5B 1N7SA 1SP4A 1SQQE 3M91A 1MZ9A 4ZKUA 3SFEC 2L91A 5KAFE 1YQ4C 3MUDC 2WPVB 5KAFH 3B5NA 4EIJA 4H0LD 3CWBE 3CCEP 4JYBA 3L73D 2FFDC 3L4FA 1RY3A 1RHZB 3G3ZA 2WSSH 2HR3A 1EXJA 3H1HG 3CCMP 1SQVJ 1DH3A 1M57D 3PHLA 5L8RJ 2QE7H 1JTHA 1HJBA 2FXOA 4JBZA 1IFDA 3CD6P 4H13D 1OWAA 4OVNF 4HB1A 3Q3DA 1KTMA 2JJLA 2SPZA 1VQ5P 2YIUB 2P7JA 5CJ0A 1DEBA 1NU1E 2AXTE 1MFZA 3FXDA 4XFJA 4PD4I 2AXTH 2XKMA 1KFMA 4IL6H 3A3YB 2BCCJ 5AW9B 3L36A 3H1KG 4WBAA 1M1JA 3LW5H 1Z56A 1M7LA 2H88C 3L37A 3L70E 2RKLA 1YJ9P 3A0HE 2GUSA 2PGDA 3AEAC 3UIAA 3GHGC 3HRNA 3WMM0 3OAKA 3D70A 1FJKA 2OYHC 1LTGC 1SFCB 4HYTB 1OXZA 1SQXJ 1SQVK 2WSEJ 2Y9ZA 2KOGA 1RF1C 1VF5C 2OQQA 3V4QA 1JNMA 2BEQD 3AEFC 3M0AA 4Y28J 2PFXA 3L71D 5KLVD 2CK3H 3LIDA 3L72G 2Q6QA 3AEGC 4IFDK 3BCCD 1JCDA 2ZT9B 1NHLA 1OZHA 5AW7B 3SWYA 1S9KE 1VQOP 5BU5A 1JOCA 2WSFH 2Q5UA 3H1HE 1YBKA 1BGYJ 2OYIB 1IZNB 1LWUC 3Q5SA 4D6TJ 1NTZJ 3U1CA 1SQVD 1NAYA 4I2LC 3CCVP 4N3YB 2YO2A 5KLVG 1S5LH 4DOJA 4GOEA 1NKZB 5K5GB 3BCCG 2Z5HA 1JB0J 1SQQJ 3V2RA 3CMAP 1YIJP 1JO5A 3O6QB 4BRYA 2QJKC 3CWBJ 3HD7D 3H1KE 1E79H 2OTLP 1N7SC 3HTKB 4U3FD 2R5BA 1L0NG 2B9BA 1X0TA 3CCJP 1W5CE 2J5UA 1QL1A 4I1LA 3B5NC 3GG2A 2OTKE 5B5EE 1KFNA 1M8OB 2J58A 1LP1B 2ZXXA 5CHXA 2Y0CA 5CBOA 1T3JA 3OJAB 2JP3A 2Q1KA 1NTZK 2OYIA 2RN0A 5KJ7A 1N8RQ 5APQA 1VQ7P 5AVYB 3AE9C 3USSA 1Y47A 1NU1J 4GODA 1D7MA 3RK2B 3I5CA 3L72E 4OWFA 2OARA 2IYOA 3H1JG 1VQ9P 5CCHA 1YHQP 2H8PD 3TK1A 1K04A 1QLED 1VQ4P 2IPPA 2B87B 3B4SA 2D2CC 1EZVD 3O6QA 3L70J 3HE5A 2W83C 2AEFA 1N7SD 3HTKA 2C9NY 1M1JC 3EFFK 1NTZD 2KYVA 5CJ4A 5KLVE 2RH0A 1GZLA 5AVXB 3B5ND 4UB6H 1GDTA 1K9MQ 1JCCA 3BCCE 3WU2E 2OYHB 1WRGA 2E76B 3MGNA 2WT7A 3AE8C 3WU2H 1VF5B 3RL0B 1EDKA 1SS1A 2QJYB 2Q9IA 1OW8A 2E74D 1ZOYC 3GMAA 2MKVA 1NU1K 1YJNP 2WSFJ 1EDJA 4LGDE 2NRGA 2L5GB 1GL2B 1GK4A 1LTJB 3CWBD 1HWTC 1K8AQ 3O8ZA 3ABVC 3H1HJ 3PLNA 3H1LG 2JDIH 1EC5A 2YIUC 1YTZT 2FYNB 1ZR2A 1HUCA 2BASA 3OA7A 4PV1C 2D2CD 1LWUB 3IAOA 2A45H 3K5BA 2YKQA 2YMYA 2ZYAA 1VQPP 3MIWA 5KKZB 1NO4A 1NWQA 2O1JA 1UIIA 1J1DB 3MZWB 5B66H 1AQTA 2WWWA 1NU1D 2E5YA 3H1JE 3PJSK 2YKOA 3BASA 2C0XA 1PZQA 3H1KJ 2M5AA 1EQ7A 2WPRA 3C9IA 2E75B 1JY2P 2LXCB 1QVFO 1EZVI 1URQB 1IFPA 4L74A 2LXBA 1VQLP 4L73A 1EDIA 2HYNA 3L70D 3CC2P 2I1KA 2GUVA 4DJGA 1GL2A 1LTJA 3N7NA 2ZT9C 3CXHI 3PTZA 4C7NA 1BSHA 1VQ8P 1R5LA 3EQ2A 1T8ZA 2M8RA 4RO0A 3L72J 3VMAA 2W27A 4W7ZA 2OYIC 1ZN5A 4AQRD 1DD4A 5KJ7C 2P10A 1T3UA 1N7LA 1GTWA 1ZRTD 2POHA 3AE6C 5GTIE 1L4AA 1DEEG 3CMEP 2WTYA 5BU8B 2IX7C 2R5DA 3U1AA 1BDDA 3H1LE 5GTIH 3GW6A 1S9KD 1YTZI 2XU6A 3H32A 1IK7A 1HBWA 3V6IA 5CCHC 3H1HD 1S3JA 1PGQA 3R2PA 3Q5RA 4W7YA 1OVRA 2P2UA 1FZEA 5KLVJ 1URQA 1G1JA 2CPSA 1M1JB 1RE3A 3A5TA 3BCCJ 1AFOA 1K73Q 3MHVA 3AE4C 3PP5A 1YQ3C 2ZT9D 2O01N 3C1LA 2KNCB 5TISE 1ZXGA 1OVVA 2WPSA 5TISH 1Y9BA 5KTBA 2KI7B 3H1KD 1VQ6P 4DT0A 2KSJA 5E79E 1RH5B 1FS0E 3VOPA 5AW2B 5KJ7D 1FBMA 5E79H 1KB9E 1KQLA 1NVOA 3H1IG 5APWA 4C46A 4ZNCA 2FYUG 3AEDC 3RK2C 1G1IA 4NPDA 3HE4A 3AE1C 1FDOA 3V2QA 2NZ2A 3D6ZA 1BE3D 2Y0EA 1BCCD 1PFIA 1UIXA 5CCHD 3NFQA 2NPSA 4PV1B 2ZVNB 1EXIA 5KLVK 1LTSC 4U3FJ 1H0TB 3CL3D 2HODA 3CI9A 1FJPA 3CCLP 5APVA 1FU1A 1FAVA 1GD2E 3L72D 3VP8A 3FWNA 1IFIA 2FXPA 2O01H 2IZ0A 4GDOA 4BWNA 2HLOA 3FX0A 3KHUA 1HTLC 2ZVOB 3A0HH 2IBZG 1L0NK 2KNCA 3RBXA 2E76C 4EYYQ 3OW2O 1BE3G 2MJZA 1BCCG 1N2DC 2WSCH 2WQYC 3RL0C 4BRYB 2QJYC 4NPEA 4GKGA 3T97B 1KN7A 2O1KA 3FWLA 3CCQP 2I1JA 1SQBD 1PV3A 1GL2C 1IFNA 1R8EA 3RK2D 1LTJC 4N6JA 5CMZA 2E43A 1ZRTE 1NTMG 3GF7A 4IL6X 1PGJA 1SQPD 1BSNA 3V2NA 1A02F 3P8MC 2FYNC 2M0BA 3KZIE 1JY3N 1GW3A 3LIEA 1HF9A 3KPEA 1XTCC 1R5SA 2R3CA 3KZIH 1NTKG 1H0TA 3H1LJ 2YXQB 1L0ND 1KD1Q 2FBWC 2QIWA 2K1AA 5AVUB 1SVFA 3H1IE 1Y8AA 3M06A 2FYUE 2QVAA 4BXLA 5KKZC 3M9QA 1GK6A 1L4AC 1J1DC 1SQBG 1NKNA 1AVYA 2Y0DA 3BRTB 2IYPA 1SQPG 2E76D 3AEBC 2E75C 1VF5D 1DD3A 2W6AA 3HE5B 3RL0D 3CCRP 2GM4A 1PP9D 4U7JA 1MFTA 1URQC 1AQ5A 3T97A 1RE3C 5AVWB 3TGUD 1FDMA 1QX8A 3E7KA 1ZLLA 1FC2C 3H1JD 1GL2D 1Q7YQ 4H44B 1Q82Q 3RK3B 3S1KA 2QJPC 1PIXA 4WVZA 1HJ0A 2JR8A 5APTA 1LJ2A 2IBZE 1HVVA 1KQSO 2WT7B 2PAJA 5B5EH 3G6EP 1BE3E 1H89A 1BCCE 1VPCA 1P84E 4K3AA 1MUUA 1S5LX 2KS1B 5KAIE 2VRSA 2ZAEB 1P84H 2FYZA 4TT3H 1T6AA 5KAIH 2B88A 1YITP 3H25A 4JPZB 1PP9G 1M1KQ 1JUNA 2ZYDA 2JWDA 1L4AD 1NTME 3TGUG 1JY3O 1N73B 2W90A 2P58A 3L74D 2O01J 3QH9A 1KORA 2NPSC 1HGVA 1L2PA 2E75D 5AVZB 1RQVA 2ZXEB 1NTKE 4R4LA 2JWAA 1URQD 4LLHA 2K88A 1U7MA 1L0LG 2WSCJ 4KT0J 3H1LD 3VMZA 2P1JA 1SQBE 4YXWH 3R4YA 1H88A 4C7RA 2R32A 5APSA 1DX7A 2M5AB 1SQPE 2A45I 3V4WA 3L74G 4JQ0D 3B71A 2KS1A 1OIPA 1OW7A 1QGKB 2KLUA 2DW3A 3AECC 2FY8A 2P67A 3D6YA 1L0NE 2N1TA 1FZGA 2WPQA 4TLFA 4WB4A 5M1BA 3MP7B 2OTJP 1N73A 4C7NB 5DJTB 2JKVA 4OGQC 3H1IJ 2ZYGA 2ZJSE 2FYUJ 3A0BE 1TU3F 1YYCA 3M0DA 1KB9D 4IFMA 3A0BH 1YJWP 1XTGB 4DZOA 1U7JA 4I6MC 3P32A 1PP9E 1IFMA 1FOSF 3KXDA 1L4AB 3EFGA 3RL0g 4EDFA 5AW1B 3GF3A 3TGUE 3V5BA 2KP8A 3H32B 1IO4A 4WY4B 3F5HA 2O3JA 4HH2A 3M9BA 1LTBC 3II6A 2V7QH 2M3EA 1VQNP 2IFNA 2ZFCA 3AE5C 4N78D 3BATA 5C39A 1PPJG 2W8ZA 1GMJA 3VMYA 2KZJA 1WMKA 4L75A 2FKWB 3B8EB 1L0LE 1BDCA 4WWIA 1BE3J 1BCCJ 2QJPB 3Q2YA 3HD7A 3A2AA 1ZP0C 4GT1A 2KXPB 3SFDC 3P8CE 4I7ZC 1FZBA 4RKUJ 4OGQD 2FYUK 2R44A 3H6PA 4RJTA 3L74E 1PGPA 3C8VA 4PV1D 3E1RA 1OVUA 2QEXP 3VP9A 1KQFB 4YPCA 4YTPC 1KQGB 2XZRA 1MV8A 3V2PA 4K35A 4ZKPA 3HE4B 3ITKA 1LTTC 2UWJE 3NXSA 4L76A 1NTKJ 4WY4A 4ZMDA 2H89C 2W6JH 1QVGO 2NPSB 1KYOE 1CW5A 1J1EC 3L75D 2KLVA 3HUSB 3F89A 3CCUP 2Z5IA 4AYCA 2ITAA 1SQBJ 2HODB 3H1ID 1NOHA 4EI2A 2FYUD 1SQPJ 1CI6A 5AW8B 3AE3C 3IR9A 2AEJA 3G71P 1FE6A 4H44C 3CX5E 3E1IA 3RK3C 1K05A 1OFCX 2IDBA 3SWKA 2W6BA 3Q1MA 3CX5H 1X22A 2QM7A 1VQKP 3CPWO 4NPFX 1RF0A 1NTMK 1L0NJ 1PPJE 5DJUB 2M3BA 2I8DA 2R3SA 1Q90D 3L75G 3I55P 2K3RA 1H8AA 2RMZA 1LT9A 1KB9H 2N1TC 4HKZH 3SWFA 1NTKK 2IBZD 3G4SP 4YXDC 5AVTB 4OGQB 1FOSE 1N73C 1IJDB 3WUUA 1P84D 5APXA 2N9BA 2B89A 1PP9J 1SQBK 1LNQA 2QG4A 3HUSA 1S4XA 3M0DC 4N78E 3TGUJ 2A06D 3H1JJ 1SQPK
chains in the Genus database with same CATH topology
2PP6A 1URQC 5CCGD 4JYCA 2Q9IA 1AQ5A 3T97A 1RE3C 1FZFA 1NU1K 1LWUA 1SLQA 3U59A 1X9VA 5AVWB 1FDMA 4Y99C 1JMMA 3MTUE 1ZLLA 1JTHB 4LGDE 2C9LY 1GL2D 2L5GB 2KB7P 1GL2B 1GK4A 3RK3D 1LTJB 3RK3B 3NMDA 1HWTC 3O8ZA 2HPCB 1LTAC 5APTA 3VMXA 1HVVA 1RE4C 4O9BA 4JF7A 3VN0A 2WT7B 2Q7CA 2PAJA 1YTZT 1FZCB 1ZR2A 1HUCA 1H89A 1VPCA 2BASA 3OA7A 2YKPA 1T2KC 2HG5D 1MUUA 1FZAA 1CZQA 3M9HA 5AVSB 2VRSA 1X79B 5APYA 1LWUB 2HFED 1SFCD 2FYZA 1GU5A 1J2JB 2A45H 2YKQA 3IFMA 2YMYA 2XV5A 3VYIA 2WITA 1A02J 2N1TD 1KILD 4XE5B 1KILB 1N7SA 1SP4A 3MIWA 1JUNA 3M91A 2IFMA 1MZ9A 1L4AD 1NO4A 1NWQA 3HD7C 4ZKUA 2O1JA 1J1DB 1JY3O 1N73B 2YNYA 2WWWA 3B5NA 2YKOA 2WZ7A 3BASA 4EIJA 2C0XA 1JY2N 2NPSC 1HGVA 4JYBA 4EOTA 2FFDC 1EQ7A 2WPRA 3C9IA 5AVZB 1HH0A 1JY2P 3L4FA 2ZXEB 1RY3A 3G3ZA 1URQD 4LLHA 1URQB 5CCGA 4IFFA 1DH3A 3TNUB 3VMZA 2P1JA 4Y99B 2HYNA 1JTHA 1HJBA 2I1KA 2GUVA 1IFDA 1GU4A 1GL2A 1LTJA 1L0LK 3N7NA 4WY4C 3KYQA 4RESB 1OWAA 1H88A 4C7RA 2R32A 1J1EB 3NTNA 5APSA 2HPCA 2J59M 1DX7A 2A45I 2JJLA 4C7NA 1G2CB 2P7JA 1WT6A 3V4WA 3EQ2A 1FZCA 5CJ0A 1DEBA 1T8ZA 2LKMA 2M8RA 1T2KD 1MFZA 3MD0A 1SQXK 1LGHB 1NAFA 2XKMA 1KFMA 2W27A 4W7ZA 1SFCA 1ZN5A 4AQRD 2OYIC 1VDFA 3A3YB 5AW9B 5KJ7C 1X8YA 2P67A 4XA4A 1T3UA 2N1TA 3L36A 1KILA 4WBAA 1N7LA 1GTWA 1M1JA 3LW5H 1FZGA 2WPQA 2POHA 4WB4A 1L4AA 1Z56A 2WTYA 5BU8B 2IX7C 2R5DA 1M7LA 1N73A 3U1AA 4C7NB 1S9KD 3L37A 1YTZI 5AW4B 2XU6A 3H32A 2XDJA 1HBWA 2GUSA 5AVRB 1RF0C 3A7OA 3UIAA 5CCHC 3GHGC 3HRNA 3WMM0 3R2PA 3OAKA 1FJKA 2FFDB 4W7YA 2OYHC 1YYCA 3M0DA 1LTGC 2P2UA 1SFCB 4HYTB 4IFMA 1FZEA 1OXZA 1SQVK 2KOGA 1RF1C 1XTGB 1URQA 4DZOA 4I6MC 2N1TB 3P32A 1LT9C 3V4QA 1G1JA 1JNMA 2CPSA 2A45G 1M1JB 1RE3A 4LC1A 3A5TA 3TNUA 1IFMA 1FOSF 1L4AB 3P8CD 3EFGA 1AFOA 3M0AA 1CSBA 5AW1B 1JY2O 4WY4D 3V5BA 2KP8A 3H32B 3LIDA 4WY4B 1IO4A 3PP5A 4HH2A 4IFDK 1ZR4A 1JCDA 3M9BA 1LTBC 3II6A 1NHLA 1RE4A 1G2CA 3HUSC 2IFNA 2ZFCA 4N78D 3BATA 1SQQK 2CPBA 5AW7B 3SWYA 2WPSA 1S9KE 3VMYA 5BU5A 1JOCA 1IC2A 2WSFH 5KTBA 2FXMA 2FKWB 3B8EB 2Q5UA 2KSJA 1NH4A 2OYIB 3VOPA 1GW4A 1QL2A 5AW2B 5KJ7D 1FBMA 1LWUC 1KQLA 3P7KA 4OH8B 2QM8A 3KQGA 5APWA 4C46A 5BVZA 5AVVB 4KHXA 3U1CA 3RK2C 3HD7A 1G1IA 3A2AA 4GT1A 3HE4A 4I2LC 3P8CE 4N3YB 2YO2A 1FZBA 3KDPB 3MUDA 2JEEA 3VTPC 3V2QA 4DOJA 2FYUK 3H6PA 1NKZB 1PFIA 5CCHD 3NFQA 2Z5HA 2NPSA 3GHGB 3V2RA 5KLVK 2FFDA 1LTIC 2H7HA 1LTSC 1W2EA 1JO5A 2XNXA 3CL3D 2HODA 3CI9A 1RF1B 1FJPA 5APVA 1FU1A 3VP9A 1FAVA 1GD2E 3VP8A 2XZRA 3HD7D 1MV8A 3V2PA 3HD7B 1IFIA 1N7SC 3HTKB 2O01H 4B86A 4ZKPA 3HE4B 1LTTC 3NXSA 2R5BA 4WY4A 3TSIA 2HLOA 1HGZA 5AW6B 1ZV8A 1HTLC 1QL1A 2NPSD 4M3LA 2NPSB 4I1LA 3B5NC 1CW5A 1J1EC 1L0NK 2KLVA 3HUSB 1KFNA 2J58A 2Z5IA 2C0WA 5CHXA 4AYCA 2MJZA 2YO3A 1N2DC 2WSCH 2HODB 3RL0C 1T3JA 3OJAB 1NOHA 1NTZK 4GKGA 5CCGC 2OYIA 5AVQB 1CI6A 5AW8B 5AW5B 5KJ7A 2O1KA 5APQA 3BRVB 2I1JA 1IK9A 5AVYB 3IR9A 2Z4EA 1GL2C 1IFNA 1KZUB 3RK2D 1LTJC 3E1IA 3RK3C 3RK2B 4N6JA 5CMZA 2E43A 3I5CA 2W6BA 1N86A 2OARA 2QM7A 3N4XA 3V2NA 1A02F 4AUWA 1IFJA 1RF0A 1NTMK 3P8MC 5AW0B 5CCHA 1FZCC 2H8PD 2M3BA 3GHGA 3TK1A 3BVHA 1JY3N 1GW3A 3LIEA 3KPEA 1XTCC 2IPPA 2OYHA 2R3CA 1CI6B 1H8AA 1JY3P 1RF1A 1SFCC 3HE5A 1LT9A 3CLQA 5AVUB 1SVFA 2N1TC 1KILC 3SWFA 1N7SD 3HTKA 1N7SB 3M06A 1NTKK 2C9NY 1M1JC 4W80A 3M9QA 1GK6A 1L4AC 3L35A 1E5WA 1J1DC 1NKNA 5AVTB 1FOSE 1N73C 1IJDB 2KYVA 2Q3IA 5CJ4A 5AW3B 4GIFA 1GZLA 2E42A 5APXA 2N9BA 5AVXB 3B5ND 2WSEH 3BRTB 3B5NB 1GDTA 1SQBK 1JCCA 3HUSA 2OYHB 1WRGA 5APUA 3MGNA 3TYYA 2WT7A 3M0DC 4N78E 2H43A 2W6AA 3HE5B 3RL0D 1SQPK 1LT9B 3RL0B 2GM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZE A;  2Z4E A;  2OYI B;  1N73 C;  1JY2 N;  1LTJ C;  3E1I A;  2Q9I A;  1RF1 C;  1LWU C;  1RE4 C;  1N73 A;  1JY3 P;  2HOD B;  1RE3 C;  2FFD C;  1LTJ A;  3GHG B;  1FZF A;  1LT9 C;  1RF1 A;  1LWU A;  1RE4 A;  3HUS C;  1FZC B;  2A45 G;  1JY2 P;  1M1J B;  1N86 A;  1RE3 A;  3H32 A;  2FFD A;  1LT9 A;  2OYI C;  3HUS A;  2OYH B;  2HLO A;  2HPC A;  1RF0 C;  2OYI A;  1JY3 O;  1W2E A;  1N73 B;  1FZA A;  2A45 I;  2XNX A;  3GHG C;  1T3U A;  1LTJ B;  1RF0 A;  1M1J C;  2HOD A;  1RF1 B;  1JY2 O;  1FZC C;  1LWU B;  2H43 A;  3GHG A;  2FFD B;  3BVH A;  2OYH C;  1FZB A;  1M1J A;  1FZG A;  3H32 B;  1JY3 N;  3HUS B;  1LT9 B;  1FZC A;  2A45 H;  2HPC B;  2OYH A; 
#chains in the Genus database with same CATH topology
 2V7Q J;  3TF5 A;  4IL6 E;  1NTM D;  3L73 G;  1NYH A;  1FZF A;  3U59 A;  1OW6 A;  1USE A;  3PH0 A;  4H44 D;  2KB7 P;  2KZI A;  3RK3 D;  5H2F E;  3RGU A;  1LT1 A;  1JMB A;  2HPC B;  2V4H A;  1L0L J;  5H2F H;  1NTK D;  4JF7 A;  2Q7C A;  4IOI H;  1JM0 A;  1FZC B;  1T2K C;  2HG5 D;  2G8Y A;  3M9H A;  2AXC A;  5APY A;  1GU5 A;  2A06 G;  1USD A;  3Q5P A;  1PGO A;  3VYI A;  2WMM A;  4ASW A;  2N1T D;  3L74 J;  1KIL B;  3JSV C;  4PD4 E;  2IFM A;  3HD7 C;  4I7Z B;  1Q86 Q;  4PD4 H;  2PRR A;  2YNY A;  4ASV A;  3AE7 C;  1AVO A;  3WUT A;  1Q2N A;  2K9Y A;  2WZ7 A;  1OX3 A;  1S72 P;  4H0L B;  1JY2 N;  1QEX A;  3L75 E;  4EOT A;  4Z1M H;  1HH0 A;  2KUB A;  2XND H;  2JO1 A;  1EDL A;  3FXE A;  5CCG A;  4IFF A;  1AJY A;  3TNU B;  4Y99 B;  2IBZ I;  3W68 A;  4DCK A;  1GU4 A;  2E5T A;  1L0L K;  4H13 B;  2YMK A;  4WY4 C;  3KYQ A;  4RES B;  1KIL E;  1J1E B;  1P84 I;  2AEM A;  3NTN A;  2HPC A;  1S5L E;  2J59 M;  2GA1 A;  1G2C B;  3L71 G;  1WT6 A;  1FZC A;  2LKM A;  1T2K D;  1ZW0 A;  3MD0 A;  1SQX K;  1LGH B;  1NAF A;  1SFC A;  3L73 E;  1VDF A;  2N9Y B;  1X8Y A;  4GOF A;  3PRJ A;  4XA4 A;  1KIL A;  3AEE C;  2BCC D;  5AW4 B;  2KK7 A;  2WVR A;  1S2E A;  2XDJ A;  5AVR B;  1SQV G;  1RF0 C;  3A7O A;  1RQU A;  3CC7 P;  1L0L D;  2FFD B;  2IZ1 A;  4A7P A;  2A06 E;  2N1T B;  3CC4 P;  1LT9 C;  3EWK A;  2A45 G;  4LC1 A;  3TNU A;  3JCU E;  3P8C D;  2E74 C;  1CSB A;  1SQX D;  3JCU H;  1AV1 A;  1JY2 O;  2OGU A;  4WY4 D;  3RK3 E;  1ZR4 A;  3GLM A;  1VQM P;  2BCC G;  1RE4 A;  4U3F G;  1G2C A;  3HUS C;  5EFW B;  5KLI C;  1SQQ K;  2CPB A;  3QWO C;  1NJI Q;  3LW5 J;  4UB8 E;  1IC2 A;  5TJH A;  2FXM A;  4UB8 H;  1NH4 A;  1GW4 A;  1QL2 A;  3P7K A;  3RBZ A;  4OH8 B;  2QM8 A;  2QRX A;  3KQG A;  5BVZ A;  5AVV B;  4KHX A;  3TDK A;  1KYO D;  1BGY D;  1SQX G;  2KIK A;  3MUD A;  3KDP B;  2JEE A;  3VTP C;  4D6T D;  4UB6 E;  1JEK A;  3L71 E;  2KSE A;  1U57 A;  1PL5 A;  3CCS P;  3GHG B;  3WUV A;  3CXH D;  2FFD A;  1LTI C;  4CPG A;  1VL2 A;  1YI2 P;  4R4M A;  2H7H A;  1LP1 A;  2K9J B;  3G9R A;  1W2E A;  2XNX A;  1RF1 B;  3CX5 D;  3SSU A;  1SQQ D;  4PJ0 E;  3HD7 B;  2BEZ F;  1KV4 A;  4B86 A;  3L75 J;  1ZME C;  1S1C X;  3AE2 C;  1EZV G;  3IN6 A;  4PJ0 H;  1OMI A;  1PPJ D;  3TSI A;  1AA0 A;  1HGZ A;  5AW6 B;  1ZV8 A;  2NPS D;  4M3L A;  1BGY G;  1SQV E;  4D6T G;  1NTZ G;  2C0W A;  2YO3 A;  1MKM A;  2YXR B;  4QMA A;  5CCG C;  3IF4 A;  2B87 A;  1Q81 Q;  5AVQ B;  5AW5 B;  3BRV B;  1IK9 A;  1SQQ G;  2Z4E A;  1KZU B;  5B66 E;  1N86 A;  3W67 A;  1M90 Q;  3S9O A;  3L73 J;  2BCC E;  3N4X A;  4U3F E;  2QSI A;  4AUW A;  1IFJ A;  3CWB G;  1FZC C;  5AW0 B;  3GHG A;  3BVH A;  2OYH A;  1M56 D;  2K9J A;  3I56 P;  1CI6 B;  1JY3 P;  1RF1 A;  1SFC C;  3D71 A;  3CLQ A;  3FGA D;  2QJK B;  2QA4 P;  1KIL C;  1N7S B;  5CBN A;  4W80 A;  1KYO I;  3L35 A;  1E5W A;  2OYO A;  1SQX E;  2Q3I A;  5AW3 B;  1FDI A;  4GIF A;  2E42 A;  2WSE H;  3B5N B;  1DIP A;  4H0L C;  1NTM J;  2Y9Y A;  4HJG H;  5APU A;  3TYY A;  1NU1 G;  2H43 A;  1KC8 Q;  1LT9 B;  2PP6 A;  2K37 A;  4PD4 D;  3S4R A;  3CX5 I;  5CCG D;  4JYC A;  2E74 B;  1LWU A;  1SLQ A;  1X9V A;  4Y99 C;  1JMM A;  3MTU E;  1EZV E;  1JTH B;  2C9L Y;  4H13 C;  3NMD A;  2LR2 A;  5GTH E;  1KMI Z;  3JC2 2;  1BGY E;  1LTA C;  5KLI B;  5GTH H;  1NGM B;  2G3A A;  1KYO H;  3L70 G;  3VMX A;  3ZDM A;  1RE4 C;  4MN4 C;  4O9B A;  3VN0 A;  1KB9 I;  4D6T E;  1NTZ E;  2YKP A;  1FZA A;  1CZQ A;  5AVS B;  2D2C B;  3CXH E;  1X79 B;  2HFE D;  2Q3E A;  1SFC D;  1J2J B;  1W2B O;  4KJM A;  3IFM A;  3CXH H;  3L71 J;  2XV5 A;  2WIT A;  1A02 J;  1KIL D;  4XE5 B;  1N7S A;  1SP4 A;  1SQQ E;  3M91 A;  1MZ9 A;  4ZKU A;  3SFE C;  2L91 A;  5KAF E;  1YQ4 C;  3MUD C;  2WPV B;  5KAF H;  3B5N A;  4EIJ A;  4H0L D;  3CWB E;  3CCE P;  4JYB A;  3L73 D;  2FFD C;  3L4F A;  1RY3 A;  1RHZ B;  3G3Z A;  2WSS H;  2HR3 A;  1EXJ A;  3H1H G;  3CCM P;  1SQV J;  1DH3 A;  1M57 D;  3PHL A;  5L8R J;  2QE7 H;  1JTH A;  1HJB A;  2FXO A;  4JBZ A;  1IFD A;  3CD6 P;  4H13 D;  1OWA A;  4OVN F;  4HB1 A;  3Q3D A;  1KTM A;  2JJL A;  2SPZ A;  1VQ5 P;  2YIU B;  2P7J A;  5CJ0 A;  1DEB A;  1NU1 E;  2AXT E;  1MFZ A;  3FXD A;  4XFJ A;  4PD4 I;  2AXT H;  2XKM A;  1KFM A;  4IL6 H;  3A3Y B;  2BCC J;  5AW9 B;  3L36 A;  3H1K G;  4WBA A;  1M1J A;  3LW5 H;  1Z56 A;  1M7L A;  2H88 C;  3L37 A;  3L70 E;  2RKL A;  1YJ9 P;  3A0H E;  2GUS A;  2PGD A;  3AEA C;  3UIA A;  3GHG C;  3HRN A;  3WMM 0;  3OAK A;  3D70 A;  1FJK A;  2OYH C;  1LTG C;  1SFC B;  4HYT B;  1OXZ A;  1SQX J;  1SQV K;  2WSE J;  2Y9Z A;  2KOG A;  1RF1 C;  1VF5 C;  2OQQ A;  3V4Q A;  1JNM A;  2BEQ D;  3AEF C;  3M0A A;  4Y28 J;  2PFX A;  3L71 D;  5KLV D;  2CK3 H;  3LID A;  3L72 G;  2Q6Q A;  3AEG C;  4IFD K;  3BCC D;  1JCD A;  2ZT9 B;  1NHL A;  1OZH A;  5AW7 B;  3SWY A;  1S9K E;  1VQO P;  5BU5 A;  1JOC A;  2WSF H;  2Q5U A;  3H1H E;  1YBK A;  1BGY J;  2OYI B;  1IZN B;  1LWU C;  3Q5S A;  4D6T J;  1NTZ J;  3U1C A;  1SQV D;  1NAY A;  4I2L C;  3CCV P;  4N3Y B;  2YO2 A;  5KLV G;  1S5L H;  4DOJ A;  4GOE A;  1NKZ B;  5K5G B;  3BCC G;  2Z5H A;  1JB0 J;  1SQQ J;  3V2R A;  3CMA P;  1YIJ P;  1JO5 A;  3O6Q B;  4BRY A;  2QJK C;  3CWB J;  3HD7 D;  3H1K E;  1E79 H;  2OTL P;  1N7S C;  3HTK B;  4U3F D;  2R5B A;  1L0N G;  2B9B A;  1X0T A;  3CCJ P;  1W5C E;  2J5U A;  1QL1 A;  4I1L A;  3B5N C;  3GG2 A;  2OTK E;  5B5E E;  1KFN A;  1M8O B;  2J58 A;  1LP1 B;  2ZXX A;  5CHX A;  2Y0C A;  5CBO A;  1T3J A;  3OJA B;  2JP3 A;  2Q1K A;  1NTZ K;  2OYI A;  2RN0 A;  5KJ7 A;  1N8R Q;  5APQ A;  1VQ7 P;  5AVY B;  3AE9 C;  3USS A;  1Y47 A;  1NU1 J;  4GOD A;  1D7M A;  3RK2 B;  3I5C A;  3L72 E;  4OWF A;  2OAR A;  2IYO A;  3H1J G;  1VQ9 P;  5CCH A;  1YHQ P;  2H8P D;  3TK1 A;  1K04 A;  1QLE D;  1VQ4 P;  2IPP A;  2B87 B;  3B4S A;  2D2C C;  1EZV D;  3O6Q A;  3L70 J;  3HE5 A;  2W83 C;  2AEF A;  1N7S D;  3HTK A;  2C9N Y;  1M1J C;  3EFF K;  1NTZ D;  2KYV A;  5CJ4 A;  5KLV E;  2RH0 A;  1GZL A;  5AVX B;  3B5N D;  4UB6 H;  1GDT A;  1K9M Q;  1JCC A;  3BCC E;  3WU2 E;  2OYH B;  1WRG A;  2E76 B;  3MGN A;  2WT7 A;  3AE8 C;  3WU2 H;  1VF5 B;  3RL0 B;  1EDK A;  1SS1 A;  2QJY B;  2Q9I A;  1OW8 A;  2E74 D;  1ZOY C;  3GMA A;  2MKV A;  1NU1 K;  1YJN P;  2WSF J;  1EDJ A;  4LGD E;  2NRG A;  2L5G B;  1GL2 B;  1GK4 A;  1LTJ B;  3CWB D;  1HWT C;  1K8A Q;  3O8Z A;  3ABV C;  3H1H J;  3PLN A;  3H1L G;  2JDI H;  1EC5 A;  2YIU C;  1YTZ T;  2FYN B;  1ZR2 A;  1HUC A;  2BAS A;  3OA7 A;  4PV1 C;  2D2C D;  1LWU B;  3IAO A;  2A45 H;  3K5B A;  2YKQ A;  2YMY A;  2ZYA A;  1VQP P;  3MIW A;  5KKZ B;  1NO4 A;  1NWQ A;  2O1J A;  1UII A;  1J1D B;  3MZW B;  5B66 H;  1AQT A;  2WWW A;  1NU1 D;  2E5Y A;  3H1J E;  3PJS K;  2YKO A;  3BAS A;  2C0X A;  1PZQ A;  3H1K J;  2M5A A;  1EQ7 A;  2WPR A;  3C9I A;  2E75 B;  1JY2 P;  2LXC B;  1QVF O;  1EZV I;  1URQ B;  1IFP A;  4L74 A;  2LXB A;  1VQL P;  4L73 A;  1EDI A;  2HYN A;  3L70 D;  3CC2 P;  2I1K A;  2GUV A;  4DJG A;  1GL2 A;  1LTJ A;  3N7N A;  2ZT9 C;  3CXH I;  3PTZ A;  4C7N A;  1BSH A;  1VQ8 P;  1R5L A;  3EQ2 A;  1T8Z A;  2M8R A;  4RO0 A;  3L72 J;  3VMA A;  2W27 A;  4W7Z A;  2OYI C;  1ZN5 A;  4AQR D;  1DD4 A;  5KJ7 C;  2P10 A;  1T3U A;  1N7L A;  1GTW A;  1ZRT D;  2POH A;  3AE6 C;  5GTI E;  1L4A A;  1DEE G;  3CME P;  2WTY A;  5BU8 B;  2IX7 C;  2R5D A;  3U1A A;  1BDD A;  3H1L E;  5GTI H;  3GW6 A;  1S9K D;  1YTZ I;  2XU6 A;  3H32 A;  1IK7 A;  1HBW A;  3V6I A;  5CCH C;  3H1H D;  1S3J A;  1PGQ A;  3R2P A;  3Q5R A;  4W7Y A;  1OVR A;  2P2U A;  1FZE A;  5KLV J;  1URQ A;  1G1J A;  2CPS A;  1M1J B;  1RE3 A;  3A5T A;  3BCC J;  1AFO A;  1K73 Q;  3MHV A;  3AE4 C;  3PP5 A;  1YQ3 C;  2ZT9 D;  2O01 N;  3C1L A;  2KNC B;  5TIS E;  1ZXG A;  1OVV A;  2WPS A;  5TIS H;  1Y9B A;  5KTB A;  2KI7 B;  3H1K D;  1VQ6 P;  4DT0 A;  2KSJ A;  5E79 E;  1RH5 B;  1FS0 E;  3VOP A;  5AW2 B;  5KJ7 D;  1FBM A;  5E79 H;  1KB9 E;  1KQL A;  1NVO A;  3H1I G;  5APW A;  4C46 A;  4ZNC A;  2FYU G;  3AED C;  3RK2 C;  1G1I A;  4NPD A;  3HE4 A;  3AE1 C;  1FDO A;  3V2Q A;  2NZ2 A;  3D6Z A;  1BE3 D;  2Y0E A;  1BCC D;  1PFI A;  1UIX A;  5CCH D;  3NFQ A;  2NPS A;  4PV1 B;  2ZVN B;  1EXI A;  5KLV K;  1LTS C;  4U3F J;  1H0T B;  3CL3 D;  2HOD A;  3CI9 A;  1FJP A;  3CCL P;  5APV A;  1FU1 A;  1FAV A;  1GD2 E;  3L72 D;  3VP8 A;  3FWN A;  1IFI A;  2FXP A;  2O01 H;  2IZ0 A;  4GDO A;  4BWN A;  2HLO A;  3FX0 A;  3KHU A;  1HTL C;  2ZVO B;  3A0H H;  2IBZ G;  1L0N K;  2KNC A;  3RBX A;  2E76 C;  4EYY Q;  3OW2 O;  1BE3 G;  2MJZ A;  1BCC G;  1N2D C;  2WSC H;  2WQY C;  3RL0 C;  4BRY B;  2QJY C;  4NPE A;  4GKG A;  3T97 B;  1KN7 A;  2O1K A;  3FWL A;  3CCQ P;  2I1J A;  1SQB D;  1PV3 A;  1GL2 C;  1IFN A;  1R8E A;  3RK2 D;  1LTJ C;  4N6J A;  5CMZ A;  2E43 A;  1ZRT E;  1NTM G;  3GF7 A;  4IL6 X;  1PGJ A;  1SQP D;  1BSN A;  3V2N A;  1A02 F;  3P8M C;  2FYN C;  2M0B A;  3KZI E;  1JY3 N;  1GW3 A;  3LIE A;  1HF9 A;  3KPE A;  1XTC C;  1R5S A;  2R3C A;  3KZI H;  1NTK G;  1H0T A;  3H1L J;  2YXQ B;  1L0N D;  1KD1 Q;  2FBW C;  2QIW A;  2K1A A;  5AVU B;  1SVF A;  3H1I E;  1Y8A A;  3M06 A;  2FYU E;  2QVA A;  4BXL A;  5KKZ C;  3M9Q A;  1GK6 A;  1L4A C;  1J1D C;  1SQB G;  1NKN A;  1AVY A;  2Y0D A;  3BRT B;  2IYP A;  1SQP G;  2E76 D;  3AEB C;  2E75 C;  1VF5 D;  1DD3 A;  2W6A A;  3HE5 B;  3RL0 D;  3CCR P;  2GM4 A;  1PP9 D;  4U7J A;  1MFT A;  1URQ C;  1AQ5 A;  3T97 A;  1RE3 C;  5AVW B;  3TGU D;  1FDM A;  1QX8 A;  3E7K A;  1ZLL A;  1FC2 C;  3H1J D;  1GL2 D;  1Q7Y Q;  4H44 B;  1Q82 Q;  3RK3 B;  3S1K A;  2QJP C;  1PIX A;  4WVZ A;  1HJ0 A;  2JR8 A;  5APT A;  1LJ2 A;  2IBZ E;  1HVV A;  1KQS O;  2WT7 B;  2PAJ A;  5B5E H;  3G6E P;  1BE3 E;  1H89 A;  1BCC E;  1VPC A;  1P84 E;  4K3A A;  1MUU A;  1S5L X;  2KS1 B;  5KAI E;  2VRS A;  2ZAE B;  1P84 H;  2FYZ A;  4TT3 H;  1T6A A;  5KAI H;  2B88 A;  1YIT P;  3H25 A;  4JPZ B;  1PP9 G;  1M1K Q;  1JUN A;  2ZYD A;  2JWD A;  1L4A D;  1NTM E;  3TGU G;  1JY3 O;  1N73 B;  2W90 A;  2P58 A;  3L74 D;  2O01 J;  3QH9 A;  1KOR A;  2NPS C;  1HGV A;  1L2P A;  2E75 D;  5AVZ B;  1RQV A;  2ZXE B;  1NTK E;  4R4L A;  2JWA A;  1URQ D;  4LLH A;  2K88 A;  1U7M A;  1L0L G;  2WSC J;  4KT0 J;  3H1L D;  3VMZ A;  2P1J A;  1SQB E;  4YXW H;  3R4Y A;  1H88 A;  4C7R A;  2R32 A;  5APS A;  1DX7 A;  2M5A B;  1SQP E;  2A45 I;  3V4W A;  3L74 G;  4JQ0 D;  3B71 A;  2KS1 A;  1OIP A;  1OW7 A;  1QGK B;  2KLU A;  2DW3 A;  3AEC C;  2FY8 A;  2P67 A;  3D6Y A;  1L0N E;  2N1T A;  1FZG A;  2WPQ A;  4TLF A;  4WB4 A;  5M1B A;  3MP7 B;  2OTJ P;  1N73 A;  4C7N B;  5DJT B;  2JKV A;  4OGQ C;  3H1I J;  2ZYG A;  2ZJS E;  2FYU J;  3A0B E;  1TU3 F;  1YYC A;  3M0D A;  1KB9 D;  4IFM A;  3A0B H;  1YJW P;  1XTG B;  4DZO A;  1U7J A;  4I6M C;  3P32 A;  1PP9 E;  1IFM A;  1FOS F;  3KXD A;  1L4A B;  3EFG A;  3RL0 g;  4EDF A;  5AW1 B;  3GF3 A;  3TGU E;  3V5B A;  2KP8 A;  3H32 B;  1IO4 A;  4WY4 B;  3F5H A;  2O3J A;  4HH2 A;  3M9B A;  1LTB C;  3II6 A;  2V7Q H;  2M3E A;  1VQN P;  2IFN A;  2ZFC A;  3AE5 C;  4N78 D;  3BAT A;  5C39 A;  1PPJ G;  2W8Z A;  1GMJ A;  3VMY A;  2KZJ A;  1WMK A;  4L75 A;  2FKW B;  3B8E B;  1L0L E;  1BDC A;  4WWI A;  1BE3 J;  1BCC J;  2QJP B;  3Q2Y A;  3HD7 A;  3A2A A;  1ZP0 C;  4GT1 A;  2KXP B;  3SFD C;  3P8C E;  4I7Z C;  1FZB A;  4RKU J;  4OGQ D;  2FYU K;  2R44 A;  3H6P A;  4RJT A;  3L74 E;  1PGP A;  3C8V A;  4PV1 D;  3E1R A;  1OVU A;  2QEX P;  3VP9 A;  1KQF B;  4YPC A;  4YTP C;  1KQG B;  2XZR A;  1MV8 A;  3V2P A;  4K35 A;  4ZKP A;  3HE4 B;  3ITK A;  1LTT C;  2UWJ E;  3NXS A;  4L76 A;  1NTK J;  4WY4 A;  4ZMD A;  2H89 C;  2W6J H;  1QVG O;  2NPS B;  1KYO E;  1CW5 A;  1J1E C;  3L75 D;  2KLV A;  3HUS B;  3F89 A;  3CCU P;  2Z5I A;  4AYC A;  2ITA A;  1SQB J;  2HOD B;  3H1I D;  1NOH A;  4EI2 A;  2FYU D;  1SQP J;  1CI6 A;  5AW8 B;  3AE3 C;  3IR9 A;  2AEJ A;  3G71 P;  1FE6 A;  4H44 C;  3CX5 E;  3E1I A;  3RK3 C;  1K05 A;  1OFC X;  2IDB A;  3SWK A;  2W6B A;  3Q1M A;  3CX5 H;  1X22 A;  2QM7 A;  1VQK P;  3CPW O;  4NPF X;  1RF0 A;  1NTM K;  1L0N J;  1PPJ E;  5DJU B;  2M3B A;  2I8D A;  2R3S A;  1Q90 D;  3L75 G;  3I55 P;  2K3R A;  1H8A A;  2RMZ A;  1LT9 A;  1KB9 H;  2N1T C;  4HKZ H;  3SWF A;  1NTK K;  2IBZ D;  3G4S P;  4YXD C;  5AVT B;  4OGQ B;  1FOS E;  1N73 C;  1IJD B;  3WUU A;  1P84 D;  5APX A;  2N9B A;  2B89 A;  1PP9 J;  1SQB K;  1LNQ A;  2QG4 A;  3HUS A;  1S4X A;  3M0D C;  4N78 E;  3TGU J;  2A06 D;  3H1J J;  1SQP K; 
#chains in the Genus database with same CATH homology
 2PP6 A;  1URQ C;  5CCG D;  4JYC A;  2Q9I A;  1AQ5 A;  3T97 A;  1RE3 C;  1FZF A;  1NU1 K;  1LWU A;  1SLQ A;  3U59 A;  1X9V A;  5AVW B;  1FDM A;  4Y99 C;  1JMM A;  3MTU E;  1ZLL A;  1JTH B;  4LGD E;  2C9L Y;  1GL2 D;  2L5G B;  2KB7 P;  1GL2 B;  1GK4 A;  3RK3 D;  1LTJ B;  3RK3 B;  3NMD A;  1HWT C;  3O8Z A;  2HPC B;  1LTA C;  5APT A;  3VMX A;  1HVV A;  1RE4 C;  4O9B A;  4JF7 A;  3VN0 A;  2WT7 B;  2Q7C A;  2PAJ A;  1YTZ T;  1FZC B;  1ZR2 A;  1HUC A;  1H89 A;  1VPC A;  2BAS A;  3OA7 A;  2YKP A;  1T2K C;  2HG5 D;  1MUU A;  1FZA A;  1CZQ A;  3M9H A;  5AVS B;  2VRS A;  1X79 B;  5APY A;  1LWU B;  2HFE D;  1SFC D;  2FYZ A;  1GU5 A;  1J2J B;  2A45 H;  2YKQ A;  3IFM A;  2YMY A;  2XV5 A;  3VYI A;  2WIT A;  1A02 J;  2N1T D;  1KIL D;  4XE5 B;  1KIL B;  1N7S A;  1SP4 A;  3MIW A;  1JUN A;  3M91 A;  2IFM A;  1MZ9 A;  1L4A D;  1NO4 A;  1NWQ A;  3HD7 C;  4ZKU A;  2O1J A;  1J1D B;  1JY3 O;  1N73 B;  2YNY A;  2WWW A;  3B5N A;  2YKO A;  2WZ7 A;  3BAS A;  4EIJ A;  2C0X A;  1JY2 N;  2NPS C;  1HGV A;  4JYB A;  4EOT A;  2FFD C;  1EQ7 A;  2WPR A;  3C9I A;  5AVZ B;  1HH0 A;  1JY2 P;  3L4F A;  2ZXE B;  1RY3 A;  3G3Z A;  1URQ D;  4LLH A;  1URQ B;  5CCG A;  4IFF A;  1DH3 A;  3TNU B;  3VMZ A;  2P1J A;  4Y99 B;  2HYN A;  1JTH A;  1HJB A;  2I1K A;  2GUV A;  1IFD A;  1GU4 A;  1GL2 A;  1LTJ A;  1L0L K;  3N7N A;  4WY4 C;  3KYQ A;  4RES B;  1OWA A;  1H88 A;  4C7R A;  2R32 A;  1J1E B;  3NTN A;  5APS A;  2HPC A;  2J59 M;  1DX7 A;  2A45 I;  2JJL A;  4C7N A;  1G2C B;  2P7J A;  1WT6 A;  3V4W A;  3EQ2 A;  1FZC A;  5CJ0 A;  1DEB A;  1T8Z A;  2LKM A;  2M8R A;  1T2K D;  1MFZ A;  3MD0 A;  1SQX K;  1LGH B;  1NAF A;  2XKM A;  1KFM A;  2W27 A;  4W7Z A;  1SFC A;  1ZN5 A;  4AQR D;  2OYI C;  1VDF A;  3A3Y B;  5AW9 B;  5KJ7 C;  1X8Y A;  2P67 A;  4XA4 A;  1T3U A;  2N1T A;  3L36 A;  1KIL A;  4WBA A;  1N7L A;  1GTW A;  1M1J A;  3LW5 H;  1FZG A;  2WPQ A;  2POH A;  4WB4 A;  1L4A A;  1Z56 A;  2WTY A;  5BU8 B;  2IX7 C;  2R5D A;  1M7L A;  1N73 A;  3U1A A;  4C7N B;  1S9K D;  3L37 A;  1YTZ I;  5AW4 B;  2XU6 A;  3H32 A;  2XDJ A;  1HBW A;  2GUS A;  5AVR B;  1RF0 C;  3A7O A;  3UIA A;  5CCH C;  3GHG C;  3HRN A;  3WMM 0;  3R2P A;  3OAK A;  1FJK A;  2FFD B;  4W7Y A;  2OYH C;  1YYC A;  3M0D A;  1LTG C;  2P2U A;  1SFC B;  4HYT B;  4IFM A;  1FZE A;  1OXZ A;  1SQV K;  2KOG A;  1RF1 C;  1XTG B;  1URQ A;  4DZO A;  4I6M C;  2N1T B;  3P32 A;  1LT9 C;  3V4Q A;  1G1J A;  1JNM A;  2CPS A;  2A45 G;  1M1J B;  1RE3 A;  4LC1 A;  3A5T A;  3TNU A;  1IFM A;  1FOS F;  1L4A B;  3P8C D;  3EFG A;  1AFO A;  3M0A A;  1CSB A;  5AW1 B;  1JY2 O;  4WY4 D;  3V5B A;  2KP8 A;  3H32 B;  3LID A;  4WY4 B;  1IO4 A;  3PP5 A;  4HH2 A;  4IFD K;  1ZR4 A;  1JCD A;  3M9B A;  1LTB C;  3II6 A;  1NHL A;  1RE4 A;  1G2C A;  3HUS C;  2IFN A;  2ZFC A;  4N78 D;  3BAT A;  1SQQ K;  2CPB A;  5AW7 B;  3SWY A;  2WPS A;  1S9K E;  3VMY A;  5BU5 A;  1JOC A;  1IC2 A;  2WSF H;  5KTB A;  2FXM A;  2FKW B;  3B8E B;  2Q5U A;  2KSJ A;  1NH4 A;  2OYI B;  3VOP A;  1GW4 A;  1QL2 A;  5AW2 B;  5KJ7 D;  1FBM A;  1LWU C;  1KQL A;  3P7K A;  4OH8 B;  2QM8 A;  3KQG A;  5APW A;  4C46 A;  5BVZ A;  5AVV B;  4KHX A;  3U1C A;  3RK2 C;  3HD7 A;  1G1I A;  3A2A A;  4GT1 A;  3HE4 A;  4I2L C;  3P8C E;  4N3Y B;  2YO2 A;  1FZB A;  3KDP B;  3MUD A;  2JEE A;  3VTP C;  3V2Q A;  4DOJ A;  2FYU K;  3H6P A;  1NKZ B;  1PFI A;  5CCH D;  3NFQ A;  2Z5H A;  2NPS A;  3GHG B;  3V2R A;  5KLV K;  2FFD A;  1LTI C;  2H7H A;  1LTS C;  1W2E A;  1JO5 A;  2XNX A;  3CL3 D;  2HOD A;  3CI9 A;  1RF1 B;  1FJP A;  5APV A;  1FU1 A;  3VP9 A;  1FAV A;  1GD2 E;  3VP8 A;  2XZR A;  3HD7 D;  1MV8 A;  3V2P A;  3HD7 B;  1IFI A;  1N7S C;  3HTK B;  2O01 H;  4B86 A;  4ZKP A;  3HE4 B;  1LTT C;  3NXS A;  2R5B A;  4WY4 A;  3TSI A;  2HLO A;  1HGZ A;  5AW6 B;  1ZV8 A;  1HTL C;  1QL1 A;  2NPS D;  4M3L A;  2NPS B;  4I1L A;  3B5N C;  1CW5 A;  1J1E C;  1L0N K;  2KLV A;  3HUS B;  1KFN A;  2J58 A;  2Z5I A;  2C0W A;  5CHX A;  4AYC A;  2MJZ A;  2YO3 A;  1N2D C;  2WSC H;  2HOD B;  3RL0 C;  1T3J A;  3OJA B;  1NOH A;  1NTZ K;  4GKG A;  5CCG C;  2OYI A;  5AVQ B;  1CI6 A;  5AW8 B;  5AW5 B;  5KJ7 A;  2O1K A;  5APQ A;  3BRV B;  2I1J A;  1IK9 A;  5AVY B;  3IR9 A;  2Z4E A;  1GL2 C;  1IFN A;  1KZU B;  3RK2 D;  1LTJ C;  3E1I A;  3RK3 C;  3RK2 B;  4N6J A;  5CMZ A;  2E43 A;  3I5C A;  2W6B A;  1N86 A;  2OAR A;  2QM7 A;  3N4X A;  3V2N A;  1A02 F;  4AUW A;  1IFJ A;  1RF0 A;  1NTM K;  3P8M C;  5AW0 B;  5CCH A;  1FZC C;  2H8P D;  2M3B A;  3GHG A;  3TK1 A;  3BVH A;  1JY3 N;  1GW3 A;  3LIE A;  3KPE A;  1XTC C;  2IPP A;  2OYH A;  2R3C A;  1CI6 B;  1H8A A;  1JY3 P;  1RF1 A;  1SFC C;  3HE5 A;  1LT9 A;  3CLQ A;  5AVU B;  1SVF A;  2N1T C;  1KIL C;  3SWF A;  1N7S D;  3HTK A;  1N7S B;  3M06 A;  1NTK K;  2C9N Y;  1M1J C;  4W80 A;  3M9Q A;  1GK6 A;  1L4A C;  3L35 A;  1E5W A;  1J1D C;  1NKN A;  5AVT B;  1FOS E;  1N73 C;  1IJD B;  2KYV A;  2Q3I A;  5CJ4 A;  5AW3 B;  4GIF A;  1GZL A;  2E42 A;  5APX A;  2N9B A;  5AVX B;  3B5N D;  2WSE H;  3BRT B;  3B5N B;  1GDT A;  1SQB K;  1JCC A;  3HUS A;  2OYH B;  1WRG A;  5APU A;  3MGN A;  3TYY A;  2WT7 A;  3M0D C;  4N78 E;  2H43 A;  2W6A A;  3HE5 B;  3RL0 D;  1SQP K;  1LT9 B;  3RL0 B;  2GM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...