3O6QA

The structure of spoiisa and spoiisb, a toxin - antitoxin system
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
145
structure length
145
Chain Sequence
TDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASLCHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and interactions of SpoIISA and SpoIISB, a toxin-antitoxin system in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Toxin/antitoxin
molecule keywords Stage II sporulation protein SA
total genus 51
structure length 145
sequence length 145
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3o6qA01
3.30.70.2720 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3o6qA02
2G8YA 1ZMEC 1WMKA 1OMIA 2P10A 3H25A 3O6QA 3IN6A 1FDIA 1FDOA 3EWKA 1AJYA
chains in the Genus database with same CATH superfamily
4B3SJ 1S1TB 4ZLJA 1FJPA 5C2GA 2POKA 2CQBA 2ASDA 1X0PA 1S0MA 3C8VA 1KB9H 1S4EA 4YPCA 4ECRA 2G2YA 3L70D 2MKHA 2R5DA 1SFCA 3AEGC 4YTPC 3KHRA 4NLDA 1JXVA 3A8IA 2XHCA 3TUJC 5DLGA 4DN0A 1X4AA 2HQGA 3KK2A 3HD7A 3OAKA 4JV0A 4F4ZA 3HSJA 1B7YB 5T41A 1NK6A 2V67A 1BE3D 2HRTA 1ZPVA 3G2XA 1L0NJ 1B0VA 2LXIA 3H1HD 3CE8A 1NEEA 1Q5VA 1LTIC 3WUUA 5FDLB 2UXDF 4KKOA 3F73A 4ZPTR 4OJGA 2KZMA 2KJWA 3MEGB 1JNMA 2LXBA 2PEHA 2ZXEB 3PV8A 1OXZA 1NJZA 1IK9A 3C1LA 3IM8A 3O2IA 3KDNA 3TF5A 1ZW0A 1QX8A 3M2VA 1UWAA 3GIJA 1R7IA 3L35A 1C0TB 3MR2A 4QWBA 1SKSA 3DRSA 4UB6H 3G8QA 4ZJOA 3PHTA 3EFFK 3F56A 1RF1B 5HAOA 1HQUB 1NJIT 1TL7B 1VQLP 2KG1A 3DDNA 1HBMB 2YH0A 5A8RA 4OMFG 1VQ8P 3THVA 5J1PA 2ZOGA 4IOAQ 1RA6A 3U27A 4WK1A 1X7VA 2FC8A 2F4FA 1BY9A 4OYXA 5EN1A 4FBUA 1Y8AA 5K14B 3D1HA 2ZYDA 2XMVA 1OSCA 1PYSB 4Y2AA 4PG8A 4EBDA 1B7FA 2JRSA 4JV5J 3JSVC 3NKYA 2GC8A 4JI1F 1JMBA 2Z30B 3C6UB 1NTZG 4G1QA 1HPZA 3IG1B 1TVRB 1VQNP 4B9VA 5F8NA 3AE5C 1N7SD 4NCAA 1EZVD 3MM8B 2P6SA 1IWAA 2IYIA 1A0OB 2I38A 1CS4A 2N7CA 3H59A 4UZBA 1Y3JA 2F40A 1RT2A 3J80U 2FLLA 1JLCA 4ER8A 3PYDA 1JY2P 3QGPA 1AB8A 3W1YC 1Q90D 3H8YA 3K5PA 2KTQA 2OJ3A 1L3KA 2RF2B 4ATNA 4DFJA 1U7JA 1T02A 4IFYB 5KT3A 3HK2A 5J2MA 2IBZG 3MGNA 3OFFA 2CK3H 4WE1B 2YNFA 3ZZOA 4NYPA 3BKFA 2EI5A 5DG9A 5B09A 2Q3PA 2WPVB 2NPSA 1NLKL 3BYPA 2CYYA 3MM5B 3KLFB 4JI6J 2ZNZA 3SYZA 4O4GB 2Y9YA 1YTZI 1EDJA 5AVZB 2F3JA 2R44A 3LIEA 1QUPA 2DH7A 3CJ8A 1RWKB 1HBWA 2P6TA 3ZO7A 1VQ6P 3ZTSA 3L3CA 1S76D 3D28A 3VMXA 1P27B 1RTJB 2KRRA 5HMXA 2EG1A 4NYZA 2E5IA 1JY2O 3NCPA 2DNZA 1JXLA 3CX5H 4KHXA 3Q5RA 3R1HA 1RA7A 3PRVA 4H4MB 2AJ1A 5J2QB 4DJGA 1RYRA 2AGQA 1EAYC 5M2UA 2NPFA 3SSRA 3MMBB 3D6ZA 1K8AQ 1R6VA 1WEYA 1YIJS 1HUCA 2JJLA 1N73B 1S9EA 1BQMA 1V3SA 5AW7B 1ZTTA 1HQEB 3M1VA 4GKGA 2UUCF 2B4PA 3BYRA 2G9OA 1YBAA 2FYUG 1YJTA 1FRIA 4B3OB 4EO6A 2BJ7A 3HVTB 3M7VA 4U3FG 1ZOTA 4LF8F 1P9YA 3UVJB 3ITHB 1VRTB 2CNOB 3HHLC 3FK4A 2C3UA 3A8KA 3HVWA 2CPXA 1LFPA 2WZ7A 3ILJA 4DV6J 1RT6B 2DPIA 4O0NA 1S1WA 5DETA 5AJ3J 4JV5F 5IT9Y 4DQQA 2B87A 4C8ZA 3U7JA 3GILA 1FVSA 2LQ8A 4F4XA 1OYEA 3M0DA 2QV6A 1VBXA 2LDIA 2YMKA 1OQ3A 2XGPA 4J91A 3H1IJ 2FFDC 3ILLA 5GTHH 2ZH7A 1FE0A 4FDFA 5APQA 1DY3A 2ZD1A 4EK2A 3R2DJ 3P8MC 3D70A 1E6YA 3PX0A 4N8OA 2W4CA 1B99A 5EWGA 2HHUA 3T5JA 4DV5J 3DFEA 1RWMB 1NK4A 1PSDA 3AH6A 1UJ4A 4I4BA 2FHMA 3MMAA 1TFWA 1S7IA 3NP5A 5E3RA 2BQ3A 3G3ZA 2ZVNB 5CQGA 4O3SA 4A8KA 2XLJA 3WZ0A 4HR2A 3VR1A 1VF5B 4YDXA 1LWUA 1SQQE 2YNIA 1AXQA 4IH7A 5CJ4A 5SZTA 3HVRA 3GMGA 1K9MT 1RB0A 1WG1A 1GMWA 1WOPA 3R5JB 2A45H 4TY8B 3P8CE 1FESA 3LF0A 2V7QH 1HBOA 1GMUA 3VP8A 5T7LB 4H4KC 2CQPA 5KAFE 2AJFE 1H0TB 1JLEB 1L0NE 1S5ZA 3JSYA 3L73G 1CULB 1SH2A 3MPVA 1Q5YA 5ETLA 3ZZTA 2C1EB 1CSBA 2MZQA 3A3NB 3SSUA 2E43A 5HANA 1DZ5A 4H4KA 4ENOA 2W7OA 1NTKE 4OX9J 5AVTB 1WI8A 2XTJP 2NYIA 1H72C 2Q79A 4ZKUA 3EVMA 2Q6QA 5AXMA 1SVDA 5FJ4A 1VRTA 1FHTA 2L91A 2ZE2A 2ZKUA 1CW5A 4D6TJ 1WKLA 4BCAA 4UUXA 3WC0A 4Z1MH 4LFCJ 2WPQA 2KNCB 3HFVA 3HVTA 3BGFA 5A6PA 5KOWA 1TKXB 1IKWA 5CCHC 1SQBD 4IH5A 3KLGA 4I1LA 4RW8A 4QIFA 2IC3A 3ENQA 4HVZA 2ROPA 2B7BB 3GIRA 3KLEB 4AE5A 1CLFA 2VFSA 2Q6CA 2MKVA 1Q4RA 3MP7B 2DITA 2HFZA 3N6MA 5KFUA 2BKPA 2E5JA 2FYNB 1L0LK 4BWJA 1Z1ZA 4M5NA 1M56D 2Y0DA 2AXCA 5KT4A 2ZBRA 3RZAA 4ECWA 5KT6A 4OHVA 4DWIA 2R7TA 5EX3A 3MFIA 4TLFA 2PA3A 1RTJA 4MH8A 1U6ZA 4ILLA 5ETNA 3GZ7A 1UW9A 3CNQP 4C4WA 1JXEA 3RW6A 3H6PA 1SFCC 3QO9B 1GX5A 3SFUA 2CJBA 3TGUG 5CH7B 3QYYA 3BV8A 4G1PA 1SUQB 3D6MB 1TKZB 3K5LA 1SH0A 2GUVA 2YTCA 5AW6B 1JLBB 3LP1B 4N5SA 3CGIA 1Q1KA 5B5EE 3HHLA 2R3CA 3DNCA 2R7RA 4OYMA 4DV3J 2HHSA 3R7BB 4OYIA 4EDFA 3IR6B 2IVFB 3S9OA 1HGVA 1IO4A 4CT9A 1RE1B 3CJ0A 4NWBA 3L73E 4DR3J 2YNHB 4K50A 1G4CA 3A8JA 1AYEA 3LPEA 3CJRA 4GT1A 1RT4B 5HMZA 4MTPA 1SVFA 1X4FA 2E75B 1S5LE 3KJNB 2W27A 2KHCA 2FVRA 3GJSB 1Q86Q 1R8PA 2YIUC 4AYCA 5FLXY 3UD4P 1KILD 1VBYA 1VQOP 1NOHA 2IM2A 4F04B 4M5MA 2HBZB 2XLIA 4IQMA 4WPAA 3E2EA 4WY4B 4HYTB 1Q82T 1FZAA 3MMJA 1Q82Q 1EKRA 4KJIA 3FBEA 3IG1A 1REVA 4MKAA 5EHHA 4C8KA 2QT7A 3GMAA 2QJYC 4NLSA 5D4LA 1ZN5A 3NAHA 2R2RA 1U1OA 4U95A 1JNRB 2HPUA 3CCLS 1OJ4A 1FVQA 2HK3A 4ZVRB 2BOAA 3HTKA 5L9NA 1N5TA 4M5HA 3OD2A 5FLXU 5KFNA 4DSIA 2VOOA 3BQ2A 1DHMA 2FYUK 4Y65A 3MM7B 2DISA 4YY3F 2BANA 1VQ6S 3POTB 5J2PA 2BCCG 1Q7YT 4I7ZB 2D2CB 2V8GA 3QZ8A 3T6JA 1VJQA 3B8HA 4A48A 1P1TA 4OYPA 1BGYE 2B9EA 4I2PA 3EJMA 3J81U 1L0LG 1LOUA 1C1CB 4IL6H 2XNRA 4ANDA 4CP5A 3BDEA 2JEFA 1RT3A 4Q2LA 2ZH8A 3IM9A 3OUYB 4YXWH 4RO0A 4NLGA 3GFYA 3MUDA 4ECXA 3GTYX 1SJ1A 2KU7A 3DDKA 3K0JA 1YJRA 3POTA 4JI2F 2ZXXA 5IWAF 2MYFA 1W2BR 5K9FA 3RBDA 2KSEA 1R31A 4MJKA 4DR2J 3PHEA 3TANA 1OO0B 4ZP6A 1EETA 2FYNC 1LFWA 4UB6E 3HHDA 3OR2A 3V6HA 3LWMA 5FD1A 4CTAA 1HW9A 1XMQF 3G82B 4CLKA 1URQB 1VK8A 3W5YA 1RHQB 3UNGC 5MLCV 3GONA 1SP4A 4PR6A 1SFCB 2I5JB 1S9FA 2P10A 2ABYA 4JI6F 2W2PP 3IR9A 4AXJA 3L72D 3TSIA 2QLWA 3M6WA 1PP9G 3FNNA 2GQ2A 1L0ND 4ZPBA 3M30B 1VIOA 1OQ6A 1NHUA 2DGQA 5KFLA 3HHKA 4RBUA 4USVA 5JMNA 3AEFC 3K7RA 2KSJA 3CC2P 2CZ9A 1QSLA 1RT4A 2HFOA 1YQ4C 2O1PA 2V8HA 4F02A 4P9SA 1DRZA 3MEKA 1IKYA 2YNHA 3O6QB 1CSJA 4XFJA 2LCWA 1NU1K 1BGXT 4HB1A 4DV5F 1AZSB 2XNDH 1QLED 2Q1KA 4U3FJ 2Z0GA 3EXYA 3H5SA 2BE7D 2WSSH 4NXMJ 2W4PA 1KLMA 2BCCE 3C14B 1U1LA 2F5GA 3G9CA 2ZH4A 3B71A 2ITAA 2GVZB 1MU2B 4OZ1A 2Z5HA 3M9HA 2CRLA 1EDIA 1FTRA 3CWBE 1NTMJ 1HMVB 1H89A 4DV0F 3KZIE 2IYOA 4NXNF 1ZYQA 5KG5A 3OJUA 3R3TA 4JYAJ 1NO8A 1RQUA 1EP4A 2BEFA 3D0IE 4EYHB 3D0GE 4CLSA 2BE9B 1SKUB 2D7SA 2H3EB 1WKJA 1JLFA 1WACA 2HAIA 1HH0A 1PGJA 4DSJA 4DPTA 3P5BP 1H2UX 3JSRA 1YJ9P 2PMHA 4NPDA 4LBIA 1HWKA 2RH3A 4DS4A 4PXBA 2YIUB 4WTOB 5CA5A 3MXHP 4LQ9A 2IM1A 4AL5A 3PFEA 5EWFA 2KRBA 2N1TA 3TA1A 1T9WA 4IDKA 3KNAA 1ZMEC 5DJUB 1CJTB 1OYDA 4G1IA 3L71G 4O3OA 4DX5A 5BU8B 1HD1A 3ZFVA 4P2FA 2QRXA 2PIIA 5KG1A 5HO4A 3MM9A 4WZQA 3N0VA 1TL1B 5LSOA 3DYAB 3BVHA 2DGXA 3BF4A 3G9RA 4RNMA 2OGUA 1IFJA 2AIRB 5D4OA 3IXQA 2E44A 3NFQA 3Q8YA 4RW6A 4IRCA 1SQEA 3H4BA 4IDKB 3PO5A 4LREA 1SXLA 4TYAA 3NBPA 5KFVA 1PAUB 1RH5B 1IFPA 1KDNA 2VG7B 4O4RA 2ILZA 3Q1MA 4NLUA 1H0TA 1FJCA 4HACA 3CX5E 2YWEA 2DIUA 1RBOB 2YWKA 3UFCX 4KGZB 3SCJE 1MNEA 2CUYA 5J2QA 4BRYA 5K20B 2WW8A 1XQIA 3DLGB 4W98A 5KAIH 2OO4A 1ZRTE 1Y5LB 1M5HA 4F4WA 4QIGA 1G3OA 3RUBL 2AYBA 3CEDA 1FZEA 2MZSA 1JLAB 3MUDC 2VKRA 2E75D 2DNOA 3MWBA 4E2FB 3HZEA 1ZM9A 2HVHA 1S57A 3VZIA 1M1JC 1IQZA 1FDMA 4CZCA 1TL3B 2DGTA 1PCAA 1GL2B 1DTTB 4U7UK 2RMLA 1TP7A 1GTEA 1YITP 5KFMA 4PZVA 3ENAA 1H88A 1CJVB 3B82A 3DGPB 3HFZB 1E6VA 5E3QA 3I0SB 2AGPA 3M8QB 3DXBA 2YNFB 2LQ5A 1GK6A 4H54A 4F0MA 2E74B 1Q16B 1YBTA 1KOHA 1D8YA 1SKWA 4U7UD 5AE3A 4XK8C 1SQPJ 3PFOA 2WSFH 1WOOA 4QWDA 4KT0C 2NPIA 3II6A 4M5IA 1QUVA 2IM0A 5IOLA 3KKFA 3VHQA 4XTTA 2FLPA 3OVBA 2CNKB 1HJ0A 3DLJA 1SQXJ 3H7HB 2QLXA 3MM8A 5CD4H 1F60B 5LM7E 1GTHA 2J9CA 2MDAA 4AQYF 2QA2A 3TWZA 2F65A 4ZP7A 1O8BA 3N01A 4GKKJ 4I2QB 3HI9A 2HODA 2V2KA 3PM9A 3GW6A 1EKSA 2KT3A 3OV7A 3M2RA 4DR7J 3E7KA 1VQLS 3ET6B 3EWGA 3ZZYA 2Q5UA 1NAQA 2DCUB 2YX1A 3JQJA 1HQEA 2FVPA 3OFGA 3VGSA 5C25B 2CPJA 1LT1A 3A1YG 2L5GB 5E3AA 1QEXA 1GH8A 7FD1A 4C9DA 4RW4B 3FC9A 3AEBC 1TL7A 2EFPA 4JI8F 5DLFA 2A18A 4P74A 3MECB 3GG0A 1Q53A 1FX4A 2DNQA 5AJ3F 1J5OB 3GPAA 2IJRA 4P2XA 3IFMA 5E5NA 5KG6A 2ZH6A 1DIPA 1K04A 2KFZA 3CPWR 1CQMA 4KHRA 2H1YA 3EGZA 2NYHA 4U67Q 1BE3J 1P84I 1LXNA 3KDOA 5IT9U 4KH0B 3MEGA 4O44B 4PD4E 5IC6B 4KKOB 3MHVA 4WFYA 4EBEA 3M6XA 5FDLA 4B3MF 1DD4A 2G0IA 3I96A 1E79H 1S7HA 2XY5A 2YPYA 4X65J 2PI5A 2IY5B 1FJ7A 3HVAA 1R27B 3HP6A 3OTOF 4RKUJ 2NCKL 1T8ZA 1CJKB 1GFWB 2J6SA 4OFZA 2IIHA 2JDJA 1JJ4A 5JUMA 4QW9A 2FBWC 3NGRA 3J81Y 4P2SA 1QVGR 3KK2B 3A3OB 4JYCA 3NRBA 4YS2A 3A0BH 4UW2A 1VQ9S 4QYZJ 2RF2A 1M57D 1K9MQ 1Y0HA 4GKJF 4JUZA 1FZCC 3H1KE 2OD6A 3NNCA 1C0UB 4NLTA 3I31A 4YY3J 2WVBA 1BQNA 1R8AA 2HHTA 4O9BA 1JKHB 3SWFA 3W66A 2WTYA 3MM6B 5DGAA 4WK3A 3BATA 4E8UA 1EJ7L 1PGZA 3QJLA 2W6JH 1EB0A 1EXIA 1CQNA 1JLGA 1PV3A 3L09A 3W2WB 1J5EF 1MLAA 3P45B 2O01J 3R5DA 3SMZA 2OTJP 4M5DB 5GAHI 1HHTP 1N52B 1N34F 4P52A 1LXJA 3P5TL 4G1QB 2C3OA 2QJPC 3FCHA 2KJVA 1URNA 1JLGB 3VMZA 3AD8C 5DDRC 4BXLA 3L36A 3L70G 4X4PA 4U3FD 1XMOF 3V2QA 1NGMB 5IWAJ 1KR4A 3SQGA 1VRQC 4F67A 2XMMA 1F3FA 3AE7C 2ZBCA 4OYBA 2H4WB 1MV8A 4AQYJ 2XMWA 3AE6C 4LLHA 2Y8WA 3QRQA 4YUDA 2RU9A 3ETMA 3O8WA 5KAIE 1WG4A 1SQFA 2OI2A 5HSPA 3WU2E 1YJWS 2YKNB 4PQUB 3CJ3A 1GU4A 3L70J 2N4DA 4PXEA 3NNHA 3GHGB 1RADB 3GSDA 1SQVD 2MY8A 2CADA 1EZZB 3PVXA 2GO8A 3KG0A 5CXTA 4DV7F 3QT7A 1CJKA 1D7MA 2B9BA 3G6ES 3SV4A 5ITHA 3L9ZA 3G71P 2D2CC 3ZNUA 3PIOQ 1FNXH 2XZDB 2CQ1A 3KJFB 5DQHA 2YY3A 4EZ6A 4JI8J 2KN4A 3IN6A 1T94A 4NRTA 4EGLA 4X4TA 4LJMA 4LGDE 1FDOA 4B3TF 2HPCA 2Y3YA 4DUZF 2CVEA 2HRYA 3TVZA 2ZZTA 4NRUA 1FA0A 4KC5A 1ROFA 3RRGA 5KG7A 5RUBA 3M91A 1KONA 3M0DC 1UIIA 4AUKA 3IN5A 1IZNB 2E29A 5C25A 4O23A 3GLJA 5JVGQ 2R3SA 4OGQC 1RT5B 1U2RA 1WHYA 4GODA 3WIVA 1DLOB 4USJC 2F9DA 3T97A 1REGX 2AJQA 2D3OR 2QG4A 4Y2CA 4I2QA 4PG5A 1RAHB 3MEDB 1JUNA 1OSDA 1NBEB 4QIEA 3ZC4A 4WTYA 1CULA 3CIZA 1FEHA 1JLEA 5APTA 1FZCB 3G71S 3QBCA 2P7JA 3BEGB 2V2ZA 5C24A 2BABA 3AFGA 2MQQA 4DV1J 3MURP 2DR5A 1LTSC 3CMQA 2RD5C 2XWXA 3UWTA 4X4UA 2YKPA 1N4LA 1HWIA 4DUTA 2GJFA 2B8PA 3UDVA 3PYGA 1TAQA 1RLCL 3TAQA 1L3UA 4BLGA 3P8BB 2Y0BB 2CJKA 2XU6A 1FK9B 3TAMA 2HNYA 1WNEA 1XIQA 3ZZZA 1NHKL 3ENVA 3RK3E 4HKQA 3FWLA 1NCLA 3LW5C 3CXHE 2H43A 3DOMA 2XI2A 4DCKA 3K58A 3FJ2A 1KEKA 2HS3A 2C2KB 2GVDA 3W68A 4B02A 1UFKA 1AJYA 2IBOA 2HVIA 4LVOP 4RJVA 3NS7B 2BEQD 3MR6A 2W2MP 1XK8A 3CC2S 3FGAD 1PBAA 2ILYA 2V94A 1N48A 2FVSA 2W7PA 1JK9B 3GYNA 4U9RA 3C15B 3W67A 4JPZB 3BGLA 2CQ4A 1IFNA 1KYOH 4A4JA 3GP9A 3AOCA 4P7VA 4NXNJ 1HHSA 1RAAB 2NZCA 4ICLB 1T8EA 2B56A 1MROA 2IFNA 4C8YA 1LT9C 5KFYA 3CC7S 4CO0A 1KOOA 2VBXA 2HHWA 3RRKA 4Q2MA 4NA2A 3PJSK 1NH8A 1QJHA 3CWBJ 1M1JA 3W60A 5DRKA 5C42A 4YB1P 4DR7F 4X4VA 2DR6A 1URRA 3H1IG 2VG7A 5DDQC 4ANCA 3BKUA 2WTFA 4ED4A 1KLNA 3EX7B 2JVOA 2R8IA 2FJWA 1ZM4A 1XNQJ 4P72A 3W5XA 3CJ2A 1GL2D 4OH8B 1D9AA 4USMA 1Y11A 4C2MA 4OI1A 3W3SA 4B3OA 5KFGA 5KFXA 4IR1A 3I9ZA 2DKOB 1VQOS 2ZT9D 1NPPA 1U4BA 2EKYA 4AQRD 3MM9B 3T19A 4QWEA 3M1VB 4LFBJ 5KFDA 1QAJA 3AOAA 3W9IA 3GSIA 4H13C 4HH2A 1FRMA 2Y1RI 2M3BA 2PFDA 2R8JA 1IKXB 1OVVA 3RYLA 4K4WA 4H4MA 1UAWA 2O5DA 2VG5B 1KILC 2GO9A 2L9NA 4J37A 2E1RA 1HA1A 2H4YB 2EWHA 1C0UA 3CCSP 4KFBA 1PGOA 1LP1A 3BPSP 2DHSA 3GF3A 1SQPD 1NSQA 4J9OA 3P3DA 5CMZA 1NB7A 1H7WA 3HM9A 3BSNA 4F25A 2ALZA 1F5AA 2KUBA 5JXSA 2YWFA 2OTKE 3D6TB 2QSWA 2BJEA 1XMQJ 1SL1A 1Q7YQ 1KILA 3M32A 2H5IB 2FXPA 1X22A 2WSFJ 2UP1A 1RE3C 4JP8A 1DURA 4LC1A 3KLIA 2M88A 3CTRA 4IOCQ 1F2HA 3GJRB 4N78E 4BHQA 1PZQA 3G8TA 2XO7A 4O44A 3GG2A 2YKAA 2MKYA 3GE9A 3GIKA 4MK8A 1FXDA 1MFTA 1LW0B 1T9UA 2W8ZA 3JSBA 2ZOMA 4C7QA 1NU1E 3MCOA 2XNXA 5F8JA 2HWTA 5B0EA 2MB0B 4KHMA 1YHQS 2HNZB 4BWMA 1PIXA 2KLUA 3TRGA 1ZP0C 4PG6A 4FN5A 1HNZJ 1FKOA 3LAMA 2XYGB 2HS4A 1OZHA 4DU8A 3E51A 1NTKD 3L70E 1HPZB 2W9AA 2KS1B 2RE1A 1KBRA 3EXCX 1FRJA 3ILOA 3TA2A 2K3RA 3M05A 2IHR1 1YI2P 2H51B 1QVFR 3R27A 1RWWB 2G0CA 5IXUA 4R0EA 4JI2J 4Z2XA 4IL6E 1T05B 3L72G 4IFFA 3CJTA 2L9WA 1N33J 2GGPA 1GX6A 1PIEA 4URSA 2Z5IA 1RTIB 1XBWA 3CCMS 2CZVC 4DV1F 3HE5A 2FHJD 3CVKA 1FU1A 4WKRA 4XPEA 1KHWA 4DDFA 3AODA 2FXOA 2IDEA 4ZLNA 4FF1A 3BKTA 2POHA 4P73A 1ULRA 5AXKA 3D54A 2VF3A 2OAUA 4N7TA 4DL0C 4I6YA 3RR8A 3GJQB 4NPEA 4TQSA 3EZUA 2EFVA 2K9JA 1YJVA 2OSRA 1B4SA 5EX0A 1VQ4S 5CCGC 1NDLA 3PDNA 1VQSA 1SS1A 1XR6A 1F3VA 4QWCA 1SQVK 2P9GA 3KWMA 1J2VA 4PCQA 3L75D 4DSLA 3BGOP 3CCRP 2DB1A 1KVKA 2B8QA 1U47A 1BE4A 4DZOA 2XY6A 2QL7B 3H5UA 3O5TB 2ZZNA 1BCCJ 4EZ9A 1TL3A 3EPIA 1T03B 1PP9E 2HIQA 3MECA 3BBBA 3PH0A 2PFXA 2MSTA 1S5LH 2EEYA 1VDFA 2M2BA 3U59A 1YJ7A 2RDDA 1IR2A 4BS2A 2ZJQQ 2AF6A 3FKBA 4N47A 3LGMA 5CCHA 2FJXA 4PRFA 2WSCH 3OT9A 3R6GB 2W4DA 2LA6A 3V2RA 1M8OB 1FRXA 1VBKA 1HI0P 3I4PA 3RBZA 5ETPA 2D2CD 3CL3D 3V4QA 3R7SB 3HXMA 1ZAVA 4HTIA 3SDEB 3MHYA 2VG6B 3O8ZA 4I2LC 2N9YB 1USEA 1FF2A 2DGSA 1NK0A 5GAEI 3KNGA 1HNVA 2IA0A 3GR0A 2F63A 3VQSA 4LRFA 2KI2A 2C3YA 2ZFHA 4R8UA 2KNCA 4Y28C 3KHHA 3IR7B 3H0PA 3VN0A 4K35A 2CWKA 3BRVB 4DL5A 1HF9A 3R6LB 2IPPA 1O6XA 1N7SA 3ULHA 4O3PA 2HHPA 1IBCB 1Q78A 3PIPQ 1GK8A 1XTGB 1UL3A 3N5FA 3NCQA 2MQPA 2AKWB 5KFOA 3QRPA 1KFMA 4K59A 4JI3J 1RHZB 1QGKB 1HWUA 2J8SA 5CAAA 2N1TD 4ELUA 4OZ2A 5H9EJ 1GD2E 1NSAA 3TW0A 3PP5A 3I0RA 1NU1G 1XTCC 4LRAA 1YKWA 5CHCB 4WFXA 3QSYB 1GL2A 5EDWA 1QAIA 4O3RA 1NDPA 2QJKB 4HKZH 1RAEB 3Q86A 2MEWA 4GVLA 2RNEA 5KKZC 3S8SA 2JNJA 2ZAEB 3MOZA 3IBCB 2E9TA 1VK3A 1X4BA 4OYAA 3S6EA 4UY85 2DHGA 3JXOA 1AVYA 2GMLA 4OIXA 1FO1A 4I6MC 1YHQP 2UUAJ 1LWUB 5KFWA 1DQAA 3BZQA 4URGA 1GNKA 2Q9IA 2HQCA 2YXQB 4OI6A 1VQ7S 4DT0A 1GXLA 4XIUA 4K4VA 2WZ1A 3FSIA 1Q81Q 2V34A 4OQJA 1DFDA 1BE3G 2MHEA 2GVDB 3A4TA 5HQLA 1FJEB 4N6JA 5I3PA 5A8WA 2E76C 1KC8Q 1QE1A 4OLOA 1J1EC 4K8RA 3DMJA 3T5HA 1TKXA 5K5MA 4B3TJ 3ENWA 4N78D 2Z57B 4A46A 4OGQB 1R6YA 4DR5F 3OLBA 3CD6S 1UVLA 4QBUA 2U2FA 2NRGA 5HVGA 2PAJA 2WOMA 1L2PA 3PEJA 3L71E 1RWVB 2IRUA 2VH7A 2X3DA 3TEGA 3EVWA 5B66E 3IR5B 1HL6A 3NL0A 3I5CA 3CUNA 1EDKA 4K2JA 3FZBA 2ZZMA 2WOMB 1UZHA 2UXCJ 4WF9Q 2Y9ZA 4OVNF 4F3OA 3HCXA 4RBTA 2MZTA 4YQWA 3V5RA 4JB8B 3WUTA 1YQ3C 4CH0S 5T7LA 2NPSD 3TARA 3OTOJ 4PKDB 2BKOA 4PG4A 1VQ8S 2QFJA 5CYJA 4UOGA 3KK1A 1XJWB 5IS2A 1KKHA 2OEMA 3KG4A 1XEZA 3G82A 2A06G 3CCQS 2CQIA 1RWOB 1OMIA 3CWBD 3V2NA 3PG9A 3Q2TC 2YX7A 3U1AA 1WC3A 1VHFA 1YRTA 2NXNA 4PD4I 3NY0A 1HMVA 1BUXA 1KB9D 1BCCE 4CLUA 4DR4F 2CQCA 2XZWA 3H1JE 4ID5A 3DLHA 2OPPB 3A13A 3LW5J 2J9DE 5CYMB 4FKXA 2JLEA 5K8OA 1WC6A 2WWWA 4Y00A 1VF5D 4CNYA 3EGNA 4U7CA 4CH7A 1ZLLA 1YJ9S 2CA9A 4ZDNA 3QGHA 2ZD1B 3CF5Q 5DJBA 2OSQA 3MAAA 2YKQA 1UJ6A 4K4YA 4I2PB 2HVEA 1LWCB 5BU5A 1SV5A 5L38A 3GJTB 5J2PB 2RDJA 5HI7A 1AUSL 1DTQB 2DR7A 2CQ2A 2BANB 1VCTA 9RUBA 2BDPA 5AW4B 4ELTA 2MQOA 2NZ2A 2OYHA 1AW0A 5KJ7A 2CFXA 4MFBA 1JY3P 4ZVPB 4HJGH 2HS0A 1S1WB 2H89C 3PRJA 1VQ5S 3MZWB 2XC9A 4M1KA 3BQ1A 1PJ6A 1FRLA 3R8YA 1X4CA 5ETOA 4HH1A 5F8IA 3MGJA 1IFIA 2O01C 5LL6d 1U1QA 2EK6A 4PJ0H 4WY4A 1RT2B 4Y28J 4E98A 2ACMA 1M1KT 1VOMA 2MLZA 4YB6A 2ZH3A 2QMUB 2IA6A 5IM0B 1U57A 1WG5A 3BRTB 1I1GA 4BC9A 4BDPA 3WQPA 1CJUB 3CMAS 1G7CB 4NXMF 2F4VF 3BO4A 5C5JA 1YG0A 3WBZA 2BOPA 1LT9A 1KD1Q 1SQPK 1RHJB 4LF2A 2IDLA 1KWMA 3CCES 3EM1A 4IOIH 5AW5B 3Q22A 5CZVA 1N0UA 1D1UA 2WB4A 2G4BA 3PHLA 3CC4S 4OX6A 3NTNA 4F7VA 3I5AA 4ZIWA 2DW3A 2XEXA 3CWJA 2FJBB 4XDCA 1BCCG 1BGYG 2HURA 4X4QA 3D6YA 2XMAA 2HVZA 1VHIA 3KPEA 5L39A 1XMOJ 3A0HH 3QWPA 1Y47A 4YEAA 3R97A 2KXNB 2KKHA 3QGIA 4NE9C 4TLQA 4AL7A 4IO1A 3KLFA 5CABA 3MM7A 1S1UA 4Y2IA 3GIIA 2AXTE 3GWCA 5D0RA 2WVCA 1HR0F 3WMM0 4OI0A 2XS5A 4WWSA 4Y2KA 4ZCLA 3JSMA 1LP1B 1UTAA 1D8ZA 2KO1A 1U24A 1YJNP 1ZETA 5KLVD 5L1IA 2EG2A 1LQ9A 2GS8A 1KFDA 4MYTA 2PRRA 3PYFA 2DNPA 5KFZA 4ES3A 4W80A 5AXLA 3OA7A 2VIHA 4NOHA 4RW4A 2FKWB 4A47A 2K1RA 2L48A 3MAHA 1M1HA 1Q86T 2DY1A 3CCSS 1R8EA 1WC1A 1YWXA 3D66A 1NTZK 3AOBA 5AVUB 3H1HE 2VBWA 1FNMA 4K4ZA 4OGQD 4MFBB 3L74J 1YZ6A 2FD2A 1HD0A 4A8QA 2QM7A 2HHXA 2MTLA 1C1BB 1LJ2A 5HJXA 2H7HA 1MMDA 2HBQB 1F5CA 3UCZP 3LP1A 3SV3A 3RAXA 3MCSA 4RLEA 2FZCB 1HQUA 4DR1F 2BZ2A 3D5MA 1Z2LA 3UN5A 2HNZA 3FRZA 4BWNA 4M8LA 3NWGA 4ZPVR 1U09A 3OW2R 3HO1A 2XS2A 1V3ZA 1NH7A 2GM4A 1TKTA 3K59A 2MSSA 4RW7A 3VTPC 1W7WA 1IR1A 1NHLA 4B9TA 2J0QD 3S1TA 3C15A 4FPIA 4UF4A 3CXHD 4TN2A 2AXTH 2A45G 1VBZA 3HD7D 3RK3C 4ZA1A 2RQCA 1E6VB 2N7YA 3NS5A 3ONQA 3MMAB 1NPKA 3OFEA 3KDPB 5CD4A 3HKZD 5GTIH 3KLEA 1UA0A 5BYQA 3ZTOA 3G8SA 4C97A 5DQIA 1U1RA 3UD3P 1E6YB 2YNGB 3NGUA 1U45A 3IBFB 1TV6B 3L74E 3LAKA 1VC6A 3SCKE 1KTMA 2IBZE 1FS0E 3H1KD 1R5LA 2LEPA 2ZH1A 1RHUB 1UKUA 4MYUA 1OMSA 1RAJA 1NTKK 4Q45A 3A3YB 3W64A 2RMZA 3ZZRA 4NPOA 4DSKA 4CCHA 3AE4C 4DLEA 1NJIQ 4ZLLA 4EBCA 4I67A 5AW3B 1X8YA 3H1LJ 2B3TB 2XNQA 2WRMA 1MSWD 4XPCA 3UCUP 2RRBA 1TU0B 5IZHA 4ED8A 4QCLA 4ASVA 4NLXA 1S48A 2VZ9A 5B7WA 2IVMA 3H2LA 3VAFA 3N4WA 4WYLA 2CPHA 4HHJA 3PY8A 4A8OA 1S3JA 3VZHA 4XA4A 3VGVA 4ZITA 4CH1A 4TNOA 2E76D 5E3PA 1SJ3P 4P6QA 1RU2A 1DD3A 4GDOA 3TGUJ 1JQGA 3TDKA 2XY7A 2RQMA 1FEEA 4AL6A 1GK4A 3MDFA 4H0LD 2L41A 1BHNA 4DOJA 2Q6BA 5A8WB 3DYAA 3FMWA 4B3RF 3OTEA 2FHKA 3DLLQ 3H90A 5A8KA 2W9CB 3C19A 1VIXA 2DR8A 2LR2A 5D15A 1N5YB 3KJVA 2HIYA 4ED7A 3RB4A 2UUBF 1N73A 4UOCA 1QTNB 4F4AA 3TUPA 3AJDA 4KH1B 1PJ5A 1Y5NB 1FNOA 2LLZA 3VYIA 2N3OA 4G65A 3H1ID 1Y5IB 3MR7A 3GV7B 1UEUA 2I1JA 2IJFA 5E33A 3DLBA 3SCIE 3AA8A 4ED2A 1N6QA 4GO7X 2WHOA 3P96A 3U1CA 3AE8C 3T1HJ 3UI3A 4CIOA 2VV5A 1ZXGA 2HVDA 3LANA 4W4MA 2LA4A 2MGZA 2B5JA 3B5ND 1UEVA 4QPXA 4LSLB 1RUSA 2YNGA 2RKLA 4LF6F 1Q8BA 1S6QB 2C2MB 1A9NB 2J0XA 1X4DA 3CO9A 3I5BA 4ZMMA 2OTLS 4I1TA 4X64J 5FIIA 3K5NA 2HMIA 1IKVB 4DI6A 2X51A 2NPSB 2DNYA 1HYSB 1FX2A 4JQ0D 2EBGA 2JEEA 4I7ZC 4TT3H 3FQKA 3RJMB 3UCGA 1GU5A 3TZZA 4AD6A 3MAQA 1T2KD 4CLFA 2BM1A 1GXUA 1RF1C 1QY7A 1TKTB 4YHHJ 2RHQB 4ZVQB 4USIA 3PJXA 3BB5A 4Y34A 4U3FE 2Q3EA 2OP5A 1WEZA 4C11B 3EDQB 4J9LA 3BH7B 5IC4B 4HHHA 4TU8A 2UZAA 4NPFX 3PRBA 3DKDA 2EKNA 5IT0A 2J59M 2MMYA 4ECTA 4ZKPA 1UP1A 1ZRTD 3AB4B 1PBUA 2BV3A 3B5NA 4WY4C 1TVRA 5DG7A 3V4MA 1HARA 1RWPB 1S1VA 4NCGB 3C6UA 4KTQA 1LWFB 2X1AA 2A6MA 1DLOA 2C28A 3MR5A 1W26A 3MM6A 5J2NA 3ILIA 5B0DA 2E1CA 4LF7J 3IFEA 3GB0A 1L0NG 1S10A 1NAYA 1X5OA 3V4WA 2ERRA 1FCAA 5H9FJ 2J76E 3O1LA 5GADU 3IWXA 4J9PA 3C3LA 2XSJA 1ZOYC 3TVYA 2ROEA 2OYIA 2IZ1A 4FVCA 1NZ8A 2HBYB 2OPQB 2YKMB 3LUYA 2IBKA 2K8GA 2R7VA 3TVKA 3QZ7A 1Q95G 4L6V3 1K8AT 1NK7A 4NI2A 1Y3KA 3V2UC 1MZ9A 5KG0A 2R7WA 1RWNB 4F4KA 4LFBF 2RKIA 1EZVE 2B0GA 4FYVB 1VQ5P 1X9WA 4ZNCA 3W9HA 5J2MB 2IVYA 5KFBA 4MAKA 2RKIB 9ATCB 3W7BA 2CNNB 3MUTP 3TZWA 2VJUA 3W62A 2W01A 3OL8A 2M70A 2YQ0A 4D6TD 2FYUE 2YWWA 5CCLA 1NKBA 1TAUA 1FE6A 4LVNP 3TZXA 1M5SA 5KLIC 1B3TA 3VWSA 5E7OB 3LWLA 1RTIA 3D67A 1XR7A 4YB7A 2CG8A 2WSEJ 2YXLA 2ZVSA 3WU2H 4L73A 1SIZA 2VFUA 1S1TA 5F8HA 2C3PA 2QIFA 4Z7YA 4DV7J 2HFSA 2NLWA 4LSNA 3TGUE 2QE5A 2ZUGA 2HODB 3H1LG 1HQ2A 1SQXK 5IQ6A 3NMDA 1REVB 2BCCD 2FJDB 1TQLA 4LIRA 2HHVA 1HKAA 2KT5A 1FKOB 4WU2A 2G2ZA 3TP2A 4EU0A 1NMEB 1EQ0A 2LXUA 1LV5A 2ZM6J 2VBYA 3TA0A 2L9DA 4B3MJ 2UUAF 4A8FA 4DN9A 1JKHA 1IBLF 2UVUA 3VAHA 3CD5A 3JQMA 1RBLA 5KFFA 2Q3IA 3D1OA 1JX4A 2LECA 2B88A 4F50A 1D09B 4PUOB 5APWA 1RGVA 2UVRA 4CLWA 3MTKA 1KFSA 5H9FK 5ETRA 2R7OA 4IH6A 3CIMA 1HIYA 3I0SA 1XR5A 4CPGA 5L8RJ 4O3NA 3AE3C 1IM6A 3OL9A 4LRCA 2FB0A 1WT6A 1PAEX 4DQPA 1L0LD 1JLBA 3P6YC 4DL3A 1Z56A 1FDDA 5B0CA 1ZAWA 2OH2A 3EFGA 2YKOA 1FI4A 3HJFA 5GAHU 4Q0BA 1KQSO 3QO9A 2R8KA 3GU0A 4ALZA 1DQ9A 3D6HB 5L8RC 1CC7A 1JLAA 2AT1B 3F41A 1RTHA 2RT3A 4XAKA 4KFBB 1L4AC 4DHVA 1Q2NA 1WUUA 4GIFA 3I55S 1IJFB 1RTDA 4C0BA 4YN3B 3OSNA 4I64A 1NTKG 5AVQB 5CCGA 1Q8KA 2QZ8A 1U2FA 3L7PA 2GX8A 1S1XB 1R5SA 3NOGA 4RNNA 3JAMY 5MAOA 3R2PA 5KFEA 1YIJP 3DM2A 2AYGA 3ISND 3MPYA 4NLVA 5C7PA 2X3GA 1GZLA 1B64A 1N5VA 3BM7A 2HR3A 1RF0C 2O01N 1FFSB 4DFMA 5BR8F 4DQRA 2IC3B 1JNZB 1BWEA 1MWYA 3E8OA 4RW8B 2AX1A 2A10A 1NWQA 2EXUA 3NBPB 4ZK7M 1IKWB 3FEZA 5DM6Q 1VC5A 2UV8G 4CYUA 3PRDA 1APSA 2DH9A 1BXNA 1PP9D 3KUGA 1USDA 2CJYB 1EIYB 1S79A 2LEBA 1Y4ZB 1HHQA 1DARA 3EZOA 2Y0CA 3ZNJ1 3H1HJ 1AFJA 1H8AA 2MQMA 1UFLA 2WSEC 1FZBA 2FJEB 3TJ9A 3V4IB 2VA2A 1NYHA 2VFRA 3HLUA 4DBQA 3QJPA 4ZVOB 1VRUB 2L3MA 4R5PB 2EFGA 1MROB 1XWLA 2XMUA 3CJ5A 1P8GA 2LXCB 2BCCJ 3TK1A 1NTZE 4LUBA 4GC6A 4L3NA 1IK7A 3AXMA 4FYXB 2KZIA 1WEXA 2CJ9A 5CYQA 2N9BA 5I3QA 4DV4F 1DJ0A 1JJHA 3Q23A 3I82A 1TL5A 1T3OA 1MWQA 1YBUA 4WKYA 2QN6B 1GMJA 2EBEA 4HDGA 2DT9A 1RDRA 2SXLA 1NTME 5DDOC 2OPRA 3M2UB 1M1GA 2F8HA 3A2AA 2ZHOA 1FK9A 3MTJA 5LJ5Y 2C42A 1KQGB 2E5HA 1FD2A 4KYZA 3KOAA 1RE3A 3IP0A 1FD8A 3MPDA 1HLWA 3NCRA 1NHVA 4RW7B 3DLGA 4IG3B 2FHOB 2K88A 1N8RT 2IDBA 3KLHB 4B9MA 2AJ4A 3CD0A 2BMBA 1SH3A 3SEOA 2A06D 2FQQB 3U1NA 3L7UA 4KO0A 1QM9A 1S59A 4J9VA 4RBVA 4GOEA 4OYWA 3G6VA 4NLWA 4JI4J 1YTZT 2G3AA 3VF0B 4IRDA 4IUFA 3N5BA 3W8GA 3GFXA 3SXLA 3CX5D 4FYWB 2KFYA 1JJCB 2HBRB 1N7SC 3V81B 4UQTA 2KP8A 1AQ5A 4C6AA 3BCCJ 5F9LA 5EFWB 2CPDA 2IMOA 3HD2A 4F2SA 4KQZA 3UW1A 1LTJB 2YQ1A 1WORA 1XMBA 1RHMB 2R5BA 3H98A 1T9VA 2JWAA 1TL1A 2ZYGA 1JLQA 3D6FB 5BR8J 2KL8A 3S01A 1IBMF 3B78A 1RT7A 4A8MP 5G4DA 2J5UA 2UUCJ 1VQPP 2KZJA 4DCOB 4FXDA 1RI7A 4BC7A 2K3IA 1KMIZ 3H4DA 2C2DA 1KD1T 2N1TB 2CJXB 2I8DA 3TYTA 1Q79A 1ZV8A 2OYHC 3BH6B 4H44D 3BASA 1O5JA 1S2EA 4WXWA 1XN9A 3H5XA 4CTAB 1K44A 3QAUA 4ZJQA 1X0FA 2WVDA 3OLAA 3Q5SA 1LNQA 5D4PA 2H65B 3PW0A 1KN7A 1MMNA 2D9PA 5AE2A 4DG1A 4FS1A 1GEHA 5THWA 3HHLD 3OJSA 1NKNA 4JI7F 1T3JA 1JY3N 4TXSA 3MTUE 4ETZA 1RTHB 2ZWPA 1X8DA 4TKTA 3ETOA 3BREA 2HQIA 3S7RA 5I4MA 5KFPA 5TJHA 2MQLA 4V19X 1KZUB 1AVOA 1N5QA 3OW2O 5IFMA 3PO4A 2RDIA 3CCLP 1S0NA 3CCWA 1FKPB 2XG8A 1SJ4P 1KQSR 4NLYA 3R9LA 2J8AA 3OPKA 3R7NB 3V5BA 1JEKA 4M5LA 1I94F 3OJAB 1V5VA 3HHNB 4L76A 1B70B 4MKBA 5BYSA 3L73J 4DQSA 1FRHA 1RE4C 2WSFC 5AW9B 2BXJA 2HRUA 1CI6A 4ZPWR 1V3RA 3TQ1A 4U8VA 1EZVG 1BCCD 1NTZJ 4ED6A 2R2SA 3HDSA 4LR8A 2JDIH 1RZMA 4HYKA 4MN4C 2HWIA 4CI0B 4OX8A 2QIWA 2VQEF 3TZYA 2ATLA 2Z2LA 3AA9A 4DL6A 4DLGA 4J9UE 5IM0A 1S4XA 2JX2A 4ZCKA 4X4OA 1Y9OA 2M8HA 2M4MA 2XI3A 4K0KF 2VD3A 2BASA 1A02F 2OEKA 3NOCA 3I4HX 3V6IA 1AUDA 5AVRB 2ZJRQ 2GGPB 2HSEB 3CDWA 1ZZFA 3HE4B 5APSA 1QD1A 3NGKA 1Y9BA 3RK2C 1T05A 3PW7A 3CWBG 4UB8H 3ZZUA 4LSNB 4L74A 3IRWP 1RQ0A 1R8CA 4ZVSB 2R7XA 1A6LA 1BWVA 3D9BA 2BVZA 3FEYB 4DMZA 2QL5B 5SUHA 3HHEA 1KTQA 2HFNA 3UDCA 3T1HF 2BJ8A 1NRKA 2KK7A 1RAOA 2DR9A 2E1MC 1N32F 1HR0J 4PV1D 1DTQA 3D1QA 4ZN1A 3L72E 2CPZA 4RR5A 4B17A 1SBRA 1TKZA 1TR0A 1WHXA 4F0HA 4LFCF 2DNGA 3AT1B 2BEZF 3LQVA 3OUYA 3FEXB 2WK4A 3CCVP 1J5EJ 1DBDA 3C8YA 3HSDA 3EWKA 2W90A 1H98A 1I6JA 2WSEH 1J5OA 1VLYA 1G2EA 2RU3A 2XSFA 1PGQA 3JCUH 3B4DA 2VICA 1SQXE 1RAGB 2W25A 2BW7A 4CO2A 2XULA 2K1AA 2O01H 4IQXA 1I5OB 2KYZA 1RKIA 5IQQA 3HD7C 3RK3D 2OIHA 3R5GA 1XNRJ 3BDPA 3PYEA 4DV2J 1YX2A 1X60A 1HNIA 1RAIB 2FYUJ 4YDDB 3RRHA 3DXSX 4PPDA 3SFGA 1VLOA 3K8WA 3CJQA 2G0JA 1QSSA 5F8MA 5B0AA 2FZKB 2ZE2B 1RQVA 5KFCA 4M5GA 3G87A 1JLQB 1KYOE 1RHKB 3T9NA 1L4AD 1IKXA 1TK8A 4Q5VA 3GIMA 1ZM2A 4TVAB 3OR1B 1RTZA 4EUVA 4IL6X 1T3UA 1P1LA 3C16B 1PO6A 2DRDA 3NS6A 2CKWA 2AQ4A 1VL2A 3EQ2A 3Q8RB 4JBZA 3N6NA 3IGNA 3R2CJ 2E7VA 3IS9B 2P5VA 3BN7A 2MZRA 3BCCG 3K5MA 1K05A 4C7NB 2VU5A 3D68A 3ISNC 1SPBP 4K4UA 4ANEA 1M90T 3HKWA 3PJ9A 5F8GA 2PN6A 5EUHA 3CCMP 1UJ5A 2FZGB 2QJYB 2YPZA 3C66A 4K0KJ 2ZBQA 4C11A 5ETSA 5JVHQ 2WONB 4ILMA 1X4EA 5D8HB 4TY8A 4DX7A 4J9MA 4EYIB 1U0SA 3C2PA 3VAGA 4Z7CA 1VQKS 3DI6A 2IJNA 5GMKa 1Q0NA 2WMMA 3PNIA 1E5WA 5L46A 4H0LB 1RK8A 2GAHC 2HZCA 4Q8FA 4P2MA 3JCUE 3QGGA 4DR3F 4J9KA 3CC4P 3M8SA 3TI0A 1PP9J 4FYDA 2XHWA 4DPOA 2MJZA 3UDLA 1NDKA 4K7QA 4ED5A 2FLOA 1NK5A 1N0VC 1S6QA 3BR9A 1C4CA 1P9QC 4USWA 5I3UA 1XTZA 3KLVA 1GDTA 4GOFA 6AT1B 1C2PA 1FDNA 2QLFB 3I6PA 2A3JA 3PXGa 5I3UB 2M7SA 3H1IE 3QT8A 4KIAA 1OY6A 2CWXA 4CLPA 4MK9A 4CM0A 3NMAA 3B5NC 3TAPA 4I56A 1N7LA 1T6AA 2GHWA 1PPJG 3E1RA 2JLGA 3BSOA 2JO1A 3U1MA 2Z56B 4OX7A 1TUWA 5KOXA 2B9XA 1SKRA 5KG4A 3TJAA 2A0FB 4L75A 2Z2YB 2GNKA 2Z2MA 3CJKB 1RT6A 2EVZA 4FNHA 1WC0A 2NXJA 2ROGA 1JMMA 3JTPA 5GAEU 4PWDB 1KHVA 1T2KC 2CQDA 2D9OA 3GFZA 3CI9A 2WONA 4V1Ak 1G2CA 1FRKA 2I0XA 4LR9A 1BLUA 3SZ2A 2RHSB 4R8UB 4QJVA 1SJFA 4X4SA 1WDDA 1IBKJ 2DNMA 3OTCA 1D0EA 1BQMB 4LF5F 5AXNA 2RB7A 3MMBA 4DEZA 6FD1A 1BSHA 5H1SV 2F9JA 3QIDA 2EFNA 3T1YF 4HT5A 4DL2A 1KVJA 4B3RJ 2J7KA 2WCXA 2QA1A 3HSZA 2CIMA 2XV5A 3W8PA 1N5SA 3LALA 1IQTA 2OD4A 1CBKA 1U7LA 2PEBA 3QFWA 1EP4B 1FDBA 2LKZA 1GQEA 4NLRA 2PMWA 3DOKB 4N56A 1IVZA 1Y00A 3KG1A 1Q7LB 3FVYA 1SI9A 4EI2A 3MUVP 3DCAA 1P6TA 4NLQA 2O3JA 2N3LA 5K8NA 1T03A 3H1KG 4DPUA 3EYZA 2UU9F 1DQ8A 2WPSA 4IFDK 5LOQA 3P8CD 2LP4A 3BO3A 4Y99B 1QAYA 4PWWA 1TL4A 1FKAF 2W24A 2W9BA 4TLRA 1D9DA 1V9OA 1JTHA 2XS7A 2UWJE 2XCAA 2OLWA 1VQ9P 2VQEJ 4ZPDA 2V9WA 1NSKL 3KHGA 1LK7A 2KH9A 3EE3A 3M8PA 4RPFA 1NNDA 5HROB 4ZLPA 5KFSA 3OSPA 3DRRA 5KFAA 1S6OA 1GAOA 2CVIA 2CAJA 2IYGA 2OEJA 4PEOA 2P1JA 3TX8A 1JCCA 2ADCA 2R4FA 2XZTB 1U1MA 3NWRA 4GRSA 3JYTB 4YHHF 4F3QA 2G1HA 4X4NA 2JLFA 1V5IB 3CJ4A 2QTWA 1YVFA 3H32B 1SQPE 1VI7A 1ELOA 2HHQA 2XBPA 4Z37A 1JMTA 4ECYA 1RJJA 2X7IA 2P58A 3HT3A 3H1LD 3DRPB 1NUEA 1S4FA 4D6TG 3E01A 4OI2A 3SIPB 4RUBA 3MZIA 1LWEA 2NQPA 1F6TA 3H32A 3SBMA 2C2OB 1VQNS 3OR2B 3HZGA 2K1RB 3FFIB 2O66A 1IFDA 3K8VA 5H2FH 3RB6A 4KGVB 2WVFA 2DXFA 1IXKA 3DRSB 2BA9A 4QIWD 2FFDB 2LYVA 2B4UA 1HNZF 1TUGB 1FOSE 4WP8A 3RTVA 3Q8UA 1HW8A 1XERA 1F1BB 2HG5D 1HNXJ 4FZVA 2J7WA 2E5YA 2V9KA 2B9WA 2HAFA 4PABA 1S0VA 4O4GA 3CSKA 3KLIB 1FT8A 3CLQA 4LF9J 3CXHH 3SSQA 4DV4J 4WJBA 3KHLA 2YKMA 2JEGA 2DGUA 4N77A 1UMJA 4PJ0E 2Z4EA 3BN4A 2R2UA 1BD6A 4PV1C 1EHWA 4LQ3A 2ZBPA 2C9NY 1L0LJ 1LTTC 4LF4F 2E7XA 1HFEL 1DAXA 3U02A 2I8EA 1NXIA 2HEKA 2WT7B 3DU5A 5J2NB 2IX7C 3JTNA 1L0LE 2ZFCA 4DG1B 1IUJA 1YTYA 1PKUA 4H4OA 1T0TV 2V6AA 1U1KA 2W83C 2H5EA 2CG4A 2Y0EA 4RZRA 4NCGA 2QG9B 1S1VB 1S6PA 4LRDA 4OZ5A 2OTJS 5IV3A 1OVRA 1J1DC 1FFWB 2HWHA 1P84E 2IM3A 2KXFA 2Q7CA 3L4BC 1NTMD 2B9YA 5HVFA 3D4JA 3CD6P 1MN9A 3DOLB 5D3GA 4DPWA 4GC7A 2ZHBA 2P2CB 2HLTA 2B43A 4LF5J 3HUSA 4DV3F 2MKIA 2KYVA 3TOQA 3OL6A 5L1JA 1UZDA 2ZM6F 1P84H 2E1AA 4WXOA 1RF1A 3T1YJ 1M1JB 1SQQJ 4XO0A 1TK5A 1QAXA 4UY8T 2AW0A 2E75C 2CPSA 4MIAA 1SFCD 2OYHB 4NCBA 3GF7A 1EZVI 1C0TA 1LW2A 1OWXA 2Q1LA 4QYRA 5HROA 1PJ7A 1YBKA 4DUYJ 1IKVA 5GAGU 1N33F 3H20A 4EFAC 2I2YA 4D6TE 3AECC 3DLKA 1HI1A 1MG7A 2FYZA 2K2PA 1S77D 3LOUA 3L95X 2B7CB 1R0CB 4PWUA 1ITPA 1I3OB 3DRYA 4GVBB 2OPSB 4EO8A 2HW3A 2D1CA 1LWUC 4DX8H 2ASLA 2HKEA 1F2GA 1X5SA 3KUEA 2JFKA 2IRYA 2P9CA 3DLEB 4IG3A 2PGDA 3VMYA 1H0HB 4XDDA 4DR6J 5J1EB 5DZ6A 3L71D 4WYWA 4NMXA 3IBWA 4FF4A 3PACA 1B0PA 2WSCC 3WC2A 4UOHA 4K5SA 3OXGA 1FDAA 2FXMA 1RABB 3A0HE 1RSCA 3BSCA 2G13A 2JC0A 4WBAA 5LSRA 4W7ZA 2W9CA 1ZAXA 1SCJB 4DUZJ 3AEEC 1TU3F 3M9OB 5HMYA 3AEAC 1CC8A 4O0IA 4DV0J 4OZ0A 5HP1A 3MIWA 5C24B 3UIAA 4OX9F 3BCCE 1FJGF 4S0MA 2FGOA 1S72P 1RAFB 3G96A 1HBUA 1WC5A 2LQ9A 3MCMA 2CPIA 2XB2D 5KAKA 3MEDA 1GXTA 1ZBTA 3ZTRA 1FTCA 3RR7A 3NNAA 2XMJA 3FSXA 5AVYB 4QYZK 3L74G 2DGWA 2HQ3A 1G2CB 1RCXB 5KFHA 3CC7P 3IRXA 5LSLA 4H13B 3PJWA 1X31C 4PWDA 3AE1C 1EC5A 4K4XA 5CZXA 4RW9A 2CNLB 1N8RQ 2C22A 4QQBA 1NU1D 3FUYA 4UTGA 4WWIA 4ZVHA 2ZUAA 2MLXA 1OWAA 3BGRB 2DRAA 2CZ4A 1TKDA 2Y0SD 3K17A 4C0OC 1JB0C 5KG3A 4YB5A 1RBAA 3I32A 5KT2A 1JOCA 1I94J 2GHVC 1T3NA 1FWPA 2M3DA 1L4AB 3TNUB 3TYYA 5J1EA 2KVIA 4Y6IA 5LXRA 5AW8B 1NK8A 1MKMA 1X9VA 4IYQA 1VGYA 1JLFB 1ZS6A 5KFRA 1N88A 3V6KA 3QLHA 5DO2A 1NAFA 2YH1A 1W2BO 2D41A 3H1HG 3NMRA 2XWYA 1K1SA 4NL5A 4DFPA 3Q89A 4EWTA 2FYXA 2LQJA 2J9DA 1U26A 2GHPA 2BR0A 2B87B 3UR0A 2M0BA 4NX9A 1CEZA 1QL2A 5L1KA 2GVZA 2VQFF 4PAAA 3LPYA 4K4SA 3DRXA 4PQUA 4ZMDA 4PD4D 3C14A 1KNZA 1S49A 3D3CJ 3DI6B 4TU7A 2OQQA 1DEBA 3AXKA 3HSGA 3BO2A 3J7YU 1K0TA 4URQU 3L71J 2A6OA 2H5JB 4F4YA 1RWXB 1C1BA 3CCJS 1QL1A 1OW8A 2DO4A 1TUVA 2KHDA 2GAGC 3SQGB 3SFDC 4J9NA 2BX6A 2XDJA 3CCEP 3THPA 1VQKP 2VFTA 4LT6A 4C8MA 1N7SB 2N4CA 3VV2B 2IFXA 3CCZA 2R32A 3GHGC 3MPUB 2GZOA 3HE4A 2DHAA 1EX8A 3KMQA 3C16A 4ED3A 1NTZD 1HNXF 2LFVA 3BR8A 4ZPAA 5HLFA 5BVZA 2D69A 3NGDA 2A2CA 4LR7A 4X64F 2RS8A 3M9NB 4NLOA 5HL7Q 1G1JA 4CNZA 4ED1A 1OY9A 2VG6A 2ACYA 3BS9A 3LH2S 1X5PA 1SJRA 3DHWC 4IFVA 2VBZA 5HATA 1H2TZ 1YITS 2MKKA 4B9UA 5AVVB 4ZS6A 4IKAA 3RK2D 4DUYF 4DV2F 1URQA 2PGCA 3SSSA 1U6BA 2H48B 3HMJG 1NJYA 1WSVA 5BJRA 2J9EA 3PKYA 2CDRB 2ZEJA 2GW8A 4PG7A 2C2RA 4A8XA 3MR3A 3MM5A 1U0HA 1YDLA 1EETB 5D0HA 4GKJJ 1SQQK 1LTAC 2MY7A 2OMLA 4NZ6A 1O51A 4JOUA 3VP9A 1YLXA 2PSZA 4QOTA 5CJ0A 3GCWP 1F9EB 4KT0J 2GA1A 3VAKA 2ZH2A 3IO1A 1WC4A 4YFUA 1T7PA 3AJ2A 5A0YA 5DZ7A 4RNHA 2V0NA 1YZ7A 2FGCA 2XGQA 1JLCB 2UVWA 5F9NA 4FNIA 2M5AA 2CDQA 1NTKJ 1CS4B 4RL1A 1R0BG 2OMOA 5CHXA 3W61A 1SC6A 1UWBB 3TR5A 1CJUA 4C98A 3B4MA 1DX7A 3UQSA 4JI7J 1VJWA 4C46A 5KLVK 1WRGA 1RT1B 3GFHA 1JM0A 4K2XA 1KN6A 5DQGA 4OYZA 2KM8B 3AB2B 5LMUF 2EW9A 3UE2A 3BPDA 3FBCA 1UA1A 1BGYD 2CQ0A 2QEXP 3HULA 2DGVA 2VONA 5G0RB 5ADZA 4J7CA 2AEMA 2BYCA 5K14A 3KFWX 2XMTA 4LF9F 1NSPA 2R7UA 4ES1A 2QX0A 2K9YA 1RT7B 2AU0A 2IRXA 1X9SA 2NXEA 1UETA 2DBBA 4F3MA 1M90Q 4U8YA 2M3EA 1GMWD 3N79A 2XM3A 1RT1A 3ZXWA 3L72J 1SQBJ 4PYAA 3M8YA 2B51A 1U02A 1UPPA 2HFUA 3EVOA 2UUWA 4RWXA 5LXYA 3GR1A 1UVMA 2J58A 3H42A 1KRPA 3M9BA 3T9ZA 3VTIA 2HFED 5AE1A 2AZ1A 1K0VA 3LGHA 3AEDC 4TYBA 1JO5A 4K5RA 2MJNA 1IBKF 4OV1A 5IV4A 3J7AN 1S9KD 5AW2B 3M8QA 2J6TA 1KORA 4OLPA 4OYOA 1F5BA 2M8RA 1K73T 3RK3B 2G8YA 1CJVA 5ETQA 2R8HA 2M5YA 4C3KA 1RE4A 2ASJA 1RYSA 1NJWA 2B4VA 1H7XA 3GYGA 2W2QP 5A2QU 2E74C 4ID5B 3QIPB 2BRKA 3ISZA 4X2BA 2F8EX 1UW4A 2O1KA 4LBHA 3ADAC 1HI8A 2LQBA 1PILA 1HGZA 2OFGX 1S9GB 3N9UC 5F0UA 1NKEA 2BJ9A 5KFKA 5E41A 3OHAA 2KB2A 3IF4A 1U6FA 1L5UA 4DSFA 1KV4A 2AEJA 4BRYB 3FGVA 1NU4A 3LP0A 3KK1B 2NXCA 2B5JB 1JIHA 2R3VA 2CJQA 5B5EH 4MK7A 4E0DA 1O0PA 5CBNA 1WD6A 2GIFA 4WFZA 1FZGA 2JZ5A 2ZT9C 2QGFB 1JJ2R 3KK3A 1TMMA 2COLA 2VG5A 1N6QB 2KVQE 4LF1A 3RK2B 4ELVA 1AV1A 3M06A 4R5PA 1VFJA 4KR0B 5TISE 3TQEA 3N7NA 3QSIA 2IAJB 3AY0A 3JTOA 4B9LA 3CB4A 1IJDB 3M8WA 3KJVB 1N5YA 4ILRA 4DR6F 2Z2ZA 4ZOSA 2B4OA 3G86A 3TUZC 2B6AB 2RVJA 3ZDMA 2DXEA 4YR2A 2QMXA 3ZTQA 3W65A 5APVA 1AA0A 2V7QJ 1LTJC 2VC0A 3US5A 1BGYJ 4PQAA 3T5LA 3I56S 3CCQP 3RGIA 1X4HA 2BRLA 2LKMA 2UXBF 5C42B 3HFKA 1HBUB 4ED0A 2PA8D 2RJZA 4LF6J 3F5HA 2W7AA 2V63A 1MN7A 1TFYA 3H1JD 4PYDA 1LTGC 3P7KA 3QT5A 5F3ZA 4KO0B 1KP6A 3AQOA 5M2PA 1TK0A 4I7FB 2QJPB 2F7VA 4ECSA 2BE2A 3PKMA 5HP1B 1B0TA 1LWXA 2FY8A 4F2RA 2DNHA 1RTDB 1BMQB 2ZC4A 4KGMA 2QO3A 3M6UA 4RUCA 4EYYQ 3KUHA 1EQMA 4I0WA 1S9GA 1S6UA 1OIPA 3KYQA 1SQXD 2ZOFA 1WTFA 3Q8SB 3IWLA 3T3FA 3M2UA 5J1NA 1QTMA 3Q8PB 1Q8LA 5I42A 2WB1D 3FCWA 1MU2A 3AQPA 2NXUA 3VGUA 3V6DA 2APOA 1KLMB 2RH0A 2IYPA 3M9QA 3DOMB 1ZA1B 2ZNYA 1HVVA 1CZQA 5CCGD 2HNYB 4YOEA 2CPYA 1H3DA 4WP9A 1NU1J 4OL8A 4CLLA 3UPFA 2FYUD 4GVBA 2JOQA 3BBFA 3RW7A 2BBEA 4DCJB 3B4SA 1U7MA 1KB9E 4PUOA 3OXFA 2UU9J 1VQYA 2ZH5A 4OV6A 5E3CA 4N3YB 4HEA9 1VDHA 2ZJPQ 2YBVA 2OARA 3BCCD 4C7NA 3B6BA 2R9LA 1SIWB 4DZDA 3RBXA 4IRKA 5LMUJ 1KB9I 1RXOB 4DZ6A 4N8NA 3W2VB 2QLBB 2N82B 4XE5B 2J7UA 2PMZD 2E7WA 4HI1A 2DHHA 1ICEB 1U25A 3AHPA 3TNVA 2BW2A 3H25A 1KSPA 1WKKA 3ITHA 4OHWA 8RUCA 3TGUD 2F8MA 4OZNA 4UT4A 3D2WA 5LT5A 3RAQA 5LMNF 3IAM9 4AYBD 4ECUA 2PO4A 2ZT9B 3T97B 3A8EA 1VC0A 1N34J 3DOLA 5ETVA 3RGUA 4WFNQ 3S1KA 1L0NK 3MCNA 3QPIA 2DCLA 3EMTA 2UUTA 4KE5A 4Q44A 4KB7A 1FXLA 1XNQF 1S9EB 1R43A 2V8VA 4MIBA 1KYOD 2WVRA 2IFMA 1UWBA 2PI4A 2BUNA 4FS2A 2XKMA 5L9XA 2ZBIA 2HQDA 2KT2A 3JAMU 4A8WA 5EGYA 3AD9C 2M5AB 5CBOA 2DTJA 2PD1A 5KKZB 4QW8A 4JI1J 2AGOA 4HLBA 2HPCB 1RT3B 2K3KA 4UUWA 2JKVA 1S9KE 1HWJA 4RKUC 4ZIVA 5AW1B 3JSMB 5KLVJ 3O44A 2FVCA 2ATCB 2BJ1A 2DRBA 3PTZA 4LBPA 2O3DA 2MQNA 4HTJA 3CCTA 2QC3A 1PPJD 1T95A 3EDRB 3GG1A 4ZHRB 1A7GE 2FUG9 3M4XA 1WOSA 3R5BA 2GMJA 2VA3A 2K9JB 3DLKB 2RAQA 3TX0A 5KLIB 2DY9A 4Q7AA 3VQTA 1W2IA 5DM7Q 3B54A 3KXDA 5DS7A 1GW4A 3NXSA 3RL0B 3IA0A 2OYIB 3HTKB 3GHGA 5DGBA 4USKA 5KFQA 2XZRA 3D71A 3I55P 4U96A 3MMCB 1X79B 2U1AA 1WHWA 3GQCA 5D0EA 2QFIA 4DJBA 1QVFO 1ZTWA 1WTBA 1L3SA 1VYAA 3Q2SC 2DGOA 3MEEB 2EFOA 1YGYA 4KV8A 3VCDA 5HLFB 3D3BJ 1OVUA 3CMEP 5D3GB 3OVSA 2UXCF 2C0XA 3K89A 1NTMK 2YXRB 5DDPC 2A06E 2OYOA 2N1TC 1LT9B 4YMEA 1EXJA 2OELA 5GMDA 2KS1A 1SQBG 4OZ3A 1N73C 4ZVUB 4R25A 5APUA 3K5OA 4JI0F 1NTMG 4DR5J 1ZH5A 2PC6A 4ZPCA 4DFKA 4KY3A 2JJ4D 4PD4H 3NLCA 2PFFB 4LIWA 3UNYA 2AP6A 3WHIA 5EWEA 4JF7A 1FXRA 3VMAA 4ZJLA 3VALA 2YWGA 3I56P 2KOGA 1QSYA 3VOPA 2WT7A 4LMZA 1BQNB 3L4FA 3CCJP 1VISA 1WF0A 3HHLB 3NAIA 1UFWA 3C46A 4B08A 2DEIA 3CPWO 4MKVA 3J81j 2K37A 4N76A 3JYTA 3R5CA 4TQRA 1RHRB 1M0SA 3JB9k 1VPCA 1LKZA 2MPUA 2M0GB 4J9SA 2HFVA 1ZM3A 3A3PB 1U1PA 1FDIA 1W2EA 1GT8A 2A45I 2W2OP 4OZJA 3FX0A 3RG6A 1K73Q 1J2JB 3M8PB 1OS5A 3OFHA 2EFQA 4NYOA 4C3LA 2QA4G 1KILB 3M32B 2Y1LB 2P67A 3W9JA 5AVWB 4A8YA 1YRXA 4YP3A 1IWGA 4R0JA 1IFMA 4OJHA 3PZPA 2DVIA 1GL2C 1V6HA 3HUSC 2F4VJ 2O1JA 1SJQA 3JQKA 3DC2A 3IC1A 2RQ4A 2JH3A 2VOPA 2OPQA 1FZFA 2KI7B 1SB6A 1LEOA 3FXEA 1MWZA 2J5AA 2M8DB 1TELA 3KLGB 4F36A 4H13D 4EIJA 2JEJA 2E74D 1MUUA 1P84D 3MD0A 4IO9Q 3G6XA 3DOKA 3AE2C 4ERDA 3LP2A 4JV1A 1VF5C 2DH8A 3C6TB 4FYYB 1BDCA 2PDAA 1N32J 1MFZA 1LWEB 2HLOA 2WBMA 5A8KB 3L75J 2V4RA 2E9ZA 2V4HA 2C2NA 2NSCA 1UVIA 4H44B 1KQLA 2V50A 4DPXA 1SQVE 4FBTA 3WDOA 4CQ1A 1S0OA 4FPRA 2B89A 2RSQA 2V8DA 2ALYB 2AHOB 4W7YA 2HNDA 3PX4A 3ICLA 4IR9A 3QQCD 3V81A 3KJQB 2YMYA 2GIRA 3M9MB 1NJXA 3H1JJ 1MW7A 2ZYAA 4X66J 4WIIA 2R8GA 4ZN3A 4NLPA 4IG0B 1Z2ZA 2RRNA 3A12A 2E5GA 1UIXA 4NEZA 1WJ9A 4WIQA 4CO5A 1I51B 1NO4A 4USTA 2JL9A 1R8HA 3PX6A 2H8PD 4R4MA 3O3LA 1HBOB 5KFTA 2P9EA 3H5YA 1T9YA 3HF5A 4RUAA 2GIQA 1HBNA 3EICA 2WSCJ 1X5TA 3CXHI 2V4JA 3TEHB 4Q43A 5C2CA 1R0AB 3V6JA 2NS1B 2W1BA 1EDLA 2KXHA 1M7LA 3QLHB 4WCEQ 4DL4A 3SFEC 1KVIA 4PV1B 5KT7A 3CMAP 3R5AA 2HYNA 2BM0A 3HJVA 4RU9A 3J7YI 2MQ8A 4J90A 4AFFA 3V6DB 4N41A 2W6BA 1FE4A 5ETTA 3VAIA 2HHHJ 5I42B 5HK4A 1F9HA 4LSLA 3CDEA 4X65F 4NZ7A 3X3UA 3TAMB 2CXEA 3TUIC 5LJ3Y 3UN3A 1F9FA 1SQVJ 8ATCB 2NSBA 2OPSA 3SCLE 4HL9A 5F8LA 3BGRA 2VODA 4EMDA 5HBMB 3RBEA 4RW9B 4ZVTB 4WBFA 2GCFA 4OI4A 3RB0A 4G6VB 1OFCX 1SLQA 2KIKA 2FLNA 2V4JB 1KC8T 2BE2B 2YX4A 1HBNB 1WHVA 1PC4A 1VRUA 1LW2B 3K2YA 2C0WA 4FF2A 3BBCA 2XCPA 2FVQA 1FFGB 2XMKA 3J7Z5 4HACB 4ZP9A 1VR6A 4IG0A 4Y2MA 5APYA 1UVKA 1M5OC 2ASYA 4PXDA 1YJWP 5GTIE 4CLTA 3WX8A 3CMES 3I0RB 3HUSB 4OHYA 2MKJA 1FWKA 5DJTB 3LIDA 4MIWA 2J6UA 4RW6B 3QWOC 4WU3A 6FDRA 2VDHA 4ES2A 2HLUA 3QT6A 2RIJA 1U2CA 3L75E 3GYXB 1IN0A 3B8EB 2R2TA 4DR1J 2WITA 2DK2A 3KMSA 2B6AA 4FF3A 1RT5A 2GQQA 4HH0A 4DR4J 3CW2C 5D4NA 4C8OA 2G1DA 4GMKA 3J7ZT 3CDAA 3KTQA 2KYXA 1S6PB 3LP2B 2IAJA 1OW6A 4KAIA 2AX0A 2X1GA 1BQXA 5KG2A 4OJ1A 2OTLP 2OHDA 2VPYB 2J0WA 3H1LE 1HNVB 3Q8QB 2DPJA 5AW0B 1AQTA 3H2UB 3KK3B 3DGVA 4JI5J 3CULA 2LVWA 4X62F 2QA4P 4M3LA 1R89A 2KZZA 3QFHA 4D3GA 5HVHA 1RU1A 3T6BA 4I6WA 3LP0B 3AAWB 5BXIA 2P8IA 2D3UA 3DU6A 4C0HA 2E66A 1YQHA 2MKCA 2VB6A 1JY2N 2A2DA 5TISH 1S1UB 3SI8A 2IBZD 4R4LA 2IMWP 4NA3A 4WE1A 2WVEA 2JWDA 5ETKA 1FERA 4IFYA 2CPFA 1H73A 2E5LF 1R0AA 5KTQA 2YKNA 1NB2A 2VASA 4ZVEA 3OVAA 2V8PA 1URQD 3OTBA 3MD1A 2HHHF 5HMWA 4TY9A 3QWUA 3PLNA 4P10A 1W25A 2G2OA 3CT9A 5KFJA 4B9NA 4MT1A 3VAJA 3Q8VA 2JWNA 4A7PA 2ZKTA 1H38A 1VQMP 3P4UB 4M63A 2CPBA 4QR0A 4UOFA 4DSEA 3M6VA 3CD7A 2LDYA 5H9EK 4QWAA 4KHPF 1N2DC 5GAGI 3RU0A 2HNDB 4J9RA 1Q8IA 1Z4UA 2BQRA 3E01B 3EGVA 5B66H 3P32A 1TZ0A 3OR1A 2FDNA 1GW3A 3M30A 2WAQD 1AFOA 4LFAF 1M1KQ 3HE5B 1H6KX 3BQ0A 3LW5H 3UN2A 4RWWA 1NPRA 2QYGA 4DX6A 4Y0FA 4KPCA 1N36J 4DR2F 4OI3A 4U6PA 3CDUA 1L3TA 3MEEA 1WI6A 5E79H 3QMQA 1IJEB 3CCVS 3CXCR 2CQ3A 1FAVA 3FCVA 2WPRA 1FC2C 2K7KA 4QR1A 4UQGA 1HBMA 5A8RB 2V2QA 3WUVA 1RF0A 3MMCA 1T9TA 4LF4J 3FRYA 1IR0A 3ABVC 1VQMS 3JC22 2X1FA 3M2VB 3PEHA 5F0WA 2QVAA 4LF7F 3H40A 5KFIA 5AVXB 4NA1A 3T41A 3CCUP 3L7OA 1YK9A 3LTOA 4HHUA 1CI6B 2Y9HA 1RISA 1PL5A 4ZHRA 3DDIA 5KLVG 2GJIA 2ZDOA 4AT1B 1WDTA 4USUA 3IWNC 2Y8YA 2W9BB 7AT1B 4ETXA 4YR3A 1LW0A 3J80Y 3HD7B 4P7TA 4YXDC 1R8BA 4DPYA 4OZLA 3HD1A 3HX9A 1YYCA 4WFBQ 4FKYA 3BJYA 1FOSF 5GADI 2E76B 1J1EB 5KTBA 4KRWA 3SWKA 1SQVG 1KFNA 1M5KC 3N4XA 2JP3A 2EC0A 2H88C 3ET6A 1M5VC 3PR4A 4IOBA 1UCNA 3DRPA 1N56A 3D0HE 3M2RB 3FBFA 2NPSC 4IFVB 4KGKA 4EEYA 1LWFA 1BDDA 1S5LX 1NM2A 3LA0A 2XLKA 3SWYA 3B5NB 4WVZA 1JWWA 2DNKA 5HN0A 1BSNA 2KG0A 4ECZA 5ETMA 2EPIA 3M0AA 1OPIA 4G3IA 2VPWB 3OL7A 2CQGA 3RAMA 2KXPB 3D7SB 1ZZNA 4C48A 2E5TA 1ZR2A 2UXBJ 2QE7H 3OQ2A 4QPTA 2EC2A 2ADBA 3UD5A 3ZTPA 1W5CE 2VC1A 3FSYA 4JYAF 1IBLJ 2XO6A 1OPZA 2OFHX 4L72B 1WWHA 1JTHB 2ZJSE 5K8MA 1H74A 1NKCA 4WY4D 3OXLA 2HMIB 3FBBA 2D74B 2OUGA 3G4SS 2AJ0A 3A0BE 3H1JG 2WBRA 3MD3A 3K5BA 3PW5A 2NREA 2FPHX 1U8SA 4CLZA 2MHNA 1SUQA 4GO5X 5C39A 5DG8A 2RUSA 3OTDA 1S72S 1EQ7A 2H9ZA 1SV5B 4M5KA 1EARA 2KB7P 1VQPS 1WMKA 2AV5A 3MAAB 2M52A 1YSJA 4ICLA 1DEEG 1PPJE 1RWUA 1MMLA 2VUGA 5CYMA 4KHPJ 3IMQJ 1GTWA 1U49A 4W90B 3Q0AA 3DHXA 3THTA 2OPRB 5LMNJ 1OW7A 3KHUA 2V68A 4MMOA 5A76A 2YQ3A 1SQGA 1J1DB 4RU2A 3RL0C 2VHGA 5M1BA 4OHZA 4WP3A 2QM8A 1UVNA 4QMAA 3MF5A 1FWLA 2BJDA 4JYBA 2ZC3A 3J7A1 3CCRS 1X0TA 4DCPB 5KJ7C 1NDCA 3HT0A 1HWLA 1VQ7P 1CG2A 1NVOA 1SQXG 2ZITA 3H1KJ 2PP6A 3LO3A 1XNRF 1N54B 2F1FA 3NGSA 5KT5A 2EK1A 1WELA 3F0NA 4CM2A 4I6AA 1JCDA 3CJKA 3OBIA 3VGTA 3G6EP 4CDIA 2I1KA 4I68A 4C3MA 2RUGA 1PFIA 4KBIA 2DO0A 1N36F 1Q81T 4FVMA 1ZA2B 1XC9A 4ZKAA 4M95A 4JBCA 5HBMA 4UZCA 3QATA 4M94A 4OHXA 3CO0P 4PXCA 4DF8A 3X1LB 4CYUB 4X66F 3OHBA 1TV6A 3A5TA 1HNIB 4QU6A 4WFAQ 4FXVA 3QJJA 4V19J 1KS2A 2LU2A 4C7RA 3WIUA 2AMCB 2AEFA 5E2QA 2E42A 3L73D 3Q3DA 4RESB 3H2VE 2V69A 3USSA 4Y99C 2XQCA 4ASWA 5HQ8A 1K1QA 2BQUA 2KLVA 1D3WA 3FMBA 3QIPA 3CX5I 1KTVA 2BKNA 4DL7A 3VVUA 2Z8QA 3MPWA 3MI7X 2O67A 2JFDA 5B0FA 4YR0A 3UR3C 1WSRA 2Y1JA 5CYQB 2QA4S 4MKYA 2Y1IA 5E0OA 3E3XA 3IAS9 5H2FE 3O6QA 4P71A 4Q8EA 4CO4A 1SC3B 1IKYB 2VPXB 4Y3CA 4GKKF 1NH4A 2LEAA 2W8LA 1RY3A 2XYPB 3MOJB 1SC4B 2DYAA 3G4SP 3EZ5A 3T5KA 4X62J 1AROP 3IS9A 2VKZG 4LF8J 4ZCIA 2HGLA 2W8KA 5E79E 1PGPA 3E1IA 2AYEA 2LU1A 3PW2A 3N28A 2R7SA 4DS5A 4C8LA 3KQGA 4FXWA 3DN9A 1S1CX 4CWBA 1OX3A 2HGNA 2D3O1 3UVJA 5CCMA 4FP9A 5CCHD 4ZP8A 2RS2A 5APXA 3C6TA 1URQC 5G0RA 2I5JA 3W5ZA 7FDRA 3IGVA 3Q24A 2C3MA 2JC1A 5D78A 3QNWB 4JV2A 2FC9A 1FJKA 1R3NA 5BYRA 3CCUS 2MZ1A 4M5DA 5GVQA 4JI3F 5A2QY 5KAFH 3C9IA 2QYCA 3UO0A 4NASA 2M9KA 2YWHA 1S1XA 3Q2YA 2AZ3A 4H4OB 2VQFJ 3BGUA 2DEJA 3WX4A 3AJ1A 3TJ8A 3M8ZA 4H0LC 2MJUA 2CQHA 4HDHA 4RNOA 1HWTC 2NUHA 1D9FA 4IFMA 3I87A 2FJVA 4UB8E 5GMEA 5KLVE 2QMWA 4KSEB 1S12A 2ZDPA 2ZH9A 2K06A 1QDUB 1HNWJ 2MLYA 4OJ3A 1C1CA 1AA1B 1U1NA 2MKSA 2R7QA 1G6BA 3QH9A 4Q0BB 4B3SF 2VPZB 4JI5F 3L75G 1YJUA 1ACMB 4KJMA 4P75A 5HJYA 1YJNS 2X1BA 2HZAA 1H2VZ 3NXZA 2L08A 2DHXA 2HYIB 3L37A 3QAEA 4K3AA 2C9LY 2VFVA 5F3TA 5B08A 2FY1A 2DNNA 3GLMA 4EOTA 4JI0J 3ZZPA 1DH3A 2GV1A 2FJAB 4X4RA 3BSAA 2PT0A 2Q66A 4QR2A 1QLNA 5GTHE 2QJ3A 4CRJA 4ZCMA 2FFDA 2NUUG 3G6YA 2JR8A 2UXDJ 3AD7C 3R1LA 1PYOB 3NG8A 1UVJA 2JHEA 3ITKA 2A1BA 3NGTA 4NEYA 2C2EA 1KQFB 1T11A 3FFIA 2MZJA 4KV8B 4O3QA 3IAOA 4JI4F 2RRAA 4HI2A 1T9XA 2WQYC 3A7OA 3PR5B 3M8RA 2UV8A 2VJVA 4BBYA 1JY3O 4DXLA 1SQPG 1S97A 1LTJA 3ELHA 3F89A 3AE9C 2C2ZB 2YVSA 2GUSA 1Y7PA 2AJ2A 1RLDA 1YRUA 4W92B 4ZVGA 4F0KA 4PPZA 1G1IA 5B0GA 1FKPA 4RJTA 1TMJA 3L74D 5HQMA 2NZ4A 2K7JA 4KPYA 1PYTA 2RQKA 2I6WA 1LWCA 5L1LA 1OY8A 3DRRB 1BE3E 5AVSB 5A0YB 3V2PA 1HTLC 2Z4PA 5D6GA 2AYMA 3KLHA 2MXYA 2YO2A 1CPZA 1VS3A 1M5PC 2QSFA 4CT8A 3T1AA 1SC1B 1VQ4P 2DJWA 4J9QA 2LXFA 2DNRA 1WF1A 2OPPA 4DOZA 2OYIC 1IC2A 3U1LA 3GCXP 1PC5A 4NI2B 2DIVA 3DGPA 1HYSA 1BC6A 4F8RA 1VMBA 3P49B 1F0XA 1U0HB 2WW4A 1QVGO 4CO3A 3KZIH 4NMLA 2YNYA 1DTTA 2QLJB 2ZVOB 3TNUA 3FZ2A 1FJGJ 2I9SA 1L4AA 1K47A 4DV6F 2XSJB 2SPZA 3RL0g 1RACB 2FTRA 2KM8C 2DNLA 2IZ0A 4ECVA 4CO1A 3VAMA 1FBMA 3FQLA 1LK5A 1X9MA 3CJSA 5F41A 4RUHA 1KQKA 1UPMB 5K5GB 1L3VA 2P2UA 1RCOB 4K4TA 1YI2S 4DQIA 4TU9A 4J5OA 2V5HG 1GMVA 2HZVA 1RP5A 1SQQG 3UDEA 3IRXB 3I9V9 4AXIA 2VL1A 3Q5PA 3W2VA 1PG5B 4ID8A 1SL2A 2LMIA 2CPEA 1IBMJ 1KYOI 2Q43A 4M5JA 3NEKA 1KILE 4H44C 3EUNA 2ZHAA 3K57A 3CDBA 1G1XA 3HPOA 4KGXB 3EPGA 2ZWOA 2QRRA 5D0GA 2UUBJ 4L3KA 4C8NA 2V2VA 3RL0D 1HNWF 4CLYA 4DF4A 1UEKA 4ITSA 2BACA 5K8PA 4B86A 2QL9B 4USHA 3FXDA 5U47A 3FDSA 1IM4A 1SQQD 3N6LA 3DMJB 2GFFA 4U7JA 5KJ7D 3EGWB 1QE1B 1J27A 2GMHA 1U48A 2HG4A 2E9RX 4LFAJ 3F44A 2I1RA 1S99A 2QSIA 2R42A 2H54B 2YNIB 2V4QA 3GV8B 3R4YA 4LSZB 5B0BA 1CJTA 2IPOB 3KYLA 4OWFA 2JEIA 4RNFA 2GQCA 3W63A 4A8SA 2AWZA 3HRNA 2BJ3A 1SQBK 2DD8S 1AFIA 3RB3A 2YO3A 1LGHB 4F26A 2FHJA 2HQFA 2QJKC 5D77A 3S4RA 2J0SD 2IBZI 2UVVA 2HGMA 2W2NP 3DLEA 4ECQA 3PTWA 4D3HA 1C4AA 3Q83A 2NR0A 3TO8A 4I7FA 2MGZB 1AT1B 3PW4A 3LGNA 2QEXS 2JVRA 1OIAA 3GV5B 1N86A 1ZPWX 2XYHB 4QIVA 1LTBC 3QRRA 4WB4A 2Z58B 4AUWA 2E5LJ 3SQOP 4QZVB 1RKJA 1WF2A 1TTHB 2KFNA 4RX6A 1HJBA 1NK9A 3FWNA 4QU7A 2DXDA 2VRSA 3VVTA 4NZ0A 1SL0A 2OKQA 1NKZB 4DU7A 5IT4A 1JB0J 2RN0A 5M2RA 3PCOB 3V4IA 4I69A 4ZVFA 2AD9A 4B9SA 3MUMP 1NZAA 2RILA 3JS9A 1U8WA 5T14A 2VDIA 5AT1B 2CJAA 1X4GA 2FIUA 4LRBA 1A02J 1AZSA 2PE8A 2GA7A 2KDOA 1FZCA 3ZZ0A 5JJBA 3MFHA 2D3ZA 8AT1B 4HT7A 4WZMA 5A6WA 2E1PA 2JSXA 2GJ2A 1SQBE 2W6AA 2ZVIA 1ZR4A 3DM2B 3W2WA 3SDEA 1Y10A 1CVJA 2HK2A 4X84A
chains in the Genus database with same CATH topology
1Q79A 1IKXB 1S1TB 3QPIA 3RYLA 2DCLA 4K4WA 4H44D 2UUTA 4H4MA 4KE5A 2POKA 2CQBA 1UAWA 2O5DA 2VG5B 1O5JA 4Q44A 4WXWA 2ASDA 1XN9A 1X0PA 2GO9A 4KB7A 3H5XA 2L9NA 4J37A 1FXLA 2E1RA 4CTAB 1XNQF 3QAUA 1S0MA 1S9EB 1X0FA 1HA1A 1R43A 3C8VA 2EWHA 2V8VA 4MIBA 1C0UA 4KFBA 3OLAA 4ECRA 3Q5SA 2MKHA 2DHSA 3GF3A 5D4PA 3AEGC 4YTPC 1UWBA 4J9OA 3KHRA 2PI4A 3P3DA 3PW0A 1NB7A 2BUNA 1H7WA 4NLDA 3HM9A 3BSNA 4F25A 4FS2A 2ALZA 1F5AA 1MMNA 5JXSA 5L9XA 3TUJC 5DLGA