1RE3A

Crystal structure of fragment d of bbetad398a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
60
structure length
60
Chain Sequence
QHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrinogen alpha/alpha-E chain
publication title BbetaGlu397 and BbetaAsp398 but not BbetaAsp432 are required for "B:b" interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 19
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1re3A00
1N86A 1RE4A 3GHGC 2FFDC 1LT9A 2OYHB 2HPCB 1LTJC 2H43A 1FZCB 1JY3P 3HUSB 2XNXA 1N73C 1JY2O 1RF1B 3H32A 1JY2N 2A45I 2HODA 2HLOA 3GHGA 1LWUC 1FZBA 1LTJA 2Z4EA 1M1JB 1N73A 3BVHA 2FFDA 2OYIC 1RE3C 2A45H 1LT9B 1JY3O 1LWUA 2Q9IA 1JY3N 2OYHC 2OYIA 2A45G 1RE3A 1T3UA 3GHGB 1FZCC 3H32B 3E1IA 3HUSC 2HODB 2FFDB 1LTJB 1RF0C 2OYHA 1RF1C 1W2EA 1N73B 1FZEA 1M1JC 2HPCA 1LWUB 1FZCA 3HUSA 1RE4C 1LT9C 1RF0A 1FZAA 1RF1A 1JY2P 1FZFA 2OYIB 1M1JA 1FZGA
chains in the Genus database with same CATH superfamily
4HJGH 4D6TG 3WUTA 3V2PA 2KLUA 3L73D 3CWBG 4PD4D 1KORA 3HUSC 2W8ZA 1U7MA 1Q81Q 3KPEA 3HUSA 1L0NE 3JC22 3TNUB 1XTCC 5KAFH 3EFFK 3M0DA 1KZUB 1SQBJ 1PPJG 2WSFH 4ZNCA 1YJWP 3I5CA 2I1JA 1VQMP 2QSIA 1FS0E 2N1TA 2BCCJ 1NU1J 4Y99C 3U1AA 1FJKA 1RF1B 2ITAA 1IK9A 2HODA 1L0LJ 1P84H 1T2KC 1BDCA 1IC2A 1USEA 4YXWH 1LJ2A 3SFEC 1QL1A 1GU4A 5E79E 2WVRA 3RK2C 3MHVA 1HGVA 3A0HE 2QJKC 5DJUB 4ASVA 3ZDMA 4EDFA 1J1EB 1MUUA 4I7ZC 2KZJA 1YITP 5DJTB 1A02J 2M5AB 5AVVB 1SQBD 5AVTB 2FYNC 1P84E 4H13B 5APQA 3A0BH 4L75A 2FXPA 3P7KA 3RBXA 1JTHA 4RO0A 3KXDA 1YI2P 3P8CD 3HE5A 2BCCD 1NU1D 5CHXA 1L0LD 1SQXE 3RL0B 1NTKK 1JMMA 4D6TJ 2BEQD 1KQGB 1J1DC 3CWBJ 1RY3A 4Y28J 2WT7A 1KB9D 1SQVK 3RBZA 4TT3H 3BVHA 1HBWA 2GUVA 1T2KD 2K88A 5GTHH 1NAYA 1VF5C 3RL0g 3VOPA 2J5UA 1PZQA 2IBZE 2ZYGA 2QE7H 3D6YA 1KYOD 2J59M 3MTUE 2Q1KA 1DEEG 1LTGC 2W90A 3TGUE 1WMKA 1VQLP 4UB8H 5BVZA 3VP9A 1JUNA 3D70A 1RH5B 3RK2D 3WUUA 3H6PA 5CCHC 3BRVB 5CCHA 1QGKB 1AV1A 1H0TB 2FFDA 3S1KA 5AVZB 3I56P 1OVUA 4D6TD 2QJPB 5KAIE 1FOSE 1T6AA 3CWBD 2JJLA 3CX5E 2OYOA 1PP9E 1GD2E 2FY8A 1DD4A 3AE4C 4U3FE 2PRRA 2LKMA 2W27A 2P58A 2WSCJ 3M91A 2Y0DA 3CCUP 5KTBA 1M1JC 3O6QA 1PPJD 1M1JA 2OTLP 5KJ7A 1N7LA 1JY3P 2XNXA 1SQXK 3NFQA 1LWUC 1KN7A 2JDIH 1LWUA 1QLED 1LTIC 3H32B 1BGYE 1VF5D 1QVFO 2AXTE 4GT1A 3Q2YA 1OW8A 1NKNA 3N4XA 2WPQA 3V4WA 4Z1MH 1GK4A 2A45I 3OJAB 5CBNA 1S5LE 2L91A 4DOJA 1OXZA 1JY3N 2P2UA 4NPEA 1Q90D 2WSEJ 1E79H 3H1LE 1JO5A 2E5YA 2WSCH 2Z5IA 2WSSH 5CCHD 2O1JA 1FZCB 1NYHA 1EZVD 1OVVA 2NPSB 3RK3C 1RE3C 4C7NB 2I8DA 3V5BA 4WB4A 1NTZE 1IZNB 3CC7P 1KTMA 1NTKG 1RE3A 3B5NC 1AVOA 3LW5J 3B5NA 2QA4P 1IFPA 4DZOA 1JY2P 2KNCB 2ZJSE 5APYA 3L71G 1IFNA 1SQVG 3L73G 2FXMA 1DEBA 3D71A 3PH0A 5GTIH 1FE6A 2WPRA 2WQYC 5AVXB 1YQ4C 1KD1Q 4AUWA 1G2CA 4PD4I 1JEKA 2OYIB 1HF9A 2YXQB 2C0WA 3SWKA 1OW7A 1LTJC 3H1KE 1JY2N 1LTJA 1GK6A 1X9VA 3E7KA 1S5LX 5AW5B 1N73B 4WBAA 2PP6A 1RE4C 5H2FE 5AW3B 2D2CC 3KQGA 3WU2H 2GM4A 3LW5H 2AEJA 2YIUC 3HRNA 1PGQA 2W83C 4AQRD 5AW8B 3VMXA 5AVWB 2QVAA 2V7QJ 2WWWA 3TSIA 5AW7B 5EFWB 3RK3D 1LTBC 1SFCB 3B5ND 4H0LB 4XFJA 2Y9ZA 1IFJA 1SP4A 3PLNA 1FZAA 1LGHB 1U7JA 1SQBG 1U57A 4WY4B 2Q5UA 1ZMEC 1D7MA 3ABVC 1VL2A 4L73A 2YO2A 2MKVA 2K9JB 2E75B 1ZLLA 4U7JA 1NTKJ 1NU1G 2K9YA 3VMAA 1Q2NA 2PGDA 1FJPA 3L71J 1HTLC 1SQVJ 1LT9B 3CCSP 4H44B 1S72P 1M56D 1Q7YQ 1FZFA 4IOIH 1PFIA 2D2CD 3OW2O 1L4AB 1USDA 1S9KD 5B5EE 3AEEC 1YTZI 3L72G 1KB9I 2JO1A 1JOCA 1KILE 5KLIB 3BATA 1H8AA 3AE1C 1OMIA 3H1IG 1ZN5A 3VMYA 2R3SA 2Y9YA 1OIPA 1KYOI 3E1RA 4K3AA 2QRXA 1CI6A 4W7ZA 4EI2A 4OH8B 1MKMA 5AVSB 1VQ4P 2KB7P 3V4QA 1NTME 3FWLA 3L74E 4AYCA 2R32A 1EDKA 3LIDA 1NTKD 1HUCA 1NVOA 4PD4H 4JYCA 1NGMB 2IX7C 2P10A 2Y0CA 1BE3G 4WVZA 1EDIA 4GOEA 3JCUH 4W7YA 3L71D 1SQVD 2FYUE 2C9LY 3RL0C 4BRYB 1NHLA 1X79B 3GMAA 2WZ7A 2PAJA 4NPDA 2A06E 1S1CX 1YTZT 2HYNA 3AE6C 1SQXJ 2V4HA 1RF0C 3H25A 1NAFA 2CK3H 1RF0A 1VQOP 3CMEP 1N8RQ 1HVVA 5TISH 2G8YA 1KMIZ 5CJ4A 3F5HA 1MZ9A 1H89A 4O9BA 1HJ0A 2Q7CA 4L76A 3H1JE 3T97B 2OYHB 3CXHI 5CBOA 2JWDA 2RMZA 1JCDA 2VRSA 1LP1A 3SWFA 4N78E 3BCCG 3U59A 5KLVK 3AEDC 5KAFE 3TGUJ 3GHGB 3L72J 2N9BA 1W2EA 5KKZB 1SQQK 1EZVG 1SQPK 1BSHA 1H0TA 4I6MC 2QJPC 2E42A 3H1IJ 3P8MC 2ZXXA 1BDDA 2M3BA 5TJHA 1L2PA 1EZVI 2IYPA 1VQ6P 1NTMK 1JMBA 2DW3A 1SQXD 4M3LA 1FZEA 4KHXA 1NH4A 3RL0D 5AVRB 4RJTA 2I1KA 3OAKA 1PP9J 5AVYB 4KT0J 2IZ1A 2G3AA 3L75E 1BE3J 1KB9H 1HH0A 3P32A 3CCEP 1L0NK 1N7SB 3A7OA 4IL6H 1M1KQ 1MFZA 2IBZD 3HUSB 3H32A 5AW6B 4ZKUA 2E43A 1KYOH 2Q3IA 3G71P 3GG2A 2JEEA 3HE4B 3TGUD 3L72D 2W6JH 2ZFCA 1TU3F 3P8CE 1BGYJ 2BCCE 3CCMP 3A0BE 4ASWA 1EC5A 1AFOA 1L0LE 1BCCG 2OARA 3H1ID 3M9BA 3H1HG 3RGUA 3GF7A 3MP7B 2N1TB 3VMZA 4BXLA 1FZCC 2KLVA 4EYYQ 1CZQA 4GODA 1X22A 2NPSC 2OGUA 1PL5A 2J58A 2GUSA 4IFDK 4I1LA 1NO4A 4N3YB 2WMMA 3PP5A 3G4SP 4C7NA 1ZR4A 1KQLA 2H43A 3GW6A 5K5GB 3CX5D 1URQC 2Z4EA 1PP9D 3N7NA 1AVYA 4U3FD 1URQA 3CI9A 3L70G 1BE3D 5GTHE 3IAOA 3BCCJ 5AW1B 2ZT9B 2ZVNB 2HPCA 3LIEA 3KHUA 1M8OB 1XTGB 2L5GB 5AW4B 3FXDA 4WWIA 2OYIC 3RK2B 1OZHA 2OYIA 4IFFA 1GL2B 1OFCX 3JSVC 4UB8E 4I7ZB 2W6AA 2UWJE 1BGYD 2FYNB 1K8AQ 1N73C 4D6TE 3AE8C 2JWAA 4PV1B 3CXHH 1N73A 1FOSF 5CCGC 5KLVG 2POHA 3USSA 5CCGA 3CWBE 3HE5B 1PIXA 3CXHD 1SQQG 1SQPG 1KQSO 2B88A 2KIKA 4DCKA 4UB6H 2WT7B 1PPJE 1K05A 3FX0A 3II6A 3SSUA 2NPSD 3BCCD 3M0AA 1RQVA 2IPPA 3AE3C 3AE2C 3G3ZA 3PRJA 4LC1A 2HG5D 3HD7C 3F89A 2XZRA 3A3YB 2KI7B 3AEAC 1M7LA 3HD7A 1URQD 2BASA 1BCCJ 1Q82Q 3CMAP 1GZLA 2O01J 4WY4C 1EXJA 3Q5RA 3H1HJ 1L0NG 4WY4A 2C9NY 2QJYB 4HH2A 2YMKA 4YTPC 2E75C 3HTKA 2KSJA 3M9HA 2FBWC 2B87A 1NWQA 1IO4A 1X8YA 2FFDB 2KXPB 2YKQA 2K1AA 3TDKA 3KDPB 1LT9C 3L70J 2K3RA 2KS1A 1Y47A 4H44C 3V6IA 2WSEH 2M0BA 5BU5A 5CCGD 1DX7A 1JY3O 1L4AC 3IN6A 1L4AA 3MD0A 4GOFA 2OQQA 3S4RA 1X0TA 5KLIC 2AEMA 1RE4A 3B8EB 5B66H 1BCCD 5GTIE 4LGDE 3TK1A 5KLVJ 1LWUB 3H1HD 2QG4A 3HD7D 5BU8B 2E76B 1GU5A 1SQQJ 1SQPJ 3KZIH 3QH9A 1MV8A 3V2QA 2FKWB 1KQFB 2Q9IA 4WY4D 3QWOC 4DT0A 1VQPP 1M57D 1IFIA 3L70D 1NTMJ 2E74B 3L74J 3VP8A 2WITA 1JY2O 2KSEA 1YIJP 1YJ9P 2E75D 3WU2E 1HJBA 1G1IA 1SQXG 1NTZK 1K04A 2Q6QA 1FC2C 1SLQA 3VYIA 4BRYA 2KP8A 3E1IA 5APTA 1FDMA 4JF7A 3TNUA 3AECC 1ZRTD 4H44D 3O8ZA 1SS1A 1L0NJ 4OGQB 3CCLP 2FYZA 1RHZB 3NMDA 1LT1A 2HR3A 3IFMA 2Y0EA 4ZMDA 4GIFA 1L4AD 3MIWA 5CMZA 2IBZG 2V7QH 3WMM0 1RF1C 5KLVD 1RQUA 1RF1A 1K73Q 1VQ7P 2P7JA 3OA7A 3TGUG 1SQQD 1KILB 1SQPD 3U1CA 2IBZI 5AW0B 1GW3A 1YJNP 2NRGA 1UIIA 2OYHC 2P67A 1T3JA 3V2RA 2OYHA 1VQNP 1VPCA 4YXDC 3CCQP 3CCVP 3GLMA 1NTMD 4I2LC 3L74D 1OW6A 1GMJA 5AVUB 1UIXA 1KFNA 1H88A 5KKZC 2LXCB 3VN0A 4B86A 1J1EC 3A5TA 4ZKPA 1S9KE 2BEZF 5AW2B 1PP9G 2O3JA 4U3FG 2M5AA 4H13C 1L0ND 1KC8Q 2YXRB 3K5BA 2KK7A 1T8ZA 2H88C 1YHQP 3CX5I 2ZVOB 2W6BA 3IF4A 2OTKE 4JYBA 1N7SC 2AEFA 1OWAA 3CC2P 4C7RA 1N7SA 1Y9BA 1OVRA 3Q5SA 1BGYG 1NTKE 1EXIA 3L75J 1R5SA 4OVNF 1VQ9P 4EOTA 1IFMA 3L71E 3M0DC 2R3CA 2KZIA 1SQVE 3L73E 1GDTA 3H1JD 3HE4A 4PD4E 1YQ3C 5E79H 1PGJA 3NTNA 1DD3A 1GW4A 3JCUE 2AXCA 4N78D 3CC4P 2QM7A 3H1LG 4GDOA 3A0HH 1FDOA 2K37A 2NZ2A 1WRGA 2N1TC 2IYOA 1YBKA 1FZBA 1HWTC 4N6JA 1QVGO 1NTZG 3FXEA 1PGPA 1AQ5A 4OWFA 2MJZA 3BRTB 2M3EA 1P84D 5AVQB 4EIJA 2E5TA 4H13D 1IFDA 2ZT9C 2HLOA 3CPWO 5TISE 2H89C 4MN4C 3TYYA 1CI6B 3L4FA 2R44A 3L75D 3IR9A 5APSA 2ZYAA 3AEFC 5APWA 1ZV8A 1GL2C 4TLFA 3H1KG 3SWYA 1GL2A 3B4SA 3V2NA 1N7SD 2PFXA 4R4MA 3AE9C 1MFTA 4U3FJ 1IK7A 2FYUK 1OX3A 4HKZH 1DIPA 2O1KA 3PTZA 2QM8A 4PV1C 3BASA 3KYQA 4L74A 3Q5PA 2CPSA 3AE7C 1SQBE 2YMYA 2XKMA 2H8PD 2GA1A 2CPBA 2XV5A 3D6ZA 2WPVB 1AQTA 2Q3EA 2Z5HA 2N1TD 1NU1E 3VTPC 1ZOYC 2QEXP 2B89A 5KAIH 3Q1MA 2HODB 2IFNA 1KB9E 2YKOA 3CX5H 4Y99B 4W80A 1FZCA 1PGOA 2NPSA 1EDJA 5AW9B 3H1LJ 4IL6E 1Z56A 2ZT9D 3AEBC 2QJYC 3L72E 1VQ5P 1LTTC 1KYOE 1T3UA 2KNCA 1LP1B 1LTAC 2IFMA 1NTZJ 1EDLA 1VQKP 1AA0A 1KFMA 3H1IE 3W67A 3CL3D 1GL2D 3C9IA 1WT6A 2FFDC 1GTWA 3MUDC 4KJMA 1ZW0A 3EQ2A 3MUDA 1CW5A 2R5DA 4XE5B 2QJKB 3FWNA 2AXTH 2WTYA 4PV1D 2HFED 1HGZA 4PJ0H 2RN0A 2ZYDA 4CPGA 1BSNA 1S5LH 1BE3E 5APXA 1JTHB 3H1KJ 3A2AA 1LNQA 1NJIQ 1A02F 1Y8AA 5KJ7C 1LTSC 1PV3A 1SQBK 2RH0A 3H1LD 2OTJP 1J1DB 4IL6X 2R5BA 1S4XA 5L8RJ 2A45G 1AJYA 2E76C 4R4LA 4DJGA 2B9BA 3EWKA 1NTMG 3L74G 1NOHA 1NU1K 1NTZD 4GKGA 1N2DC 3PJSK 1FZGA 1L0LK 5APVA 1SVFA 1S2EA 3L35A 4PJ0E 1SFCC 4H0LC 4JBZA 1JCCA 4YPCA 1R8EA 2KYVA 1SFCA 1VF5B 2XU6A 2H7HA 2E74C 2FYUG 3CXHE 3M9QA 1W2BO 1FU1A 4XA4A 3W68A 1FAVA 3L36A 3AE5C 3CD6P 1J2JB 3UIAA 2A06G 3C1LA 4UB6E 3BCCE 2K9JA 3H1KD 4OGQC 4QMAA 1EQ7A 5H2FH 4IFMA 1URQB 1CSBA 1EZVE 1E5WA 3AEGC 1LT9A 2HPCB 1FDIA 2WPSA 2QIWA 1G1JA 3S9OA 3L37A 3NXSA 5CJ0A 3CCJP 1KILC 2JKVA 3H1JG 5KJ7D 3FGAD 1KILA 1JNMA 2LR2A 2O01H 3O6QB 1M1JB 2M8RA 4HB1A 3EFGA 2E76D 4A7PA 3MGNA 3MZWB 2C0XA 1SFCD 1N86A 1YYCA 4H0LD 3G6EP 2FXOA 1QX8A 2JP3A 4RESB 2E74D 2P1JA 3CCRP 1Q86Q 5M1BA 1ZR2A 1BCCE 1P84I 1JB0J 3L75G 1IJDB 3H1HE 1JM0A 1ZXGA 3G9RA 1VQ8P 4OGQD 3HD7B 5B66E 2KUBA 1S3JA 3WUVA 2XDJA 3SFDC 2FYUJ 4LLHA 3RK3B 5B5EH 3RK3E 2IZ0A 3B5NB 1R5LA 2LXBA 3PHLA 2O01N 2YNYA 3KZIE 3HTKB 3L70E 1ZP0C 1QL2A 1QEXA 2N9YB 1KILD 2BCCG 5C39A 3Q3DA 2B87B 2YO3A 1L0LG 4C46A 2JR8A 1G2CB 2KS1B 3I55P 3L73J 5APUA 2A45H 1ZRTE 4JPZB 1KV4A 3T97A 1LTJB 3R4YA 2KOGA 3R2PA 3GHGC 3H1JJ 1NKZB 3GHGA 1DH3A 4K35A 3TF5A 5KLVE 1VDFA 2D2CB 2XNDH 1M90Q 3CLQA 1FBMA 1K9MQ 2YIUB 2FYUD 1SQQE 1SQPE 2WSFJ 4JQ0D 3GF3A 3C8VA 4BWNA 1W5CE 3ITKA 3B71A 2YKPA 2IDBA 2SPZA 2ZXEB 2A06D 2ZAEB 4NPFX 3M06A 4HYTB 2RKLA 4RKUJ
chains in the Genus database with same CATH topology
2YMYA 2XKMA 2H8PD 2WWWA 3TSIA 3V2PA 5AW7B 2WT7B 3RK3D 1LTBC 2CPBA 2XV5A 1SFCB 3B5ND 3HUSC 3II6A 2NPSD 1IFJA 3KPEA 3M0AA 1SP4A 2IPPA 3HUSA 1FZAA 1LGHB 2N1TD 3G3ZA 2Z5HA 4LC1A 2HG5D 3HD7C 3TNUB 1XTCC 2XZRA 4WY4B 2Q5UA 3A3YB 3VTPC 1M7LA 3HD7A 1URQD 2BASA 3M0DA 1KZUB 1GZLA 2WSFH 4WY4C 2YO2A 2HODB 2IFNA 2YKOA 4Y99B 4WY4A 3I5CA 4W80A 1ZLLA 1FZCA 2C9NY 2I1JA 2NPSA 4HH2A 5AW9B 1FJPA 1Z56A 2N1TA 4Y99C 3U1AA 1FJKA 1RF1B 3HTKA 1IK9A 2HODA 2KSJA 3M9HA 1HTLC 1LTTC 1T2KC 1LT9B 1IC2A 1T3UA 1NWQA 1IO4A 1LTAC 2IFMA 1X8YA 2FFDB 2YKQA 3KDPB 1LT9C 1KFMA 1FZFA 3CL3D 1PFIA 1GL2D 1L4AB 3C9IA 1WT6A 2FFDC 1S9KD 1GTWA 1YTZI 3EQ2A 2WSEH 3MUDA 5BU5A 5CCGD 1DX7A 1QL1A 1JOCA 1CW5A 1GU4A 1JY3O 1L4AC 2R5DA 3BATA 4XE5B 1H8AA 1L4AA 2WTYA 3MD0A 2HFED 1HGZA 1ZN5A 3RK2C 3VMYA 1HGVA 1RE4A 1J1EB 1MUUA 3B8EB 5APXA 1JTHB 1CI6A 1A02J 5AVVB 4W7ZA 5AVTB 4OH8B 3A2AA 4LGDE 5APQA 5AVSB 2KB7P 3TK1A 1A02F 3V4QA 4AYCA 1LWUB 2R32A 3P7KA 3LIDA 5KJ7C 1LTSC 1JTHA 1HUCA 1SQBK 4JYCA 3HD7D 2IX7C 5BU8B 3P8CD 3HE5A 1GU5A 5CHXA 1MV8A 3V2QA 2FKWB 1J1DB 4W7YA 2R5BA 2Q9IA 3RL0B 1NTKK 1JMMA 2A45G 4WY4D 2C9LY 1J1DC 1NU1K 4GKGA 1N2DC 1IFIA 3RL0C 1FZGA 1RY3A 1L0LK 5APVA 1NHLA 1SVFA 1X79B 2WT7A 3L35A 3VP8A 1SFCC 1SQVK 2WITA 1JCCA 1JY2O 2KYVA 1SFCA 2WZ7A 1HJBA 2PAJA 2XU6A 3BVHA 1G1IA 1NTZK 1HBWA 2GUVA 2H7HA 1T2KD 1YTZT 1SLQA 3VYIA 2HYNA 3M9QA 2KP8A 3E1IA 1FU1A 1RF0C 5APTA 3VOPA 1FDMA 1NAFA 4JF7A 3TNUA 2J59M 4XA4A 1RF0A 1FAVA 3MTUE 3L36A 3O8ZA 2FYZA 1J2JB 1LTGC 3NMDA 3UIAA 1HVVA 3IFMA 4GIFA 1L4AD 5CJ4A 3MIWA 5BVZA 3VP9A 1MZ9A 1H89A 1JUNA 4O9BA 5CMZA 1EQ7A 2Q7CA 3WMM0 1RF1C 4IFMA 1URQB 3RK2D 1RF1A 1CSBA 3H6PA 2P7JA 3OA7A 1E5WA 5CCHC 2OYHB 1LT9A 2HPCB 2WPSA 3BRVB 1JCDA 2VRSA 5CCHA 1G1JA 3SWFA 4N78E 2FFDA 3L37A 3U59A 1KILB 5KLVK 3NXSA 3U1CA 5AW0B 1GW3A 5CJ0A 2OYHC 5AVZB 2P67A 1T3JA 3GHGB 2N9BA 3V2RA 2OYHA 1W2EA 1FOSE 1KILC 1VPCA 5KJ7D 1SQQK 1SQPK 2JJLA 1KILA 4I6MC 4I2LC 1JNMA 1GD2E 2E42A 2O01H 2LKMA 5AVUB 2W27A 1KFNA 3P8MC 1H88A 1M1JB 2M8RA 2M3BA 3EFGA 3M91A 3VN0A 4B86A 1NTMK 1J1EC 3A5TA 4ZKPA 5KTBA 4M3LA 1FZEA 1S9KE 1M1JC 3MGNA 4KHXA 5AW2B 1NH4A 1M1JA 3RL0D 2C0XA 1SFCD 5AVRB 1N86A 5KJ7A 1YYCA 1N7LA 2I1KA 3OAKA 1JY3P 2XNXA 5AVYB 1SQXK 3NFQA 1LWUC 1T8ZA 4RESB 1LWUA 2P1JA 1HH0A 1LTIC 3H32B 3P32A 1L0NK 2W6BA 1N7SB 4GT1A 3A7OA 1MFZA 4JYBA 1ZR2A 1NKNA 3N4XA 2WPQA 3HUSB 3V4WA 1N7SC 1GK4A 3H32A 1OWAA 2A45I 3OJAB 5AW6B 4ZKUA 2E43A 2Q3IA 4C7RA 1N7SA 4DOJA 1IJDB 1OXZA 1JY3N 2JEEA 2P2UA 3HD7B 3HE4B 2XDJA 2ZFCA 3P8CE 1JO5A 4LLHA 3RK3B 2WSCH 2Z5IA 4EOTA 1IFMA 1AFOA 5CCHD 3M0DC 2OARA 2R3CA 2O1JA 3B5NB 1FZCB 1GDTA 3HE4A 2NPSB 3M9BA 2YNYA 3RK3C 1RE3C 4C7NB 3NTNA 3V5BA 4WB4A 3VMZA 2N1TB 1GW4A 1RE3A 3HTKB 4N78D 3B5NC 1FZCC 2KLVA 1CZQA 1QL2A 2QM7A 2NPSC 2J58A 2GUSA 1KILD 3B5NA 4IFDK 4I1LA 1NO4A 4N3YB 4DZOA 1JY2P 1WRGA 2YO3A 3PP5A 2N1TC 5APYA 1IFNA 4C7NA 4C46A 1ZR4A 2FXMA 1DEBA 1KQLA 1G2CB 2H43A 1FZBA 1URQC 2Z4EA 2WPRA 5APUA 3N7NA 1HWTC 4N6JA 2A45H 1URQA 3CI9A 5AVXB 3T97A 5AW1B 1LTJB 4AUWA 1AQ5A 2KOGA 1G2CA 2MJZA 2HPCA 3BRTB 3LIEA 5AVQB 2OYIB 3R2PA 4EIJA 2C0WA 3GHGC 1XTGB 2L5GB 1IFDA 5AW4B 1LTJC 1NKZB 1JY2N 3GHGA 2HLOA 1LTJA 1DH3A 2OYIC 3RK2B 1GK6A 1VDFA 2OYIA 1X9VA 4IFFA 1GL2B 3TYYA 1CI6B 5AW5B 3L4FA 1N73B 3CLQA 4WBAA 1FBMA 2PP6A 1RE4C 2W6AA 3IR9A 5APSA 5AW3B 5APWA 3KQGA 1ZV8A 1GL2C 2GM4A 3LW5H 1N73C 3SWYA 1GL2A 3V2NA 1N7SD 1N73A 1FOSF 5CCGC 3HRNA 2POHA 2YKPA 2FYUK 5CCGA 4AQRD 5AW8B 3HE5B 3VMXA 2ZXEB 2O1KA 2QM8A 3BASA 3KYQA 5AVWB 2CPSA 3M06A 4HYTB 1NOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N86 A;  1RE4 A;  3GHG C;  2FFD C;  1LT9 A;  2OYH B;  2HPC B;  1LTJ C;  2H43 A;  1FZC B;  1JY3 P;  3HUS B;  2XNX A;  1N73 C;  1JY2 O;  1RF1 B;  3H32 A;  1JY2 N;  2A45 I;  2HOD A;  2HLO A;  3GHG A;  1LWU C;  1FZB A;  1LTJ A;  2Z4E A;  1M1J B;  1N73 A;  3BVH A;  2FFD A;  2OYI C;  1RE3 C;  2A45 H;  1LT9 B;  1JY3 O;  1LWU A;  2Q9I A;  1JY3 N;  2OYH C;  2OYI A;  2A45 G;  1RE3 A;  1T3U A;  3GHG B;  1FZC C;  3H32 B;  3E1I A;  3HUS C;  2HOD B;  2FFD B;  1LTJ B;  1RF0 C;  2OYH A;  1RF1 C;  1W2E A;  1N73 B;  1FZE A;  1M1J C;  2HPC A;  1LWU B;  1FZC A;  3HUS A;  1RE4 C;  1LT9 C;  1RF0 A;  1FZA A;  1RF1 A;  1JY2 P;  1FZF A;  2OYI B;  1M1J A;  1FZG A; 
#chains in the Genus database with same CATH topology
 4HJG H;  4D6T G;  3WUT A;  3V2P A;  2KLU A;  3L73 D;  3CWB G;  4PD4 D;  1KOR A;  3HUS C;  2W8Z A;  1U7M A;  1Q81 Q;  3KPE A;  3HUS A;  1L0N E;  3JC2 2;  3TNU B;  1XTC C;  5KAF H;  3EFF K;  3M0D A;  1KZU B;  1SQB J;  1PPJ G;  2WSF H;  4ZNC A;  1YJW P;  3I5C A;  2I1J A;  1VQM P;  2QSI A;  1FS0 E;  2N1T A;  2BCC J;  1NU1 J;  4Y99 C;  3U1A A;  1FJK A;  1RF1 B;  2ITA A;  1IK9 A;  2HOD A;  1L0L J;  1P84 H;  1T2K C;  1BDC A;  1IC2 A;  1USE A;  4YXW H;  1LJ2 A;  3SFE C;  1QL1 A;  1GU4 A;  5E79 E;  2WVR A;  3RK2 C;  3MHV A;  1HGV A;  3A0H E;  2QJK C;  5DJU B;  4ASV A;  3ZDM A;  4EDF A;  1J1E B;  1MUU A;  4I7Z C;  2KZJ A;  1YIT P;  5DJT B;  1A02 J;  2M5A B;  5AVV B;  1SQB D;  5AVT B;  2FYN C;  1P84 E;  4H13 B;  5APQ A;  3A0B H;  4L75 A;  2FXP A;  3P7K A;  3RBX A;  1JTH A;  4RO0 A;  3KXD A;  1YI2 P;  3P8C D;  3HE5 A;  2BCC D;  1NU1 D;  5CHX A;  1L0L D;  1SQX E;  3RL0 B;  1NTK K;  1JMM A;  4D6T J;  2BEQ D;  1KQG B;  1J1D C;  3CWB J;  1RY3 A;  4Y28 J;  2WT7 A;  1KB9 D;  1SQV K;  3RBZ A;  4TT3 H;  3BVH A;  1HBW A;  2GUV A;  1T2K D;  2K88 A;  5GTH H;  1NAY A;  1VF5 C;  3RL0 g;  3VOP A;  2J5U A;  1PZQ A;  2IBZ E;  2ZYG A;  2QE7 H;  3D6Y A;  1KYO D;  2J59 M;  3MTU E;  2Q1K A;  1DEE G;  1LTG C;  2W90 A;  3TGU E;  1WMK A;  1VQL P;  4UB8 H;  5BVZ A;  3VP9 A;  1JUN A;  3D70 A;  1RH5 B;  3RK2 D;  3WUU A;  3H6P A;  5CCH C;  3BRV B;  5CCH A;  1QGK B;  1AV1 A;  1H0T B;  2FFD A;  3S1K A;  5AVZ B;  3I56 P;  1OVU A;  4D6T D;  2QJP B;  5KAI E;  1FOS E;  1T6A A;  3CWB D;  2JJL A;  3CX5 E;  2OYO A;  1PP9 E;  1GD2 E;  2FY8 A;  1DD4 A;  3AE4 C;  4U3F E;  2PRR A;  2LKM A;  2W27 A;  2P58 A;  2WSC J;  3M91 A;  2Y0D A;  3CCU P;  5KTB A;  1M1J C;  3O6Q A;  1PPJ D;  1M1J A;  2OTL P;  5KJ7 A;  1N7L A;  1JY3 P;  2XNX A;  1SQX K;  3NFQ A;  1LWU C;  1KN7 A;  2JDI H;  1LWU A;  1QLE D;  1LTI C;  3H32 B;  1BGY E;  1VF5 D;  1QVF O;  2AXT E;  4GT1 A;  3Q2Y A;  1OW8 A;  1NKN A;  3N4X A;  2WPQ A;  3V4W A;  4Z1M H;  1GK4 A;  2A45 I;  3OJA B;  5CBN A;  1S5L E;  2L91 A;  4DOJ A;  1OXZ A;  1JY3 N;  2P2U A;  4NPE A;  1Q90 D;  2WSE J;  1E79 H;  3H1L E;  1JO5 A;  2E5Y A;  2WSC H;  2Z5I A;  2WSS H;  5CCH D;  2O1J A;  1FZC B;  1NYH A;  1EZV D;  1OVV A;  2NPS B;  3RK3 C;  1RE3 C;  4C7N B;  2I8D A;  3V5B A;  4WB4 A;  1NTZ E;  1IZN B;  3CC7 P;  1KTM A;  1NTK G;  1RE3 A;  3B5N C;  1AVO A;  3LW5 J;  3B5N A;  2QA4 P;  1IFP A;  4DZO A;  1JY2 P;  2KNC B;  2ZJS E;  5APY A;  3L71 G;  1IFN A;  1SQV G;  3L73 G;  2FXM A;  1DEB A;  3D71 A;  3PH0 A;  5GTI H;  1FE6 A;  2WPR A;  2WQY C;  5AVX B;  1YQ4 C;  1KD1 Q;  4AUW A;  1G2C A;  4PD4 I;  1JEK A;  2OYI B;  1HF9 A;  2YXQ B;  2C0W A;  3SWK A;  1OW7 A;  1LTJ C;  3H1K E;  1JY2 N;  1LTJ A;  1GK6 A;  1X9V A;  3E7K A;  1S5L X;  5AW5 B;  1N73 B;  4WBA A;  2PP6 A;  1RE4 C;  5H2F E;  5AW3 B;  2D2C C;  3KQG A;  3WU2 H;  2GM4 A;  3LW5 H;  2AEJ A;  2YIU C;  3HRN A;  1PGQ A;  2W83 C;  4AQR D;  5AW8 B;  3VMX A;  5AVW B;  2QVA A;  2V7Q J;  2WWW A;  3TSI A;  5AW7 B;  5EFW B;  3RK3 D;  1LTB C;  1SFC B;  3B5N D;  4H0L B;  4XFJ A;  2Y9Z A;  1IFJ A;  1SP4 A;  3PLN A;  1FZA A;  1LGH B;  1U7J A;  1SQB G;  1U57 A;  4WY4 B;  2Q5U A;  1ZME C;  1D7M A;  3ABV C;  1VL2 A;  4L73 A;  2YO2 A;  2MKV A;  2K9J B;  2E75 B;  1ZLL A;  4U7J A;  1NTK J;  1NU1 G;  2K9Y A;  3VMA A;  1Q2N A;  2PGD A;  1FJP A;  3L71 J;  1HTL C;  1SQV J;  1LT9 B;  3CCS P;  4H44 B;  1S72 P;  1M56 D;  1Q7Y Q;  1FZF A;  4IOI H;  1PFI A;  2D2C D;  3OW2 O;  1L4A B;  1USD A;  1S9K D;  5B5E E;  3AEE C;  1YTZ I;  3L72 G;  1KB9 I;  2JO1 A;  1JOC A;  1KIL E;  5KLI B;  3BAT A;  1H8A A;  3AE1 C;  1OMI A;  3H1I G;  1ZN5 A;  3VMY A;  2R3S A;  2Y9Y A;  1OIP A;  1KYO I;  3E1R A;  4K3A A;  2QRX A;  1CI6 A;  4W7Z A;  4EI2 A;  4OH8 B;  1MKM A;  5AVS B;  1VQ4 P;  2KB7 P;  3V4Q A;  1NTM E;  3FWL A;  3L74 E;  4AYC A;  2R32 A;  1EDK A;  3LID A;  1NTK D;  1HUC A;  1NVO A;  4PD4 H;  4JYC A;  1NGM B;  2IX7 C;  2P10 A;  2Y0C A;  1BE3 G;  4WVZ A;  1EDI A;  4GOE A;  3JCU H;  4W7Y A;  3L71 D;  1SQV D;  2FYU E;  2C9L Y;  3RL0 C;  4BRY B;  1NHL A;  1X79 B;  3GMA A;  2WZ7 A;  2PAJ A;  4NPD A;  2A06 E;  1S1C X;  1YTZ T;  2HYN A;  3AE6 C;  1SQX J;  2V4H A;  1RF0 C;  3H25 A;  1NAF A;  2CK3 H;  1RF0 A;  1VQO P;  3CME P;  1N8R Q;  1HVV A;  5TIS H;  2G8Y A;  1KMI Z;  5CJ4 A;  3F5H A;  1MZ9 A;  1H89 A;  4O9B A;  1HJ0 A;  2Q7C A;  4L76 A;  3H1J E;  3T97 B;  2OYH B;  3CXH I;  5CBO A;  2JWD A;  2RMZ A;  1JCD A;  2VRS A;  1LP1 A;  3SWF A;  4N78 E;  3BCC G;  3U59 A;  5KLV K;  3AED C;  5KAF E;  3TGU J;  3GHG B;  3L72 J;  2N9B A;  1W2E A;  5KKZ B;  1SQQ K;  1EZV G;  1SQP K;  1BSH A;  1H0T A;  4I6M C;  2QJP C;  2E42 A;  3H1I J;  3P8M C;  2ZXX A;  1BDD A;  2M3B A;  5TJH A;  1L2P A;  1EZV I;  2IYP A;  1VQ6 P;  1NTM K;  1JMB A;  2DW3 A;  1SQX D;  4M3L A;  1FZE A;  4KHX A;  1NH4 A;  3RL0 D;  5AVR B;  4RJT A;  2I1K A;  3OAK A;  1PP9 J;  5AVY B;  4KT0 J;  2IZ1 A;  2G3A A;  3L75 E;  1BE3 J;  1KB9 H;  1HH0 A;  3P32 A;  3CCE P;  1L0N K;  1N7S B;  3A7O A;  4IL6 H;  1M1K Q;  1MFZ A;  2IBZ D;  3HUS B;  3H32 A;  5AW6 B;  4ZKU A;  2E43 A;  1KYO H;  2Q3I A;  3G71 P;  3GG2 A;  2JEE A;  3HE4 B;  3TGU D;  3L72 D;  2W6J H;  2ZFC A;  1TU3 F;  3P8C E;  1BGY J;  2BCC E;  3CCM P;  3A0B E;  4ASW A;  1EC5 A;  1AFO A;  1L0L E;  1BCC G;  2OAR A;  3H1I D;  3M9B A;  3H1H G;  3RGU A;  3GF7 A;  3MP7 B;  2N1T B;  3VMZ A;  4BXL A;  1FZC C;  2KLV A;  4EYY Q;  1CZQ A;  4GOD A;  1X22 A;  2NPS C;  2OGU A;  1PL5 A;  2J58 A;  2GUS A;  4IFD K;  4I1L A;  1NO4 A;  4N3Y B;  2WMM A;  3PP5 A;  3G4S P;  4C7N A;  1ZR4 A;  1KQL A;  2H43 A;  3GW6 A;  5K5G B;  3CX5 D;  1URQ C;  2Z4E A;  1PP9 D;  3N7N A;  1AVY A;  4U3F D;  1URQ A;  3CI9 A;  3L70 G;  1BE3 D;  5GTH E;  3IAO A;  3BCC J;  5AW1 B;  2ZT9 B;  2ZVN B;  2HPC A;  3LIE A;  3KHU A;  1M8O B;  1XTG B;  2L5G B;  5AW4 B;  3FXD A;  4WWI A;  2OYI C;  3RK2 B;  1OZH A;  2OYI A;  4IFF A;  1GL2 B;  1OFC X;  3JSV C;  4UB8 E;  4I7Z B;  2W6A A;  2UWJ E;  1BGY D;  2FYN B;  1K8A Q;  1N73 C;  4D6T E;  3AE8 C;  2JWA A;  4PV1 B;  3CXH H;  1N73 A;  1FOS F;  5CCG C;  5KLV G;  2POH A;  3USS A;  5CCG A;  3CWB E;  3HE5 B;  1PIX A;  3CXH D;  1SQQ G;  1SQP G;  1KQS O;  2B88 A;  2KIK A;  4DCK A;  4UB6 H;  2WT7 B;  1PPJ E;  1K05 A;  3FX0 A;  3II6 A;  3SSU A;  2NPS D;  3BCC D;  3M0A A;  1RQV A;  2IPP A;  3AE3 C;  3AE2 C;  3G3Z A;  3PRJ A;  4LC1 A;  2HG5 D;  3HD7 C;  3F89 A;  2XZR A;  3A3Y B;  2KI7 B;  3AEA C;  1M7L A;  3HD7 A;  1URQ D;  2BAS A;  1BCC J;  1Q82 Q;  3CMA P;  1GZL A;  2O01 J;  4WY4 C;  1EXJ A;  3Q5R A;  3H1H J;  1L0N G;  4WY4 A;  2C9N Y;  2QJY B;  4HH2 A;  2YMK A;  4YTP C;  2E75 C;  3HTK A;  2KSJ A;  3M9H A;  2FBW C;  2B87 A;  1NWQ A;  1IO4 A;  1X8Y A;  2FFD B;  2KXP B;  2YKQ A;  2K1A A;  3TDK A;  3KDP B;  1LT9 C;  3L70 J;  2K3R A;  2KS1 A;  1Y47 A;  4H44 C;  3V6I A;  2WSE H;  2M0B A;  5BU5 A;  5CCG D;  1DX7 A;  1JY3 O;  1L4A C;  3IN6 A;  1L4A A;  3MD0 A;  4GOF A;  2OQQ A;  3S4R A;  1X0T A;  5KLI C;  2AEM A;  1RE4 A;  3B8E B;  5B66 H;  1BCC D;  5GTI E;  4LGD E;  3TK1 A;  5KLV J;  1LWU B;  3H1H D;  2QG4 A;  3HD7 D;  5BU8 B;  2E76 B;  1GU5 A;  1SQQ J;  1SQP J;  3KZI H;  3QH9 A;  1MV8 A;  3V2Q A;  2FKW B;  1KQF B;  2Q9I A;  4WY4 D;  3QWO C;  4DT0 A;  1VQP P;  1M57 D;  1IFI A;  3L70 D;  1NTM J;  2E74 B;  3L74 J;  3VP8 A;  2WIT A;  1JY2 O;  2KSE A;  1YIJ P;  1YJ9 P;  2E75 D;  3WU2 E;  1HJB A;  1G1I A;  1SQX G;  1NTZ K;  1K04 A;  2Q6Q A;  1FC2 C;  1SLQ A;  3VYI A;  4BRY A;  2KP8 A;  3E1I A;  5APT A;  1FDM A;  4JF7 A;  3TNU A;  3AEC C;  1ZRT D;  4H44 D;  3O8Z A;  1SS1 A;  1L0N J;  4OGQ B;  3CCL P;  2FYZ A;  1RHZ B;  3NMD A;  1LT1 A;  2HR3 A;  3IFM A;  2Y0E A;  4ZMD A;  4GIF A;  1L4A D;  3MIW A;  5CMZ A;  2IBZ G;  2V7Q H;  3WMM 0;  1RF1 C;  5KLV D;  1RQU A;  1RF1 A;  1K73 Q;  1VQ7 P;  2P7J A;  3OA7 A;  3TGU G;  1SQQ D;  1KIL B;  1SQP D;  3U1C A;  2IBZ I;  5AW0 B;  1GW3 A;  1YJN P;  2NRG A;  1UII A;  2OYH C;  2P67 A;  1T3J A;  3V2R A;  2OYH A;  1VQN P;  1VPC A;  4YXD C;  3CCQ P;  3CCV P;  3GLM A;  1NTM D;  4I2L C;  3L74 D;  1OW6 A;  1GMJ A;  5AVU B;  1UIX A;  1KFN A;  1H88 A;  5KKZ C;  2LXC B;  3VN0 A;  4B86 A;  1J1E C;  3A5T A;  4ZKP A;  1S9K E;  2BEZ F;  5AW2 B;  1PP9 G;  2O3J A;  4U3F G;  2M5A A;  4H13 C;  1L0N D;  1KC8 Q;  2YXR B;  3K5B A;  2KK7 A;  1T8Z A;  2H88 C;  1YHQ P;  3CX5 I;  2ZVO B;  2W6B A;  3IF4 A;  2OTK E;  4JYB A;  1N7S C;  2AEF A;  1OWA A;  3CC2 P;  4C7R A;  1N7S A;  1Y9B A;  1OVR A;  3Q5S A;  1BGY G;  1NTK E;  1EXI A;  3L75 J;  1R5S A;  4OVN F;  1VQ9 P;  4EOT A;  1IFM A;  3L71 E;  3M0D C;  2R3C A;  2KZI A;  1SQV E;  3L73 E;  1GDT A;  3H1J D;  3HE4 A;  4PD4 E;  1YQ3 C;  5E79 H;  1PGJ A;  3NTN A;  1DD3 A;  1GW4 A;  3JCU E;  2AXC A;  4N78 D;  3CC4 P;  2QM7 A;  3H1L G;  4GDO A;  3A0H H;  1FDO A;  2K37 A;  2NZ2 A;  1WRG A;  2N1T C;  2IYO A;  1YBK A;  1FZB A;  1HWT C;  4N6J A;  1QVG O;  1NTZ G;  3FXE A;  1PGP A;  1AQ5 A;  4OWF A;  2MJZ A;  3BRT B;  2M3E A;  1P84 D;  5AVQ B;  4EIJ A;  2E5T A;  4H13 D;  1IFD A;  2ZT9 C;  2HLO A;  3CPW O;  5TIS E;  2H89 C;  4MN4 C;  3TYY A;  1CI6 B;  3L4F A;  2R44 A;  3L75 D;  3IR9 A;  5APS A;  2ZYA A;  3AEF C;  5APW A;  1ZV8 A;  1GL2 C;  4TLF A;  3H1K G;  3SWY A;  1GL2 A;  3B4S A;  3V2N A;  1N7S D;  2PFX A;  4R4M A;  3AE9 C;  1MFT A;  4U3F J;  1IK7 A;  2FYU K;  1OX3 A;  4HKZ H;  1DIP A;  2O1K A;  3PTZ A;  2QM8 A;  4PV1 C;  3BAS A;  3KYQ A;  4L74 A;  3Q5P A;  2CPS A;  3AE7 C;  1SQB E;  2YMY A;  2XKM A;  2H8P D;  2GA1 A;  2CPB A;  2XV5 A;  3D6Z A;  2WPV B;  1AQT A;  2Q3E A;  2Z5H A;  2N1T D;  1NU1 E;  3VTP C;  1ZOY C;  2QEX P;  2B89 A;  5KAI H;  3Q1M A;  2HOD B;  2IFN A;  1KB9 E;  2YKO A;  3CX5 H;  4Y99 B;  4W80 A;  1FZC A;  1PGO A;  2NPS A;  1EDJ A;  5AW9 B;  3H1L J;  4IL6 E;  1Z56 A;  2ZT9 D;  3AEB C;  2QJY C;  3L72 E;  1VQ5 P;  1LTT C;  1KYO E;  1T3U A;  2KNC A;  1LP1 B;  1LTA C;  2IFM A;  1NTZ J;  1EDL A;  1VQK P;  1AA0 A;  1KFM A;  3H1I E;  3W67 A;  3CL3 D;  1GL2 D;  3C9I A;  1WT6 A;  2FFD C;  1GTW A;  3MUD C;  4KJM A;  1ZW0 A;  3EQ2 A;  3MUD A;  1CW5 A;  2R5D A;  4XE5 B;  2QJK B;  3FWN A;  2AXT H;  2WTY A;  4PV1 D;  2HFE D;  1HGZ A;  4PJ0 H;  2RN0 A;  2ZYD A;  4CPG A;  1BSN A;  1S5L H;  1BE3 E;  5APX A;  1JTH B;  3H1K J;  3A2A A;  1LNQ A;  1NJI Q;  1A02 F;  1Y8A A;  5KJ7 C;  1LTS C;  1PV3 A;  1SQB K;  2RH0 A;  3H1L D;  2OTJ P;  1J1D B;  4IL6 X;  2R5B A;  1S4X A;  5L8R J;  2A45 G;  1AJY A;  2E76 C;  4R4L A;  4DJG A;  2B9B A;  3EWK A;  1NTM G;  3L74 G;  1NOH A;  1NU1 K;  1NTZ D;  4GKG A;  1N2D C;  3PJS K;  1FZG A;  1L0L K;  5APV A;  1SVF A;  1S2E A;  3L35 A;  4PJ0 E;  1SFC C;  4H0L C;  4JBZ A;  1JCC A;  4YPC A;  1R8E A;  2KYV A;  1SFC A;  1VF5 B;  2XU6 A;  2H7H A;  2E74 C;  2FYU G;  3CXH E;  3M9Q A;  1W2B O;  1FU1 A;  4XA4 A;  3W68 A;  1FAV A;  3L36 A;  3AE5 C;  3CD6 P;  1J2J B;  3UIA A;  2A06 G;  3C1L A;  4UB6 E;  3BCC E;  2K9J A;  3H1K D;  4OGQ C;  4QMA A;  1EQ7 A;  5H2F H;  4IFM A;  1URQ B;  1CSB A;  1EZV E;  1E5W A;  3AEG C;  1LT9 A;  2HPC B;  1FDI A;  2WPS A;  2QIW A;  1G1J A;  3S9O A;  3L37 A;  3NXS A;  5CJ0 A;  3CCJ P;  1KIL C;  2JKV A;  3H1J G;  5KJ7 D;  3FGA D;  1KIL A;  1JNM A;  2LR2 A;  2O01 H;  3O6Q B;  1M1J B;  2M8R A;  4HB1 A;  3EFG A;  2E76 D;  4A7P A;  3MGN A;  3MZW B;  2C0X A;  1SFC D;  1N86 A;  1YYC A;  4H0L D;  3G6E P;  2FXO A;  1QX8 A;  2JP3 A;  4RES B;  2E74 D;  2P1J A;  3CCR P;  1Q86 Q;  5M1B A;  1ZR2 A;  1BCC E;  1P84 I;  1JB0 J;  3L75 G;  1IJD B;  3H1H E;  1JM0 A;  1ZXG A;  3G9R A;  1VQ8 P;  4OGQ D;  3HD7 B;  5B66 E;  2KUB A;  1S3J A;  3WUV A;  2XDJ A;  3SFD C;  2FYU J;  4LLH A;  3RK3 B;  5B5E H;  3RK3 E;  2IZ0 A;  3B5N B;  1R5L A;  2LXB A;  3PHL A;  2O01 N;  2YNY A;  3KZI E;  3HTK B;  3L70 E;  1ZP0 C;  1QL2 A;  1QEX A;  2N9Y B;  1KIL D;  2BCC G;  5C39 A;  3Q3D A;  2B87 B;  2YO3 A;  1L0L G;  4C46 A;  2JR8 A;  1G2C B;  2KS1 B;  3I55 P;  3L73 J;  5APU A;  2A45 H;  1ZRT E;  4JPZ B;  1KV4 A;  3T97 A;  1LTJ B;  3R4Y A;  2KOG A;  3R2P A;  3GHG C;  3H1J J;  1NKZ B;  3GHG A;  1DH3 A;  4K35 A;  3TF5 A;  5KLV E;  1VDF A;  2D2C B;  2XND H;  1M90 Q;  3CLQ A;  1FBM A;  1K9M Q;  2YIU B;  2FYU D;  1SQQ E;  1SQP E;  2WSF J;  4JQ0 D;  3GF3 A;  3C8V A;  4BWN A;  1W5C E;  3ITK A;  3B71 A;  2YKP A;  2IDB A;  2SPZ A;  2ZXE B;  2A06 D;  2ZAE B;  4NPF X;  3M06 A;  4HYT B;  2RKL A;  4RKU J; 
#chains in the Genus database with same CATH homology
 2YMY A;  2XKM A;  2H8P D;  2WWW A;  3TSI A;  3V2P A;  5AW7 B;  2WT7 B;  3RK3 D;  1LTB C;  2CPB A;  2XV5 A;  1SFC B;  3B5N D;  3HUS C;  3II6 A;  2NPS D;  1IFJ A;  3KPE A;  3M0A A;  1SP4 A;  2IPP A;  3HUS A;  1FZA A;  1LGH B;  2N1T D;  3G3Z A;  2Z5H A;  4LC1 A;  2HG5 D;  3HD7 C;  3TNU B;  1XTC C;  2XZR A;  4WY4 B;  2Q5U A;  3A3Y B;  3VTP C;  1M7L A;  3HD7 A;  1URQ D;  2BAS A;  3M0D A;  1KZU B;  1GZL A;  2WSF H;  4WY4 C;  2YO2 A;  2HOD B;  2IFN A;  2YKO A;  4Y99 B;  4WY4 A;  3I5C A;  4W80 A;  1ZLL A;  1FZC A;  2C9N Y;  2I1J A;  2NPS A;  4HH2 A;  5AW9 B;  1FJP A;  1Z56 A;  2N1T A;  4Y99 C;  3U1A A;  1FJK A;  1RF1 B;  3HTK A;  1IK9 A;  2HOD A;  2KSJ A;  3M9H A;  1HTL C;  1LTT C;  1T2K C;  1LT9 B;  1IC2 A;  1T3U A;  1NWQ A;  1IO4 A;  1LTA C;  2IFM A;  1X8Y A;  2FFD B;  2YKQ A;  3KDP B;  1LT9 C;  1KFM A;  1FZF A;  3CL3 D;  1PFI A;  1GL2 D;  1L4A B;  3C9I A;  1WT6 A;  2FFD C;  1S9K D;  1GTW A;  1YTZ I;  3EQ2 A;  2WSE H;  3MUD A;  5BU5 A;  5CCG D;  1DX7 A;  1QL1 A;  1JOC A;  1CW5 A;  1GU4 A;  1JY3 O;  1L4A C;  2R5D A;  3BAT A;  4XE5 B;  1H8A A;  1L4A A;  2WTY A;  3MD0 A;  2HFE D;  1HGZ A;  1ZN5 A;  3RK2 C;  3VMY A;  1HGV A;  1RE4 A;  1J1E B;  1MUU A;  3B8E B;  5APX A;  1JTH B;  1CI6 A;  1A02 J;  5AVV B;  4W7Z A;  5AVT B;  4OH8 B;  3A2A A;  4LGD E;  5APQ A;  5AVS B;  2KB7 P;  3TK1 A;  1A02 F;  3V4Q A;  4AYC A;  1LWU B;  2R32 A;  3P7K A;  3LID A;  5KJ7 C;  1LTS C;  1JTH A;  1HUC A;  1SQB K;  4JYC A;  3HD7 D;  2IX7 C;  5BU8 B;  3P8C D;  3HE5 A;  1GU5 A;  5CHX A;  1MV8 A;  3V2Q A;  2FKW B;  1J1D B;  4W7Y A;  2R5B A;  2Q9I A;  3RL0 B;  1NTK K;  1JMM A;  2A45 G;  4WY4 D;  2C9L Y;  1J1D C;  1NU1 K;  4GKG A;  1N2D C;  1IFI A;  3RL0 C;  1FZG A;  1RY3 A;  1L0L K;  5APV A;  1NHL A;  1SVF A;  1X79 B;  2WT7 A;  3L35 A;  3VP8 A;  1SFC C;  1SQV K;  2WIT A;  1JCC A;  1JY2 O;  2KYV A;  1SFC A;  2WZ7 A;  1HJB A;  2PAJ A;  2XU6 A;  3BVH A;  1G1I A;  1NTZ K;  1HBW A;  2GUV A;  2H7H A;  1T2K D;  1YTZ T;  1SLQ A;  3VYI A;  2HYN A;  3M9Q A;  2KP8 A;  3E1I A;  1FU1 A;  1RF0 C;  5APT A;  3VOP A;  1FDM A;  1NAF A;  4JF7 A;  3TNU A;  2J59 M;  4XA4 A;  1RF0 A;  1FAV A;  3MTU E;  3L36 A;  3O8Z A;  2FYZ A;  1J2J B;  1LTG C;  3NMD A;  3UIA A;  1HVV A;  3IFM A;  4GIF A;  1L4A D;  5CJ4 A;  3MIW A;  5BVZ A;  3VP9 A;  1MZ9 A;  1H89 A;  1JUN A;  4O9B A;  5CMZ A;  1EQ7 A;  2Q7C A;  3WMM 0;  1RF1 C;  4IFM A;  1URQ B;  3RK2 D;  1RF1 A;  1CSB A;  3H6P A;  2P7J A;  3OA7 A;  1E5W A;  5CCH C;  2OYH B;  1LT9 A;  2HPC B;  2WPS A;  3BRV B;  1JCD A;  2VRS A;  5CCH A;  1G1J A;  3SWF A;  4N78 E;  2FFD A;  3L37 A;  3U59 A;  1KIL B;  5KLV K;  3NXS A;  3U1C A;  5AW0 B;  1GW3 A;  5CJ0 A;  2OYH C;  5AVZ B;  2P67 A;  1T3J A;  3GHG B;  2N9B A;  3V2R A;  2OYH A;  1W2E A;  1FOS E;  1KIL C;  1VPC A;  5KJ7 D;  1SQQ K;  1SQP K;  2JJL A;  1KIL A;  4I6M C;  4I2L C;  1JNM A;  1GD2 E;  2E42 A;  2O01 H;  2LKM A;  5AVU B;  2W27 A;  1KFN A;  3P8M C;  1H88 A;  1M1J B;  2M8R A;  2M3B A;  3EFG A;  3M91 A;  3VN0 A;  4B86 A;  1NTM K;  1J1E C;  3A5T A;  4ZKP A;  5KTB A;  4M3L A;  1FZE A;  1S9K E;  1M1J C;  3MGN A;  4KHX A;  5AW2 B;  1NH4 A;  1M1J A;  3RL0 D;  2C0X A;  1SFC D;  5AVR B;  1N86 A;  5KJ7 A;  1YYC A;  1N7L A;  2I1K A;  3OAK A;  1JY3 P;  2XNX A;  5AVY B;  1SQX K;  3NFQ A;  1LWU C;  1T8Z A;  4RES B;  1LWU A;  2P1J A;  1HH0 A;  1LTI C;  3H32 B;  3P32 A;  1L0N K;  2W6B A;  1N7S B;  4GT1 A;  3A7O A;  1MFZ A;  4JYB A;  1ZR2 A;  1NKN A;  3N4X A;  2WPQ A;  3HUS B;  3V4W A;  1N7S C;  1GK4 A;  3H32 A;  1OWA A;  2A45 I;  3OJA B;  5AW6 B;  4ZKU A;  2E43 A;  2Q3I A;  4C7R A;  1N7S A;  4DOJ A;  1IJD B;  1OXZ A;  1JY3 N;  2JEE A;  2P2U A;  3HD7 B;  3HE4 B;  2XDJ A;  2ZFC A;  3P8C E;  1JO5 A;  4LLH A;  3RK3 B;  2WSC H;  2Z5I A;  4EOT A;  1IFM A;  1AFO A;  5CCH D;  3M0D C;  2OAR A;  2R3C A;  2O1J A;  3B5N B;  1FZC B;  1GDT A;  3HE4 A;  2NPS B;  3M9B A;  2YNY A;  3RK3 C;  1RE3 C;  4C7N B;  3NTN A;  3V5B A;  4WB4 A;  3VMZ A;  2N1T B;  1GW4 A;  1RE3 A;  3HTK B;  4N78 D;  3B5N C;  1FZC C;  2KLV A;  1CZQ A;  1QL2 A;  2QM7 A;  2NPS C;  2J58 A;  2GUS A;  1KIL D;  3B5N A;  4IFD K;  4I1L A;  1NO4 A;  4N3Y B;  4DZO A;  1JY2 P;  1WRG A;  2YO3 A;  3PP5 A;  2N1T C;  5APY A;  1IFN A;  4C7N A;  4C46 A;  1ZR4 A;  2FXM A;  1DEB A;  1KQL A;  1G2C B;  2H43 A;  1FZB A;  1URQ C;  2Z4E A;  2WPR A;  5APU A;  3N7N A;  1HWT C;  4N6J A;  2A45 H;  1URQ A;  3CI9 A;  5AVX B;  3T97 A;  5AW1 B;  1LTJ B;  4AUW A;  1AQ5 A;  2KOG A;  1G2C A;  2MJZ A;  2HPC A;  3BRT B;  3LIE A;  5AVQ B;  2OYI B;  3R2P A;  4EIJ A;  2C0W A;  3GHG C;  1XTG B;  2L5G B;  1IFD A;  5AW4 B;  1LTJ C;  1NKZ B;  1JY2 N;  3GHG A;  2HLO A;  1LTJ A;  1DH3 A;  2OYI C;  3RK2 B;  1GK6 A;  1VDF A;  2OYI A;  1X9V A;  4IFF A;  1GL2 B;  3TYY A;  1CI6 B;  5AW5 B;  3L4F A;  1N73 B;  3CLQ A;  4WBA A;  1FBM A;  2PP6 A;  1RE4 C;  2W6A A;  3IR9 A;  5APS A;  5AW3 B;  5APW A;  3KQG A;  1ZV8 A;  1GL2 C;  2GM4 A;  3LW5 H;  1N73 C;  3SWY A;  1GL2 A;  3V2N A;  1N7S D;  1N73 A;  1FOS F;  5CCG C;  3HRN A;  2POH A;  2YKP A;  2FYU K;  5CCG A;  4AQR D;  5AW8 B;  3HE5 B;  3VMX A;  2ZXE B;  2O1K A;  2QM8 A;  3BAS A;  3KYQ A;  5AVW B;  2CPS A;  3M06 A;  4HYT B;  1NOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...