3O6QA

The structure of spoiisa and spoiisb, a toxin - antitoxin system
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
145
structure length
145
Chain Sequence
TDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASLCHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stage II sporulation protein SA
publication title The structure and interactions of SpoIISA and SpoIISB, a toxin-antitoxin system in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Toxin/antitoxin
total genus 51
structure length 145
sequence length 145
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3o6qA01
3.30.70.2720 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3o6qA02
2G8YA 3EWKA 3IN6A 1FDOA 1FDIA 3H25A 1ZMEC 1AJYA 1WMKA 1OMIA 2P10A 3O6QA
chains in the Genus database with same CATH superfamily
3MF5A 3K5PA 4QOTA 3M1VB 4LR7A 2V9WA 3NBPB 4XPCA 2W25A 1UA1A 4ZITA 2CRLA 3HFVA 3RK3B 1DURA 4B17A 3CCWA 3AJ2A 1WKKA 2FGCA 1PBUA 2YQ3A 2MJUA 4KY3A 1N7SB 2ZKTA 5JJBA 4M5GA 4P6QA 1WHYA 2VFTA 3JSVC 2QA4G 1S49A 4IQMA 4JI7J 4AUKA 1ZYQA 4WTYA 2K9JB 4WWSA 4OMFG 4J9RA 5ETSA 2YKMB 4X65F 3R2DJ 3EZUA 4W80A 1HWKA 2LA4A 5AE2A 2KZZA 3M1VA 1UFLA 2ZZMA 3NBPA 2NXUA 1NDLA 1OY8A 3GFZA 2IA0A 4A8WA 3DHXA 3CCRP 1J1DB 2RT3A 2DO0A 4OHXA 1IUJA 5DQGA 2M88A 5A6WA 4DR5J 2AYGA 1CW5A 4RR5A 2APOA 4RX6A 3BR8A 1NO8A 2EI5A 1S59A 4DV3F 4XFJA 2OYHC 1N7SA 2VQEF 1OFCX 1OX3A 2XV5A 4YB1P 3OL8A 2V34A 3GV7B 2BOAA 1M56D 1FD2A 2AT1B 2PFDA 3I5BA 2K9JA 3KZIE 1HHTP 4P2XA 1SQXD 1L0ND 4EU0A 3P32A 1KZUB 1RP5A 1CJKB 2A2DA 2YKMA 5IV3A 2C3UA 2AX1A 2GIRA 1PIXA 3NCPA 2WPSA 1F5AA 1U09A 1PJ6A 3V4QA 1NPRA 3CD6P 4FBUA 4MH8A 3L95X 3CC2S 5C39A 1WF0A 3HFKA 3JQJA 4DUTA 4N8NA 2JJLA 2DR7A 2XNXA 2R8IA 4Y28C 4DMZA 2XO7A 2BE9B 4LF8J 3H90A 2UXDJ 2V2ZA 3CCJS 1EHWA 1R6VA 4Z2XA 2DY1A 1RDRA 1S4XA 4B9LA 4WF9Q 2W6AA 2IYIA 1KYOI 1CJKA 2ASDA 1HL6A 4KQZA 5GMDA 1F5BA 2P5VA 4NLQA 3MPVA 3NL0A 1SKWA 3OAKA 3KLGB 3JSRA 2NXCA 2PEBA 3C3LA 1RQVA 2QRRA 1SH2A 2RDIA 3HSGA 4LT6A 2AGOA 1NDPA 2HK3A 1SBRA 2Q6CA 3NS6A 4PXDA 1P27B 1S5ZA 2W8ZA 2MZJA 1FU1A 4ZLJA 3L72G 2GX8A 5C24B 3J7YI 4DI6A 1PZQA 2YNFB 1HYSB 3QWUA 3LQVA 1VCTA 1VLOA 3G9RA 3F41A 5KG7A 2R7OA 4MK8A 4I2QB 4PYDA 2UU9F 4JV5F 2O67A 3MCMA 2KSJA 2GHVC 3C1LA 4B08A 3UPFA 3ZO7A 3MXHP 3PH0A 4KHMA 3TZXA 2LECA 3L72E 3F73A 1K47A 1SQQG 5KT7A 3KLGA 3UNYA 2YWWA 4WWIA 1G1XA 1IBMF 4W7ZA 3FX0A 1HWJA 2FY1A 2CQ1A 1UIIA 4N56A 4P7VA 1R8EA 1HF9A 4QW8A 4DN0A 3EM1A 5KT4A 2B8QA 1P1LA 5C24A 3AB2B 3EPIA 3CL3D 3UCUP 1MLAA 4D6TJ 2YNFA 2CNNB 3CC2P 1HYSA 1CSJA 4ES3A 1RAFB 1N56A 3SFDC 2GCFA 4I2QA 1LW0B 2B51A 1F2HA 3MHYA 5B0DA 4OWFA 2O01C 3CCJP 2YO2A 1KS2A 3KJVB 4KC5A 2LXBA 2ZEJA 2K1RB 1URQD 2VRSA 3E1RA 2ZC3A 2PGCA 1ZPVA 4M8LA 3A13A 3N6MA 1RWWB 4AQYJ 5AT1B 2VPWB 3VALA 1BQXA 3Q8PB 4USWA 4DPTA 1EARA 2B9YA 2CPHA 4URQU 1MW7A 3B71A 1R5LA 1N34J 2FUG9 2E74C 2C22A 3AOAA 4DR4J 2C2RA 3OT9A 2BJ8A 2Q5UA 4LFCJ 3OD2A 4JQ0D 2DBBA 3FEYB 2DPIA 1LW0A 3A1YG 4H44B 3SWFA 2CG8A 2VDHA 2JSXA 2IAJB 3TGUD 2ZBCA 3KJVA 1IBCB 2JWNA 4F50A 2MHNA 5CD4A 3ZTPA 2K1RA 1B0VA 2RDDA 1TU3F 4ZLLA 1S2EA 4ED3A 1J5EJ 2UVUA 4JV1A 2BASA 4KT0C 4IKAA 4NXMF 4DSKA 5ETKA 1WD6A 3B8HA 2YMKA 4EMDA 1GD2E 2VODA 3KWMA 1XN9A 2UUWA 2C9NY 1J27A 1RLDA 2M7SA 2VH7A 3RG6A 2ZFHA 2XYHB 1REGX 4Q8EA 2E1CA 3BF4A 2ZNZA 3H4DA 4X4NA 4ZVFA 4HHUA 1MWYA 3KDNA 1K05A 1NK4A 3FZ2A 2IAJA 5KFUA 1UJ6A 4JBZA 4X66J 4J37A 5HBMB 3MCOA 3K5LA 3IM8A 1UVIA 1SVDA 3ITHB 4QQBA 4TT3H 2HLUA 2VASA 3HHKA 4ED5A 3R8YA 2NR0A 2LDYA 3K58A 3R7SB 1W2BO 3RB6A 4XIUA 1BQNB 1UMJA 2YX7A 1UWAA 4FYVB 1LWUC 4HDGA 4WFBQ 3AE4C 4CO0A 3DYAB 4DLGA 1ZM9A 3BASA 5DGBA 1RU2A 4H4MB 1N32J 3NWGA 2P9GA 3H0PA 1KQKA 1T02A 5HBMA 1YIJS 1URQC 3ITHA 1KONA 1S0MA 1OSCA 2MQMA 2IPPA 2HVEA 1HWLA 3BV8A 3P4UB 5L8RC 2ZH1A 3RK3D 2Y1LB 5KTQA 4ER8A 3PRVA 4K2XA 3WBZA 1BQNA 3A8JA 3CD0A 1N7SD 4HJGH 3S01A 2FYNC 3BRTB 3FUYA 3DYAA 3HULA 3MM6B 1IFDA 1HHQA 2JWDA 4LF9F 4H4MA 4TN2A 2ATLA 4KSEB 1NO4A 3ILOA 1WI6A 3ZZZA 3L72J 5IZHA 1ZN5A 1TP7A 2MKSA 3TJ9A 3Q23A 3BGRB 2FD2A 4L3NA 3CCES 1Q2NA 3JXOA 2DD8S 2GVDB 1H2VZ 1M5PC 3SCJE 3CE8A 4X4SA 3M05A 3LA0A 4MAKA 3S1KA 1ZMEC 3CCQS 3B5NB 5KFAA 1SQQJ 2R7SA 1O51A 3FRYA 3G96A 2V2VA 1HGVA 1TUGB 3AEDC 3FK4A 2HBRB 3HLUA 1IJEB 1D9FA 3MM6A 2FC9A 1S79A 4QR1A 5ETLA 2VG6B 3OTOF 2V0NA 2R32A 3S4RA 2CADA 2PEHA 2AMCB 1MWZA 3NGTA 3UCZP 1SQVK 2XZWA 1FESA 5F8LA 3BGRA 2I0XA 5IFMA 2KIKA 1NUEA 5KFLA 1M0SA 2BCCG 3ENVA 2GVDA 1PAUB 3SCIE 4DX8H 1IC2A 1YBUA 4CLWA 4HYTB 5KFGA 3TQEA 1DARA 3BGOP 1R27B 1XNRF 3B5NA 2E1MC 3QFHA 5KFNA 1PGZA 1I94F 1WHXA 1YBAA 2ATCB 4K4SA 1U2FA 4F3MA 4U8YA 3J81U 4DV5J 2LEBA 4BC9A 4DR7F 2BCCE 2VG6A 3KTQA 4WKRA 1DX7A 3CPWO 3MPWA 3GONA 4AYCA 3CI9A 5K5GB 2HLTA 1DTQB 3A2AA 4WBAA 3M6WA 4QIWD 3CNQP 5H9FJ 4JI2J 4PG5A 3RU0A 5HP1B 1Y5IB 3OUYB 2MDAA 2V2QA 4U7CA 3CPWR 3VZIA 2B8PA 3G2XA 3RK3C 1YQHA 4LMZA 3CCEP 1JJ4A 4DL7A 4CLYA 3CCVS 1FVSA 3M0DA 2EFNA 4YMEA 1HBOB 1HR0F 3I0RB 4I1LA 4HLBA 3CCQP 1F9HA 2BKPA 4DV4F 2HBQB 4DV3J 5K5MA 1DTQA 5D0EA 1LTGC 1ZM2A 1JK9B 1SQVD 3ETMA 3L3CA 5HP1A 3OUYA 1YTYA 2C3PA 2XZDB 3R97A 2E5TA 1J1DC 3WMM0 1FZFA 4OHZA 4ZCKA 2CQ2A 3MEEB 5BYSA 3D2WA 4I6MC 1GTHA 5E0OA 1FWKA 3W9HA 1HBOA 3WZ0A 3I0RA 5DDPC 1VQ9S 3EXCX 1ZW0A 2FJDB 3OR2B 2MQ8A 3J80Y 3NMRA 3RBZA 1CVJA 4ATNA 3PCOB 3JQKA 4JI1J 4JI5F 2OPSB 1ZV8A 5H2FE 4LFAF 3NY0A 2E5JA 1JTHB 3D6HB 1LTIC 1HMVB 2IX7C 2HHTA 4H4KA 1Q4RA 4KR0B 2VBXA 3PW0A 3S1TA 1RHUB 1IJDB 3HHNB 3G6XA 4WY4D 1I6JA 4DV6J 4ZJOA 2PMZD 1DTTB 1D8YA 1NSKL 5M2UA 3C66A 2CZVC 4N3YB 2B89A 2HHSA 3BH6B 4YR0A 5AW0B 3MEEA 2ZAEB 5L1KA 2QM7A 3C6UA 2WSFJ 3OR2A 4YS2A 1JOCA 5JXSA 2KKHA 5LOQA 2F9JA 3RB4A 4OHWA 5F9NA 2OPSA 3CCVP 2YNYA 4H44D 1JTHA 3PV8A 1HMVA 3KHHA 2DTJA 1E5WA 2DRAA 2WW4A 1SJ4P 1RWOB 2RQKA 1U1LA 2YWHA 3ZTRA 3EPGA 1U47A 2KVIA 1DTTA 2UU9J 4JV5J 5KG3A 1RAGB 4PJ0H 2I1KA 3G4SS 3HUSB 3HVRA 2CPSA 2NS1B 2D7SA 4PG4A 2KU7A 4O3QA 5GAEU 1MMDA 4F0KA 1R0CB 1X5TA 2V8GA 1VFJA 2WSFC 1KD1T 4QYZK 5AJ3J 4TKTA 5K8OA 3NAIA 4OI6A 1SH0A 1RHMB 3KOAA 3RL0B 3G71S 3W5XA 1RT5B 1U49A 1KR4A 1HQ2A 3SDEB 2MY7A 2V7QH 2BA9A 4OZ2A 5GAHI 4NXNJ 2UVVA 1D0EA 3HZGA 3MEDB 1PPJG 3UQSA 1SL0A 3H98A 4OLOA 3AEBC 3KQGA 2BCCJ 2BUNA 3A4TA 3VAKA 4LSLB 2KT2A 2W4CA 4JI0F 5LJ3Y 3CXHI 2MQPA 4O44B 3SXLA 1URRA 1M1HA 5F8NA 2W8LA 1S9GB 1F6TA 2JNJA 1PPJE 1T11A 4GKJF 1FBMA 5F0WA 3PFEA 2QLXA 1RAAB 1U2RA 2PSZA 1R6YA 2MKYA 4DQQA 3UD4P 3OLBA 2HFUA 1RT5A 3DDNA 1X9SA 4CQ1A 1JY2O 1NYHA 1T9WA 3SDEA 2IBOA 2D3UA 2GAGC 3TZZA 1Z4UA 5HI7A 3GJTB 2W4PA 5AW7B 2NLWA 1JY3O 1EIYB 2QE5A 3MEDA 2YKNB 4IR1A 5HO4A 5AW5B 3H7HB 6FD1A 5F3ZA 4WYLA 2J7UA 4W98A 2QG9B 4NPFX 4UUWA 1U26A 4LSLA 1YJTA 3HKZD 1YI2S 5A8WB 3O8WA 1RWUA 3TVKA 1C0UB 2Q6BA 3G8TA 4O44A 4CYUB 1NWQA 3G4SP 2Z8QA 3ZZUA 2JFDA 4OI4A 3R5CA 2JEEA 1HJ0A 2BJDA 1S9GA 2EG2A 3OFHA 3MUTP 4B9SA 5B09A 1NOHA 4F8RA 2I6WA 4MIAA 1T9UA 2PGDA 1UFKA 4OZ0A 2XNRA 2YKNA 1U1KA 1RE4C 4PWWA 1ZZFA 3G71P 2OEMA 1L5UA 1NU1G 4ECYA 3S6EA 4HR2A 4DFJA 3B5ND 2V5HG 5EHHA 4PRFA 4CPGA 5A8WA 5LMUF 1KORA 3B54A 3GJQB 1C0UA 2D41A 4CYUA 4GDOA 2ZVIA 4IOAQ 3I6PA 2W2NP 3SFGA 2BQRA 3RRHA 1X4GA 2FLNA 5TJHA 5KFZA 4DJBA 4BBYA 3O6QB 2VG7B 1D1UA 5EWFA 3TK1A 1NU1E 4OYOA 1UCNA 3H2VE 1GXLA 1M8OB 4DUZF 1FKAF 4M5IA 1AA1B 3Q24A 4ZVQB 3L75G 5CCGA 2AEJA 2ZITA 1JKHB 4QIFA 2K3IA 3BSOA 4QIGA 3F56A 3BJYA 3SSUA 3PVXA 1YQ4C 5KG0A 3PJ9A 1DEEG 2H89C 3FVYA 4EBDA 5KLIB 2B3TB 2BEZF 1UEUA 2XO6A 4BXLA 1YBTA 4YOEA 1YI2P 5B0EA 3O6QA 2VG7A 2WSCH 4EZ6A 2EFOA 1FZGA 4M5DB 1XMQF 1IN0A 4K4TA 2V2KA 3DNCA 1S0NA 2GMHA 3H1ID 2HQIA 1JKHA 1GL2B 4HT5A 4OJHA 4ZKUA 1CC7A 3MM8B 3NOGA 5F9LA 5T14A 4FYWB 2FJEB 4X4OA 4WP3A 3CJ4A 4N7TA 2YQ1A 1VQ4S 1MROB 1QSYA 1CULB 2VF3A 4CT8A 2OPQB 4FXWA 2XY6A 1S1WB 2B43A 3MDFA 4A4JA 3GWCA 4ILLA 2MKJA 1WC6A 1RB0A 1X8DA 3D54A 5AXMA 1H8AA 4B3SF 2JRSA 5CYJA 3TYYA 4ZPDA 5IWAJ 1KEKA 4L6V3 3BPDA 4M5DA 4J9OA 4F0HA 2LU2A 1AZSB 3CSKA 2WHOA 3KDPB 3HPOA 4N47A 5GMKa 1GL2A 2GIFA 1K44A 4K4XA 3MM8A 3G8QA 1S1VB 3QATA 4CLFA 2DYAA 1X4CA 1DD3A 1MROA 1S9EB 1S97A 2C28A 2F5GA 3WU2E 1U8SA 2XNQA 2FDNA 1R0BG 3N4WA 2OPQA 1QJHA 1Q82T 2BKNA 2ZOMA 1S1WA 5H9EJ 4UTGA 2KG1A 1I94J 1HHSA 1KWMA 3L73D 3W2VB 2XC9A 1KTVA 1TFWA 2DPJA 1H3DA 4KGKA 2WQYC 3NTNA 4PWDB 2IY5B 1RQUA 1U1NA 4JI8J 1FO1A 2J8SA 4JI6F 1AZSA 4L73A 4QR2A 4FKXA 4L74A 1ZRTD 2RH3A 2HQFA 1BE3D 4QIEA 2UUAJ 2W9CB 4LUBA 3BO3A 1S1VA 3TYTA 1RHKB 2B9XA 1FX4A 5ITHA 1S9EA 3CX5H 5F8MA 3M0DC 3W2WB 4DJGA 3VOPA 3RJMB 3DHWC 3NOCA 5LXYA 3OR1B 2Q3EA 4OGQB 1TL1B 1X4BA 4DV7F 3OFGA 3A7OA 1VQ4P 3W2VA 1HR0J 2Y8YA 4PWDA 4Q44A 1QE1B 1AT1B 4O0NA 1UPPA 1EETB 4MN4C 2KZMA 1H6KX 5D6GA 1G1JA 1D7MA 1N5YB 2M2BA 4I7ZC 2XMAA 4TY9A 3IO1A 2W9CA 2IVMA 2V4RA 1GAOA 4EUVA 2R8KA 3QT8A 5LMNJ 5SUHA 2HFVA 3IWXA 3KHLA 3EVWA 4PPZA 4WBFA 3OA7A 1RK8A 3W2WA 2QLBB 1GK4A 3MM9B 1T3OA 3GF7A 2DRBA 4LF4J 1VHIA 3RAQA 5CYMB 1NU1J 3GSDA 2HBYB 1N73C 3KLHB 2L9DA 1TL1A 1UWBB 2ITAA 2D1CA 2V8PA 4YHHF 2IZ0A 1QE1A 2QLWA 2GGPB 3RL0D 2RS8A 3KKFA 1C1CB 1EETA 3LW5H 3NLCA 1V5VA 5HROB 4ZIWA 1YZ7A 2M3DA 1N5YA 5CYQB 4GODA 2KZIA 4ZVTB 1KB9E 4ZCIA 1IR2A 4GMKA 2KFYA 3Q8VA 4X64F 1P84E 1O6XA 3EE3A 1JQGA 5HMWA 1XMOF 1RT6B 3L75J 2HLOA 3LGNA 1RWXB 2M4MA 2DB1A 5CYMA 3P45B 2XS2A 1NPPA 3O1LA 1EXJA 4DR2F 2GA1A 3KMQA 4W7YA 4J9UE 2VFVA 4OYIA 2N3OA 2XLJA 3KLHA 5JVHQ 1UWBA 1FJ7A 4UQTA 1AQTA 1T7PA 3UR3C 2CIMA 4NEYA 2V4JB 4NE9C 4O3PA 1FRLA 2GGPA 3KK2B 1U8WA 1C1CA 2KSEA 2UXBF 2J5UA 5HROA 5CYQA 3BATA 2UUCF 3R7NB 4WTOB 1GU5A 5AW2B 2AJ4A 4I4BA 4USUA 3BQ1A 1J1EB 2E66A 4NASA 4ZPCA 3GV8B 3W68A 3VAJA 1RT6A 3Q8RB 1E6VB 1VQ6S 4LGDE 2FXOA 5L38A 4OJ1A 3K2YA 3WQPA 3LF0A 4ASWA 1TUWA 1YGYA 2R3SA 4N6JA 1IR1A 3IXQA 4F3OA 1CJUB 1U4BA 2V4JA 2VBYA 2WVDA 4GC7A 4NZ7A 3KK2A 5EX0A 3HVAA 1A7GE 2HR3A 3BN7A 1HWIA 4FN5A 2BKOA 1UJ4A 4HDHA 3HSJA 2LQ9A 2ZKUA 4DL6A 2ADCA 5CCGD 1S4EA 1X9VA 2HKEA 3M6UA 5IT0A 4TLRA 4FP9A 3MOZA 3P5BP 2CPYA 1DRZA 2Q6QA 1IQZA 1E6VA 3O3LA 1TVRB 4FPIA 1FZCB 2BJEA 2DNYA 3THTA 3R5JB 3F0NA 1HJBA 3KYQA 1BD6A 4DSEA 4ZVRB 4BS2A 2CPDA 1EC5A 1JLCB 1KOOA 2DHSA 3HX9A 3CGIA 5KAIH 1DQ8A 5HATA 2D9OA 3GIKA 1REVB 1CJUA 4M5NA 4F2RA 2H5IB 4LF6F 2V8HA 3BZQA 3RL0C 3CD5A 2KZJA 3L74G 5CA5A 1X0FA 2HHXA 5KFDA 1KB9D 2B9BA 3D6TB 4C11B 1IO4A 3QSYB 2IM0A 1P84D 3IWLA 1Q90D 2DR8A 5KJ7C 2GJ2A 1YTZI 1PCAA 4NMLA 3UCGA 1MU2B 3EVOA 5DM6Q 1BDCA 1IFJA 2QIWA 2VOPA 4DEZA 3Q2YA 4AUWA 3KNGA 1TVRA 2YH0A 1MN7A 1FZCA 3N01A 1HUCA 1VPCA 3L74E 3PDNA 4Y2AA 4C6AA 1BGYG 2BM0A 2HK2A 5JVGQ 1JLCA 2P6TA 2K37A 4AT1B 1REVA 2ZZTA 1Z1ZA 3THVA 1FERA 3C19A 2FYUE 1VQ6P 1SKRA 3ZTOA 2ZH3A 1Y0HA 4CTAB 3JSBA 2QVAA 3N0VA 3G9CA 2GNKA 3H5XA 1SQGA 2CPBA 4USJC 1PGJA 1RZMA 4QU6A 3AE6C 4C11A 1Q81Q 2QJ3A 1NXIA 3M9QA 5B7WA 3IR9A 1S6PB 4Y2CA 1GL2D 3NS7B 2RUSA 1MU2A 3I5CA 2E7WA 2XWXA 3BQ0A 1NB2A 3GIRA 4DCPB 1HW8A 2J59M 3LTOA 1XR7A 1K9MQ 5IQQA 1BC6A 3GE9A 2CZ9A 2Z0GA 2I1JA 3M06A 3OTEA 2FYUK 2EPIA 4WFZA 3V2PA 5ETNA 2CQHA 3IC1A 2XGQA 3D70A 2CUYA 3BS9A 4ID8A 4K59A 2QL9B 1N36F 3I96A 1IFPA 1E6YB 1GMUA 1L3VA 2XY5A 3SIPB 2B0GA 3QT7A 1FCAA 3ETOA 3GMAA 2HG5D 2GVZB 4CTAA 3CC4S 1OW6A 4TLFA 2WK4A 5SZTA 4PD4H 3RRGA 2W9BB 2ZM6F 2U1AA 2Z2LA 5CCGC 3B4DA 1S6PA 1GTWA 2DHAA 4QMAA 1OW7A 1XTCC 2YKAA 2MQLA 3R6LB 4DUZJ 1FK9B 1SV5B 2Y0SD 4DS5A 2FLPA 4DOJA 1VOMA 5KT2A 2WB1D 4OYBA 4B3MJ 1H73A 2HPUA 2GHWA 4I1TA 1E6YA 3VGUA 3W62A 5E3AA 2FVSA 1YITS 2GVZA 1N88A 3VVUA 1SKUB 4ZPAA 2MPUA 4NYOA 1S76D 4CNYA 1QAYA 2W9BA 3FEZA 4LR8A 2XCPA 4J9QA 2ZDOA 2WONB 4C8YA 3KUHA 2H4WB 4ZNCA 4GOFA 1NCLA 3EFGA 2Y1IA 3NMDA 4JI3F 2YX4A 1FK9A 1SV5A 1EP4B 3TUPA 4HT7A 3AAWB 5D4PA 1WRGA 1P9QC 2VQFF 2R5BA 2KJVA 3AEEC 3K5BA 4O3NA 1QUPA 1VLYA 2M9KA 5KLIC 2A18A 2BXJA 2FYUD 1GK6A 1RADB 1LTTC 2XSFA 1NK6A 1YK9A 3A12A 4OGQD 1WC1A 4B9MA 1FDBA 5HJYA 5E5NA 2ZHBA 1DD4A 4PQUB 5AW4B 3T5HA 2OEJA 1JXEA 1NTMK 3BPSP 2J9DA 5AVWB 1SI9A 1JMTA 2WONA 1GL2C 2OEKA 3RL0g 3CC4P 4B3OB 5A0YB 1SQPG 5GAEI 4CM0A 2FGOA 4DT0A 1EP4A 1JX4A 2YMYA 4YDDB 1ZM3A 4RNHA 1VBYA 4ZPWR 2R8JA 2MKCA 4LF2A 2W8KA 1WC0A 2C42A 2HHWA 2N4DA 3SQGB 4JYCA 4A8QA 2J76E 4PQUA 2PN6A 2E5LF 1SQPE 4F26A 1LP1B 4KTQA 5DJUB 2A2CA 2M8HA 3BM7A 5BXIA 2FXMA 5KAKA 1YHQS 1VJWA 3K17A 2KOGA 1QTNB 3KDOA 5CBOA 1RTDB 2YH1A 1VHFA 1X5OA 3ZXWA 2HG4A 2VA3A 1EZVI 4B3OA 3L74J 1RAOA 5A0YA 4R25A 4HTIA 3BKUA 1FAVA 1OY9A 5J2MB 1WSVA 1Q7LB 1HNWF 4USMA 4LRAA 1WACA 1HNZJ 3QO9B 3G82B 3CWBD 4C8KA 3Q5RA 3W3SA 3O5TB 3Q89A 2AYBA 3VHQA 4NLYA 2G0CA 1SUQB 3D6ZA 4PUOB 4LBIA 3SQGA 5KLVE 4OX8A 1B0TA 1BCCD 1VRUB 3QJJA 5D0RA 1M5HA 2HYNA 1BGYJ 3OXFA 1LP1A 5IT9Y 4DCOB 1UW9A 2K88A 4C46A 3PG9A 4DV7J 2XNDH 1TK5A 4JBCA 2HYIB 1NTMD 3LO3A 2CQPA 4JYAJ 2EK6A 3AOBA 1RTDA 1VQ8S 2W6BA 1FJPA 3ENWA 4KO0A 2ROGA 5J2MA 4IFDK 3HD1A 5L46A 5KLVK 3OXLA 3Q0AA 4Q0BB 4ECZA 3QO9A 2DCUB 1AW0A 3OSNA 3G82A 1Q79A 4RNFA 4AYBD 1ZM4A 1SUQA 4ECWA 2ACMA 4PUOA 4OGQC 3MEGB 5AVSB 5CJ4A 1VRUA 3L4FA 4TQRA 1W25A 3A0BH 4KV8B 1HWUA 1PP9G 5EX3A 5J2PB 3MPYA 1LEOA 3IGNA 4ECTA 1HI8A 2IDBA 2WBMA 2CJXB 4DSFA 3U1NA 3GHGC 2HZVA 1X9MA 3UWTA 1BQMB 3MTUE 1NPKA 2QJKB 2ZC4A 4QYRA 3DC2A 3MTJA 1RHRB 4OZLA 1IBLJ 2VFRA 2ZVOB 2ZUAA 1YHQP 3JCUH 3EQ2A 4Q0BA 1S1XB 1RWNB 4GVBB 1PP9E 4ANDA 1QEXA 4ASVA 1JY2N 1PAEX 2RILA 3QLHB 4NZ0A 2AEFA 1JY3N 3MEGA 1XMOJ 1HLWA 1H2UX 4KV8A 2D3OR 1CG2A 5J2PA 1X4FA 2YNGB 4AD6A 1CQNA 4ID5B 4JOUA 2HHHF 3UIAA 3JSMB 2FIUA 2DNOA 5AW9B 3RYLA 4GIFA 2RB7A 1RAJA 1BQMA 1KQGB 1V9OA 5APXA 1FTCA 2J9DE 3M4XA 4N8OA 4C2MA 5C2CA 3PXGa 1B7FA 2NSBA 3VTPC 2MKKA 4RKUJ 1S1XA 3GIMA 1T9TA 3FEXB 1WUUA 1KKHA 4WZQA 1VQ8P 4CLKA 5KLVD 2QYGA 3TDKA 3V81A 3RGUA 3QLHA 1BGXT 4AFFA 3N7NA 1V3RA 3TR5A 1KQSO 3I55S 5CJ0A 1YX2A 2BE2B 1PL5A 1KDNA 2JEJA 3WC0A 2YNGA 4ID5A 2KTQA 4ANEA 3BYPA 2NPIA 3JSMA 2OI2A 2DISA 2AEMA 1QY7A 1HQEB 3CWJA 2U2FA 1ZPWX 1KQSR 3TO8A 3BVHA 2BE7D 8ATCB 3MCNA 4UY8T 3HT3A 3BSCA 1SJQA 1RACB 4TQSA 1A02F 1MG7A 2AJ1A 4P9SA 1GX5A 1SQPJ 5KFEA 1RYRA 1RBOB 2ROEA 3G86A 2QG4A 3KJFB 3TOQA 4DF4A 2B7BB 4D3HA 3LIDA 2BE2A 1QM9A 5BVZA 3LGMA 2E1AA 1FDMA 3SV4A 4JI7F 2QL7B 2IM3A 4FBTA 4LSNB 2VU5A 4AL7A 2E76B 3W61A 5L9NA 4FYDA 5K9FA 1E79H 5L9XA 1HQEA 1RKIA 5L39A 5IC4B 4LF6J 4A8SA 5D0HA 4M5HA 4NI2B 2K7KA 3A3PB 1QSLA 1VC6A 2WVRA 4NCAA 2CJYB 1RYSA 1SC6A 3D4JA 4NLGA 3M2RB 3EGNA 1NH4A 2B6AB 5JUMA 4NMXA 2DW3A 2C2DA 2DNRA 2OPPA 4DR3J 3NS5A 1ICEB 3LP2B 3J7AN 1Y3KA 4TY8B 2VKZG 1PC4A 2PI5A 3SV3A 1XC9A 2RH0A 3H1LG 4LSNA 1PILA 3E8OA 2MGZB 3I55P 3VYIA 3KFWX 2RSQA 3D1QA 2ASYA 4NRTA 2L08A 1GDTA 4GO7X 2RD5C 4NI2A 3IA0A 1TL4A 2KB2A 1RAIB 3M2RA 2B6AA 4CH0S 3VMXA 3H1LE 4O3RA 4ELTA 3A8EA 1TQLA 3LP2A 3M32B 2RQ4A 2AQ4A 3T1YJ 4TY8A 1L0LK 4LF8F 2UXDF 4DL2A 3FXDA 3E3XA 3QWOC 2H51B 4LBHA 2PD1A 2MGZA 3H5SA 3SFUA 2WVEA 3HJVA 2DNNA 3D71A 3CX5I 3ZNUA 4RW6B 1PP9J 5F8JA 2DNHA 4CO2A 2C9LY 1XIQA 2O01H 3A8IA 1LT9B 2LXFA 1EZVG 3DDKA 2RMZA 3D5MA 2DH7A 2OFHX 4EDFA 2HQGA 2DNMA 4J7CA 1GU4A 2HZCA 3Q8UA 4PJ0E 3DXSX 3VAHA 3OJAB 5LSOA 3NRBA 1OXZA 3CULA 3N5FA 3PEJA 3M32A 3CDWA 3MFHA 1B64A 5I3QA 1DBDA 3TAPA 2XB2D 5LSRA 3QIPB 1QLNA 5CCLA 2R7XA 4ZVPB 1C1BB 2EFQA 4WXWA 1EZVE 5EUHA 1YKWA 4NA1A 1S0VA 1FFSB 1S10A 3WX4A 5HN0A 4KRWA 2QMUB 4RW6A 1JXVA 4PYAA 4LREA 3IP0A 4DHVA 5ETTA 1LT9A 3FBBA 4A47A 2Q43A 5K8MA 5CQGA 3H1KG 3OLAA 4U96A 1ULRA 3DI6B 2W27A 3EXYA 4MK9A 2JH3A 1FDOA 5M2PA 1BY9A 3GJSB 1FDNA 1YJRA 1I5OB 3QIPA 4Y65A 2B4VA 2EEYA 1RE1B 1C1BA 3B6BA 1L0LD 2ZDPA 1OPZA 3H1KE 4H0LB 1ZBTA 3OHAA 1OWXA 3FZBA 3ISND 2JDJA 3MMJA 2E74B 1WOOA 3HCXA 5HANA 1TV6B 2QFIA 2L3MA 1U45A 2YWKA 3DRXA 1Q8LA 5KFTA 5A6PA 4USVA 1RABB 1DH3A 2LFVA 1VDHA 4AQYF 1G2EA 3QSIA 2E75D 3DI6A 1T8EA 2VFSA 5ETRA 1ZTTA 1EKSA 4KGVB 1Q5VA 2A1BA 1N34F 1JCCA 2FJAB 4LVNP 2KB7P 4DR4F 3VZHA 3R1LA 2QEXS 3AFGA 4LFCF 1H38A 1UJ5A 3NNCA 2DH8A 2QL5B 1SC4B 2OPRB 2VPYB 3LAKA 1WMKA 1N5TA 1TV6A 1G6BA 1RSCA 4Q45A 5LM7E 2QSIA 2PC6A 1KN6A 3THPA 3OPKA 4NCBA 3H4BA 1T03B 4N41A 2QTWA 4ZN1A 2ZJQQ 3NXZA 1KFMA 3CCTA 1DIPA 2Z56B 3E51A 2OTJS 2E7VA 1CJTB 1KOHA 2FZGB 1MNEA 1HNWJ 2IPOB 3PKYA 1RWPB 3HM9A 4GO5X 2KO1A 2HNZB 1AQ5A 4U3FD 3E7KA 1ZAWA 3U1MA 1RHQB 4NWBA 4QWBA 3G3ZA 3M9OB 1I1GA 2GW8A 3LP0A 2OPRA 4NLPA 5DLFA 1ACMB 3PHLA 1GEHA 3DLLQ 3H6PA 3ZZRA 4FF2A 1Y4ZB 4X66F 2NSCA 3H1LJ 3D28A 1IKYB 2FB0A 1T03A 4KHPF 3Q5SA 4ES1A 1V5IB 3T6BA 3ZZOA 2ZBPA 4NLWA 3NNAA 4BWNA 2NZ2A 2J58A 4F4AA 2KXNB 4PPDA 3H2UB 4I6YA 1CJTA 1EDKA 2JKVA 1L3KA 3K5NA 2LU1A 1WOSA 1FT8A 2JDIH 2HNZA 2UXCJ 3IMQJ 3PR4A 3HKWA 2XZTB 3RBDA 3TZWA 1AYEA 2F4VJ 2BR0A 5GTHH 2R7RA 2GFFA 2L5GB 3FMWA 1N32F 2P2UA 2ZYDA 3ISNC 2MZSA 2YWGA 2FYNB 4EZ9A 4DL5A 2H5JB 2LQBA 3LH2S 1SFCC 2QEXP 1WI8A 4PV1C 1UAWA 5IT4A 4C3LA 4DL4A 3D1HA 4FF1A 3MR3A 1IKYA 2Y9ZA 4ZJQA 4KPCA 3KK3B 2N7YA 2JOQA 1H0TB 3ILIA 2FYXA 1OYDA 3QYYA 3AD9C 1XTZA 2Z57B 1B0PA 2XLKA 4CO5A 2IFXA 2UP1A 1X5SA 3H2LA 3QPIA 1FJGJ 1S6OA 3ADAC 3I9V9 3P3DA 3C8VA 3VAIA 4I56A 2WITA 3RW7A 4IG0B 2OTJP 4WFAQ 2MSTA 5DG8A 3AEGC 2E76D 2AV5A 1JLEB 4NYZA 2V7QJ 3L70G 3T19A 1TL7B 1GZLA 3PW7A 3KLFB 3CJTA 1TZ0A 3QBCA 4F3QA 2HHHJ 2PE8A 3PYGA 3KK3A 2LDIA 2XYPB 1H0TA 3HTKB 2W7OA 2XMUA 4M1KA 3H1KJ 4PXEA 2F3JA 4PD4I 3PTWA 1YWXA 2JHEA 4OIXA 3L70E 3GJRB 5APSA 1T2KD 1R8HA 5GAGI 8AT1B 2XMTA 1OVVA 4YPCA 3FGVA 4OV6A 4B3RF 4IG0A 1VK8A 3CJRA 3QT5A 1R8PA 4MK7A 2A10A 4ZP6A 4HKZH 2BRKA 4B3TJ 1JLEA 1TL7A 1IBKJ 2HWHA 2CXEA 4UW2A 1NU4A 3KLFA 3PACA 2DEJA 1LWFB 4J9NA 1VQLS 2FQQB 2WPQA 3TF5A 2V9KA 2ZE2B 2B5JB 1HBUB 1VISA 3V6KA 4XE5B 3HTKA 2AZ1A 1QX8A 1JMMA 4K8RA 4GRSA 3SWYA 1A02J 1XMBA 4AL6A 4ENOA 4K0KJ 4FYXB 4DV5F 2AP6A 1DFDA 3OSPA 1KFSA 5HL7Q 2FFDB 1NLKL 1VGYA 3NG8A 4WVZA 2FPHX 5BU5A 2ZJPQ 5I4MA 3TP2A 3GLMA 1JUNA 4IH7A 4JI2F 1LWFA 3M2UB 2WZ7A 1H72C 2VBWA 5B0BA 2ZE2A 2B5JA 4IRKA 1HBUA 3HI9A 1RUSA 3UD3P 2G0JA 4C0BA 4TXSA 2A45G 3CCMS 2BQUA 3FQKA 5DLGA 3NWRA 4K7QA 2R3CA 4H13C 3ISZA 2JLEA 1JLQB 3L71G 2CDQA 1D9AA 1YDLA 4ICLB 1YJWP 2KUBA 3GLJA 1PGQA 2DR9A 3RAMA 2K06A 2K3KA 3ZZTA 2FFDA 4URSA 1K73Q 2MXYA 4CH1A 2E76C 2K3RA 4C48A 2EG1A 3MZIA 2H88C 3K5OA 3DMJB 1VQKS 2NXEA 4W90B 2BJ9A 2YO3A 1AROP 1NTKG 3VN0A 1FRKA 4N78E 2HRYA 1M5SA 3L71E 3FJ2A 3M2UA 1IFMA 2O01N 4ILMA 3A8KA 4NYPA 4EBEA 2AXTE 3GYNA 1LT1A 3DN9A 1IKVB 4U8VA 2CJQA 4DR1F 5FDLB 2M8RA 5EFWB 1T0TV 3MGNA 1VQLP 3QT6A 1JLQA 3BR9A 4RL1A 1RTHB 3I0SB 2Y9HA 4ICLA 1T2KC 1EQMA 1B99A 4M63A 2GUSA 3LALA 5DZ6A 2Y0CA 5A2QU 4JI1F 2WSCJ 3V6DB 3MTKA 3IM9A 4H0LD 2OIHA 2XMWA 4S0MA 3DMJA 3WUUA 2E74D 2K2PA 1KSPA 4AXIA 2WWWA 1NK7A 1S9KD 3D68A 2WMMA 4D6TD 2A06G 3FNNA 2JLFA 2QMXA 3D1OA 2XSJB 3HE5B 4DV6F 4DN9A 4UB8H 2VHGA 1EQ0A 1ROFA 2KI7B 2J9CA 4I69A 1IKVA 1R43A 2Q1KA 5FDLA 4FXDA 4G1QB 4RLEA 3FDSA 1ZS6A 1RTHA 3I0SA 3PYEA 3QH9A 3QWPA 2HSEB 2XQCA 3EWKA 4ZOSA 2A06E 3CCMP 3V2RA 4DFPA 2MZTA 5G0RB 5C25B 3V6DA 1SLQA 1ZZNA 1NHVA 2X1AA 3SZ2A 2WSCC 1RI7A 2N9BA 4E0DA 2Z5HA 2NPSC 5BR8J 1S77D 4DV1J 5HVHA 3IN5A 3MCSA 2HQ3A 2ZOGA 3TVZA 2XSJA 1LT9C 1YSJA 3QAEA 3SEOA 4JUZA 3HE5A 1J5OB 3RZAA 3T1AA 3L70J 1VQKP 4P74A 2DR5A 3CC7S 3I4HX 2XBPA 3ZNJ1 4G1QA 3EGWB 4B02A 3RB0A 4OX7A 3JSYA 2AXCA 2BV3A 3W66A 4MKBA 2N82B 1WKLA 3CJ3A 5AJ3F 1S6QB 3M9NB 1K04A 2NZ4A 2OMOA 2XKMA 3SMZA 2KFNA 5G0RA 3IRXB 5C25A 2J5AA 1D8ZA 1KFDA 3Q8SB 3CJ2A 5CBNA 5MAOA 1UVMA 5KAIE 3MI7X 1F9EB 2CKWA 1LW2B 1L4AC 1RT7B 1NJIT 4O9BA 2IMOA 1SQQE 3NFQA 4NXNF 1Q95G 3EMTA 1WTFA 1J5OA 4QZVB 1YTZT 2CQDA 5B08A 4OFZA 1OMSA 2IBZI 3IBFB 4C4WA 1SIWB 4ZDNA 1FKOB 3R5BA 1VYAA 2YX1A 4NLOA 5CHCB 5A8RB 2ILYA 3KNAA 1UL3A 2ZH4A 3EJMA 2ZVNB 2BW2A 4K2JA 2MZQA 4I7FB 3L37A 1S6QA 1QL1A 5BYRA 1SQQK 2JVOA 3IRXA 1F9FA 1OMIA 4H0LC 2W9AA 4BRYB 3ZFVA 4I67A 4YXDC 3BYRA 3J7YU 4A7PA 1HNXJ 1WSRA 4HB1A 1AFIA 3BCCG 1LW2A 2B4PA 1RT7A 2CQGA 2LEAA 2JO1A 1WDDA 3C14B 4KB7A 1H0HB 4R0JA 3US5A 3IR7B 1Z56A 2RIJA 3C15B 3MPDA 1N5QA 1FKOA 5K8NA 4IFVB 1LGHB 2E29A 5A8RA 5DDRC 1XBWA 3BCCE 3SWKA 4I7FA 3CJ0A 2V94A 1CEZA 5FD1A 2GQQA 1HPZB 3T41A 2DNKA 3L71J 4BRYA 3TANA 1OWAA 3NP5A 2W1BA 3LW5J 4O23A 3MAQA 1M1KT 1BE4A 2P2CB 4RW4B 1M1GA 2X3GA 3HK2A 2F40A 3C14A 1F1BB 2GHPA 5T41A 4PD4E 3L72D 5H9FK 1Y47A 3C15A 1NTKJ 1UTAA 5B0FA 4IFVA 1U6BA 3JTOA 2HVIA 4ITSA 1NRKA 1R8AA 3GYGA 3TNUB 1U2CA 3SSQA 3H5UA 4KHPJ 4DUYJ 3N4XA 1RE4A 4W4MA 3ZC4A 5D8HB 1EX8A 2YIUB 2OQQA 3BQ2A 2BABA 3D0GE 3MMAB 4AXJA 1HPZA 2FJVA 1OIPA 1SQFA 1Y3JA 1FX2A 2VD3A 1S72S 4YN3B 1PFIA 4IFYB 3L7OA 2MKVA 4WPAA 1X4EA 4E8UA 1SQQD 2OO4A 4GVLA 3BO2A 2D2CB 2V4QA 2H43A 1ZA2B 4RW4A 3QGHA 1GQEA 3C6TB 4OV1A 4P75A 3AE1C 1M1JB 2YXLA 4DZDA 1WG4A 2MHEA 2Q1LA 4K4VA 1JXLA 4W92B 1NTZG 3NXSA 2IDEA 4DR6J 4ES2A 3TNUA 3PO5A 3GIIA 2KS1B 1SXLA 4ZHRB 2GUVA 3N9UC 1TK0A 4C7QA 5EWGA 4FF4A 3MMAA 4ZKAA 5DZ7A 4ZA1A 5I42B 1C4AA 4IFYA 3VCDA 3G6ES 5AXKA 1R8CA 3CT9A 5IQ6A 3MR2A 3AQOA 2QA2A 2GZOA 2QYCA 1NTZE 2JL9A 1GMWA 3DRPB 3OTBA 1APSA 1T94A 1TL5A 5KFSA 5KFVA 3C6TA 4ED7A 2KJWA 4ZLPA 1KRPA 2AF6A 2ADBA 3UVJB 2KRBA 1M1JA 2ZH5A 2GC8A 3JTNA 5E7OB 4DPOA 1X7VA 3X3UA 3P6YC 5TISE 3N28A 2KS1A 2UV8G 4ZHRA 4X4UA 3OVBA 3MMBB 1G1IA 2CJAA 3NCRA 2R7UA 4NCGB 1S6UA 2F7VA 3IAS9 1N8RQ 4RNMA 1P6TA 1DJ0A 4E98A 5I42A 3OV7A 2DGVA 1FRXA 4UT4A 3PM9A 3WHIA 2M5YA 5F41A 4ZIVA 2Q7CA 2XHCA 4F4YA 5AVTB 1QAIA 5IWAF 3GCXP 4NPDA 4B3RJ 4IYQA 1XTGB 3DRPA 1S72P 2RUGA 2EC0A 1TK8A 4C8NA 2Q79A 1WEYA 1JO5A 1FRHA 1NVOA 3UVJA 1NJXA 1FFWB 2Q3IA 1J2JB 3TAQA 1EKRA 2AJQA 1RA7A 1M5OC 5KT6A 2KHCA 1VIXA 5B0CA 4EBCA 2QA4S 3MMBA 3I31A 3JAMY 1ZP0C 4NCGA 3LWMA 1O0PA 4F25A 4UB6H 2GV1A 3CDUA 5APYA 3DFEA 1YIJP 3V5BA 3FKBA 3SBMA 2DK2A 2C0WA 3HDSA 4FS2A 1KYOE 1FXDA 4K5RA 1UW4A 3DLKB 3H1HG 4JI8F 4Q43A 1JJCB 4G65A 3BGFA 1SJ1A 3AT1B 1RE3C 3G6EP 3M30B 2RKLA 4LF5F 2LQ8A 4F0MA 3BCCJ 2UUAF 1PGPA 1N7LA 3D3BJ 3PW4A 4EYYQ 3AECC 3CCZA 3GZ7A 1FWLA 4RUBA 3B78A 2FHJA 4YQWA 5F8HA 5GMEA 2EVZA 1FOSE 1WC4A 4I7ZB 1LKZA 2DXEA 1U7LA 3R5DA 3GYXB 4XDDA 3WUVA 3OFEA 1WTBA 2FFDC 4C7NB 1RTZA 1S7IA 7AT1B 1GK8A 4LRCA 7FD1A 2CQBA 4NPOA 2P7JA 4RBUA 1CBKA 3DLKA 3GF3A 5GADI 1OSDA 2H65B 1VQ5S 1N73B 4FYYB 3M30A 4AQRD 2EFPA 1UEKA 2M3BA 3H1JG 4K4UA 3AA8A 2QJPB 3KPEA 3D9BA 3Q83A 2V8DA 3LOUA 5AW8B 2CWXA 2K8GA 5LMNF 4RJTA 4ZS6A 2HVZA 3AD7C 5IV4A 2IBZG 5CZXA 5T7LB 1NHKL 3NGSA 2QM8A 1N33F 2M5AB 2VPXB 3JCUE 2I9SA 4LF4F 4NLTA 4OZ5A 4DQIA 4V19X 4DR1J 4IL6X 4URGA 2HMIB 2DVIA 4DX7A 1WHWA 1SQBG 2J6UA 4C7NA 3D0IE 2JP3A 4X4RA 2QA4P 3H1JE 3C6UB 2NREA 1K1QA 2RHQB 1T8ZA 1X4AA 5DM7Q 4HTJA 2FJBB 1FJEB 1TELA 3OL7A 1LK7A 1N73A 4NLVA 5K8PA 4IQXA 2OYIB 1NH8A 6AT1B 2QN6B 2AHOB 2I38A 3IBCB 4JI4J 1VR6A 1PSDA 4USHA 2F4FA 2YKPA 3VMZA 4CLPA 3ENAA 3W67A 4PG7A 1SQBE 2ZJSE 4O3OA 3OQ2A 4M5LA 5MLCV 5T7LA 2OJ3A 2RQMA 2M5AA 3CDAA 4TU8A 1NTZJ 1JLGB 2PFFB 4IFFA 2MQNA 2HMIA 1KYOD 3U1CA 3MM5B 4U95A 3FCWA 2BCCD 2EK1A 4LIRA 1SJ3P 2DGUA 4RO0A 3W65A 2G4BA 1Q78A 2OHDA 2R2RA 4OX9J 5CH7B 4YDXA 4DDFA 1RKJA 2OYIA 1FRMA 3KG1A 3QZ8A 8RUCA 4X4TA 2QLFB 1I3OB 1HW9A 4R4MA 1R89A 5CCMA 3L36A 4J9MA 2V63A 1VQ5P 1OIAA 4EYIB 3J7Z5 3IR5B 2DHGA 2MB0B 4IG3B 3ONQA 1HKAA 1Q16B 1SC1B 1JLGA 1S5LX 1QAXA 2O3JA 3MM5A 2HGNA 3MD1A 4WU3A 3P8CE 2HQCA 3GFHA 4B86A 3T5KA 2R7QA 4NLRA 1CI6B 1QL2A 2HNDB 1SL1A 1HBMB 3KLEB 4DU7A 7FDRA 4G6VB 3MR5A 3QQCD 4NA2A 2A0FB 1VQ9P 5KFKA 4XO0A 1HA1A 3GR1A 1HWTC 2XCAA 4FS1A 2PP6A 1PG5B 4IG3A 1QUVA 4P2FA 1ZOYC 1N5VA 2C2EA 4FNIA 3W60A 2ZBIA 4QWAA 2WOMB 3UN2A 2IZ1A 4F67A 1SH3A 2KYVA 3AB4B 4YB7A 1VIOA 1QLED 1KVKA 1MKMA 3EX7B 3FWLA 1M57D 5D3GB 1IFNA 1X22A 5KAFH 3NNHA 3ULHA 2R9LA 4NEZA 2VV5A 1TUVA 4CT9A 3AE8C 3R1HA 2LMIA 2E5HA 2QE7H 1CI6A 4PG6A 2H9ZA 2FZCB 3P8BB 2I1RA 2HNDA 2Y9YA 3VP8A 1HBMA 2D2CD 5E79H 3TARA 5KFHA 1GMWD 3OHBA 3KLEA 1HTLC 2GMJA 2WRMA 1G7CB 3EYZA 4I0WA 5ADZA 5DDOC 2CWKA 2G0IA 3H1HJ 4DZOA 4ALZA 5KFXA 2FHMA 3K0JA 1LWXA 2EBGA 1VS3A 2VKRA 4X4QA 4PR6A 3M2VB 3UDVA 3W9IA 1FWPA 2WOMA 5KJ7A 2F1FA 2KDOA 4OX6A 5KG1A 2AJ0A 5KFMA 1SQXG 1L0NG 3M9HA 1WG1A 4A8YA 5D3GA 1AVYA 1NHUA 3T5LA 3JAMU 3C16B 5KFBA 4X62J 2XWYA 4OYPA 5H9EK 1NKZB 1K8AQ 4WU2A 3JYTB 2IRYA 2FXPA 2H5EA 2BYCA 1VBZA 1KB9H 1UZDA 2N4CA 4BDPA 4DU8A 1VQMS 1DAXA 1V6HA 1SQXE 3DLGA 3BREA 4Q7AA 1R0AB 3KMSA 1P84H 3AHPA 1N2DC 3Q1MA 2IC3B 3KG0A 4WFXA 5DG9A 1Q1KA 1NDCA 4A8XA 1FEHA 3M2VA 4TVAB 3H1JJ 1SIZA 5ETVA 3P8CD 2OD4A 3OTDA 4F4ZA 3BSNA 2OSQA 3R4YA 4CP5A 4LRBA 3L7PA 2ACYA 3NAHA 4CI0B 2N1TC 3LP1B 2WW8A 2LQJA 3C16A 4UZCA 3MP7B 1M5VC 1SQBJ 1BLUA 3H8YA 4K4YA 3JYTA 3DGPB 4WP8A 4ECXA 2G1HA 3CIMA 3D6FB 1FDAA 5L1LA 2QJYB 4UOGA 4ED6A 2HFED 1R0AA 1IFIA 4CLLA 2XGPA 2IC3A 2MKIA 4DSJA 3CD7A 3HT0A 1F60B 3VWSA 3GW6A 4RU9A 5HSPA 2FHJD 1EJ7L 3GG2A 2D69A 2EXUA 2RKIB 5M2RA 3V4WA 2AYEA 4ZKPA 4B3MF 2YIUC 2VPZB 3C9IA 1MZ9A 2MLZA 4LLHA 2IM1A 2L41A 1NB7A 2IBKA 3R5AA 3RTVA 4I68A 1NZAA 4DS4A 3LP1A 4IDKB 3MUMP 4J9SA 1S1TB 4IL6H 3MUVP 1NU1K 4DPXA 1PPJD 2WTFA 2D2CC 5LSLA 1SKSA 1IKWB 3TA1A 3CJ8A 1LQ9A 1GW3A 3DGPA 3MFIA 1IQTA 1WC3A 3L75E 1VBKA 3E1IA 4X4PA 2ZYGA 2EKYA 1M1JC 3J7A1 4Y2MA 4Q5VA 1ZAXA 3J80U 3LWLA 4NLSA 4UQGA 1UVKA 3AJDA 4ZCMA 2LKZA 1RTIB 4ZCLA 3PX4A 1VQMP 2RKIA 4GKGA 3GB0A 2ASJA 1FZEA 5K14B 2G3AA 2WPVB 1NSQA 1JLFB 4RNOA 4Y28J 2BANB 3AOCA 3V4IB 4IDKA 5AW3B 2HW3A 4EO6A 4LF7J 3CO0P 3R27A 1TR0A 4DFMA 1S1TA 4A46A 2Y0BB 2XMJA 5DDQC 2E42A 2LXIA 5D0GA 2I8EA 1IKWA 1Q0NA 1O8BA 1P9YA 3QAUA 2Z4PA 2B4UA 1X4DA 1USDA 2UUTA 1NK9A 3H59A 3POTB 1A9NB 3A3NB 3WIVA 1W5CE 1Q8IA 2M0BA 5A8KB 3SCKE 5B5EH 1RTIA 4J91A 2ZH2A 2A6MA 4LBPA 5KFOA 4FVCA 4DV2J 5K14A 2BVZA 1X5PA 4DG1B 1JLFA 3RRKA 3VGTA 4G1IA 2BANA 2ZYAA 4EWTA 1MMNA 3V4IA 3BRVB 3TGUG 3OL6A 1X60A 3KYLA 1S5LH 3AXKA 1NU1D 1NM2A 1P8GA 3K89A 3QRPA 3W8PA 2PMWA 4KBIA 4MTPA 3AQPA 4Z7YA 2X3DA 1NAQA 3TEGA 4OYXA 3POTA 4NRUA 1NKBA 1Q7YQ 5DS7A 3P96A 5A8KA 3TGUE 1KC8T 2RF2B 2WVCA 4RW8B 1YG0A 3MIWA 1U1MA 4LF5J 1HNZF 2Z5IA 4O0IA 1N48A 2XHWA 3DLBA 2EC2A 2HHVA 3BDPA 2C2OB 3CIZA 1RISA 4DG1A 5KKZB 2GIQA 4WFYA 3E01B 4RWWA 2Y8WA 1OPIA 1U7JA 2MMYA 4P71A 3IAOA 2P67A 3L75D 1SQXJ 1EXIA 2KLUA 1L0NJ 1XNQJ 3JS9A 1PKUA 4NLXA 4Y3CA 4NL5A 4QWDA 5GTHE 2O01J 4KH0B 5CAAA 2YKOA 4HI2A 2LEPA 4JYAF 4YP3A 1VQOS 1JMBA 4LFBJ 3IFMA 2AU0A 1RHZB 4QBUA 3RR8A 2F8MA 1KP6A 2SXLA 2N7CA 2MJNA 2RF2A 4RW8A 1Q86T 3J81Y 4DQSA 1DZ5A 3GHGB 2MLYA 2FLOA 1UA0A 1H7XA 2WVFA 3Q3DA 2VL1A 4CLTA 3UDEA 2M3EA 2UZAA 2HURA 3D3CJ 3E01A 2ZT9B 1JNRB 3M6XA 4P73A 1N33J 1MFZA 2BW7A 1YBKA 2HAIA 5HJXA 5J2QB 2WB4A 2YTCA 4JP8A 1FNOA 3SCLE 2A45H 1PIEA 4H54A 4M3LA 2QJPC 2R2UA 3ZZ0A 4OI0A 3HJFA 4WY4B 5D15A 3TA2A 3FMBA 1IBLF 4ZMMA 3HO1A 3GHGA 4KT0J 3PRDA 2ZH8A 3GR0A 3LUYA 5KJ7D 1TFYA 2DNQA 3CXHE 3QJPA 3T5JA 3GILA 1IWGA 4ZLNA 4QPXA 3BDEA 3OL9A 3RK3E 3PIOQ 2IVYA 1WT6A 4ZP9A 1H98A 1SB6A 5J2QA 4HYKA 1Q8KA 2OKQA 4PXCA 2OYIC 2HPCB 2RRBA 5ETOA 1T9VA 3KLVA 3SYZA 4WZMA 4RZRA 2C2NA 1BSNA 3N5BA 4UZBA 1YZ6A 4WY4A 4LSZB 3GG1A 3HVTB 4QU7A 2R42A 3E2EA 2NXNA 2YPYA 3RUBL 3CMQA 4Z7CA 3I32A 4YFUA 4JF7A 3SI8A 1VQOP 4YEAA 1YJ9S 2XI3A 3GFYA 2E1RA 1FZBA 3TNVA 1AJYA 5C2GA 3VQSA 3U7JA 3GU0A 1W2EA 5C42B 4KH1B 2IM2A 1GT8A 2M8DB 4OH8B 2PI4A 3DU6A 2HPCA 5DG7A 2P1JA 4ANCA 2Z4EA 2FKWB 4NOHA 3N79A 2POHA 2WSSH 2F63A 4V1Ak 3UO0A 3HVTA 1JNZB 2AYMA 3M0AA 2OAUA 5BYQA 5L8RJ 2P6SA 3FSYA 3M9MB 1T6AA 2XMVA 2LA6A 4I2LC 1QAJA 4FVMA 5THWA 1GTEA 3HZEA 4ECSA 4U67Q 1DQ9A 3WC2A 1NKEA 2HVDA 5C42A 3OTCA 3EICA 4CDIA 2JFKA 1PJ5A 3MECB 2C2MB 1T9XA 2QGFB 2NXJA 2DGSA 4A48A 4DPWA 3TGUJ 5HK4A 1W2BR 4A8OA 1ZAVA 2DNLA 2GQCA 2PDAA 1RT3B 1URNA 4G1PA 1RF1C 4DV0J 1GXUA 2DJWA 1NJYA 1HBNB 2DNZA 2W2MP 3CXHD 2WSEH 1MV8A 2K7JA 1S12A 4C0OC 2VONA 2QSFA 1C4CA 1T05B 4CLSA 2CJ9A 4DX6A 3VVTA 5CXTA 1U1QA 4DQPA 1CS4B 4DR3F 3TUZC 1JEKA 4OYZA 1SQVG 1M7LA 1Y5NB 2FVCA 1TU0B 3ET6B 3S7RA 1YJ9P 3MECA 1WHVA 2R3VA 2BJ3A 3FSXA 2Y1RI 2NQPA 3PJXA 2R7TA 3CJ5A 4BHQA 1RT3A 4EK2A 2DGXA 1LXJA 2DY9A 4LRDA 2IA6A 1HBNA 1MSWD 3UD5A 3FCVA 3PHTA 1SQVE 2KXHA 3J81j 1T05A 1KMIZ 3M8WA 1BGYE 4EEYA 1KQFB 1VI7A 4UB8E 4C9DA 2FY8A 1LTBC 1R5SA 4C98A 3S8SA 1CS4A 2HWTA 1L3SA 1JIHA 3T1YF 1EAYC 4R8UB 2QV6A 1VMBA 2O3DA 4TU9A 5KFCA 1QDUB 1N6QB 3ET6A 2E7XA 1PYOB 3EVMA 3DRSB 2JWAA 2I8DA 4DXLA 2BEFA 3X1LB 3D0HE 1Q53A 1HD0A 5G4DA 4ZPTR 1UVLA 3I56S 3JC22 5DJBA 1OZHA 3EDQB 2W7AA 2FBWC 2H3EB 2J8AA 4ED0A 3OJSA 3RB3A 2FJXA 1UFWA 3UR0A 1NSAA 4XTTA 1H7WA 2CVEA 3MR7A 2ZHAA 3PP5A 2JC0A 2AJFE 1NSPA 2VC0A 1BXNA 3A3YB 2C1EB 3IFEA 2HQDA 4WJBA 5BJRA 3PX0A 1VRTB 4R8UA 4ZVUB 1A6LA 1N6QA 2CDRB 3CB4A 3DRSA 3FFIB 2B87B 3D66A 3PX6A 1B7YB 5APVA 4B9VA 2M0GB 5HLFB 2CQ0A 4HH1A 5HVFA 2QJYC 3PEHA 1WOPA 2BOPA 3TRGA 2IRUA 3GIJA 2VJVA 4J9PA 4YB6A 4ZMDA 2GJFA 2XULA 1TAUA 4X65J 4RW7B 1CQMA 4Y99B 2KK7A 2QZ8A 5KTBA 1X4HA 2RE1A 2OGUA 4QWEA 2FZKB 2ABYA 3L74D 3KJQB 1N7SC 1WNEA 4DX5A 1VRTA 3TWZA 3UI3A 4DZ6A 1D09B 1KTQA 5M1BA 2HFOA 5KFRA 2D3ZA 2DEIA 3FFIA 3TW0A 4EO8A 2B87A 5KT3A 2DHHA 1IJFB 2VQEJ 1WF1A 1WELA 4FDFA 5HLFA 2V6AA 3AE5C 4WYWA 2CQ4A 2LCWA 2J7KA 4DCJB 5HMZA 1BGYD 4RW9B 3FC9A 3FRZA 1S99A 5I3PA 4J9KA 3I56P 2QSWA 3MEKA 4RW7A 3BGLA 5AVQB 1FDIA 4M95A 1S1UB 2ZOFA 4R0EA 5L1IA 2CA9A 2LP4A 4M5JA 2CJBA 3QGIA 3K5MA 1FXLA 2ZT9D 2B88A 4K3AA 2L48A 2HS0A 1X31C 2KN4A 4N77A 4ZP7A 1CC8A 4RUCA 5IOLA 2XYGB 3QIDA 3OBIA 4CO3A 2KNCB 1RLCL 4LIWA 2CVIA 2C2KB 4M94A 1FEEA 2I5JB 4JV2A 1HARA 1MWQA 2CQCA 1ZTWA 2DR6A 4RW9A 5B0AA 5DETA 2EFGA 2JEGA 3PRBA 2H1YA 1IR0A 2VJUA 1T3JA 1YITP 1S1UA 1LWCB 4KO0B 5L1JA 4P2SA 1NKNA 1UVNA 2XS7A 5DO2A 4ERDA 1NBEB 4LRFA 1UIXA 1BUXA 2W2OP 1SQPK 2PO4A 4XPEA 3C46A 3GMGA 3HD7B 3SQOP 1G4CA 2KNCA 4KHXA 2YNHB 2D9PA 2FVQA 2E9RX 1NAFA 1SQVJ 4N76A 2I5JA 1S57A 2XY7A 3VP9A 2MYFA 4OI1A 5GTIH 3PY8A 2HEKA 3A0HH 4ZPVR 2ZVSA 2CPZA 2I2YA 4JV0A 2J6TA 3TX0A 5BU8B 3IS9B 1SFCB 4B9NA 5KFJA 4PV1B 1LWCA 3UFCX 1RT1B 2E43A 3WDOA 3M91A 2WZ1A 2OARA 5KKZC 1XERA 5A76A 1LTJB 3H32B 5D4LA 2OD6A 4XAKA 1FJKA 3QMQA 5D4NA 2UUBF 4DPUA 1IBMJ 2UXCF 3R2PA 4WB4A 2F4VF 3FCHA 3HD7A 1KBRA 2YNHA 4KAIA 3V6HA 3GPAA 2KL8A 4JPZB 1NJIQ 1KTMA 1RWMB 3AXMA 4PWUA 1R7IA 3IGVA 5HMYA 4MKYA 3DDIA 2D3O1 4ED4A 2DGQA 2JEFA 3IS9A 3HUSA 1SFCA 2RAQA 2ERRA 1RT1A 3UNGC 4GOEA 2O66A 1U1PA 1LTJA 2P9EA 3H32A 1T3NA 3DOLB 4QWCA 2W7PA 2ZT9C 4D3GA 4LJMA 2FVRA 3ZTQA 1KB9I 3IN6A 1FJGF 5KFQA 4A8MP 3V5RA 3V81B 1P84I 3BN4A 1BMQB 2DGTA 3QZ7A 2MLXA 1G3OA 2AJ2A 1SQPD 3H1IG 1KVIA 5J2NB 3AA9A 1SC3B 1GMJA 3PZPA 1M90T 2HBZB 3AE2C 4WY4C 1RHJB 1TKXB 3R9LA 2JZ5A 3CF5Q 1JM0A 4U6PA 3OVSA 1AXQA 9RUBA 2LVWA 1X8YA 3DOMB 5FJ4A 4YB5A 3B8EB 2R5DA 4KE5A 3H1IE 1B3TA 2LXCB 2AGQA 3AJ1A 4RBVA 5CMZA 2E9ZA 3DOLA 4EYHB 2KVQE 4R5PB 4I64A 4CWBA 5E33A 3IAM9 1XR6A 2IJRA 1U24A 1QVFO 2DXDA 2MZRA 4OZJA 4NXMJ 1HGZA 5AVVB 1F5CA 4KHRA 1DY3A 2AZ3A 4TYAA 3PLNA 2J0QD 4UB6E 4KGXB 3U27A 5AE3A 3KJNB 4B3TF 4H44C 3IF4A 5J2NA 1Y8AA 4LQ9A 1AV1A 2ZHOA 1M1KQ 1S9FA 2BMBA 1IBKF 2JLGA 1U1RA 1QVFR 3CJQA 1TKXA 3T3FA 2CPFA 2V67A 2RJZA 2IDLA 2PAJA 3DOMA 3HXMA 3W8GA 6FDRA 1F2GA 3L73G 2QFJA 3BO4A 2N9YB 4R5PA 5DQHA 1TL3B 1UVJA 3AODA 4JYBA 3M8QB 4K0KF 2H54B 4RKUC 4H4OB 4ED2A 2X1GA 1VK3A 1Z2LA 1PYTA 4UOFA 1N54B 2DXFA 1CJVB 4H13B 3CMAS 2X1BA 2CQ3A 2OPPB 1BE3G 3AE7C 4DWIA 3MD3A 4WCEQ 2E5GA 3HE4B 2FJWA 3PNIA 3SFEC 1VQSA 2BZ2A 3L73E 1S1CX 5K20B 4Y6IA 3RR7A 5APTA 4F04B 3ITKA 3LIEA 4NZ6A 1L3TA 4TU7A 3QJLA 1SS1A 1XEZA 2KLVA 4CRJA 2SPZA 3M7VA 2ROPA 1RT4B 1PP9D 1ZRTE 2FYZA 1NH7A 4ECQA 2VUGA 1BE3E 2H8PD 3PW5A 5B66H 4KFBB 1TL3A 1OYEA 4IO9Q 2EBEA 3CXCR 5EGYA 3VV2B 4DF8A 3M8QA 2PRRA 2LQ5A 4DOZA 4H4OA 1X9WA 1IWAA 3MM7B 4RNNA 2QLJB 4QYZJ 1CJVA 2OTKE 1FZAA 2ZFCA 3CDEA 5KFYA 5KFPA 1K73T 5F8GA 1SJFA 1X79B 5DGAA 2CZ4A 4WK1A 3HE4A 4OL8A 2DNGA 4HVZA 2W01A 2MEWA 3V6JA 2E5YA 4LF9J 2BJ1A 1SVFA 1HVVA 2E5IA 3LANA 1AFOA 1VQYA 2HODB 2B9WA 2UVWA 4DBQA 3KHRA 2P58A 2DKOB 1UP1A 1RT4A 3T9ZA 1ELOA 3L4BC 3RK2B 3VMYA 1NNDA 4KFBA 2W2QP 3AEAC 5LJ5Y 1BDDA 2PIIA 3MM7A 1HNIB 2NUUG 5F8IA 3W9JA 4AL5A 4BWJA 5CZVA 2EFVA 2N3LA 4XDCA 5APQA 1NMEB 3MUDA 1XK8A 2HHUA 3AE3C 3M8YA 2NRGA 1FRIA 1HBWA 5LL6d 3OTOJ 3DOKB 3CMAP 2HODA 1X0PA 2MQOA 5AVZB 1U7MA 2NPSB 2ZWPA 4P2MA 1U0HB 4Q2LA 4YY3F 3WUTA 3CCLS 5IT9U 3B5NC 4XA4A 1KHWA 3HHEA 2KT5A 3Q5PA 2FHKA 3GV5B 4CO1A 4DQRA 3BGUA 1CULA 3DM2B 3KK1B 1HNIA 5AXNA 4ECVA 1YRTA 1XNRJ 2IFMA 1JLAB 1JNMA 2C2ZB 2IIHA 2WPRA 1BSHA 4UOCA 3I82A 1VL2A 1NEEA 5FLXY 5BR8F 3VMAA 4QJVA 4DV1F 4DR7J 1K1SA 1LXNA 3I87A 1QSSA 3IWNC 3PTZA 1W2IA 2CK3H 1WDTA 3DOKA 2MY8A 4M5MA 4Q8FA 3H1IJ 2L9WA 2M52A 2NPSA 2MQQA 1U0HA 4HH2A 5KG4A 2Z58B 1Q5YA 3B82A 2YWFA 4FZVA 1L4AB 3TEHB 2HGLA 3KHUA 2H48B 1PGOA 4C8OA 2A45I 3L35A 1HIYA 3HP6A 3DM2A 3KK1A 3TVYA 3ZZPA 4CZCA 1D3WA 1CPZA 1JLAA 1O5JA 3HD7D 2HFSA 2RDJA 2YPZA 1IM4A 1MFTA 3M8RA 3DLHA 2QA1A 3O44A 4WP9A 4O4RA 5KAFE 1H88A 1NK5A 4OZ1A 1TAQA 4DV4J 1JWWA 5E79E 3TQ1A 4K5SA 3V2UC 1NZ8A 5AE1A 4Y99C 3D6YA 1SFCD 1PC5A 1L4AA 2CYYA 1KQLA 4PV1D 1EQ7A 2JJ4D 4MT1A 2AD9A 3H1LD 4GKKF 1LFWA 2XU6A 3A3OB 2KG0A 5E3CA 1Y11A 1FRJA 4MMOA 2GQ2A 3CCLP 2C3MA 3OR1A 1CSBA 2R7WA 4PQAA 3L73J 3OXGA 2W4DA 2KXFA 2IRXA 1U48A 2O5DA 2JX2A 2ZD1B 2C3YA 3KZIH 1HNXF 4H4KC 3UDCA 1L2PA 1U6ZA 3LP0B 4JI5J 1ZETA 1BE3J 3UE2A 4PZVA 2AXTH 4HKQA 4LFAJ 4QW9A 1PJ7A 4O4GB 3SSSA 3OFFA 2W90A 2IHR1 1RJJA 3GCWP 5ETMA 4F2SA 4G3IA 2EWHA 4KGMA 2MSSA 1RF0A 1RAEB 2YY3A 3I5AA 4WIQA 4FNHA 3MM9A 1LK5A 4OJGA 4MKAA 1OVRA 3UW1A 4J90A 1F3VA 2GS8A 2ZD1A 1IVZA 1EZVD 3EDRB 3PJSK 1K0VA 1GH8A 3CMES 1LOUA 4K50A 1BWEA 5AVUB 2CG4A 3MD0A 4MJKA 2Q9IA 1LTSC 4FPRA 4O4GA 1IK9A 1SQEA 4RPFA 5APUA 3OJUA 4IOBA 2XG8A 3TI0A 5KFWA 4HI1A 1Y5LB 1XJWB 4USTA 2YXQB 2CPJA 4DUYF 1W7WA 2RS2A 3VTIA 2VC1A 3PO4A 5IXUA 1DLOB 2L91A 2CPIA 3HD7C 5E3RA 4ZVGA 4IRCA 1KNZA 1FVQA 2UUBJ 1KD1Q 2YQ0A 3H1KD 2HS3A 1OY6A 2Z2YB 5IC6B 4IRDA 1JB0J 4IL6E 2B7CB 1H2TZ 1C0TB 2DIVA 2OTLS 4CM2A 3T1HF 3P7KA 4Y34A 3RGIA 5C7PA 2DHXA 1L3UA 2XS5A 3HUSC 2Y1JA 1KV4A 1VRQC 4IFMA 4M5KA 4DR6F 1LTJC 1WORA 1KILB 3PJWA 2QMWA 3HSDA 4PG8A 3M9BA 3DKDA 1DLOA 1FKPB 4ZVOB 4OLPA 4H13D 4NX9A 4JI0J 1UETA 4UUXA 1EDIA 2FVPA 2OELA 1C0TA 2DO4A 1JB0C 5KOXA 4GKJJ 2XZRA 1N5SA 2Z2MA 1J2VA 2NCKL 4IOCQ 2J7WA 1HD1A 2POKA 4TYBA 3IG1B 4ILRA 1NK0A 1UEVA 2KT3A 4L75A 1PO6A 4X84A 5AVXB 2R8GA 2FYUG 3BKTA 3CMEP 2XI2A 1ZXGA 4RESB 4LVOP 1KILA 2B9EA 4RJVA 1NJZA 2XDJA 2COLA 5B5EE 3A5TA 1H74A 5CABA 2J6SA 1RU1A 4CIOA 3G6YA 3KXDA 3PYFA 4IUFA 1FKPA 1N8RT 3BSAA 1QGKB 2HRUA 2RHSB 2WCXA 4ELUA 1JCDA 4YR2A 1PV3A 2PA8D 1FTRA 1S5LE 3VR1A 2HWIA 1QVGO 5J1NA 3DCAA 1T3UA 1FFGB 2K9YA 3IG1A 5FLXU 1S0OA 3F89A 1U0SA 3KLIB 1NKCA 3ZDMA 4EI2A 4LR9A 3EGZA 4GT1A 1RWKB 2WBRA 4EIJA 1TKZB 3TSIA 2CNOB 2OTLP 1VC5A 3P5TL 3RK2D 2R2SA 3TJ8A 3CUNA 2YKQA 1QVGR 3Q2SC 2OP5A 3IR6B 1YVFA 3HHLB 2HS4A 3GSIA 3V6IA 3EWGA 2RQCA 2ZXEB 3B4SA 5LMUJ 1IM6A 5E3QA 4O3SA 4FKYA 1FA0A 3S9OA 1N52B 3CX5E 1NDKA 9ATCB 1N86A 2P9CA 2FC8A 1XWLA 2OH2A 2KYZA 2Z2ZA 1A0OB 3FBFA 1KHVA 5EN1A 3CWBG 5GVQA 4PEOA 2HZAA 1VJQA 2B4OA 2NPSD 3VAFA 3KLIA 3AD8C 4K4ZA 2BRLA 3NGUA 1DHMA 1RBLA 2IYPA 2WTYA 3II6A 1TKZA 2GM4A 2ZH9A 1RE3A 2V68A 1BCCG 1UKUA 1USEA 2RVJA 1VBXA 5C5JA 1KLMB 1W26A 4MKVA 5HAOA 1YRXA 1GFWB 4CCHA 4PCQA 3HHLA 3CWBE 1NTMG 4DL3A 5CCHA 2VB6A 2ALYB 2VDIA 2G2OA 5GAGU 2KH9A 2DRDA 2ZZNA 1BCCE 1AB8A 1QTMA 3HHDA 2JR8A 4DSLA 4PABA 2FTRA 4MIBA 2KYXA 4KJIA 1RAHB 1TMMA 3L7UA 1NTME 1XMQJ 1L4AD 4OI2A 2CNKB 1YJVA 1KLMA 1LFPA 4DLEA 3OW2O 1S3JA 1FHTA 4L76A 4FF3A 2KM8B 2CAJA 1FD8A 2BJ7A 4YUDA 3L70D 2A6OA 2FLLA 5LXRA 4YXWH 4V19J 2E9TA 3BBFA 3UN5A 5JMNA 1EDJA 2M70A 1RGVA 1NTKE 2DH9A 3MUDC 2Q66A 3PRJA 3EFFK 3B4MA 3CLQA 3OW2R 3KHGA 2WSFH 2ZBQA 3TUJC 5LT5A 2CFXA 3TAMB 4JI4F 3ILLA 1RY3A 4B3SJ 2CPXA 3L09A 3G8SA 5TISH 4OVNF 1F3FA 4C0HA 2XMMA 3FXEA 1AA0A 5DQIA 3M8PB 3RK2C 3K57A 3HVWA 3GP9A 4RU2A 2BDPA 1NTKK 4ETZA 1FE6A 4YY3J 5F0UA 4C8LA 1AVOA 4J9VA 1Q8BA 1IK7A 4Z37A 1KILE 3CX5D 4OHVA 5AVRB 4KJMA 1OJ4A 3CCSS 3O8ZA 1Q82Q 5AVYB 4OX9F 1MN9A 1BWVA 2AGPA 3C2PA 3HMJG 4P10A 4EFAC 1AUSL 2DGOA 2LLZA 4Y00A 3VQTA 3MR6A 1OW8A 3TAMA 2NPFA 3QFWA 5KLVG 1TMJA 4Y2KA 4DPYA 4HL9A 2VZ9A 4JI6J 1LNQA 1KC8Q 3V2QA 5J1PA 1G2CB 4BLGA 3M8PA 4YTPC 5CD4H 1R31A 4MFBB 4A8KA 2FYUJ 4UY85 2IYGA 2IJNA 3ZZYA 3RBXA 1OQ6A 1KYOH 1FC2C 4ZJLA 2LR2A 1S48A 2JEIA 1V3SA 3NGRA 1RWVB 3UN3A 2DNPA 2V50A 2ZH6A 1FE4A 2L9NA 3KUEA 1YJ7A 4N78D 5FIIA 4K35A 4E2FB 3L71D 3QGGA 2ILZA 4CH7A 2Z30B 4U7JA 3VGSA 1FF2A 3FWNA 1TTHB 2YWEA 1Q86Q 3I4PA 1G2CA 1CLFA 3CCUS 2R44A 3CJKB 4F02A 2GAHC 2E75B 3RBEA 1YJUA 4MFBA 3P8MC 4RBTA 1RCXB 2ZUGA 5DJTB 2BACA 1NTKD 2GO8A 4YR3A 3NKYA 1WKJA 1U02A 3F5HA 2CNLB 4GKKJ 1DQAA 2J0XA 5U47A 3HD2A 4TLQA 2MKHA 4JB8B 4C97A 1RTJB 2VOOA 1EZZB 2UV8A 3H42A 3V2NA 2C3OA 4YHHJ 4Z1MH 2P8IA 3CCSP 1FOSF 3BB5A 2XM3A 1DEBA 4ED8A 4ZVHA 3W1YC 3K8WA 5HQMA 3Q8QB 3PFOA 1RF0C 4OYMA 3CWBJ 4QIVA 3HRNA 3CJKA 5APWA 3N6LA 2NUHA 1KILD 1VF5B 2ZWOA 2QRXA 2ALZA 1CZQA 4X64J 3G6VA 2WT7B 1BCCJ 3VF0B 4F4XA 4HH0A 3IBWA 2DIUA 2A06D 3FSIA 5B0GA 3MAHA 4J5OA 3TA0A 1UPMB 1T9YA 1WWHA 1FNMA 5D77A 2OSRA 4X62F 4QR0A 3CC7P 4DR2J 5H2FH 4USKA 1RTJA 2VFUA 1NAYA 1NTMJ 4DCKA 1ZH5A 4EOTA 2JC1A 1K8AT 3HFZB 4IR9A 4C8MA 2N1TB 3DLEB 5CHXA 1H89A 3W63A 1FXRA 3H20A 3AE9C 4KPYA 4HHJA 2UXBJ 2F8EX 4ECUA 3VGVA 4GVBA 2KRRA 2UUCJ 2W2PP 2AKWB 4F4WA 2QX0A 3K59A 3CO9A 1OS5A 4XK8C 2WT7A 1YJNS 1VQ7S 3LPYA 3CCUP 1MUUA 1KFNA 2JVRA 3NCQA 2H4YB 3R5GA 4OQJA 3BEGB 2V69A 2O1JA 2N1TA 3DLEA 1PYSB 4ZN3A 1Y7PA 5E41A 3C8YA 2W83C 5AW6B 2RRAA 1EB0A 5D78A 3TJAA 5EWEA 3LW5C 3SSRA 1Y9OA 3H40A 2UWJE 2KHDA 1WJ9A 3DRRB 1J1EC 4L3KA 2HIYA 3W5ZA 1VC0A 3M6VA 3NMAA 3T1HJ 5EDWA 2YNIB 3TX8A 5AW1B 2LXUA 1F0XA 4P72A 1ZA1B 2KFZA 4R4LA 4MIWA 1RT2B 3ILJA 2HHQA 3HHLD 4TNOA 2R7VA 4J9LA 5CCHD 3BBBA 3Q2TC 4FXVA 2G2YA 1HH0A 1VQNS 4L72B 2BM1A 2ZJRQ 2OYHB 1Y9BA 3H5YA 1OVUA 2QIFA 2BX6A 1LV5A 3D7SB 3G87A 3DGVA 2R2TA 2Y0EA 1FDDA 4LF1A 2MJZA 1ITPA 3DRRA 1SCJB 5RUBA 4F4KA 2YNIA 2IJFA 3PW2A 5KLVJ 1NGMB 1KILC 5HQLA 3VAMA 2OUGA 3MHVA 2QC3A 1FZCC 2LYVA 1L0LG 4LQ3A 4DR5F 3QRQA 1RT2A 3BCCD 3ZTSA 4X2BA 2CPEA 3UDLA 4OZ3A 3CEDA 3NGKA 3QRRA 4LF7F 3D6MB 2E1PA 5D4OA 1NTZK 1M5KC 4NPEA 2DITA 2G1DA 3KUGA 2V8VA 3HSZA 2KI2A 2OYHA 2FHOB 1YJNP 1VQ7P 1HNVB 4C7RA 1S7HA 2G2ZA 4IH5A 1L0LE 4ZK7M 3AY0A 1T95A 2VICA 2R8HA 3CVKA 2WSEJ 3LPEA 4PD4D 4ECRA 3H25A 3USSA 1OO0B 4KGZB 2GJIA 2EKNA 2YBVA 4USIA 4WFNQ 4ED1A 1NHLA 2MTLA 4WE1B 1LJ2A 1B4SA 1LWEB 4DV2F 3KG4A 3VAGA 1ZLLA 1QD1A 4IH6A 4BWMA 1K0TA 1TKTB 5J1EB 3EGVA 1JJ2R 2G13A 3CJSA 1FE0A 5HQ8A 1VDFA 4MYUA 4NA3A 4PAAA 1N36J 1XR5A 1HNVA 4A8FA 1GMVA 1EDLA 3U59A 2HIQA 2BQ3A 1V3ZA 3GG0A 3DRYA 3U1LA 2ASLA 1VQNP 4N5SA 4I6AA 5ETQA 4Y0FA 4IO1A 1C2PA 2WSEC 1Q7YT 3K7RA 2ZM6J 2PA3A 1U25A 5GTIE 4U3FG 2YXRB 3A0HE 2AW0A 4WE1A 2RU9A 4DL0C 1WF2A 2D74B 1LWEA 3F44A 3R3TA 1RCOB 2HVHA 2B56A 3RW6A 3HHLC 1TKTA 5J1EA 3FQLA 1ZR4A 5CCHC 4PXBA 3H1HE 1AFJA 3DU5A 3EZ5A 4I6WA 2X51A 3BH7B 3WIUA 3PYDA 1XNQF 2IYOA 3JQMA 1NTZD 4EGLA 4U3FE 2J0WA 4OJ3A 2O1KA 2IMWP 3T97B 1R3NA 5E2QA 3ABVC 4LFBF 5KFFA 2OLWA 2ZXXA 3A0BE 3RAXA 3MPUB 4P52A 3U02A 4B9UA 4QPTA 4BCAA 3M8SA 3LAMA 5KOWA 5KFIA 1U57A 2G8YA 5KG5A 1WEXA 4HHHA 1LTAC 2E44A 1SP4A 2ZNYA 1VQPS 1P1TA 2V4HA 3LGHA 4JI3J 3W5YA 3V4MA 5KG6A 1HI1A 2VQFJ 3TUIC 2AX0A 2NYIA 2NZCA 4DSIA 4RUHA 3OVAA 3ELHA 3U1AA 4OI3A 5ETPA 3Q86A 1XQIA 4K4WA 4DFKA 2ZH7A 3GFXA 3T97A 1KLNA 4WKYA 1KVJA 2IBZE 5IS2A 5HVGA 4P7TA 2OFGX 3MZWB 3BBCA 5IM0B 2KM8C 1NJWA 1GW4A 3MAAB 2O1PA 2VBZA 1X0TA 3GQCA 3MGJA 1S4FA 2VG5B 3GTYX 3PR5B 2J9EA 2X7IA 1MMLA 3N6NA 1N4LA 3CDBA 1UZHA 4X4VA 2QT7A 1JJHA 4U7UK 2BEQD 2HFZA 1OQ3A 1GX6A 2NYHA 2RMLA 1NK8A 2XEXA 2YVSA 2LKMA 2KXPB 1D9DA 1YYCA 5DRKA 3EZOA 2E5LJ 1R8BA 3QNWB 2HRTA 5GADU 1SQBK 5KG2A 4OYAA 2Q3PA 2P10A 1N0VC 3MMCB 4OZNA 2HGMA 2MZ1A 3CTRA 2RNEA 1JLBB 1U6FA 4ZPBA 2A3JA 5IM0A 1J5EF 1SPBP 2PFXA 1VF5D 3MAAA 4HACB 4WXOA 4CLZA 3I9ZA 5A2QY 3H1HD 4C3MA 2VG5A 3WU2H 3DXBA 4ZVEA 1RXOB 3R2CJ 4HEA9 2RN0A 1N0UA 4UOHA 1L0LJ 2Y0DA 4WK3A 2DGWA 4BC7A 1SL2A 5F3TA 1VQPP 3NGDA 1FI4A 4UF4A 1IZNB 3JB9k 1LWUB 1U1OA 2C0XA 2N1TD 3O2IA 1GXTA 4U9RA 2BBEA 4RWXA 4KKOB 4ZP8A 1JY2P 2X1FA 1FS0E 2OYOA 3MMCA 5E3PA 3IRWP 2HAFA 2J0SD 2W24A 1JY3P 3L9ZA 5KT5A 3D67A 3P49B 1JLBA 1TKDA 3DLJA 3PIPQ 4ETXA 4HACA 3WX8A 1RF1B 1IKXB 3FBCA 1URQB 4C3KA 2GA7A 1Y10A 3NEKA 3TZYA 3ENQA 2XLIA 1SJRA 4PKDB 2HNYB 5B66E 3H1JD 2QO3A 2PMHA 2K1AA 4OHYA 1LWUA 2VIHA 2HFNA 4NLUA 2WVBA 2H7HA 2IBZD 4U7UD 1BHNA 4KKOA 3JTPA 1IXKA 2W6JH 1RQ0A 3MURP 4Q2MA 1HQUB 4DV0F 3Q8YA 4LC1A 1YRUA 1SQBD 4WIIA 1WEZA 2RRNA 1HI0P 2F65A 2E75C 4I2PB 4F36A 4ZVSB 3DLGB 3W7BA 3QGPA 2XTJP 3CW2C 1RF1A 1IKXA 4AE5A 2VA2A 4B9TA 2CJKA 1URQA 4F7VA 1YQ3C 1FNXH 4U3FJ 4CNZA 3BKFA 1HFEL 2HNYA 1WC5A 2GO9A 2HHPA 2G9OA 4CLUA 1FJCA 2IFNA 2PT0A 1ZOTA 4NLDA 4CO4A 3M8ZA 2AWZA 3PHEA 1M90Q 1RH5B 2EW9A 5H1SV 2AIRB 1GNKA 3MOJB 4Y2IA 1RBAA 3AH6A 2DCLA 3PKMA 3T6JA 1HQUA 2QJKC 1AUDA 1WG5A 2RU3A 2GMLA 5I3UB 3CCRS 3CXHH 1YJWS 4I2PA 2WAQD 1VF5C 3R7BB 2ZBRA 5HMXA 1L0NE 1Q81T 1PBAA 2CQIA 2R4FA 5GAHU 2KP8A 3FBEA 4KYZA 3Q22A 4MYTA 4KIAA 3W64A 2F9DA 1K9MT 2UVRA 4IOIH 3T9NA 5AXLA 4D6TG 1YLXA 4GC6A 1ZR2A 4C8ZA 4ELVA 3FGAD 3MWBA 2Y3YA 1RA6A 1KN7A 1SQXK 3EUNA 1L0NK 1I51B 4QCLA 3ICLA 2OMLA 3HF5A 1Z2ZA 1Y00A 3K8VA 4OYWA 2IVFB 3AEFC 1S9KE 2DT9A 3J7ZT 5I3UA 4RUAA 1B70B 2F8HA 4D6TE 3CD6S 2XMKA 3R6GB
chains in the Genus database with same CATH topology
1MU2A 3MF5A 3I5CA 4DPOA 1X7VA 1ZRTE 2E7WA 2XWXA 3K5PA 3X3UA 3BQ0A 4QOTA 3P6YC 1NH7A 4ECQA 2VUGA 3M1VB 3N28A 1HW8A 2V9WA 3NBPB 3PW5A 1XR7A 2UV8G 4KFBB 5IQQA 4ZHRA 2W25A 4XPCA 4X4UA 1BC6A 3GE9A 3OVBA 2Z0GA 1TL3A 3MMBB 2CJAA 4IO9Q 1UA1A 3NCRA 2EBEA 2CRLA 3CXCR 5EGYA 3OTEA 4WFZA 2EPIA 4DF8A 3M8QA 2R7UA 1DURA 4NCGB 2LQ5A 1S6UA 2CQHA 4B17A 3IC1A 4H4OA 3CCWA 2F7VA 3AJ2A 3MM7B 4DOZA 2FGCA 4RNNA 2XGQA 1X9WA 3IAS9 3D70A 1P6TA 1DJ0A 4RNMA <