3O6QA

The structure of spoiisa and spoiisb, a toxin - antitoxin system
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
145
structure length
145
Chain Sequence
TDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASLCHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and interactions of SpoIISA and SpoIISB, a toxin-antitoxin system in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Toxin/antitoxin
molecule keywords Stage II sporulation protein SA
total genus 51
structure length 145
sequence length 145
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3o6qA01
3.30.70.2720 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3o6qA02
1AJYA 1FDIA 3EWKA 2P10A 1FDOA 2G8YA 1WMKA 1ZMEC 3IN6A 1OMIA 3H25A 3O6QA
chains in the Genus database with same CATH superfamily
1Q8IA 3KMQA 2B6AB 1NTZK 3BM7A 1HYSB 3H2LA 1B4SA 1GNKA 1AQ5A 2ZWOA 4ZDNA 3C8VA 1N73A 1GH8A 3H1LD 2O01J 2AJ0A 2RH3A 5F3TA 1TL5A 3CPWR 5L8RJ 4D6TJ 1FJKA 1UFWA 4URSA 5TISH 5K8OA 2J8SA 3ENQA 2WW8A 4HTIA 3NY0A 2C0XA 4HACA 2MZTA 3H6PA 2DHAA 2NYHA 4GC7A 4LF2A 4BDPA 1H88A 4JI2F 1VLOA 2R7SA 3AE6C 3KHRA 4RR5A 5EX0A 2MKHA 4A8SA 1F3VA 5DGBA 3B54A 1XNQF 1FRIA 2ZKTA 3C6TB 3CCVP 3BVHA 7AT1B 3TUIC 3DI6B 4RL1A 2XYPB 5LSLA 1EZVG 5DQGA 2A3JA 3ILOA 4M5DB 3GV7B 1LOUA 2PE8A 1SV5B 4ECTA 5L46A 2HIYA 5J2MA 3ITHA 5K8PA 1DLOB 2DGVA 2WK4A 4DHVA 2ERRA 4X4UA 2WBRA 1HYSA 2QL9B 2XY5A 3B78A 1RE4A 2CADA 2ZUAA 1Q8KA 2UUBJ 1RCXB 2GIQA 3N7NA 5EHHA 2K7JA 1Y9BA 2IA0A 5CA5A 3V6DA 1HVVA 5L9XA 2FD2A 2CPIA 3M32A 3KTQA 3DGPA 4JB8B 4MAKA 1UJ4A 2FYZA 4NCAA 2V2QA 2J7KA 2Y8YA 2WWWA 4L75A 1PSDA 3KJFB 3KK2B 4ED6A 3PCOB 4TY8B 3Q2SC 4JV1A 3CJRA 4C3KA 1NDPA 2HK2A 3IMQJ 4E0DA 2B8QA 3AEDC 1X9MA 3TX0A 1Q79A 3KLGA 3W63A 2G2OA 4I4BA 1FRKA 2QMXA 2V63A 2GO8A 2F9JA 4O3OA 2X3GA 3Q8VA 1PCAA 4DMZA 4OIXA 2XG8A 1WJ9A 3IFEA 4IFFA 4LR7A 2KOGA 3EFFK 4AUWA 3DRRA 1U0SA 2A06G 4RLEA 2W2NP 3VVUA 4USMA 5KFEA 4DQIA 3QYYA 1QLED 5GMEA 4KAIA 4USUA 2VKRA 3NGRA 1N8RQ 4DF4A 5G0RB 2P10A 2ZH4A 1TFYA 4EZ6A 1HARA 4N3YB 4C48A 1RA7A 1HI1A 3H1JJ 1QGKB 2E44A 2F40A 2KXNB 2OPQB 5KFTA 1BUXA 2JL9A 3EDQB 1VRQC 4X64J 3PHLA 3CCSP 1ZR4A 2AKWB 4OYAA 1S1XB 1M57D 3H5YA 4JOUA 4CH1A 2IHR1 1HQ2A 4PPDA 1U57A 4C0BA 1TK5A 2LCWA 4EUVA 3G6EP 2VFVA 2E5IA 5J2PA 1KN6A 4ZPAA 2ZJRQ 4CLFA 1QY7A 4EBEA 3CXHH 1R5SA 2MB0B 1CI6A 4U7JA 1XR7A 4G1IA 1PYTA 2DNGA 1WEXA 4RNMA 3LGNA 4EMDA 3MR5A 2ZD1B 2OYHA 1GFWB 4MJKA 4OHZA 2I1JA 2YO3A 1S5LH 5H2FE 3OW2O 2UV8G 4Q43A 4XA4A 1DHMA 3CJQA 4KHRA 3T19A 3E1IA 1N7LA 3HHDA 1KVJA 2PFXA 3II6A 5HVHA 1QD1A 3SSRA 2NZCA 2VBXA 3HX9A 2OTJP 4DUYF 3AXKA 5F8HA 2R5DA 4RWXA 1TQLA 1TKTA 3HK2A 3M1VA 2XKMA 1NWQA 4FXDA 3MFIA 2JX2A 3PJ9A 1YBUA 1PAEX 4IG3A 4AQYJ 3T6JA 3DN9A 1TL3B 2ZHBA 3Q83A 3FEXB 1JY2O 4N7TA 1CJKB 3KLEB 1SQXJ 4ZKUA 2LEPA 5CCGD 3PACA 5HMZA 3KHHA 1JXEA 2AYGA 4UF4A 1BQNA 2LXCB 4DL2A 5BVZA 1T9UA 3FZ2A 1NJIQ 4F4YA 3H1KG 4F4KA 4CZCA 2HLUA 3IAM9 1NB7A 1SV5A 2P9CA 1HBOB 4YMEA 2ZH7A 2D74B 3NGDA 3SDEB 2IAJB 1IM4A 1V6HA 3HI9A 4OYOA 4H13C 1SQBG 3G8TA 2KO1A 4G3IA 4LSLB 3CCLS 4LBHA 5AVVB 2YNGA 2ASJA 4LFBJ 2CUYA 1V9OA 3JTNA 1MMDA 3DOKA 3FFIB 3CJTA 1AUSL 2LXIA 1MG7A 2VOOA 4U8VA 2BCCG 2R8GA 3DXSX 4Y2KA 2HHUA 5E5NA 2E1CA 3UFCX 5A6WA 1QX8A 4KPYA 4NPFX 4ZVRB 3ZZOA 5D4LA 5I42A 4QWDA 1QAJA 1MSWD 2J76E 1N73B 4HI1A 2X1GA 1GL2C 1GXTA 2B9XA 2B5JA 2G3AA 1XMBA 4RW4A 5D0EA 4QW8A 1BHNA 2W83C 3MURP 3ZC4A 1SQPE 5AVSB 1S9EA 3TAQA 5APYA 1RAAB 2VG5B 4IH5A 3N5FA 1LTJB 3O8WA 3SDEA 5DQHA 1KQKA 1DTTA 3OFGA 1U7LA 2DNZA 1VL2A 2AGPA 2V7QJ 3TW0A 1HI8A 1IKYB 1RT3A 1JB0J 3QT6A 2A10A 3A0BE 2RF2A 1NNDA 5IC4B 2OTKE 2PAJA 2VQEF 3QRRA 1NEEA 3D3BJ 1DLOA 3RG6A 2NZ2A 4MT1A 3BQ2A 3H4BA 1XERA 5CCHA 5KFCA 2CQ1A 4TLFA 5LMNJ 2MQLA 4OHXA 3I55P 1ZPWX 2A45G 3CLQA 4R8UB 3LPEA 1EARA 4OHWA 5KFVA 4DJBA 1VQ7P 3LIDA 4ZP7A 1N36J 3R9LA 4ZP9A 4MFBB 3W60A 1LJ2A 1HHTP 3L74J 3NS5A 4F2RA 5GAHU 4N6JA 4M1KA 1L0NG 4LF7J 1JUNA 3PW2A 2UVWA 1RT4A 2BQ3A 1KOHA 1QSLA 2LQ8A 1GTEA 4BCAA 1JLEB 1HNXF 2XGQA 1J5OA 1JCDA 2BCCD 1VYAA 2N9YB 3G86A 1K8AQ 4WBFA 5B66H 4HH2A 2DCUB 4ZVHA 2H4WB 2ROGA 1KILB 1HA1A 4DL3A 3R97A 3KNGA 3VAHA 2Z56B 1BLUA 5CQGA 2BYCA 3CWBD 2DHXA 3KK3A 1GU4A 2QSFA 3GZ7A 3RRGA 4WE1B 3Q5RA 4ES1A 5TISE 3RR8A 2MZSA 5E79H 1R6VA 4R8UA 4C8KA 4X4PA 1CC7A 2PGCA 3B4DA 3GHGA 5C24A 3A8JA 2DCLA 2Q6QA 5B66E 4ZVFA 5DZ6A 5K8MA 2ZZNA 1JLAB 1GU5A 4ZMDA 3A8IA 4M95A 1QE1B 5B0EA 2C2RA 1JMBA 2DHHA 4CO2A 2L9WA 5F0UA 4Q8FA 1T7PA 1T8ZA 2GIFA 3HSZA 1X4FA 1A6LA 2KNCA 3B4MA 2VQEJ 1NMEB 3CXHD 2MHNA 4J37A 3L75D 4DLEA 5C2GA 3THPA 4DPYA 2QG4A 1XNQJ 4FNIA 3DRSB 3L73E 3VAGA 1I3OB 1NGMB 1ZOYC 1F1BB 4ECSA 2Q43A 3HVAA 2YQ1A 2D41A 2ZJPQ 4JUZA 4WWIA 2QV6A 3I32A 3Q1MA 5L1LA 4Y99C 4K0KF 5IQQA 4OX9F 1NO8A 2DNYA 1U47A 2GIRA 3JTPA 4ZN1A 2UUCF 2BJDA 3H1IJ 3JQJA 1DIPA 3PZPA 4CLZA 4ZCMA 4QPTA 3K59A 3T97B 4JP8A 1FAVA 1FDIA 3G2XA 3RTVA 3TARA 1KV4A 1G6BA 2M52A 2VBWA 3OTDA 3IRXA 4NLQA 3AE5C 3QBCA 2KG1A 1J2JB 2Z0GA 1T2KC 4MIBA 5AXNA 1U8SA 2Y9YA 2LQBA 2HRTA 2CPEA 1L3KA 2UVVA 2P7JA 1VR6A 2Z2YB 2VZ9A 3L70J 1CC8A 3PW4A 4DV7F 1KC8Q 4TYAA 4EO8A 5A8KA 1RTIB 3RW7A 3R1HA 3A0HE 1TAUA 2NS1B 3KZIH 1VBXA 4JI2J 3DOLA 1SQPJ 1HMVB 3LH2S 4JI0J 1IC2A 3DLKA 1WC1A 2VONA 5J2QB 4LF8F 2RNEA 3KMSA 2C2MB 4USHA 1EZZB 3RK3B 1JJ2R 3GILA 3BO4A 1NH4A 3CMES 4FPRA 2YKNA 3ZZZA 2W2QP 4XPEA 3US5A 4ID5A 4KO0B 4BS2A 5KG4A 1YTZT 3M30B 2WPRA 2K9YA 1ZM3A 1RAIB 3P8BB 1GK6A 3CCQS 5J2NB 4C11B 1JY2N 3L71G 1UVIA 2BX6A 1NSQA 1QLNA 3HT0A 1AT1B 2XMTA 4I1LA 3HMJG 2WSFH 2CIMA 5HN0A 4F8RA 1BE3E 1W2EA 4OVNF 3BBCA 1SQPK 2UXCF 4XIUA 1ZAXA 3HRNA 3DOLB 2ZJSE 4DU8A 4EYYQ 1UP1A 2K3KA 3H2VE 3GIIA 4EBCA 1AZSA 1WSVA 2HNYB 3JSBA 3L7OA 3FZBA 1ITPA 4AQRD 4RU9A 3KQGA 2D1CA 3F56A 4Y00A 1KFNA 2VODA 4NA3A 2CQIA 2E75D 2CDRB 2ZD1A 3GG2A 2W4CA 2VPWB 2VG6A 3D1HA 5KAKA 1WOOA 3NXSA 1YZ6A 2KJWA 3QWOC 3GIKA 1DTQB 3I5CA 5AW0B 3VZHA 4L76A 3DDIA 4Y99B 2KSEA 2BJ7A 3R7NB 4DL4A 4EWTA 1BDCA 3OFFA 1B70B 1LGHB 3OR1B 3UD5A 4LGDE 4E2FB 2I1RA 1SKRA 1RWWB 4P7TA 4FBTA 1XEZA 3SFGA 1UJ5A 5AT1B 4F3OA 3RGUA 3L37A 3U02A 3NOCA 1V5VA 3BATA 4O3RA 4OZ3A 3A3YB 4JYCA 5I3UA 1IJFB 3HFVA 3G71P 4F26A 2HVIA 2YKPA 1RP5A 3UDLA 4F7VA 1S9KD 1IFNA 5GADU 5LMNF 4M63A 2F5GA 2A18A 1VJQA 4F3QA 1VQNS 1QL1A 4O4RA 3CNQP 1N0VC 1XTGB 1UWBA 3I6PA 1HFEL 3R5DA 4UT4A 3J80U 3LP1A 2FYNB 4QR1A 3TA2A 4OGQD 4UB6H 3D1OA 2I8EA 1NKNA 1NTKJ 1ZA2B 1FX2A 5KOWA 3HUSB 1PYSB 2LXBA 3ZFVA 2W9BA 2IBZD 3KG4A 1W25A 2YWGA 3GYXB 4YR0A 2Q3PA 2CWKA 1S5ZA 2QLJB 4C6AA 3KK3B 4IFVA 3GYGA 2BQRA 1WG1A 2R8JA 5B0GA 2IM1A 1RTJA 5FD1A 3BKFA 3QT7A 5DO2A 4WK1A 1D7MA 2OAUA 1B7FA 1JNRB 4TU9A 3VTIA 3HCXA 5ETMA 2WRMA 4B9TA 1OZHA 1N5VA 2OARA 1RQ0A 1F9EB 1DTTB 5JMNA 1UIIA 5APSA 4F0KA 1IVZA 3M9OB 4DF8A 5KAIH 3A8EA 3HP6A 2W8ZA 3SQGA 1O0PA 1PG5B 2EFNA 1M1HA 3MXHP 2KHDA 2MKVA 3IFMA 4U3FG 5DDRC 4FF2A 4B3OB 4ENOA 2F8EX 2BVZA 1DD4A 5D4PA 2C1EB 2P67A 3RK3D 2WW4A 5I4MA 1DD3A 4O0NA 3BYRA 1SQBJ 3MCSA 2YTCA 2QJKC 3NS6A 3UN2A 2WVEA 1L0NJ 1FFSB 4I56A 1M5VC 1VF5D 1T0TV 4DCOB 2V8VA 5F41A 4OZ5A 3V2QA 1RT3B 1N33J 1SQQJ 5H9FK 1YBAA 3FBEA 3HE4A 5IFMA 2GMHA 2HNZA 2ZM6J 2XC9A 2UXCJ 5KTQA 4ZN3A 3MEGB 3RRKA 2AX0A 3MTJA 3IP0A 5CBOA 2E43A 2DGWA 4LSNB 1M90T 4NLRA 4NLWA 3J7AN 2IYOA 2IC3B 4ZVGA 2LKMA 4QIWD 4X4VA 2G0CA 2F4FA 1NTKG 2ZBCA 1NU1K 1M5HA 5G0RA 2PSZA 5J1NA 3IGNA 2JRSA 2VKZG 4H4OB 5EX3A 4FNHA 2QRRA 2YH0A 4CT9A 2DY1A 3BDEA 3HXMA 4F4AA 1ZMEC 1L0LD 5AW7B 2CYYA 3W5XA 1IBLF 2L41A 2LA6A 3F41A 2RVJA 1XJWB 4NPEA 4UOFA 1FHTA 1KB9E 3W8GA 1SFCD 3VMAA 1C1CB 1LK7A 1S7HA 4LIRA 3FXEA 4DCJB 5GAGU 1PIXA 3GQCA 3RL0B 5CCHC 4HT5A 2N1TB 1RAOA 4OX7A 3F89A 4Z7YA 4WJBA 3QQCD 2OQQA 4ZKPA 2EFPA 4I2PA 4AL7A 1NO4A 1KQSR 1VBYA 2RT3A 2AD9A 4IFYA 2YPZA 2R8HA 2AV5A 4DL5A 1DZ5A 2C9LY 5GMDA 1TL3A 4EI2A 3RB3A 3IO1A 4CLKA 3DU5A 3FQKA 2QFJA 2ZNYA 1WC3A 1VQ4S 2JLFA 3DCAA 2NCKL 4BXLA 2HYNA 1JJCB 1LKZA 2QT7A 3W9IA 1WELA 1LTJC 3F73A 2NUHA 4A7PA 1ICEB 3P3DA 4ATNA 2JDIH 4PV1D 2PIIA 2BANB 1UTAA 4WPAA 2HHVA 4OX6A 3OSNA 3K89A 4RW6B 2WONB 3QATA 1SH2A 5T14A 1TUWA 3A3PB 3K2YA 4DZOA 4ED8A 5LMUF 3AB2B 4JI7F 4XDDA 2D2CC 4NL5A 2UUAF 3RU0A 4YDDB 1QEXA 2C3YA 2XS5A 1RT5B 2OPQA 3CD6S 4DSJA 1YIJS 2KUBA 4DUYJ 5THWA 1IKXA 3NKYA 1QSYA 1SJ1A 2XHCA 5AE2A 4RW6A 2HGNA 4FXVA 3WDOA 4DOZA 1KONA 3EICA 5E41A 2BV3A 4PWUA 4IKAA 2ACYA 2IVYA 1FU1A 4QWCA 4CDIA 3QFHA 2RU9A 2JFDA 4IYQA 2CZ9A 3OL9A 1WEZA 4YY3F 3HF5A 2QYCA 3VP8A 3I55S 2RU3A 1OWAA 3Q23A 3H1LJ 3V2PA 2OYIC 4XO0A 4DR1F 3EGZA 4C11A 1H0TA 3RK2B 1CQMA 4CLPA 2R7RA 4F67A 3FCWA 3N01A 1KBRA 2B89A 3PP5A 4K4SA 2M88A 2JEIA 3C6TA 2F3JA 3CE8A 2XMAA 3CXCR 3QH9A 4M5HA 2LLZA 1JOCA 1RTZA 2ZFHA 4QBUA 4UUXA 1WG5A 3GFZA 4HL9A 4TU8A 4BHQA 1USEA 1HWLA 3TAMB 2HNDB 3LW5H 3QZ7A 2J9DA 4KTQA 1URQB 1VQ6S 4H44C 1WWHA 2RRAA 1YJWS 4LF4J 2R9LA 1SIZA 1RAEB 4WFYA 1FJ7A 1CSJA 5K5MA 3JAMU 1C1CA 1QM9A 5D15A 3QIDA 2H4YB 3ENVA 1S5LE 3CC2P 2GGPA 4ZPCA 2DGTA 4UY85 1L4AB 2RN0A 4YR2A 4AXIA 2DB1A 1HGZA 1WKLA 1U1OA 2DNLA 1XR5A 3UW1A 4K50A 2HPCB 3UVJA 3S1TA 3U27A 2RAQA 1HH0A 3GU0A 4OYBA 1URRA 4OGQC 2V8HA 1EDIA 2IM0A 4NRUA 3BGOP 3O6QA 3D67A 4MYUA 2OTLP 3HSDA 4TY8A 1GMWA 1E79H 4TVAB 3CCLP 3N6MA 4URGA 1N33F 3VMZA 3C16B 1PJ6A 5B0AA 4AYCA 2YQ0A 4JBZA 1T3NA 4ZJLA 5CCGC 1VC5A 2I5JA 1NU4A 3KHLA 1ELOA 3ILIA 3TZWA 3BO2A 1LW2A 4C98A 1JLQA 2IZ1A 1Y5NB 1ZZNA 2W24A 2R32A 1KLMA 4MH8A 4X65J 3JB9k 2KSJA 3PRVA 4NXMJ 2IRUA 3P8CD 3TUJC 1L0NK 4LVOP 2FXMA 1YJVA 2IJFA 2V50A 2V2VA 5KKZC 4L72B 2D2CB 2JO1A 2NXCA 3LANA 3AOBA 4KJMA 2CQGA 1VQ6P 3DRSA 5HLFB 3EQ2A 3MEDA 4WE1A 4HYKA 3PW7A 2Y0BB 1HF9A 3UDVA 3WIUA 4ZVSB 2KB7P 3K5PA 2ADBA 4B9MA 1IFIA 1RAGB 4ANCA 3V4IB 5EWFA 1NZAA 2FJEB 2V4JB 4TYBA 8RUCA 1K8AT 5F8LA 1NAFA 3BN7A 3DYAA 2KYVA 3AJ2A 4KHPJ 3SFUA 1WC6A 1SQGA 2HNZB 2L5GB 4WY4D 1VPCA 1SVFA 4FF4A 2BA9A 4HHJA 2KK7A 3G8SA 1RT2A 2OPRB 4YN3B 1DARA 2EXUA 2QG9B 1FKPA 3RAQA 3NMRA 2VFUA 2CJKA 3KLHB 1C2PA 2P2UA 2B56A 3WUTA 2M3BA 2GJIA 2OO4A 1SQFA 3OAKA 3D6FB 4XPCA 3G71S 1N88A 3MM9A 1X4DA 3C8YA 1X4AA 1HNVB 1IUJA 1UL3A 4Y28C 1JM0A 3R8YA 4RNOA 4PJ0E 1S6PA 1J1DB 4JI8F 4I6YA 2VICA 1JLEA 1RTDA 2V9WA 2HW3A 4HTJA 3M8SA 4Q45A 3PR5B 4G6VB 1N7SA 3M06A 2E76C 5T7LB 2XI2A 4FYWB 1VQ9S 1S1WA 3TZXA 1G7CB 2PMWA 3O2IA 1R8HA 4F36A 5DDPC 3M8RA 5E0OA 3HD7C 1K9MQ 1EP4B 4C9DA 4KHPF 2PC6A 5ETNA 1JB0C 4FBUA 3VAJA 2BXJA 1R8BA 1S1TA 3DLGA 2ZWPA 2DBBA 1HQUA 2DH7A 3FGVA 4M94A 4EYIB 1RAJA 3HD2A 2UZAA 5CABA 2F65A 3NBPB 4X4NA 2PT0A 3T1HF 2NUUG 4EDFA 3OTBA 3UI3A 2R7TA 4B3TJ 5F9NA 2QJYC 3P45B 2AIRB 3RZAA 2LFVA 1AFOA 3D6TB 4D6TD 2EFOA 1WDDA 1RT6A 2Y3YA 2Z4PA 4I7FA 4WYLA 3MIWA 4ZA1A 5LOQA 2EFVA 1YJRA 2AF6A 2A45H 1FRJA 3UNGC 3UO0A 3OJUA 2UUTA 1HQEA 1LTTC 2JHEA 3MUDA 3BGRB 3EGWB 4PD4D 4YHHF 1HBNB 1XN9A 5KT7A 5KJ7A 2J9CA 1KLNA 2W2PP 1L3TA 4Z2XA 2VC1A 1JLGA 2P6SA 1JJHA 3FSXA 1AA0A 4TN2A 1CJKA 4DV6F 2EEYA 1RHZB 3W7BA 2AYMA 3HHLD 1U2CA 3RB6A 2QO3A 4QQBA 2DEIA 2FY1A 4EK2A 2BKPA 2HG4A 1TL7A 4ELTA 3R1LA 4C2MA 2HG5D 3PW0A 1NK0A 1NKCA 1LT1A 3W9HA 3MECB 3LW5J 2M2BA 2VPXB 2C3PA 1UZDA 2DR6A 1TU0B 2P5VA 3THVA 2E1PA 3BYPA 1R8AA 3W65A 2O1KA 3IBWA 4C97A 3LWLA 1GX6A 1IKWA 2H43A 1LWFA 3BH6B 2C3OA 2PA3A 5K14B 2Z2MA 3WZ0A 4AFFA 1BCCJ 1U24A 2MTLA 3H40A 3M05A 3TQEA 4X62J 1IR1A 3D54A 3D4JA 2AYBA 2P9EA 1ZS6A 3NL0A 3I87A 4M5IA 4I6WA 3PHEA 1IR2A 1SQVE 2Q1KA 5CYMB 1EDJA 3BF4A 1ZR2A 4Y34A 4WCEQ 4ERDA 5A8WB 2FJBB 2N3LA 1G3OA 1MZ9A 1TL4A 1FXLA 4AL6A 2HURA 1SCJB 2C3UA 1LT9A 1WC5A 2LMIA 5A2QU 1J1EC 2P2CB 3QAUA 1VISA 4QYZK 4M8LA 1SQVJ 2ZDOA 3KZIE 1XK8A 4BC9A 1FEHA 2G13A 3FUYA 3QZ8A 5JUMA 4E98A 1ZTWA 1RWXB 1BGYD 4LF7F 2J6SA 2BUNA 3AE1C 5DQIA 2BANA 1TFWA 3T97A 3WIVA 4NEYA 3IWLA 1YQ4C 2WMMA 1FKAF 3T5JA 1VQLP 1IKVA 1U02A 2MKIA 3HHEA 4TLRA 4KGVB 1BMQB 4F0MA 1BGYG 1RHUB 2B51A 3R2CJ 1FNMA 2IPPA 2RE1A 3HFKA 1WMKA 1EKSA 3P8MC 3ZO7A 3G96A 2AU0A 3L4FA 1QVFO 3OD2A 2YQ3A 1W2IA 3H1KE 4M5NA 1NK4A 4XTTA 2FYXA 3ISND 1FKOA 3BZQA 3DHWC 2POHA 1NHVA 4OZ0A 1SQXE 4KRWA 2W8LA 4M5DA 2VDIA 1NB2A 4Y0FA 1S1VB 5IM0B 5HAOA 2QJPB 2CWXA 3KLFB 4PD4H 4P7VA 1BE3D 3KG0A 4RNHA 1JLFB 3L4BC 1P1LA 3SQOP 2ZH1A 4ZK7M 1KB9D 1EZVE 4C8NA 3S4RA 5I3QA 3TNUA 2BCCE 3MM8A 1VFJA 2EKNA 3DRXA 1AB8A 3H1HJ 4CO0A 5CXTA 2FUG9 4LRDA 4Q0BA 2B4PA 4G1PA 3JS9A 4CM0A 2OPPA 1T03B 3MM5B 4W80A 3HSGA 3UPFA 1U1QA 5CAAA 2H7HA 2K2PA 1X5SA 1WORA 1JMTA 3P6YC 3MGJA 4OV6A 1N5TA 3AODA 4MKVA 3QSIA 3D5MA 4JI5J 3CF5Q 4L73A 4F50A 1BGYE 2FHMA 2OD4A 2Y1LB 5C42B 3H1IE 4OHYA 3Q8YA 1HPZB 1FESA 1TKZB 3AAWB 5HP1B 3KK1A 2A06E 2ZXXA 3ENAA 1N7SB 4W98A 1U2RA 1TU3F 4OI2A 2ZOFA 1A02F 3RL0g 2MY8A 3CSKA 2HLOA 3IS9B 5CYQB 3CJKA 2UUCJ 3QJPA 5KFQA 2IM3A 1ZA1B 1D3WA 4K4ZA 4IQMA 4USVA 2U1AA 2HVDA 1RGVA 4DV2J 1NKBA 3PRDA 4KKOB 4MKYA 4KHMA 4PCQA 1URQC 3O5TB 4GOFA 2M0BA 1JY3O 3BEGB 2ABYA 3AEFC 1A7GE 3E2EA 5F9LA 3QGHA 1MROA 5HLFA 2ZBQA 1S1WB 4GVBB 3PV8A 3CWBE 2G9OA 3J80Y 3H1JG 1Q95G 3MCNA 4FP9A 3CX5E 3M8PA 4NLUA 2YWWA 4ECYA 4PWWA 5EFWB 1ZM4A 1FRHA 2NREA 4O9BA 4N78D 4OYPA 1SL1A 5DG9A 1OFCX 3IWXA 1Q7YT 1IXKA 1KYOD 1Q90D 2VG7A 2W9CB 1RT4B 3B5ND 5L8RC 1N6QB 3AEGC 3EXYA 2GFFA 5KFSA 1HPZA 2OUGA 1VQSA 3UNYA 1KS2A 1RADB 3IM9A 3NG8A 4OYMA 3HTKA 1FF2A 1VS3A 2XB2D 2DNQA 3OXGA 2M8DB 1F5BA 2NRGA 4X4SA 5KFBA 1X4CA 5A8RB 1M5OC 5FDLA 4LF5J 4OHVA 3QWUA 3M9HA 5HMXA 1JJ4A 1H3DA 1FZFA 4DR5J 4O23A 3FWNA 4QIGA 1NKZB 3RBEA 4RO0A 3QFWA 1VBKA 1L4AD 2P9GA 2OSRA 1HL6A 4GKKF 1T8EA 3SFEC 1SQQK 2IMWP 1FRXA 3IG1A 2M70A 2IMOA 2WB4A 4ICLA 2GGPB 2YNYA 3ULHA 1RSCA 3CC7P 2KYXA 4Y2CA 4NX9A 3OPKA 5LL6d 5RUBA 1TTHB 3G4SP 4X66J 3W2VB 1RWVB 2B7BB 3L74D 3I0RB 1DAXA 1VF5C 1GAOA 2LA4A 3QO9A 2JWDA 2W6AA 4ZHRA 2APOA 1JKHB 3N0VA 4R5PB 2WSCC 3CC2S 4P10A 1ZRTD 3MP7B 3M2UB 3CCTA 3B71A 4KT0J 3MM5A 1YJWP 2QM8A 2KI7B 2X3DA 1MMNA 2AMCB 3UIAA 2K1AA 1P9YA 5AJ3J 3L73J 2HNYA 2M0GB 5AW5B 3Q3DA 3DM2A 3Q5PA 1IFMA 2Q7CA 2CK3H 1TKTB 2MY7A 3MPDA 3JC22 3IC1A 3E01A 2PEHA 3ZNUA 4NCGA 2R8IA 3PHTA 2J0XA 3Q8QB 2FFDB 4OI0A 1CW5A 1B64A 2W27A 2B8PA 3HLUA 2AZ1A 5J1PA 1U09A 3TGUJ 5BYSA 2IX7C 1X8YA 4WF9Q 2ZH3A 1Q53A 4QMAA 3MD0A 5C7PA 1N34J 1DTQA 2W4PA 3GJRB 1MWQA 2QLWA 3W61A 1XMQJ 3UD4P 1MWYA 1UPPA 1SFCC 1LT9B 1YGYA 2HAFA 3JSYA 1NTKE 2JLEA 4UTGA 3GONA 4LF6J 3CDBA 4UY8T 3HSJA 4PQAA 2FYNC 2VPYB 2HPUA 3BSNA 4N47A 1U1PA 3JCUH 3HZEA 1KB9H 4ZLPA 2HFSA 1Y4ZB 4KHXA 4CO4A 1VBZA 2LECA 3AD9C 4UZCA 2M4MA 4U6PA 4L3NA 1WDTA 4MKAA 4OI1A 3H1HD 1N73C 4MKBA 3HVTA 3GSDA 4N77A 4QZVB 1SQEA 1RWPB 2CQDA 5APUA 5ETSA 2E5LJ 3AXMA 2E5HA 2KB2A 4JV5F 4NASA 4IFDK 3L70G 2OP5A 1GMWD 3Q8UA 5C2CA 2EG1A 4RW8A 1HJ0A 4O0IA 5C39A 4RPFA 2FYUK 1S1VA 3KJVA 3C6UA 1JLCA 3RB4A 2EVZA 2GVDB 1PP9E 4ELVA 3CCVS 3W62A 2KU7A 3BKTA 3L74G 1REVB 1GMVA 4WY4A 1BXNA 2VDHA 2X1AA 1D1UA 2CRLA 2DY9A 3TVZA 5H9EJ 4ECUA 1HR0J 3GB0A 1S6QA 1VRTA 4QWEA 3K5LA 1GXLA 2YY3A 3CEDA 2FHOB 1TKDA 1KN7A 2CPZA 1S1UA 4OV1A 1O5JA 3PLNA 3A13A 3M2VB 1SH0A 2QIWA 2NPFA 4LRCA 2KG0A 2C2NA 1RE4C 2QJKB 3KLGB 1S7IA 2N7YA 1YG0A 1R43A 5EUHA 2E74C 3DGVA 1NTKD 2QL7B 4F0HA 4A8XA 3M4XA 1VOMA 1KQLA 4EU0A 3S6EA 2A6OA 1CJTB 2QSWA 3IAOA 1PGJA 5IV3A 5KLVG 1TL1A 4LVNP 4P52A 4K4XA 1HBMB 5KFGA 4OZLA 1QTMA 1FOSE 3HJFA 1FS0E 4B3RJ 2MSTA 2V9KA 3L72G 4JQ0D 1M1JC 4F04B 2YNFB 1FC2C 4O44A 1VRUB 3L09A 3PH0A 2MDAA 1L0LJ 1LTAC 1LWCA 2UVRA 4OX8A 1JY3P 2QN6B 3HULA 5KT3A 2JOQA 3GJQB 2RHSB 1KD1Q 2FBWC 4BRYB 3K17A 2P1JA 3SCKE 2XLJA 5DDOC 1Q82Q 3OUYA 3AE9C 3M8WA 3B6BA 1KILD 1UFLA 3ITKA 2HHXA 1IZNB 4YXWH 5KFLA 5MLCV 1V3ZA 1QTNB 4HH0A 2ZE2A 3CMEP 3T5HA 2NR0A 1UPMB 1RH5B 1MWZA 2NPSA 3BR9A 4Z7CA 2XSJA 5EWEA 2WTYA 2KVIA 2IJNA 4WTYA 3ZTPA 1LP1B 2W1BA 1WHYA 4M5MA 1Q0NA 2GVZA 3THTA 2BCCJ 1Q8LA 1U8WA 1WI8A 3LQVA 1JLAA 1L2PA 4HACB 4BC7A 3P32A 3U1NA 3M9QA 3QIPA 5KG7A 1DY3A 4FKYA 2KS1B 4R4MA 3R7BB 2JEEA 5B7WA 5A8RA 1RBLA 3OTEA 2QEXP 1MUUA 2PO4A 2DR5A 2OGUA 4LF1A 1WUUA 3CB4A 2OTJS 3CJ5A 1IM6A 3I9ZA 5AW8B 4U95A 3NMAA 1MW7A 3D2WA 3W8PA 3H0PA 1CULA 3PEJA 3E1RA 4WFNQ 3O8ZA 2DXDA 1NTMD 1YITS 2OJ3A 3CO0P 2HZVA 3J7ZT 3I9V9 5KG3A 2AW0A 4PR6A 2KI2A 3FMBA 4M5KA 3JSMA 4Y2IA 3MPWA 1FVQA 4CLLA 3QT8A 4FKXA 4TKTA 3CMQA 4HKQA 4I64A 3JQMA 3NP5A 1OPZA 3BRTB 1JMMA 2E5JA 1KFSA 2HHSA 4GVBA 1N4LA 4U3FE 3W2WB 2M5YA 3EPIA 3MUTP 4DSEA 1KQGB 3EXCX 4CI0B 3PDNA 1SC1B 2WSEC 3CC7S 4JI3F 1RUSA 4DV5J 4XFJA 1PGPA 1WG4A 1CG2A 1N32J 3IM8A 2ZYAA 3EPGA 2PN6A 1RQVA 2ZC3A 3G6XA 4PAAA 2CPBA 2JR8A 4K4VA 1MN9A 3FSIA 2K7KA 1Q2NA 3FWLA 2QLFB 3OSPA 1PPJE 3RK2C 4DZ6A 4JI1F 2V68A 2VV5A 1UEUA 2KIKA 1SQBE 3BRVB 1FZEA 2EK6A 3BSCA 5DJTB 2QZ8A 3TEGA 5CZVA 3CCJP 2CPJA 3C2PA 1CJVB 1VMBA 2RDIA 3I5AA 3B82A 1SQQE 4KR0B 9ATCB 2BEZF 4DFKA 2HMIB 4ALZA 1P6TA 1D0EA 2B5JB 7FD1A 2XCAA 2YX7A 5E3PA 4X66F 3H1KD 4BWJA 2BE2A 5APWA 2W90A 2DO0A 1KFMA 4X4RA 4HDHA 2XLIA 4R4LA 1LV5A 4NYPA 2W9BB 3TEHB 1T95A 5FIIA 1BQNB 3BREA 3NMDA 1VIXA 1KKHA 2JSXA 4JPZB 2ZNZA 3KHGA 2EKYA 1T9TA 1EXIA 4GKJJ 2G4BA 3I82A 5KAFE 4B9SA 2HBQB 4CNZA 4OGQB 1NZ8A 2JLGA 2KYZA 5KG5A 3KHUA 2M8RA 1FKPB 1TUGB 3FEZA 3ENWA 1URQA 2DXFA 3G6YA 1OSCA 3R2DJ 1H73A 1C4CA 1EB0A 1SI9A 4FF1A 4RESB 2YXRB 3H32B 4NZ0A 2ILYA 4OYWA 5K14A 3PTZA 3A0HH 3ZZRA 4NE9C 4PUOB 2B9BA 4H44B 4DR4J 4L3KA 3CCUP 3C1LA 3UVJB 3VP9A 3FGAD 3IBFB 2X1BA 1CI6B 1FDOA 1SQXD 2KN4A 5D77A 2BJEA 3MEDB 3ZTOA 3V6KA 3VGSA 1RKIA 4LRBA 3FBFA 2ASLA 2XWYA 4K4WA 3FCHA 3IWNC 4NLYA 2PMZD 1NPPA 1Y47A 2NXUA 4PG4A 2CQCA 2CJBA 3PX0A 3R5JB 4C8OA 3NGUA 2HR3A 2HVEA 3CJ0A 2VPZB 3EE3A 3BV8A 2YWKA 1U6BA 3PJXA 3CJ8A 1S5LX 1YTYA 4IH7A 2UXBF 2O1PA 3NNAA 2DXEA 3J81U 2DVIA 2YMYA 1RHMB 4C7QA 4IL6X 2MMYA 4BLGA 3M2RB 3KKFA 5HVFA 5H9EK 5GTHH 1U6ZA 1K9MT 4JBCA 4QJVA 1IBKJ 3DRYA 3AEEC 2KP8A 4A8MP 4DBQA 1PGOA 2HODB 4CLYA 3HVTB 4QOTA 1FTRA 2XZTB 5DLFA 3EZ5A 1LTSC 3K58A 1GTWA 2PD1A 2GC8A 4PZVA 1AV1A 2FXOA 2E74D 4YP3A 5F8IA 2AWZA 5KFHA 2F7VA 3WU2H 4ZVUB 1N86A 4U7UK 1RACB 3V81A 4IUFA 1RLCL 2EK1A 3AEBC 1JNMA 1JX4A 1NJXA 2FPHX 4I67A 1PILA 4IFYB 2VIHA 1U4BA 3PJSK 4E8UA 2HNDA 3HZGA 4AXJA 1F9FA 2KLUA 4LIWA 1S0VA 6FDRA 3GF7A 2IRYA 4IR9A 1JEKA 3UN5A 3MR3A 2Z30B 3M0AA 3HHNB 4KJIA 2CA9A 2H88C 3Q2TC 1IWGA 3WX4A 1BE3J 4U96A 5AVQB 3TI0A 2F4VJ 3AB4B 5T7LA 3MOJB 4Q2MA 3T41A 3LTOA 3V4WA 1FWKA 2W6JH 1JTHB 4Q8EA 1R0BG 2BEFA 3QGGA 4U7CA 3D66A 3GFXA 2UP1A 4J5OA 2XMMA 2WVCA 3VCDA 4PKDB 3M8ZA 1N7SC 2ZOGA 2RHQB 4K8RA 1BDDA 5FJ4A 1CS4B 3AE2C 1X5PA 3MM9B 2DPJA 1S97A 2C9NY 2E1AA 5AXLA 5HBMB 3Q24A 2VQFJ 5AVXB 3VAFA 4K35A 4WZMA 1Q4RA 5D6GA 1WD6A 2XY6A 1AW0A 1L0LK 2IPOB 2FFDA 2KNCB 1HJBA 2AXTH 4KY3A 1S9FA 1UWAA 4WKRA 2CPXA 3KJNB 4JI0F 4EOTA 2MZ1A 2XO6A 3R5BA 2GQCA 2JJLA 5B0DA 1DBDA 1RZMA 2AJ1A 2BE7D 1AROP 3HM9A 4JI1J 1RBAA 2WVDA 3CPWO 1E6YB 4GKKJ 2RILA 1WEYA 2DTJA 1NJWA 3BJYA 3MMJA 3MUMP 1NK6A 2OFGX 1GL2B 3A3OB 2HQFA 1U25A 3X1LB 4L6V3 4LBPA 4WK3A 2FQQB 3HJVA 2X1FA 4ZPWR 3SI8A 4C3MA 4ECQA 3BSOA 1Y7PA 1ZW0A 3TDKA 2JC1A 3M2UA 4M3LA 3R27A 2G2YA 2M3DA 1EHWA 1T3UA 4URQU 3WBZA 3R6GB 1JLBA 3IG1B 4EGLA 1LW0B 3VN0A 3FMWA 3CCMS 1Y9OA 4FYYB 4OX9J 3M6VA 5DLGA 5B0FA 1NK8A 5HQ8A 2QC3A 2DIVA 3GR0A 1XR6A 1OQ3A 3NOGA 1VK3A 9RUBA 3W2VA 5AJ3F 4GOEA 2X51A 3VMYA 1OMSA 4HH1A 5IXUA 1LWUB 1HBWA 2PI5A 1OPIA 5HQLA 2JEFA 3LPYA 2K3RA 1KDNA 1GL2A 5AVZB 1FK9A 1SKWA 1EIYB 3P7KA 4ZJQA 4DFJA 1SFCA 4DFPA 4IRKA 4KC5A 2WSSH 2R2UA 5AVYB 2FKWB 1OVRA 4XAKA 3ET6B 6AT1B 2MEWA 3TYTA 4IR1A 2B0GA 4K4YA 2BE9B 4DEZA 1WNEA 1G1IA 2WPVB 4MYTA 1L3SA 3RUBL 3TNUB 4YHHJ 1RT1B 4C46A 1F2HA 2ATCB 3AE8C 2ZM6F 3OLBA 3M6XA 3POTB 2V4QA 4YOEA 2R44A 3FX0A 2L9NA 4DV0J 4CM2A 3LAMA 3TWZA 2H89C 1YHQP 2V4HA 3CGIA 1VJWA 1EQ0A 4I2LC 2V2ZA 1RAFB 1RT7A 2IRXA 4RUBA 2IIHA 3OL8A 4U3FJ 3H1LE 2FLOA 3BGLA 3N4XA 3KUGA 3DKDA 1H2TZ 2GO9A 1VGYA 1WTFA 2DGQA 3EDRB 4K5RA 4KV8A 1HBOA 3B8HA 4ILMA 1R8EA 4J9LA 1UAWA 1S0OA 5BXIA 1WHXA 4DV4J 3A3NB 1D9FA 1VRUA 1LWEB 1NU1E 5KAIE 3IRWP 4WVZA 1LW0A 3KDNA 1TV6B 4A8WA 3KLEA 3UE2A 4O4GB 2Z8QA 5I3PA 5HROA 4ZKAA 3RK3C 2V4JA 3MHVA 2D3ZA 2RJZA 4QWAA 1G2CA 1KD1T 3W2WA 5L1KA 2O01C 2AQ4A 4RBUA 1RT1A 5IS2A 2R7VA 4WY4B 4FVMA 2ZHOA 2MQ8A 1EAYC 4OJHA 4NXMF 3LO3A 2YIUB 2ROPA 3JSMB 5C42A 3QRQA 2Z5IA 5I42B 3CX5H 3HKWA 1IBKF 4JYAF 4J9UE 4ED2A 3E51A 1HNZF 2HPCA 3PFEA 3IBCB 1X8DA 2KFZA 4YB5A 5IT9U 2K9JB 1S0MA 1NVOA 4ZCKA 1VRTB 1U0HA 5D0HA 2K1RA 3RYLA 2MKSA 3K57A 4AYBD 2NSBA 1Y0HA 5A8WA 3QMQA 1FDAA 3DOKB 1ZLLA 2CQBA 4NA1A 1R6YA 3VAMA 5KT5A 2XBPA 2P58A 4DCKA 3BPDA 1KVKA 2MQPA 1QSSA 3CL3D 1PC4A 1PJ7A 2O3JA 1H7XA 3I31A 1TK8A 2YWEA 3D0HE 2Q9IA 4RZRA 3BCCJ 2CQ3A 3LP1B 3B5NB 1NH7A 4QW9A 4FVCA 3OTOF 2ZH6A 1IBCB 3DNCA 2BKNA 2EI5A 5HP1A 2ZT9D 3UDEA 3UDCA 4DV5F 3N28A 2HFVA 1QAYA 5AVTB 1KZUB 3OUYB 3U1AA 2XMKA 3AEAC 4P71A 3A5TA 4DG1B 3J7A1 2R42A 3SCLE 4DUTA 2Z2ZA 3JSVC 4U8YA 1F5AA 4ETZA 1U1LA 1WC4A 4USTA 5L9NA 5F8NA 5DJBA 4UQTA 1AYEA 2YNFA 1JTHA 2RUSA 4WU2A 1VQNP 2VHGA 2W7AA 2XHWA 3K5OA 2NQPA 2HQDA 3TAPA 3EZOA 3NCPA 5AE3A 2XEXA 1DEEG 4QU6A 4DUZF 1VHIA 2W8KA 1HBMA 1UEVA 1U1MA 2W2MP 4I6MC 3AD7C 2FHJA 3I0SB 2IBKA 1UJ6A 4ZCIA 2QFIA 1CJUA 2DH9A 3GWCA 3DDKA 3ADAC 2E5YA 2HKEA 3C3LA 3GJTB 1PJ5A 2R7WA 3FBCA 3WMM0 3L35A 4ZP6A 2H5JB 3RL0D 2KDOA 4FYDA 2M5AA 4O4GA 3H5XA 2V8DA 2BRKA 1JWWA 5GAHI 2DKOB 2FY8A 5HO4A 1T2KD 2G1HA 1EKRA 4A8QA 2XU6A 4WXOA 4NYZA 2QM7A 3LOUA 2XS7A 1S48A 2V34A 1LFWA 1YQ3C 2ZVOB 3TGUG 4HHHA 2QJYB 4NRTA 4DG1A 4OI4A 3EWGA 2RH0A 4IDKB 4W4MA 1MFZA 3CCUS 2FLNA 1YRTA 3FVYA 4PWDB 1HLWA 1NTMK 4W90B 5KOXA 3PYFA 2DJWA 5AW9B 2NPSD 2DH8A 2LR2A 3CT9A 4H0LD 2HQIA 3IR9A 4YDXA 2CZ4A 3WX8A 1N2DC 1LXJA 6FD1A 3MI7X 1Y3KA 4RKUJ 3R2PA 5AXKA 2NYIA 4B3RF 3KLIB 4LF4F 2RUGA 4H13D 2HHHF 2XYGB 2Y1RI 3T5LA 2LQ5A 2MPUA 1XQIA 2HRUA 1RAHB 3O1LA 3M9BA 2HFED 2MZQA 1S0NA 1FBMA 2HODA 1H2VZ 1REVA 2XV5A 3TZYA 1XMQF 3CCZA 2GVDA 1YRXA 2QMUB 1EC5A 3VQTA 5GVQA 2LDIA 1LTBC 3K5MA 4KKOA 3M0DA 2B7CB 2V7QH 2Z2LA 3SSSA 3M30A 3TGUE 3H8YA 2MQNA 3GP9A 1R0CB 3D0GE 1LWUC 2KT5A 2UXDJ 2RQCA 2GVZB 4I7FB 5HK4A 2CZVC 4NLTA 5E3AA 2XSJB 2E42A 2FZGB 3TOQA 2Y0SD 1J5EF 3MM7B 4JI8J 1L0LG 5KFKA 5FDLB 4FDFA 5LSOA 3CI9A 2JNJA 3VALA 4B3MF 4B17A 2A45I 3T9NA 1SL2A 3GYNA 2MLYA 4NZ6A 1IQZA 1VQOS 1UW4A 4DR7J 3L36A 2HQ3A 1BQMB 1IK9A 2KM8C 5KFNA 1RISA 3BCCE 3EUNA 3DI6A 4YXDC 2YO2A 2C2OB 5HJXA 3KLHA 1K05A 1C0UA 3QAEA 3M91A 1ZPVA 4R0JA 4RNNA 5CCGA 5E33A 2M7SA 1RWUA 5CHCB 2QA4P 5D0GA 3TANA 3N4WA 2QVAA 8AT1B 1YZ7A 4NA2A 4Q7AA 1GK4A 3V6IA 2XNDH 1OS5A 1NDCA 4DPUA 2ZH8A 2N82B 1ZXGA 2G0IA 1EETA 4UB6E 1ZV8A 3BGFA 1FFGB 5GADI 3Q86A 4U7UD 2XY7A 4YY3J 1A9NB 3WUVA 1B0PA 2DR8A 4WFZA 2MGZB 1P9QC 1W26A 1T03A 2YH1A 1VF5B 2YNHB 2B43A 1NDLA 5JJBA 1S1TB 3DLGB 1S72S 3M9MB 4N76A 2L9DA 2R2TA 4J9RA 3KWMA 4A46A 5L1JA 1NLKL 1HNIB 2KTQA 4YUDA 2FVRA 2L91A 2D2CD 1RT6B 3GG1A 5JXSA 4BWNA 1PO6A 3PXGa 2DRAA 2QX0A 2HBRB 2JVRA 3H98A 2F1FA 1S9KE 1HNXJ 1RE1B 1R31A 1L3UA 3BB5A 4WIQA 1APSA 1NSKL 4ZOSA 4X4QA 4WFAQ 2WPQA 4UB8E 2RMLA 1FTCA 2H1YA 2MGZA 3HUSA 1U6FA 1XNRF 2E5LF 3DMJA 1NU1J 3C15B 2E75B 2V8GA 3H1ID 1WC0A 3BQ1A 2WCXA 1RQUA 1M90Q 3CX5I 5DZ7A 3WQPA 2E74B 4BRYA 2O66A 2EG2A 1T9VA 5CH7B 2OSQA 3P5TL 4ZCLA 3KLFA 3MZIA 2L48A 4OJ1A 4MTPA 5JVGQ 3L3CA 1PPJG 3KLIA 3N6LA 3HDSA 2R7OA 1T05A 2HQGA 3LP2B 1EX8A 3AHPA 4FXWA 3F5HA 2OKQA 3C6UB 1TKXB 2GS8A 1T94A 1FE4A 4DQQA 5M2PA 3H1HE 2OMOA 4NI2A 1WOSA 1N5SA 1SC4B 4LBIA 3AOCA 3TJ8A 4HHUA 4LFBF 3PVXA 3WHIA 4CLUA 2HBZB 5E3QA 3WC0A 1PKUA 1UIXA 1DQ8A 2OIHA 1NHLA 1RY3A 4U3FD 1M1GA 2YMKA 2MYFA 3AJDA 5HBMA 2J0WA 3OXLA 4HDGA 5KG1A 1Q82T 2GW8A 4I1TA 1KTQA 1J1EB 1LWCB 3R3TA 2KXFA 2ZVIA 2ZBPA 2DHSA 4ZNCA 1JK9B 1GQEA 3U1MA 4C7NB 2XQCA 3SCJE 4DR3F 1DQAA 4ZMMA 4GVLA 1FJGF 3MM8B 2HHTA 5LSRA 2CQ4A 3RAXA 2CG8A 4WYWA 4DV3J 3P49B 3MAAA 1HWJA 1LK5A 3CDEA 3BGRA 3GMAA 2YNGB 1URNA 5KJ7D 5AVRB 3L7PA 2UU9F 1FJCA 4DV0F 2VOPA 5D8HB 2ASDA 1W2BO 1UEKA 5J1EA 1R8CA 2LQJA 1NJIT 1GD2E 3OTOJ 1MNEA 1JXVA 5HATA 1YI2P 3W3SA 3RR7A 4ECVA 1VC0A 4JF7A 2YBVA 1LT9C 3KYQA 1BY9A 2ZITA 2B3TB 3FRZA 1VQ8P 4NCGB 2HFNA 2MHEA 3A12A 5DGAA 3OR2B 2CVIA 5KFXA 5K8NA 1KYOI 2BOAA 1PP9J 3DM2B 3OW2R 5CYJA 4RW9B 1BC6A 3NGSA 1YJNP 2J6UA 4DV1J 3H1JE 2F8MA 3BS9A 3GIMA 3BASA 3VTPC 1HBNA 3VGTA 3EGVA 5A0YB 1IKVB 4J90A 5CJ4A 2DNRA 1DURA 1NOHA 4XE5B 3CTRA 3KPEA 1J5EJ 1VQ7S 5APQA 3L73G 4RW7B 1NAQA 4ZHRB 3L74E 3ABVC 1F9HA 4K2XA 2CXEA 2BRLA 1YTZI 2GQ2A 2OYOA 2WVBA 4DV7J 4I7ZC 1PC5A 3SV3A 4LF9F 1SIWB 1T6AA 2FTRA 5A0YA 2FYUE 1O8BA 1X60A 2HHHJ 3DGPB 1NH8A 1OY6A 4LFAJ 1H0TB 1S3JA 4CT8A 3ISNC 4USWA 2XZDB 3AECC 3LP2A 4ECZA 3EVWA 3GCWP 1K73Q 2GAGC 4TNOA 3V4QA 1FDBA 4KH1B 1KWMA 2G8YA 4WKYA 3H1KJ 1W2BR 3KJVB 2I9SA 3ETMA 3IR7B 1M5SA 4WP9A 2XO7A 2EFQA 5BYQA 2C2DA 4K0KJ 1YITP 4GC6A 3D1QA 3CCRS 2RSQA 1AQTA 2FZCB 2CAJA 4YR3A 3OL7A 2V8PA 5D4OA 3POTA 4LT6A 4C8YA 1N7SD 1YQHA 1WHVA 3OVAA 3J7YI 3PIOQ 1HD0A 5C25A 1R0AA 5ETKA 4KGXB 2LVWA 2HFOA 4Z1MH 1SXLA 2MKJA 4ECWA 4KPCA 4J91A 1NTMG 2HQCA 2HK3A 3I0RA 4MK7A 5F3ZA 1BE4A 1NTZE 3UCUP 1D8YA 2F9DA 3DLEA 1HHSA 4J7CA 1EP4A 3VZIA 2H8PD 1K73T 4K7QA 1RWMB 1KQFB 3CD7A 1BCCD 3J81j 2HIQA 3CIMA 3EFGA 1MV8A 3ZTRA 2BKOA 1ZOTA 2LQ9A 3KFWX 1OW6A 4RUAA 4Y6IA 2FFDC 2IYIA 1VCTA 3GIJA 4LSNA 4GO5X 4PD4E 2Y0EA 3SQGB 3C14B 5KFAA 5HMWA 3CUNA 1JY2P 1XTZA 4CWBA 3M7VA 1GEHA 1G1XA 5IZHA 3MM6A 3OVBA 5JVHQ 2GNKA 3VGVA 1OIPA 2JDJA 3CMAS 3FBBA 3MCOA 5KKZB 4WTOB 2DIUA 3B8EB 3W66A 1N6QA 2EBGA 2CJQA 3V6JA 1SQBD 3CULA 1W5CE 4F25A 5EN1A 2HHWA 1BGYJ 4ECRA 3M32B 1RHQB 4J9PA 5AE1A 4JI6F 4GO7X 4G1QA 5DJUB 3G3ZA 4JI4J 1EZVD 4AUKA 2D9OA 3AQPA 2FJWA 5CJ0A 2KZJA 3G9RA 4IG0B 1EQ7A 1SQBK 3DMJB 2LKZA 1WHWA 4AD6A 5EWGA 4ZJOA 3Q0AA 4Q0BB 3TVYA 2G2ZA 3OTCA 4ASWA 2IVFB 3SZ2A 3DRPB 1JY3N 3LALA 2Q6BA 3GPAA 4OLOA 2J9EA 1URQD 1RABB 4Z37A 4CO5A 3DYAB 2CFXA 4DX6A 2ZE2B 3JSRA 1FE0A 4PABA 5CD4A 1IWAA 2N1TD 2R7XA 1K0VA 3JYTB 3N5BA 4B02A 3AA8A 2YPYA 5B0CA 3MM6B 2MQOA 1RF1B 2MQQA 4KH0B 5E79E 5GTIE 1Q16B 3CCSS 3OA7A 2W01A 3MR7A 3NLCA 5BR8F 3J81Y 1OY9A 2UU9J 5B5EH 3U1CA 1FNOA 4JI4F 2E76B 2I8DA 1S1UB 1KOOA 5KG6A 5H9FJ 1SPBP 5GAEU 2Y9ZA 3MTKA 4MK8A 4EEYA 3L72E 5BU8B 1QL2A 4DSLA 2H3EB 4H13B 5ETLA 1DRZA 1ZYQA 3RGIA 1OVUA 5HL7Q 2AX1A 1RYRA 3H2UB 3L75G 2OLWA 5KFOA 4WZQA 3H42A 3GW6A 4JI3J 3HO1A 4HI2A 1HD1A 3L72J 1KILE 3OFHA 1H89A 1HNZJ 2A1BA 4PYDA 4ED1A 3ZZYA 2CG4A 3DXBA 2QE5A 4CYUB 4A48A 2QJ3A 5KLVJ 4S0MA 1VQ9P 3RBXA 2KRBA 2BABA 1SP4A 1N0UA 1FJPA 3W68A 3CCJS 4NPDA 3P5BP 2DGUA 2D69A 3KUHA 2AZ3A 1MKMA 4OZ2A 3KG1A 3M8QA 2HGLA 1LWUA 3SV4A 4GT1A 3HTKB 1GX5A 4IG3B 3HHLB 1UVLA 3CD0A 5LT5A 4MN4C 2Q79A 4QYZJ 2FJDB 3CWBG 2OEKA 3TGUD 2PFDA 1CS4A 2OPPB 2YKOA 2W7OA 4CP5A 1Q81T 4PQUB 2JP3A 1S9GB 2MLZA 3HD1A 5F8JA 1AVOA 2FGCA 3IS9A 3CJKB 2DRDA 1KLMB 2LXUA 2ZFCA 1RYSA 5IQ6A 1DX7A 1GMUA 2LEBA 1AFIA 1HNWJ 2AXCA 4P2XA 3MUDC 2ZZTA 3NWRA 4PXCA 1OX3A 1FJEB 4V1Ak 2RDJA 3G9CA 4DI6A 1OMIA 1GMJA 1RE3A 1JXLA 2Y8WA 2H9ZA 4CLTA 1VC6A 3H32A 1T11A 4K4UA 1SB6A 4IDKA 4ASVA 2ALYB 5B0BA 3JXOA 1DFDA 3CCEP 3CO9A 2IZ0A 2IDEA 3IF4A 4HYTB 4I7ZB 3RW6A 3FC9A 5ETPA 1TL7B 2VRSA 1DH3A 2C22A 2BM1A 1RLDA 2BM0A 1KVIA 5K9FA 3MMAA 1YSJA 4OWFA 4ZIWA 1NU1D 1NJYA 3I4PA 4DQSA 1C1BA 2DW3A 2JC0A 3R5GA 2NPSB 3D28A 1FERA 1ZH5A 2Z57B 1F2GA 1QAXA 4EYHB 2IFNA 4AE5A 3QWPA 4LF6F 1FJGJ 1PGZA 4IFMA 4DR3J 3QLHB 1PYOB 3CCQP 3PO5A 4LF5F 4YEAA 3G6VA 4DCPB 4DR4F 2IY5B 5KFIA 1CJUB 2WVFA 4DXLA 2HZAA 1S12A 2NLWA 4IOCQ 1IKWB 1HBUB 2NXEA 2BBEA 1X22A 4J9NA 3FSYA 3PYDA 2KJVA 4RW8B 2Q5UA 1CJVA 4X65F 3I4HX 4NPOA 4RW9A 4F3MA 4KFBB 2AJQA 1TV6A 2J8AA 3IA0A 4GODA 1SUQB 3RK3E 5TJHA 1OJ4A 2O01N 3BCCG 1Q1KA 2PI4A 1NPKA 3MAQA 3MMBA 2FVSA 4KBIA 4F4XA 1M5PC 1TVRB 2BZ2A 2GQQA 4Y3CA 2LU2A 1HBUA 3UWTA 4NXNJ 3CDAA 3UN3A 5J2MB 1S1CX 5K5GB 3J7YU 1GXUA 4UUWA 2NZ4A 1ZAVA 4C4WA 1QVGR 2K3IA 2HMIA 3OVSA 4DSKA 3ETOA 3QLHA 5H1SV 3A4TA 5DETA 1JQGA 1OWXA 2UXBJ 3CCES 4YFUA 5HMYA 3ILJA 2AYEA 1N56A 1TKXA 2FDNA 1U1KA 3HE5A 1M8OB 5KT2A 4DL6A 3ZZTA 4CH0S 1HNIA 1PZQA 1GW4A 2WHOA 4RBVA 4CIOA 4JI6J 1KFDA 1RU2A 2M9KA 1F6TA 4D3GA 5DM6Q 1OY8A 4K4TA 2B88A 2ASYA 1X4HA 1Q7YQ 3VHQA 2Q6CA 4R0EA 4H0LC 5AW1B 2YNIA 1J1DC 2GZOA 1LWFB 4IRCA 3NNHA 3FRYA 2QSIA 2VG7B 1IKXB 1KRPA 1VHFA 4PEOA 2GMLA 4LFAF 3H20A 3MCMA 2E7WA 1MU2B 1EZVI 2IVMA 1AFJA 5CMZA 4V19J 4LF9J 2B87A 3TR5A 2VA2A 2GJ2A 4P9SA 1Y10A 5KFWA 4NMXA 1KTMA 4MIWA 2E75C 1I94F 1Q8BA 4ZP8A 5KFPA 2GA1A 1YIJP 1LW2B 2W2OP 4DSFA 1KILC 4LREA 3JYTA 1ZAWA 1CEZA 1N34F 2ZKUA 2FHJD 2V4RA 5GAGI 2YKAA 3ZTSA 5BYRA 3GR1A 3M9NB 3QGPA 3MUVP 1T3OA 3BPSP 1YYCA 4RKUC 4X64F 2K1RB 2CKWA 2J7UA 4GMKA 4WY4C 3RAMA 4CNYA 4DQPA 2C2KB 2LDYA 4FYVB 4DR2F 2ROEA 4IL6E 2JEJA 5IT9Y 3AJ1A 1RU1A 2C0WA 2B4VA 4B9UA 1VK8A 1YJUA 5LMUJ 4V19X 4EZ9A 4USKA 1ZZFA 2KXHA 1L5UA 4H0LB 2XULA 3IGVA 4D6TG 3EM1A 4DWIA 2KHCA 2PP6A 1KP6A 2A06D 3V4IA 2GUVA 3GHGC 2O67A 2C42A 1SJ3P 4JV5J 1USDA 1X0PA 3J7Z5 3H1LG 1N5YB 2D3O1 3HD7B 1M7LA 2VF3A 1S77D 1DQ9A 3V6DB 1FO1A 3O6QB 3HPOA 3Q8RB 2EC0A 2EWHA 4X84A 2BE2B 2IM2A 2EC2A 2WSEJ 1PIEA 1FWPA 4F2SA 3FNNA 3MMBB 2HS4A 4ZLNA 3E7KA 3OJSA 5KLIC 1LWXA 4R5PA 1U49A 4WP3A 3C66A 2I2YA 5AW2B 4HB1A 2K06A 1Z2ZA 2RKIB 2PMHA 2ZVSA 1HW9A 4DZDA 1Y5IB 3TVKA 2HS0A 3MOZA 2ITAA 4F02A 3Q5SA 2ATLA 4B9NA 4X62F 3VV2B 1RHKB 1VQ5S 2WB1D 4EIJA 2VASA 4WP8A 3PRJA 2E5GA 4X4OA 1S99A 5KFFA 5C25B 5F8GA 5CYQA 3KXDA 1V3SA 1CULB 1TZ0A 3BKUA 5SZTA 3OXFA 2Q3EA 1C0UB 1OQ6A 2Z58B 4NLDA 5IT0A 4PV1B 3KK1B 4M5GA 5L38A 1FWLA 4JI7J 1RA6A 2RS8A 3USSA 2CPSA 1BQMA 5KFRA 4B08A 1UVKA 2POKA 4YB1P 2YIUC 1T9WA 3QT5A 5IOLA 5F0WA 4W92B 1WKKA 3DLEB 1YJ9S 2KXPB 5APXA 3H25A 2J5AA 2XMWA 1SH3A 3SFDC 1NSAA 3LUYA 4B9LA 1CJTA 2KRRA 3G8QA 2KFNA 3OHAA 4UZBA 3BQ0A 4Y2MA 1UA0A 1JLBB 2Y1IA 5HQMA 5EDWA 3AE4C 3CDWA 3VWSA 2AJ4A 1AVYA 3GFYA 1Z56A 1PV3A 3A7OA 2D9PA 3PG9A 3V2NA 2J58A 2KKHA 4JYAJ 1LXNA 3OJAB 4O3PA 1KEKA 3GFHA 3PYEA 4YTPC 4PG5A 1M1JB 1B7YB 3M6UA 1N48A 4PG8A 4PQUA 4IH6A 3ZZ0A 3CCRP 1Q5YA 4U9RA 3DLKB 2N1TA 1FX4A 4CPGA 1DJ0A 1NPRA 2HRYA 5CCHD 1YHQS 3TAMA 2W6BA 2WITA 1IN0A 1YJ7A 3NNCA 2KLVA 3QGIA 3QPIA 2DR9A 2VFSA 5IV4A 2E29A 1SL0A 2DNHA 1JLCB 4HT7A 3N9UC 2LXFA 3SSUA 5LM7E 3S7RA 4J9MA 2VFRA 1BSNA 4DJGA 1H0HB 1X79B 3DC2A 1Q7LB 1R27B 4ID5B 4KO0A 1MN7A 3TF5A 5CZXA 5D4NA 1XMOF 4RX6A 4P6QA 3GJSB 2MJZA 1SVDA 2KM8B 2Y0CA 5ADZA 5EGYA 2E9TA 3I56P 2VC0A 4A4JA 5J1EB 2IYPA 2BJ1A 2CQ0A 1QVGO 4ZPDA 1ULRA 1KQSO 1IFDA 4NOHA 5MAOA 4OYZA 3LAKA 1YVFA 2IYGA 2V2KA 3AY0A 3CCMP 3V81B 1FD2A 1S72P 3I5BA 4I2QB 1KB9I 2HS3A 3S9OA 2V69A 2I5JB 2HYIB 4B3SJ 3I96A 2WSEH 5E3CA 1TL1B 3CD5A 3KLVA 3IRXB 4X2BA 2R7UA 4IOAQ 1FT8A 1LTGC 4UQGA 1B3TA 1F0XA 2GM4A 5CCLA 2I1KA 1LEOA 1ZETA 4DUZJ 2ZBIA 1KMIZ 4HLBA 1RCOB 3C46A 3IN6A 2QYGA 5BJRA 2VG6B 2EBEA 3SWKA 1RHJB 1Z2LA 2AJFE 2MKKA 3CDUA 3NBPA 5HI7A 1FD8A 4AT1B 2C3MA 1D8ZA 2K37A 4DPTA 1PP9D 2ZDPA 5APTA 4NLPA 2YKNB 3T1HJ 3FEYB 3U1LA 3NCQA 1R7IA 1SS1A 2I6WA 1B0VA 4RWWA 3DRRB 4OI3A 1IR0A 4J9VA 3ITHB 3L95X 4NLSA 1OW7A 3EJMA 2C2EA 2ZYDA 1MROB 1F5CA 1RE3C 4DV4F 1H72C 2ZT9B 3VMXA 1NK5A 3GIRA 1RTIA 3QNWB 1NHKL 3MHYA 2WT7A 5KT6A 4ZIVA 1M56D 4NI2B 3LWMA 1ROFA 3FQLA 2N7CA 2Y0DA 2NSCA 3CW2C 1PFIA 2UUWA 3PFOA 1P84H 4DT0A 2J59M 2AP6A 3NGKA 4DR6J 3BBBA 1S79A 2ZHAA 2XS2A 3M8PB 2FYUG 4ZVEA 4DV6J 1SQVG 2CQPA 1X9SA 3PYGA 4ER8A 1K1SA 4K59A 4LR9A 4PG7A 3SBMA 1XNRJ 1JCCA 1U0HB 1PAUB 4NCBA 2P6TA 2KZIA 3NRBA 3RL0C 1FZAA 4N8NA 1D09B 3TJAA 5HVGA 3AD8C 1E6YA 1G1JA 1UW9A 2W9CA 3GLMA 4TQSA 4C0OC 3NWGA 3R6LB 3KDPB 2ZH5A 1QAIA 4DFMA 1WTBA 1NAYA 3QO9B 3FKBA 1NHUA 3CJ3A 1T05B 2OELA 1BCCG 2ZVNB 1SQQD 1S59A 1RT7B 1NTKK 4GDOA 2KZZA 1M1KT 1TAQA 4QIVA 4H4MA 1U7JA 1ZN5A 4ITSA 4IOBA 4HKZH 4YB6A 1NTZD 1NSPA 3SSQA 2IA6A 1SQQG 5DDQC 2U2FA 4GKGA 4ID8A 3GV5B 1D9AA 3OFEA 2DITA 1M5KC 2KT3A 2QE7H 8ATCB 1YWXA 1F60B 1P8GA 1IFJA 4MK9A 1NDKA 2VJVA 1S4FA 2AXTE 4RUCA 3OL6A 4A8KA 3KUEA 3VVTA 3D9BA 3TA0A 3AOAA 1LWEA 1VDHA 3H7HB 1H38A 3FK4A 4JI5F 2DNKA 4DS5A 2FHKA 4OZNA 1WKJA 4FPIA 4GKJF 2VH7A 4IG0A 3L71J 2C28A 3DLLQ 3PX4A 1NKEA 3R5AA 1FDNA 1JLFA 2RMZA 4ZPBA 2B6AA 1WSRA 1B99A 5BR8J 1PBUA 1S49A 2DNMA 3MTUE 2BDPA 1L4AC 1S6UA 2D7SA 2WZ7A 1UA1A 2WSFC 1E5WA 4O3NA 5KLVE 2VBZA 2W25A 1U1RA 4H4KC 3ILLA 1KSPA 1AUDA 4KGMA 5C24B 3PO4A 2UUAJ 1UWBB 2RB7A 2WPSA 5DG8A 3GV8B 1EDKA 3EYZA 5AW3B 3U7JA 5KTBA 4ZLJA 2YX1A 1R8PA 4FN5A 5BU5A 3FDSA 4B3MJ 1S2EA 1CVJA 4Q2LA 1CLFA 2QA2A 1KNZA 3M1VB 3PJWA 3MR2A 3HFZB 2IFMA 1WF0A 1RB0A 2OEJA 4J9KA 3K8WA 5L39A 5G4DA 3BGUA 2RQ4A 1GK8A 1UZHA 4H54A 3DU6A 2LEAA 2ZZMA 2DISA 2GCFA 2K8GA 3FJ2A 1WACA 4TT3H 3MWBA 3SMZA 1XTCC 2B87B 3EVOA 2L08A 4O44B 1MLAA 4K2JA 5ETVA 3VGUA 5KFDA 3V4MA 2HFUA 1J27A 1SJRA 4OZJA 1H98A 1Y3JA 2Q66A 2YKMB 3OR1A 3H90A 4DX7A 5AVWB 1A0OB 1HNVA 3UQSA 3UCZP 3RK2D 2PA8D 3ONQA 1N32F 3GMGA 2JWAA 3VQSA 3SXLA 2RKIA 4I6AA 3MDFA 2QLBB 1GTHA 2E76D 2EPIA 2A6MA 2RKLA 3BO3A 5HJYA 3L75J 2HBYB 4LJMA 4FS1A 2KS1A 1TR0A 4ZPTR 4PPZA 4HEA9 5J2QA 5I3UB 3HVRA 3GG0A 3HD7D 1N54B 3FXDA 2GHPA 2IDLA 3L75E 5L1IA 2AGOA 2CJ9A 5D3GB 2BOPA 2OYHB 4PUOA 4KB7A 2Q1LA 3MMCA 1SQPG 2CNOB 5IM0A 2FB0A 1X4BA 5DG7A 1Q86T 3OLAA 4YQWA 1X0FA 3P4UB 2XNQA 1ACMB 3HHLC 4C3LA 1UVJA 5FLXU 2ZYGA 4ZVOB 4OYXA 2VB6A 4EO6A 1NXIA 3VR1A 2OI2A 4AQYF 2JH3A 2QJPC 1YX2A 1BWEA 2JFKA 3TJ9A 1NU1G 1C1BB 1IBMJ 1X9VA 2COLA 3C9IA 3M8YA 3N6NA 2DD8S 5A8KB 2F4VF 5KLVK 2FGOA 7FDRA 2BASA 2HWHA 2H51B 4G65A 3OR2A 4P2MA 2XZWA 4I0WA 1VQPS 3EZUA 3JCUE 3NXZA 2FVQA 1L0NE 4JV2A 2DGSA 4DU7A 3ZZPA 1SC3B 3HKZD 4FF3A 1S57A 4N8OA 1FA0A 2V94A 2N4CA 3JTOA 4N78E 2FC9A 4K3AA 4X4TA 4C8ZA 4ETXA 3DLBA 3H1IG 2QEXS 2WTFA 2MXYA 5KLIB 2RDDA 1LQ9A 3MMCB 1KYOE 4MMOA 1WOPA 1RDRA 4DR6F 5D3GA 2HGMA 2KH9A 4WB4A 3M2VA 4I2QA 2B4OA 4PXBA 3AA9A 1SQXK 1OW8A 3TYYA 1QJHA 4LC1A 1RF1C 4IO1A 2ACMA 2N3OA 4B9VA 2AEMA 1PBAA 4LLHA 1EDLA 3F0NA 2OFHX 2A0FB 1HMVA 2YNHA 4H4OA 4ED5A 2XLKA 1UMJA 1KYOH 1C0TA 3C19A 2Z4EA 3Q89A 2YWHA 3TNVA 1X9WA 3I0SA 4MFBA 1VQKS 4PXDA 2OTLS 2BJ3A 4QR0A 1EETB 2L3MA 4LRFA 3V6HA 3CJSA 3VYIA 2MQMA 3HE5B 2HVHA 3CCWA 1YBKA 3MD3A 2P8IA 1FRMA 3VOPA 4P72A 1IFPA 3RBZA 2O01H 1RT5A 4DX8H 3EGNA 1O51A 4OQJA 4CRJA 1O6XA 2CPHA 1TUVA 2DEJA 1I51B 3ISZA 1VQ5P 3TK1A 2XM3A 1YKWA 2NPIA 3MFHA 2BW7A 1U26A 4CO3A 2AEJA 5HSPA 3T5KA 2XTJP 3TQ1A 3P8CE 1NTME 5CBNA 4DR7F 2VQFF 4WWSA 3T1YF 2VG5A 2CNNB 1L0ND 3M0DC 2BACA 2FJXA 1N52B 3DOMA 5AXMA 3MPVA 4DV2F 4IO9Q 2ILZA 1SJ4P 2WQYC 3C15A 1H2UX 5C5JA 4IRDA 1EJ7L 1K1QA 1NTMJ 5SUHA 4LF8J 3HHLA 3A0BH 2N1TC 3T3FA 4ELUA 5ETOA 2GV1A 3FCVA 1P84E 4DOJA 2MJNA 3GTYX 2Q3IA 2GHVC 3LP0A 2YX4A 2IBZG 2XWXA 1GZLA 2BMBA 4KV8B 3A8KA 3KYLA 4ILLA 1RHRB 1RXOB 2O1JA 2BW2A 2W7PA 2PRRA 4N41A 4WFBQ 2YXQB 1YRUA 2WAQD 3H1HG 1FDDA 2YWFA 1PPJD 1VQMS 3TUPA 2NXNA 3E01B 2J9DE 1YJTA 4OI6A 1Q81Q 3S01A 5T41A 1PL5A 2NXJA 1U7MA 1CBKA 3K0JA 2FLLA 4DL7A 1W7WA 1YJNS 4PXEA 5IC6B 1WI6A 4NLVA 4Q44A 4USIA 2E9RX 5GMKa 1YK9A 4I69A 3IR5B 1GW3A 1NCLA 2CPFA 4MIAA 3T1AA 4LR8A 4HJGH 2FYUD 5B08A 5A76A 4CLSA 1RF1A 4HR2A 2IC3A 1G2CB 1KILA 4KGKA 1HWTC 2IBZE 1HIYA 1HUCA 3ELHA 2HAIA 3MEGA 2IFXA 3K5BA 4NXNF 1FEEA 2F63A 1QVFR 4C7RA 3K7RA 1OYDA 3LP0B 4F4ZA 4XDCA 1FRLA 1UVMA 1GL2D 1SFCB 2E5TA 2AHOB 3DRPA 5KAFH 1S9EB 2HZCA 3O3LA 4LQ3A 4NMLA 1K0TA 1VQ8S 2VD3A 2QA4G 3PNIA 3HD7A 1JLQB 1RTJB 2M5AB 1SJQA 1IK7A 1RK8A 1BGXT 2WZ1A 3HT3A 5DM7Q 4NLXA 3CWJA 2BEQD 3PY8A 2JEGA 1R5LA 3LGHA 3U59A 2WBMA 4OYIA 4QIFA 1Z1ZA 3BSAA 1SC6A 2VA3A 2UV8A 1EXJA 4DS4A 2E66A 3CVKA 2IBOA 4F4WA 4H44D 3S1KA 1CQNA 4ED3A 1FZCB 1N8RT 1UFKA 3V2RA 3LW5C 2RQKA 2H48B 1FOSF 2M8HA 4EBDA 3PR4A 1RTHA 5LJ5Y 5DS7A 1L0LE 1VQLS 1FK9B 2FJVA 1TKZA 2FIUA 4DQRA 1MMLA 2IBZI 2K88A 1BQXA 1VI7A 3IAS9 2XI3A 3DOMB 2C2ZB 3H5UA 5CD4H 2DGXA 2CVEA 2QTWA 4ZS6A 2BJ8A 2XSFA 1NTZG 3NTNA 1UVNA 1VDFA 3E8OA 4IOIH 1RWOB 1N36F 3NFQA 1FFWB 2QA1A 1L4AA 4YB7A 2AEFA 4RBTA 1X5TA 4OL8A 2CQ2A 2ZBRA 3R7SB 1LTJA 3D3CJ 3WUUA 3NEKA 1XWLA 2HWIA 5KG2A 2H65B 1SJFA 3FFIA 2HVZA 3TA1A 3W1YC 1RJJA 2FZKB 1JO5A 2IJRA 4DV1F 4BWMA 3SEOA 3HUSC 3MD1A 3VAIA 2FC8A 3GCXP 2MZRA 4TY9A 4IQXA 2BQUA 2GX8A 2OPSB 2VL1A 2VFTA 4LUBA 5KFMA 2CNKB 4PG6A 2LP4A 3KK2A 3AH6A 1FKOB 1D9DA 1U48A 2PDAA 1HHQA 1DEBA 1TVRA 2EFGA 1NM2A 1FZCC 2JVOA 2R3SA 3GLJA 4U67Q 3G82B 4NZ7A 2CNLB 4TLQA 2DNNA 3D70A 1FE6A 4A47A 2UUBF 2E7VA 4Q5VA 1AA1B 3NCRA 1Y11A 1K04A 4ZVQB 1VQPP 1IJEB 3SIPB 4A8YA 2OYIA 4OJGA 1JIHA 4DR5F 3GSIA 2V0NA 4PYAA 1SBRA 4PD4I 2XDJA 1X0TA 2XGPA 1RBOB 2MLXA 4RW7A 4PV1C 1RF0A 2XMUA 2A2CA 4ED0A 3Q2YA 1BSHA 5IWAJ 1HI0P 2QRXA 3NAHA 4OH8B 1I5OB 2QA4S 5HROB 3OV7A 4WFXA 4CQ1A 3KNAA 4C7NA 2JKVA 2G0JA 3ZZUA 1P84I 2GMJA 1WRGA 2CPYA 2VU5A 3DFEA 3HE4B 3CJ2A 1S6QB 3G82A 1P27B 1CPZA 1BE3G 1C4AA 3L72D 1S9GA 2FXPA 4ZVTB 3EX7B 2QMWA 4ECXA 2ZJQQ 1XBWA 4CTAB 1FNXH 5KLVD 3BH7B 1WF2A 5IT4A 4RUHA 4LQ9A 1KHVA 1M1JA 1R0AB 3OQ2A 3X3UA 4ES3A 3W64A 1IBMF 2V5HG 2I0XA 3ICLA 1RI7A 2KZMA 2ZXEB 5LJ3Y 1MFTA 3E3XA 2FYUJ 2GJFA 2WONA 4J9QA 2V6AA 3PRBA 5GTHE 2V67A 4OFZA 1G2EA 3CC4S 3GHGB 1VIOA 4QR2A 1IJDB 1R3NA 4OJ3A 4DL0C 1C0TB 4DSIA 3IN5A 3ZTQA 2H5EA 4OZ1A 3MPUB 3HHKA 4DV3F 1NJZA 4QU7A 4AL5A 2O3DA 2E1MC 5F8MA 1PGQA 1JLGB 4ANEA 3M2RA 5J2NA 2H54B 2K9JA 1SQPD 4N56A 3CJ4A 3G87A 3D6HB 3UD3P 1K47A 3RRHA 1HWUA 3MF5A 3VAKA 1Q78A 3W9JA 2RIJA 1KTVA 4CTAA 4ZPVR 5FLXY 2E9ZA 4QCLA 5H2FH 5J2PB 2GUSA 2DRBA 1VLYA 1U2FA 3KOAA 2DO4A 5LXRA 3JAMY 3EVMA 1ZRTE 3SYZA 4EFAC 2DR7A 1FDMA 1OO0B 3ZXWA 2DGOA 4H4MB 1S1XA 2YKQA 2W4DA 1BWVA 2RRNA 1HKAA 2CJAA 2HEKA 3D68A 4B3OA 2Z5HA 2HWTA 4RU2A 3D6YA 1YI2S 3CX5D 3D0IE 4WU3A 3V5BA 2OMLA 2UWJE 2ZAEB 2SPZA 2EW9A 4IL6H 1UCNA 2FVPA 1EQMA 1V5IB 4CCHA 3MECA 1FZGA 1OXZA 2OYIB 3LIEA 3GF3A 3PEHA 1QUVA 1GT8A 1SLQA 3TSIA 1V3RA 2QL5B 5LXYA 2XMVA 1ZTTA 3CC4P 4RNFA 3CMAP 2UVUA 1SQVD 2CJYB 3S8SA 4ICLB 3MAAB 2R3VA 4BBYA 2WOMA 3TX8A 2XYHB 3Q22A 3MEEA 1M0SA 2WSFJ 3R4YA 2LU1A 1KHWA 4TXSA 3W5YA 3IXQA 1H7WA 2R7QA 3QJJA 2WVRA 2YVSA 1T9XA 1WT6A 4P2FA 4RJTA 3JQKA 3C14A 2J7WA 4QIEA 2WSCJ 4PJ0H 2JWNA 2A2DA 4FZVA 2KVQE 4UOGA 1S76D 2ZEJA 4DR2J 3L7UA 2B4UA 2OPSA 3EMTA 4LMZA 4G1QB 1AJYA 1T3JA 2MKCA 1U45A 2GAHC 3H5SA 3PIPQ 1AZSB 2XCPA 3AQOA 2J6TA 4UOHA 4D6TE 5M1BA 1TELA 1XC9A 2R2SA 3L70E 2DYAA 4KGZB 3RB0A 2B9WA 2ZH9A 2MKYA 1QE1A 1RT2B 1UKUA 4C8LA 4KIAA 2J0QD 3Q8SB 1R89A 3TO8A 1HWIA 2RS2A 1SKUB 3TZZA 1BD6A 1LP1A 1PP9G 1NRKA 5ETTA 5APVA 4UB8H 4KQZA 2HHQA 1RKJA 4D3HA 4DPOA 4DR1J 4JYBA 1CSBA 5KFJA 4YS2A 5KFZA 3DLHA 1TP7A 3F44A 3AT1B 2M3EA 1KORA 3D6ZA 1REGX 2XMJA 3I56S 1E6VA 4ED7A 2HLTA 4NYOA 4WBAA 2F8HA 4QWBA 2OEMA 1AXQA 5CCMA 3T9ZA 1FVSA 3ZDMA 4P73A 5KJ7C 3QIPB 2DT9A 2OYHC 3BCCD 2B9EA 4B3SF 1ZM9A 1HGVA 1J2VA 3MM7A 4USJC 4Y2AA 3WC2A 1RTDB 2ZT9C 1VQMP 1P1TA 1H8AA 4A8OA 1Y5LB 3T6BA 3EWKA 2AGQA 1N5YA 1S6PB 2VUGA 4FS2A 2QIFA 5GTIH 1B0TA 1FXDA 1N5QA 4M5JA 4O3QA 4H4KA 2OH2A 2ZOMA 2QLXA 1FZBA 1S10A 2N9BA 4OLPA 5B5EE 5E2QA 4XK8C 1HTLC 4IFVB 3N79A 4RW4B 4DDFA 1U1NA 3RJMB 1QUPA 3A1YG 3AE7C 3CIZA 1YDLA 1A02J 1G4CA 5B09A 1Z4UA 5K20B 5D0RA 3B4SA 4TQRA 4WXWA 3L9ZA 5DRKA 2E7XA 3W5ZA 3L70D 2R4FA 3PM9A 2I38A 2OHDA 3V5RA 4P75A 2ZC4A 4DX5A 4ZITA 3B5NC 5IWAF 3D6MB 2RF2B 4B3TF 1IO4A 5D78A 4ILRA 1HWKA 2HFZA 3P96A 2JJ4D 4A8FA 2XNXA 1IQTA 5KFUA 2PFFB 2WOMB 1L3VA 2FVCA 4KSEB 2FLPA 4DPWA 4I2PB 3IR6B 2R5BA 1HQEB 3MR6A 1F3FA 3MGNA 3SCIE 1FXRA 3UR0A 1S6OA 4CLWA 5A2QY 4RJVA 4LSLA 1OSDA 4DN9A 1SQXG 2MJUA 4PWDA 1ZBTA 2IAJA 2VJUA 4DN0A 1NBEB 3BN4A 1VQ4P 2J5UA 3ZNJ1 1NTZJ 5AW4B 1FCAA 1P84D 4P74A 4HVZA 3TP2A 3BBFA 1VQYA 3OT9A 2FJAB 3LF0A 5AVUB 2BJ9A 3T1YJ 3H4DA 2ZUGA 5A6PA 4NLGA 1OIAA 4LFCF 3QRPA 5KT4A 4KFBA 4ZLLA 4ANDA 1Y8AA 1I6JA 1H74A 2DHGA 1M1KQ 4C8MA 3KDOA 5GAEI 5AW6B 1S4EA 2NPSC 5M2RA 1HW8A 4TU7A 1JNZB 3MPYA 3R5CA 2D3UA 2JZ5A 3RBDA 3QJLA 3K8VA 3D71A 3OHBA 2N4DA 3WU2E 4NLOA 1UETA 4KYZA 3NGTA 2DNPA 4M5LA 1NK7A 4DLGA 4QYRA 4DPXA 4ES2A 2WT7B 2R3CA 1WF1A 1YLXA 5ETRA 5CYMA 3BDPA 1I1GA 3UCGA 3PTWA 3AFGA 3MMAB 1FI4A 1T02A 3HVWA 4I68A 3QSYB 4KT0C 3A2AA 1TK0A 3VF0B 4W7YA 1OVVA 5U47A 2PGDA 5E7OB 4P2SA 3KJQB 3TRGA 3MAHA 3O44A 4GIFA 4B86A 3LA0A 3L73D 2OD6A 1NYHA 2QGFB 4C0HA 2PEBA 2YXLA 3PW5A 3NAIA 1T9YA 1SQVK 2B9YA 2AT1B 4LRAA 3PKMA 2RRBA 3W67A 2OPRA 4R25A 2KFYA 1X5OA 5ITHA 3V2UC 2DNOA 1Q5VA 2KT2A 3LGMA 3B5NA 1OYEA 2DK2A 4O3SA 4NWBA 2WSCH 3DLJA 2HHPA 1IBLJ 2E1RA 3AE3C 1X4EA 5M2UA 1HR0F 2VBYA 2CDQA 1QDUB 3SWYA 4L74A 1HNWF 2CQHA 1LNQA 3L71D 3GE9A 5HANA 2RD5C 1X4GA 4ZVPB 1SUQA 2SXLA 4QPXA 3DDNA 2H5IB 3CXHE 4CO1A 1X31C 4Y65A 3UR3C 4ED4A 1FZCA 4NEZA 2R2RA 5CHXA 2YKMA 3H1JD 2CPDA 2RQMA 1ZP0C 4GRSA 1LFPA 2ALZA 2XNRA 2R8KA 2MZJA 1H6KX 1YBTA 1LTIC 4J9OA 4W7ZA 5ETQA 3BR8A 4N5SA 2BR0A 1NUEA 2MSSA 2ADCA 4OMFG 3CWBJ 1RWNB 2GHWA 3Q8PB 4CH7A 3M6WA 3NS7B 3C16A 2UXDF 2IDBA 4JV0A 3G6ES 4LFCJ 1GDTA 1K44A 3K5NA 1TMJA 4KE5A 1XMOJ 4PRFA 5KFYA 1RF0C 4Y28J 3D7SB 4FYXB 3ET6A 1HQUB 1Y00A 1RWKB 2O5DA 3CD6P 1TMMA 3PKYA 2HSEB 1KR4A 4LSZB 3OBIA 1JKHA 1XIQA 2CJXB 2ZH2A 1IKYA 2Y9HA 1I94J 2KL8A 2AJ2A 3MEKA 5E3RA 4YPCA 3SWFA 1E6VB 1BCCE 2YNIB 1Q86Q 4UW2A 3MEEB 1ZM2A 3TUZC 1NK9A 2D3OR 2GA7A 3MZWB 1YJ9P 2DPIA 4J9SA 3M8QB 1S4XA 2XZRA 3G4SS 2X7IA 4WIIA 2W9AA 1RTHB 3L71E 2J0SD 1J5OB 3DHXA 4CYUA 2G1DA 4UOCA 1VQKP 5KG0A 4K5SA 1X7VA 1VQOP 1MU2A 3H59A 2LYVA 1CZQA 2Y1JA 3CXHI 3PX6A 1SKSA 1KC8T
chains in the Genus database with same CATH topology
2R7WA 3EGWB 1Q8IA 3KMQA 2B6AB 4ZP6A 4YHHF 1HBNB 2XS2A 3M8PB 1XN9A 3BM7A 1HYSB 2KDOA 5KT7A 4ZVEA 5J2QA 2J9CA 3H2LA 1KLNA 1GNKA 4FYDA 2CQPA 1X9SA 1L3TA 4Z2XA 2VC1A 1JLGA 2P6SA 1JJHA 3FSXA 4O4GA 4TN2A 3H5XA 4ZDNA 2V8DA 3C8VA 1K1SA 4K59A 1GH8A 4DV6F 2BRKA 2O01J 3W7BA 1JWWA 4PG7A 5GAHI 2AJ0A 5HO4A 2RH3A 5F3TA 1TL5A 2AYMA 4A8QA 3HHLD 4WXOA 3CPWR 5L8RJ 4NCBA 2P6TA 3RB6A 4NYZA 2QO3A 4QQBA 1UFWA 4URSA 5K8OA 3NRBA 2FY1A 4N8NA 3LOUA 2HG4A 3ENQA