3O6QA

The structure of spoiisa and spoiisb, a toxin - antitoxin system
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
145
structure length
145
Chain Sequence
TDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASLCHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stage II sporulation protein SA
publication title The structure and interactions of SpoIISA and SpoIISB, a toxin-antitoxin system in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Toxin/antitoxin
total genus 51
structure length 145
sequence length 145
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3o6qA01
3.30.70.2720 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3o6qA02
3H25A 3EWKA 1ZMEC 1FDOA 2P10A 2G8YA 1AJYA 1FDIA 1OMIA 1WMKA 3O6QA 3IN6A
chains in the Genus database with same CATH superfamily
2ACMA 1P84H 3UDCA 2YH0A 2UUCF 2QYCA 3D1QA 1IBKJ 2F3JA 3PW7A 3F56A 3BO4A 3D6ZA 3IR9A 1IBCB 1NU1E 3B6BA 4USKA 1ZRTE 3G6EP 2ZBIA 3DNCA 1X9WA 1IJDB 1P84D 4IRCA 3KK2B 4R0EA 3DOMA 3OTOJ 3K5LA 4B02A 4WY4C 2YVSA 2ILZA 2YKMA 3L7PA 2GZOA 1NPPA 4ECRA 3THVA 4C0HA 1B0TA 2BANA 3K17A 5F9NA 2E5TA 4PD4H 1NK6A 2P7JA 2O01H 4DV1J 1XJWB 3TUJC 2CPHA 2GMLA 3I4HX 2UUBF 3NL0A 1MUUA 2DPJA 1NH4A 3BQ2A 3X1LB 1FJKA 1R8HA 4C8KA 2EEYA 4YPCA 2BQRA 4U3FJ 5GTIH 4C97A 1J5OA 3H1KJ 2HAIA 3L95X 2IC3B 4ZCIA 5F3TA 1PPJE 3R5BA 4PD4D 1Q5VA 1SQVD 2ZXXA 3CT9A 1LTBC 2OPRA 4M1KA 3DN9A 4YB1P 1Q7LB 1U0HB 1WHVA 1FVSA 4H0LC 5DG9A 3D5MA 3CC7S 3PJ9A 2HLTA 3TAPA 1RKIA 1KLNA 2MXYA 5LSLA 2MKYA 2H3EB 4X4UA 2B9YA 3C6UB 2KVQE 4WY4D 4YR3A 1Q81T 4GO5X 3VVUA 1KDNA 4DPTA 1WACA 5F3ZA 1BE3J 1DIPA 3HVRA 3GR1A 3DRPB 3M9HA 4NLTA 3TDKA 4LF4J 2CIMA 4YY3J 3BS9A 5CD4H 4Y99B 2XMVA 3ABVC 4WFNQ 3QJJA 1CS4A 1KOHA 2VOOA 1VQ7S 4CLFA 1E6VB 3W66A 3CDWA 3GIKA 1FXLA 3V2RA 2DR5A 3UDVA 4ELUA 1NLKL 5A2QU 4Y2CA 2N7CA 2LQ8A 4M5KA 4F3OA 1RT2B 2Q43A 4PG7A 2WVEA 2JJLA 1C1CA 3KKFA 4U7CA 5AW5B 1S77D 1HJ0A 1BSNA 4P73A 4LF8F 1KTMA 4OGQB 3TJ8A 5AW0B 2CQHA 1HBOB 1NK4A 1YITS 2FC9A 2LKZA 3M2RA 3MM5A 5KLIC 4EZ6A 4FF2A 4X84A 3DLEA 3WX8A 4DPWA 1WF1A 2PC6A 3GHGB 3QLHB 3K5OA 3QAEA 2N4DA 1Y5NB 5APXA 5KG4A 1YJRA 2GCFA 1WKKA 2WSCC 1GK6A 4L73A 2KP8A 3VAKA 5KFZA 4RUHA 1X7VA 5AVYB 2HGNA 1H38A 4AD6A 1I3OB 3R9LA 1PKUA 1RT7A 1H2UX 4CDIA 3W9IA 5DG8A 4HKZH 2J9DA 4F8RA 1SQBJ 1Z2LA 1YG0A 3L73D 5K14A 1T8EA 1JXLA 1KC8T 3H98A 1OMIA 2UUWA 3H1HD 2X3DA 1S48A 3V6JA 3Q2TC 1PBUA 3DRYA 3W65A 2MKKA 3EZOA 2E7VA 3M0AA 4EBDA 3H1JJ 1S9KD 4G3IA 1G7CB 1X5TA 2VV5A 3KNAA 4ZVHA 2OTJP 3POTB 2LEPA 3RRKA 1QE1B 5E41A 2WSEH 1PJ5A 5AVQB 3IRXA 4WIQA 3HKWA 1TL1A 3IR5B 2C3OA 4QIFA 1ZBTA 4OI2A 2JFKA 1LW0A 2K3KA 1PFIA 5I42A 5HBMA 2RU3A 4CCHA 2OYHB 1APSA 2NSBA 1PC5A 3TA1A 2W25A 4ZPVR 5TISE 3PJXA 4O3SA 1BC6A 3EDQB 4UUWA 3LP2B 3H5XA 1SQPG 4R8UB 3OTBA 2B4UA 1OO0B 3ITHB 3EGZA 3R5DA 4DX7A 1P8GA 2HHXA 1N0UA 1TQLA 1LTGC 2YWKA 3RAMA 4OYWA 1S5LH 4PYAA 2CJ9A 2HKEA 4QWBA 5KTBA 4B86A 1OW6A 3HTKB 4ZVFA 4JI7J 4Z7YA 5HN0A 2X3GA 4HHHA 5HK4A 2M3BA 1NSKL 1F1BB 4QR1A 2PRRA 3DI6A 2LXFA 4C8MA 4OHYA 2XWYA 2V5HG 5G0RA 4RW9B 4FYVB 1BGYG 3H6PA 2FJDB 1KHVA 2NPIA 3CW2C 2Z58B 4WXOA 3AD7C 1A02F 2YPYA 4ENOA 3M0DA 5GAHI 4EDFA 4I7ZC 3QIPB 2A45H 1BSHA 1QTNB 1RAEB 3HLUA 3DCAA 3RU0A 4HYTB 2A6OA 4PWUA 4DJBA 3EYZA 1T94A 5K8NA 1RE1B 4LF7J 5K9FA 5ADZA 2HNZB 3AE2C 2OQQA 2LQ5A 3H59A 1KV4A 2RQKA 2CG8A 2V4QA 2VFUA 1SQXE 1X4AA 3CCJP 4RBVA 5HMZA 3G6VA 4KH1B 2WB4A 1JY2N 3GYXB 4CLSA 4C0BA 5L1JA 3S01A 4A8SA 3M2UA 2E74D 5I3UA 3LWLA 4WB4A 2UXDF 2W24A 4LGDE 3RK3D 1BCCD 3BGRA 1CSBA 3DLKA 1S1TB 3SCKE 3A0BE 5IFMA 3LW5C 1IFJA 4K4XA 1UZDA 3FSXA 1TL3A 3J7AN 4HKQA 2GAGC 2ZFHA 4F02A 3L72J 2LR2A 1JO5A 4S0MA 3W67A 3AE8C 2KHCA 3R5GA 1RHZB 3DFEA 1EQMA 5MLCV 1HQ2A 2J0WA 2ZD1B 2MZSA 2HG4A 4JI8J 2YX4A 1TV6B 4L76A 4O3OA 3L71G 4N7TA 2BCCD 4N8OA 3VGSA 3MAHA 2IM2A 3CEDA 2D69A 2MHEA 4HDGA 2DYAA 2M5YA 3TR5A 1E6YB 2I0XA 2ZBRA 1TL4A 2V8HA 1N48A 1LTJC 4OHZA 3IAM9 4LSLB 5KFDA 3HVTA 2V69A 4LFCJ 1RT6B 4CTAB 3HHNB 4L75A 1VQLP 3GJTB 4O4GA 4QW9A 2IPPA 1S6QA 1VQ8P 4DX6A 2Y0DA 4WK3A 5CAAA 2MQMA 3T1HJ 3E51A 2F40A 3HHLC 5EN1A 2M0GB 1KLMB 2MGZA 3L70J 4K3AA 2V2QA 1TKXB 1VK3A 3Q8UA 2R32A 2DHXA 2J76E 3M05A 1GD2E 1B99A 1BD6A 2RH0A 4LR7A 1AQTA 2NXCA 4M5LA 4LMZA 4ES2A 2Q6QA 2R42A 2J6UA 2NXJA 4ELTA 3L9ZA 4ZPDA 1OIAA 3IFMA 4LSZB 3H90A 1N36F 2D3ZA 3D3BJ 2OFGX 3ET6A 4Z2XA 3AOAA 1K47A 2BJDA 1SH0A 1F5CA 3D6YA 2BMBA 3QT8A 4USWA 4NLWA 1M7LA 4ZVQB 3HD7B 1USEA 3GMGA 4HH0A 1QSSA 1YLXA 1UVLA 1V5IB 2E9ZA 2Y1JA 4LFBJ 4PQUA 2QLBB 3EWKA 2WSFH 3ZTRA 2W4PA 3AH6A 3M8QB 4K50A 1L4AD 3T5KA 3RB0A 1AT1B 2V9KA 2VB6A 3ZTSA 2XS5A 4K8RA 1I94F 1WWHA 2FJBB 3HHLD 4WXWA 3KK3A 2M70A 2HQIA 2YTCA 4ZHRA 1KVKA 1L0NK 2MJUA 2HR3A 3ZZPA 4KGVB 1KN6A 3K5NA 1K9MQ 2G0IA 5ETPA 4DPXA 1JCDA 4DHVA 1EDLA 2HIYA 2K8GA 4JV5F 2V34A 4NL5A 3EICA 3EGNA 3D9BA 4I1TA 3M30B 2ZH4A 2V67A 1C0TB 2ATLA 3HCXA 4XDCA 2NYHA 2ZM6J 4XO0A 2R4FA 4B9TA 1M1KT 3CJQA 2HNDA 3PRVA 4WTOB 3G9CA 2XY7A 1NKCA 1IBMJ 2F63A 5AXMA 5K8OA 3U02A 1WKLA 2OMOA 4KHPF 2H4WB 1EZVI 1RTIA 3ZZOA 2YXRB 4K4ZA 4GMKA 3MUVP 2XMUA 4DQQA 1UFLA 3RJMB 2CQ2A 1N7SD 3EFFK 2AT1B 2YWWA 2G1DA 5DJUB 2W8ZA 1OWXA 3FZBA 3W1YC 3MD1A 4Y28C 4RW6A 5B0EA 3MCNA 3SCJE 1IKWB 2HHWA 1AA0A 1SQXG 1SQGA 3AJDA 4IOBA 4KE5A 2Q7CA 1HHSA 3BCCD 2OPQB 1KOOA 2Z2ZA 4DCJB 1LT9C 1IWAA 4TT3H 2BJ3A 3N4WA 1HQEB 2MTLA 1RK8A 2XEXA 3MEDA 4Q8FA 3V2QA 2PFXA 1QY7A 2XB2D 2HWIA 4YDDB 1JJ2R 1D9DA 3QZ7A 1HBWA 3HD1A 3CLQA 1OYDA 5J2PB 1HBNA 2Z57B 3CVKA 1N5YA 3RW6A 4U95A 4A8OA 4XAKA 3N9UC 3DHWC 3FXEA 2RILA 1L5UA 3PHTA 3R7SB 3PJSK 4IG0B 3H20A 2ZC3A 4DPUA 3MEKA 4PG5A 1MSWD 2R5BA 1X60A 2N1TB 2K1RA 3R5JB 3NWGA 2DHAA 1NPRA 4QIGA 1BDCA 2P67A 1YKWA 1M1HA 4OHWA 2VL1A 1Q7YT 2KVIA 4KRWA 1IKXA 5CCLA 1Q4RA 5J2MA 1LWXA 1CVJA 5LXRA 4D3GA 3VWSA 3JSMB 2W8KA 4CNYA 2CWXA 3R5AA 2O5DA 3AE4C 1RHUB 2MHNA 3G82B 1URQA 4ZVRB 1T9UA 4ZJLA 2ZITA 3NAHA 2QE7H 1UWBB 4K2JA 1LFPA 2ZOGA 3HI9A 3JCUE 3HT0A 1Q82Q 2KJWA 3JB9k 1KEKA 1RABB 3FRZA 4DUZJ 1NO8A 3HHEA 1VI7A 4H4OB 1JLGA 1M1JA 2MKCA 4XTTA 2OEJA 5JVGQ 2MZJA 3VP9A 3HDSA 2KSEA 5KT2A 3CC7P 3GFYA 4DV4F 3BBCA 1MROB 3PFEA 4CLUA 3VMXA 3PW0A 2BQ3A 2DJWA 2HHPA 4DR2J 1XR6A 2NCKL 1NNDA 2OYOA 1R3NA 1VQNP 2MQLA 2HVZA 4F7VA 2OYIC 1HBUB 3FMWA 3M8WA 2DW3A 1PGOA 2U1AA 4B3MJ 4P75A 3D1HA 2KU7A 3HP6A 1M0SA 2GJ2A 3IGVA 5AVSB 4E98A 1C4CA 4WY4B 1U1RA 5HMXA 3G71S 4H13C 5B5EE 4DR7J 1SQPJ 3V4QA 3AEEC 4DJGA 3SSQA 1HQUB 2OMLA 4GDOA 2I8DA 3MAAB 5L1IA 2C0XA 1GXLA 2FFDA 4XFJA 1S1UA 1KYOI 2M3DA 3II6A 1FC2C 1SQVE 1WC1A 1VS3A 5EDWA 1ZP0C 3ILJA 1HVVA 1MLAA 2H9ZA 5E0OA 3TP2A 4AE5A 4Q43A 3AE6C 5KLVG 3P5BP 1RAAB 3O3LA 2XKMA 1BGYJ 2XS2A 4M5DA 1UVKA 2IDBA 4I67A 3T41A 2WHOA 4EU0A 3DDKA 4P74A 1NVOA 1V5VA 4OIXA 3OV7A 1PGZA 4ED5A 3L4FA 2N3LA 2NPSA 4NCGA 4LQ9A 2MJZA 4DV0J 2VFSA 1Y10A 4L3NA 1S1WA 1U48A 1EX8A 4EZ9A 1PYTA 4K5SA 2KYXA 5CJ4A 2M8DB 1VGYA 2WVCA 1RHRB 3TJAA 2H1YA 1OS5A 3EPGA 4GKJF 1N32J 4TU7A 2BRLA 3N5FA 1Y9OA 1FCAA 2X1FA 3L74G 2K37A 1S99A 5H2FE 2YQ1A 2EFPA 4JI3J 1MFTA 2GGPA 2MMYA 1J1EC 3M8PA 3DYAA 1PCAA 1VQ6S 1PYSB 4FF1A 3FRYA 3TW0A 4QYRA 1DLOB 4UB8E 2CKWA 2AZ1A 5B0BA 1T8ZA 4ZVOB 4NXMJ 2VBWA 5KLIB 4N5SA 4W7ZA 1HI0P 4TYAA 1Q95G 2YNIA 3L71J 3FC9A 3LUYA 1UETA 1Z1ZA 3NS7B 1NO4A 1NTKG 3T3FA 3BRTB 4WYLA 4PYDA 5DDOC 4WE1B 5KFUA 3K0JA 3UD5A 3I82A 3D6FB 8ATCB 3VMYA 2AIRB 4ES1A 2XHWA 1LT1A 3NGTA 2N7YA 1YJWP 1WSRA 4ZNCA 2WPSA 1RQ0A 4ED6A 4N6JA 3H1HE 4IFVA 3V4IB 1N73A 3AFGA 3MOZA 3AD8C 3UDLA 3V5BA 2EG2A 1L0ND 3UN5A 1IUJA 1FEEA 3SFDC 1M5HA 1RZMA 1S9KE 1EZZB 2Z8QA 2I1RA 4H4MB 1SKUB 4RNHA 3FEZA 3KUEA 2EFVA 4C11A 2AXCA 2KB7P 1FDMA 4JQ0D 2JRSA 3OXLA 2R8IA 3MP7B 1HLWA 4JI5F 5CYJA 4LSNB 1TUVA 4BS2A 1R8PA 2O01C 3MPDA 2DNYA 2WBRA 2BX6A 5BR8J 1R0CB 2OTLS 2IYOA 1FZCA 4ITSA 3NMDA 2W4CA 2RD5C 1AZSA 3K2YA 1YTYA 3W2VB 2XY6A 2DXEA 4KKOB 3MM9B 4PQAA 3RGUA 1AROP 3W68A 2QC3A 1KILC 4C7NA 2UXCJ 1K8AT 2I38A 2R7OA 3FJ2A 2MLZA 4N76A 1FKPB 3T9ZA 1S97A 4L74A 3FX0A 3UNYA 4PR6A 4DX8H 3LP1A 3I87A 3PYEA 3UW1A 2W90A 1YJNS 4GIFA 4QWDA 1FT8A 4DSFA 2FVRA 1IKYB 2W8LA 2CFXA 4USVA 2XWXA 2DRDA 2A18A 1AFJA 3H1IE 1HD0A 4LF9J 2XZDB 3U1AA 4I1LA 6AT1B 3HSGA 3M1VB 2DISA 4OZ1A 4RNMA 5A8RB 3FVYA 5B08A 3DLLQ 2IJFA 4LR9A 3RK3B 1ZR4A 4FP9A 2Z30B 1CJTA 1SC3B 1XWLA 3AAWB 2OFHX 5ETQA 5ETNA 1JB0C 1FNMA 1V6HA 1GX6A 1HJBA 2ZVOB 2VD3A 2CWKA 1T05A 1RT5B 3H1KD 4DLEA 3IO1A 4X66J 2UU9J 1YIJS 2CPXA 1OXZA 4LFAF 1XNQJ 1H98A 3GE9A 1V3SA 4ED7A 1T0TV 1OFCX 3OJUA 1UVMA 4LR8A 1Q81Q 4YB6A 2VG5B 2K3IA 2W2PP 2YPZA 4NPDA 5GAEI 2QJKC 2CNOB 3IS9B 3K89A 5KG6A 3NBPA 3RK3E 1BCCE 2HMIA 4F25A 1BE3D 2AV5A 3W7BA 1VJQA 4MKAA 2ZYDA 1RTHA 1QEXA 1SQXJ 4RPFA 1Q16B 2JHEA 3EMTA 1RAGB 3KMSA 4RW7B 1JJCB 4DR1J 4RKUJ 2M8HA 4I64A 5LMUF 2R7XA 2LLZA 1GL2C 3IWXA 1CULA 2D7SA 1NRKA 4DN9A 2QTWA 4X62F 5KFOA 1TKTB 4E8UA 5DQHA 2AU0A 2BCCE 3FSIA 3M8YA 3Q3DA 2DRAA 5DM6Q 2Z5HA 1EKSA 3LIEA 5A6WA 1GNKA 1X5OA 3W3SA 2XMKA 1UIXA 4GKGA 1RT3B 4GKKF 3FXDA 2CYYA 2ZVIA 1PIEA 4PXDA 2AEFA 1GW3A 3OSPA 1FFGB 2QG9B 3VTPC 3HFVA 2V2ZA 2QEXS 3CWBG 4F0MA 2H43A 2YKQA 1BY9A 4F67A 2XM3A 5J1EB 2WSEC 4DFPA 1L4AB 3HRNA 1RF1C 1WNEA 4PZVA 2YKNB 2E75C 1V9OA 2V8VA 4CIOA 3ONQA 1RHJB 1QL2A 1ZM2A 1T11A 3HHLB 2RE1A 1RE4A 1SQBD 1GL2D 4YN3B 2HHUA 1RT1B 1TZ0A 4ZLLA 2QFIA 3PYFA 4RLEA 3DRXA 4ECVA 2DXDA 1X5PA 2M88A 1OX3A 4QCLA 2C2ZB 2ZKUA 1LTAC 3KLIA 5HVGA 1AFOA 2HHHF 4OZ3A 3H1JD 4ECTA 1WG4A 4N47A 1HMVB 2IJRA 2SPZA 1RI7A 1MV8A 5B66H 1QVFR 4P2MA 2AQ4A 2BW7A 4NLQA 3GIRA 1FD8A 2E9TA 1R0AB 1XTZA 3I6PA 4J9OA 3LAMA 3IR6B 4HTIA 3RRHA 1HPZA 4ZKUA 3CCWA 3LPYA 2B7CB 2E75D 2PGCA 1HNVA 2BASA 4DV2F 3AEAC 3CPWR 3U59A 3C9IA 3HO1A 2HQGA 5CBNA 3SXLA 1SQEA 1N7SB 1FTCA 3H5UA 2WVDA 3KK1A 1FFSB 1JIHA 4DWIA 3W2WB 2PMHA 7FDRA 3CCES 3NRBA 1N2DC 2RU9A 3UR0A 3T6BA 3HVAA 1K73Q 4CO1A 1NHVA 1NCLA 1QDUB 5E3CA 4B3RF 2ASLA 3M32B 1R6VA 1XBWA 1UIIA 2NSCA 5L39A 1IR0A 3GG1A 4O44A 1S0OA 1XMOF 5M2PA 4DR6F 1TFWA 3CDUA 5KLVJ 1XIQA 2D74B 1R6YA 3CMAP 5DLGA 1SKSA 1N6QB 4NEYA 5K8MA 4BDPA 1TVRA 1TKZB 2AYBA 2IYPA 2DPIA 1K0TA 5ITHA 3CCLS 4ED1A 5J2NB 2IHR1 2WT7A 3KNGA 3W61A 3KUGA 1ZXGA 3H32A 4OV1A 1UJ6A 3TA0A 1USDA 1ZH5A 4D3HA 3CD6S 3BCCE 5J2QA 3TF5A 4ZLPA 4XK8C 2VASA 1G6BA 1SQPK 3D2WA 2AGQA 1FE4A 4IFYB 3BF4A 2ZC4A 3PNIA 3EGWB 1B4SA 1GX5A 4DV5F 3CJ0A 3UD3P 1VBKA 5KFJA 3TVKA 2F4VF 3CB4A 2Y8WA 2DO4A 5KAFE 4PABA 4ZP6A 1U6BA 4PRFA 3L72D 5KJ7D 1WOOA 2L08A 4K4WA 3TO8A 4URGA 2W2MP 2FVPA 2F8HA 3UNGC 1LOUA 3HE4A 2HHVA 4AYCA 3LPEA 3PTZA 1NHLA 1ZZNA 1QAIA 3GV7B 2W1BA 4R5PA 3J80U 5B09A 2A06G 2UUAJ 4D6TG 4CYUB 1U7MA 1FZBA 4MN4C 4BCAA 4IFDK 1WC0A 1HW9A 2MZTA 2V9WA 4ECSA 1B0VA 4U96A 3MI7X 1VC0A 2LFVA 6FD1A 1NTKJ 4USJC 2ZH1A 1JQGA 2WK4A 1GK4A 1T3JA 5KFHA 1EZVD 3G71P 1SCJB 2B51A 3CDAA 3FNNA 3Q5SA 5CCHA 1NJIQ 2VG6B 2XSJB 5A6PA 3OUYA 3ZZZA 3L70D 4DF4A 1DD4A 3SEOA 1SS1A 3KHHA 1VL2A 3VR1A 2D2CD 3C14B 3V81B 4GO7X 1G2CA 3OTCA 5ETSA 4NMLA 3I5AA 1HI1A 1K1QA 1UVJA 1YTZT 5KFNA 2DH9A 1JLEA 1NYHA 3QH9A 4A8MP 1DTQA 1XERA 2P2UA 3OR2B 4U8VA 1IK9A 4DZ6A 2ZH3A 2CPBA 1FKOB 1K04A 5EWGA 5C25B 1KB9E 2O66A 4IKAA 1QVFO 2BABA 2DD8S 1JLCB 1N33J 3QGHA 3HZGA 4X4VA 2OYIB 3CF5Q 2KG0A 3LGHA 1MMNA 2H4YB 3UIAA 1CC8A 1XR5A 2RHQB 1TAQA 2QMUB 3CPWO 3GLMA 2N9BA 2JEEA 3FBCA 4I56A 1U7LA 2IYGA 2WAQD 1VQ6P 1K05A 1TTHB 4RNFA 1T03B 4PPDA 5CYQB 1U0HA 3ENVA 3WMM0 2X51A 2FJEB 2CPZA 2JVRA 3FZ2A 4A8QA 2O67A 1VQ4S 1VQOS 4KB7A 3OT9A 4KAIA 1QX8A 2XLJA 4WPAA 3C6UA 2Z5IA 5F8LA 1NAFA 1I1GA 3CJ4A 4KIAA 2B9WA 3P8BB 3H42A 5C24A 2W9CB 4JI4F 2L9WA 3N6LA 3M0DC 5DGAA 1DEEG 2IZ0A 4QR2A 4HT5A 1E6VA 5THWA 2IFXA 4OZ0A 2W7OA 3QGGA 1FRHA 2CPSA 1KFNA 3C8VA 2J8AA 4HVZA 1U1LA 4WP3A 2GUVA 3IA0A 3GP9A 4EIJA 1S12A 3OTDA 1BQMA 4FN5A 2GVDA 4A8XA 2J7UA 5ETOA 1HBOA 2GNKA 1MW7A 2OPPB 4K35A 1WHYA 5K20B 5GAGU 2Q1KA 3RW7A 2MEWA 3PRBA 3GHGA 5DDRC 5IC6B 4WBFA 3QPIA 4DQRA 3PDNA 1J1EB 3VZHA 5DRKA 4FF3A 2R7TA 1KQGB 1U1QA 2DK2A 4WTYA 5KG1A 4JI0J 3I56P 3LP0B 4F26A 5HL7Q 5L46A 1VF5C 3FEYB 3H5YA 2AJ0A 1YGYA 1F5BA 4HEA9 4HH1A 5JJBA 3R1LA 4CLWA 4YHHJ 4OYAA 3L7OA 1KQSR 1LP1B 2R8GA 2RF2A 2YWFA 1OWAA 4MT1A 1ITPA 1KYOD 5IV4A 2DH8A 1YYCA 2YXLA 2NPFA 2A1BA 1SBRA 3C3LA 1SQXK 2BXJA 3GR0A 3CWBJ 5IS2A 3MMAB 5FJ4A 5KT7A 1L0NE 3GYNA 3SSUA 2QJ3A 3UDEA 2KFNA 4U6PA 3ZNJ1 3VOPA 4F4AA 2ZFCA 4OX9F 3VHQA 5J1PA 2ITAA 4IRDA 4Q2MA 2P6TA 1UEUA 4ZKAA 1BQXA 4PUOB 3RK2D 2VA3A 1GW4A 3EVMA 4LC1A 2W6BA 3A7OA 1YIJP 1KQKA 1UA0A 1RCXB 2ILYA 2AF6A 4JI1J 1S6PB 3J81U 1EQ0A 3QBCA 1P9YA 1L0LD 2VH7A 3HX9A 1JWWA 1KFDA 1LK5A 1Q8BA 2JL9A 2EWHA 2VQEF 2OYHA 1SUQA 5HANA 1ZN5A 4F4KA 4NA1A 3EE3A 2J0SD 2WSCJ 3SZ2A 2YIUB 4OI6A 3LP2A 4Y2IA 2ADBA 5IWAJ 3FBFA 1OY9A 4LF5J 1VMBA 2VPZB 5L9NA 4F4ZA 4IO1A 3CL3D 2AXTH 4DCKA 4TQSA 2C2DA 3O6QB 4B08A 3B8EB 3HTKA 1VRQC 1U8WA 2IRUA 4FNIA 5LXYA 1S9EB 1FOSE 4RW9A 2E29A 1RYSA 3L7UA 1SQPD 2GJFA 4F2RA 4U3FE 3C6TA 3MM7B 3H1IJ 2VKZG 2CXEA 1HW8A 3H1KE 3I55S 3M9OB 1HWKA 3MTKA 1KHWA 2CQPA 2VDIA 3CC2S 4IH7A 1KILE 3QO9B 2HNZA 4KQZA 1VDFA 2BRKA 3HJVA 3OJAB 1N34J 1U4BA 2AX0A 1NJWA 3IBWA 3LAKA 4ZIVA 1BGYD 4EI2A 2G2YA 5K5GB 5AW6B 4WP8A 3RBDA 1PPJD 3L35A 1S7IA 3TGUG 2IFMA 4B3SF 1U57A 4JB8B 3CCSS 5LMNF 4CLZA 1SQQG 2QM7A 3IC1A 1S1TA 1NB7A 1HD1A 3T5LA 2BJEA 1F2HA 3LGNA 1VRTA 2QJKB 1UPMB 1J5EJ 5C7PA 4DSKA 5A0YA 1HWJA 3O8WA 4NLRA 3EDRB 3V2NA 1OW8A 2KZMA 1JNRB 1RHKB 3A4TA 1HFEL 2N82B 2HGLA 3RAQA 4TQRA 1FFWB 1GMVA 2NREA 2Y1RI 3LANA 1SH3A 2R9LA 2LA6A 2I6WA 2ZH9A 2QN6B 4U67Q 3WU2E 4CLPA 4K0KF 2VODA 1OY6A 2HURA 1GL2B 1IZNB 1Y00A 1Y11A 2AHOB 1U1PA 2FGCA 1NTMG 4OYZA 3AOCA 2YKPA 3NGSA 4N77A 5KLVK 3HZEA 1RTJA 2EBGA 2R3SA 1RT6A 4CTAA 4XPCA 2FZKB 4JYCA 1YBAA 1GT8A 2LCWA 1O0PA 1L3UA 4USMA 2KS1A 3AJ2A 3TZYA 4LF2A 1RAJA 2KFZA 3KJQB 3S8SA 1ZTTA 1T95A 3L71D 1KLMA 1TKXA 3DM2B 3DRRA 3I0SB 3RB4A 3SI8A 7FD1A 1RBOB 1KQSO 3CCEP 2IMOA 2ZBQA 3PV8A 3UCUP 4J91A 4AQYF 5KOWA 4RU2A 3AQPA 3UN2A 3FCVA 1YDLA 2OJ3A 3MR5A 1RF1B 4DUYJ 1Q1KA 2E75B 2FXOA 3KJVA 2JEGA 1ZM9A 4B9LA 4MKBA 3LW5J 2UZAA 3V6DB 4DLGA 2YWHA 3HFZB 1T9XA 3ZZYA 3HD7A 2QLWA 3H1JE 2B8PA 1URQC 3DOLB 3IBFB 2F8EX 1ZAWA 2WWWA 4LT6A 4OH8B 1NOHA 3MZIA 2GJIA 3I9ZA 1EHWA 5IQ6A 3Q8YA 1S5LX 4B9SA 2XGQA 1C1BA 1QUVA 1NK9A 3PVXA 1M1JC 4CPGA 4TY9A 4MFBB 2C1EB 1NTKK 3HUSA 3MCOA 5F8HA 4GOFA 4DL0C 4C8LA 5DS7A 3RL0C 2IRXA 3W8GA 2IA6A 4UB6E 4J9MA 3CMEP 3B5NA 1GTWA 3CCZA 2IVYA 1CZQA 3M30A 1WTBA 1JEKA 5TISH 4CLTA 1PJ6A 2ZOFA 4NYPA 5AVWB 3BKUA 1UCNA 2CPEA 4DCPB 2V50A 4G1QA 2F9DA 4DR4J 3MMBB 3R7NB 3NLCA 5G4DA 1J27A 4OZLA 3ENQA 2E1PA 2NQPA 5KFWA 5AVTB 3GV8B 1YTZI 3GLJA 2LDIA 3OL8A 1K9MT 2BANB 2WOMB 2RNEA 1F6TA 2DVIA 2LU1A 4A8WA 1C2PA 2NZ4A 1E5WA 3N7NA 4OWFA 2C2EA 3J7YU 1S6UA 4QMAA 2FFDC 3KLGB 1BXNA 3AXKA 2C3MA 1J1DB 4HDHA 2EKNA 4KO0B 3HT3A 2D9PA 1JJHA 3VAJA 1IKWA 1FKAF 1J5OB 2RDDA 1YRXA 5JVHQ 5M2RA 4ZP7A 2UXBJ 2FYUG 2WONA 4FYXB 3QYYA 2VQFJ 2OPQA 2W6JH 2FHOB 2H88C 4LF6J 2NPSC 1PYOB 3TSIA 1M57D 1KP6A 2CUYA 3EQ2A 3A0BH 2RRAA 1SQXD 5AE3A 5C2CA 4WFBQ 1M90Q 3WQPA 2ZZNA 2CPJA 1BDDA 3FGAD 3MHYA 5J2PA 2VA2A 3L72E 3UVJA 2GVZB 2HVIA 3CGIA 5D77A 4CI0B 1PGPA 4C0OC 2U2FA 2KXFA 1CS4B 4Z37A 2ZHOA 2O1PA 2GX8A 3TYTA 2XGPA 4AUKA 4M5MA 2KB2A 2LQJA 3D0IE 1N5VA 1F9EB 1R43A 4F2SA 3D7SB 4H4KA 2VDHA 2DGXA 1C1CB 1EP4A 4NPOA 3SSSA 1IM4A 5M1BA 4K7QA 3D66A 3DXSX 3CJRA 1XTGB 4GODA 2Z4EA 5IM0A 1EZVE 3MM5B 3JSMA 3AOBA 2R2RA 4DV7F 1V3ZA 2P10A 4MKYA 4Y28J 2VPWB 3L73G 3L70E 4K4YA 5E79E 2G3AA 1WOPA 4F50A 2YMKA 5HROB 3MPYA 3Q1MA 4LRFA 2ZKTA 5KT4A 3W5ZA 3ISNC 1AB8A 2Y1LB 1LWUB 1S1VB 1YHQS 1N73C 4P2FA 4NLUA 1OPIA 1MROA 3F41A 1GXTA 5K14B 5AJ3F 3A2AA 1XNRF 4NRTA 2JP3A 2IRYA 3ZTPA 2EK6A 4URSA 4XIUA 2DY9A 2MKIA 1R8BA 5C2GA 1YJ9S 2DBBA 2X1GA 1Q82T 1IM6A 3DLHA 1SPBP 3ICLA 2NXEA 1NJYA 1IFIA 1U2FA 1IBKF 1FDOA 3VF0B 5HI7A 2IA0A 1FZCC 2J7KA 1Q86Q 3BO3A 2KNCB 1DAXA 3B78A 2ALYB 1LTSC 2DHHA 2LDYA 1WEYA 3EVWA 1RA7A 1ZAVA 1H88A 4ED3A 1HQUA 1U47A 4DN0A 3OTOF 2J9DE 3Q5PA 4RBUA 2BKPA 2GUSA 2VUGA 3VN0A 2VIHA 3MAAA 4QBUA 5T7LA 3FDSA 4K5RA 5H9EJ 4MH8A 2DHGA 2JLGA 2M5AA 1LW0B 1KNZA 2E5YA 4NLXA 5I42B 4CT8A 1ZM3A 4DV1F 5KKZC 3CX5I 4ED2A 1UJ5A 3AE9C 1WC5A 1FOSF 3DGPA 2ZHAA 2ZT9D 5CD4A 1NKZB 1EDKA 3VV2B 4Y2KA 4QPXA 2YBVA 2XU6A 5IOLA 3CXHI 5EHHA 2OGUA 5L38A 2XYGB 4ETZA 1F0XA 2IBZG 2BUNA 4RUBA 3LOUA 4LREA 4JI6J 3TUZC 2I5JB 2DB1A 3E1IA 5KLVD 2F5GA 2RQCA 1H73A 1D7MA 4OZNA 3CCUS 3TQ1A 4XE5B 3TGUJ 2A2DA 4YUDA 1JY2P 2A45G 1LXJA 1SC4B 2MJNA 3ZTQA 5LL6d 2G0CA 3EJMA 5CH7B 5FD1A 4O3QA 1U24A 2E42A 2ZUGA 4HHUA 4P7TA 4DV6J 3Q83A 4YY3F 3R8YA 1RDRA 2HAFA 4AL7A 1SC1B 5EUHA 1OYEA 3K5MA 1HNXJ 3MOJB 4DFJA 3R6GB 1T02A 4JF7A 5I3UB 5SUHA 3KHRA 4J9LA 2PGDA 2FHMA 3BGRB 1DBDA 4G1PA 4C48A 5KFPA 1W2IA 5H1SV 3PRJA 2VC0A 1Q53A 1MU2A 4YB5A 4C8NA 1NTMJ 1JLQB 1UL3A 5AE2A 1X4HA 1TL3B 3V4WA 1CJUB 2ZBPA 3C15B 2XDJA 4Q7AA 3EGVA 1IVZA 3QZ8A 1RBAA 1VF5B 4I69A 1KYOE 2M8RA 1HNZJ 4M63A 4I0WA 1AVYA 2B3TB 4EMDA 2DNRA 3RG6A 2RRBA 4KV8B 3SV4A 4MIAA 3MEEB 4IQXA 3DMJB 1NTKD 4BRYB 2VG7B 2RN0A 5T14A 4P7VA 2NUUG 2X1BA 3P6YC 4H4MA 3AT1B 3BVHA 3K58A 5DJBA 1XMQJ 4ER8A 1JJ4A 1GDTA 3WUVA 3NS6A 4G6VB 3NNAA 3MPVA 2KLUA 2YKOA 1URNA 4O4GB 3I55P 1LWEA 3BBBA 3J81j 2WTFA 2DGTA 3JCUH 1RA6A 3OLBA 3CCMS 3MDFA 5EFWB 2XZTB 1V3RA 2E1AA 1PGQA 2RDJA 3CC2P 2B5JA 5I3PA 2HWTA 3TOQA 2DNQA 1RE4C 4LIWA 1ZA2B 4IDKA 4NRUA 2BE2B 1YK9A 5KFQA 2VPXB 3NWRA 2A6MA 3CC4S 4LVOP 2J7WA 4KKOA 4U7UK 3MM9A 1MWQA 1G3OA 2K9YA 5HVHA 4BWNA 1HKAA 1FKPA 4O3NA 3BSAA 4Q2LA 3CCSP 3MMJA 3HM9A 4EK2A 1VPCA 1N86A 1DARA 2V8GA 3H4BA 1YI2S 2H5JB 5A8WB 3S9OA 3K8VA 4HLBA 4ANDA 2M4MA 2N1TD 4TNOA 3KFWX 2DITA 4PKDB 1HIYA 4GRSA 4DQPA 5AW9B 1T6AA 4IR9A 4DV3J 4NZ7A 5A8RA 1RWKB 2E5JA 2ZNZA 2Q66A 2ZH6A 2GA1A 3CTRA 1RAOA 3W5YA 5LM7E 5B5EH 2W9AA 4N56A 2FUG9 1SQPE 1EDIA 1A7GE 2M9KA 3GF3A 3KK3B 3QATA 3C16A 4DCOB 3M2VA 4PXCA 1R5SA 4NXNJ 1R0BG 4JI7F 1SVFA 5HAOA 1LNQA 3CE8A 1QSLA 3US5A 2KUBA 3IN6A 3BGOP 1Y0HA 4OHVA 2O01J 4URQU 1EQ7A 1FRIA 1BGYE 2J6TA 2K88A 2QIFA 4DOZA 1OQ3A 3IS9A 4OI0A 5F8JA 1SQFA 2ZBCA 1P1LA 2HBQB 2YH1A 2GO8A 2RJZA 2HVHA 5FDLB 1ZW0A 3BKFA 1X79B 4LF7F 3JSRA 3E01B 1OW7A 3BN4A 4M5NA 2DNGA 1TL7B 4RW7A 4CM0A 3OW2R 1TU3F 1PJ7A 3BPSP 2FYUJ 5MAOA 4MIBA 4NI2A 3BR9A 4RUCA 4IO9Q 9ATCB 2J6SA 1U1KA 3BQ1A 4RWWA 2G1HA 1DFDA 5C5JA 2XQCA 3HPOA 1Y5LB 1PP9G 4RJVA 4H44C 3ISZA 3OFEA 3FBBA 3GG0A 4IQMA 5H2FH 4OX7A 2HPUA 1TKTA 3GB0A 5D4LA 5GMDA 3L37A 4NE9C 3SQOP 3E2EA 1MN9A 3NCPA 2GAHC 4ZA1A 1HWTC 1JB0J 3A8JA 3LQVA 1JNMA 4USUA 4ZVTB 4ES3A 2LQBA 1XC9A 4NPEA 3SSRA 4UB8H 3AA8A 2UVRA 1VISA 1P84I 4DR5J 1Y7PA 2B7BB 2HQDA 1ZPWX 4F36A 3MEDB 3VZIA 3OAKA 2ZNYA 4X4NA 5CMZA 4TY8A 4PXBA 4JI8F 4DFMA 3L71E 2MLYA 1EETB 3D54A 3JTPA 3MMCA 3Q2SC 1YRUA 2HW3A 4H0LD 4TXSA 5EX3A 1L4AA 2RVJA 2RDIA 2Y8YA 4YOEA 2YKNA 1SKRA 3SMZA 4NCBA 4LBIA 3TX0A 2WB1D 3KWMA 1HBNB 2R8KA 3PX6A 2E5LJ 4HACA 4LFCF 1R89A 2MY8A 1RT1A 2DGVA 4H44D 5KFKA 3T1HF 3CWBD 3Q0AA 3BJYA 4PD4I 5IT9Y 3PW5A 1FDDA 1JCCA 3A13A 1S1CX 1CI6B 1EXIA 3TRGA 2ZYGA 1HMVA 5CCHC 5JXSA 1JKHB 1MG7A 3DGVA 1IKXB 2C2RA 5HQLA 4IG3A 2OHDA 4ZVSB 5J2MB 4ZPTR 2LA4A 3U1LA 3E3XA 1R31A 4N3YB 5HSPA 2COLA 3KLEA 4FNHA 2WSCH 3ETOA 4FPRA 1RE3A 2EG1A 3IBCB 3AB2B 3T1AA 3G3ZA 1GTEA 5B0DA 2KRRA 2KT3A 4WFXA 1JLGB 4LFBF 5F0WA 1JNZB 1M1JB 3U1MA 1N7SA 3BSCA 3T6JA 2R44A 1VDHA 3HFKA 3BRVB 3W2WA 4ZVPB 3A0HE 1JLBB 3WDOA 2YO3A 1Q79A 3KTQA 2WSEJ 2BJ9A 1TK8A 2OTKE 1S7HA 5B7WA 4M95A 5LSOA 3R1HA 1XTCC 3BREA 3PO5A 2P5VA 3NGRA 1OVRA 4Z7CA 3M32A 4DR3J 2H51B 1FK9A 2HHSA 4OYXA 2H65B 1X5SA 4DEZA 2XMAA 1NSAA 2OD4A 1SJRA 2ZM6F 2MQNA 4ZKPA 4P2SA 1WC3A 5A8KA 3IWLA 3H1ID 4ILLA 1KTVA 1MWYA 3H1LG 3QJLA 1IBMF 4C8ZA 1N6QA 1FWLA 3KOAA 1YJUA 1OSDA 1UPPA 2HRTA 1Z4UA 3AEBC 4Q44A 1K73T 2K9JB 2MZQA 5J2NA 1KONA 2FFDB 2NZ2A 2PFDA 1X22A 4IOAQ 2RMZA 2MKSA 3VTIA 5GAGI 3IP0A 4C8OA 1UVNA 3B71A 2FC8A 4IFYA 4M5DB 4ZN3A 4F0KA 3FWLA 2FLNA 1L3TA 1LTIC 1D09B 1Z2ZA 5H9EK 3OXFA 2H89C 1IFDA 2OPSB 3HHDA 2WVRA 2DNOA 2LMIA 3Q24A 1E79H 3JAMU 2I2YA 5AE1A 1RSCA 3GYGA 1NK0A 1X4BA 3USSA 4KGMA 3OW2O 4NCGB 1YHQP 2B56A 2CJQA 4M5HA 5F8IA 2QSFA 3FWNA 1UMJA 2CDRB 3G4SS 2PEBA 3MUTP 1HR0J 3SFEC 2YNGB 1GMJA 1QAXA 3QRPA 2BBEA 1YJ9P 2KFYA 4CYUA 3UCZP 1U2CA 2Q3IA 3Q2YA 1IFPA 3GHGC 4O4RA 2QRXA 3SWKA 2FHJA 2CQCA 4ZJOA 3Q23A 2E1MC 4U7UD 2O3JA 3THTA 3M8PB 4DMZA 2XNQA 3DYAB 4CT9A 4O23A 1NJXA 3GSIA 1S1XA 3DC2A 4O3RA 1Y3JA 1IBLJ 2VG6A 3GFXA 1GH8A 2YMYA 3ADAC 1S4FA 2XLIA 3LW5H 2JDIH 2XZRA 3OFHA 1VBYA 2KH9A 3IGNA 1D9AA 2W83C 2H5EA 2FYNB 1T9TA 2QT7A 1GU4A 4IUFA 4V19X 2Y0BB 2IBZI 3P5TL 3N4XA 1RJJA 3BDPA 2CG4A 2VF3A 5KFXA 3OR2A 3JSYA 2XNRA 2JSXA 3U1NA 1KD1Q 4ECZA 2KYZA 2DHSA 1H72C 4IFVB 4QIWD 1NJIT 1NTMK 4DUZF 4KGZB 1FKOA 4QQBA 4PXEA 3BDEA 1UFWA 4ETXA 2WW4A 5C25A 3VAMA 4J37A 1ACMB 2ZT9B 3OTEA 4DUTA 2DCLA 2A45I 2WRMA 3EX7B 2BW2A 2OELA 3QWUA 2BEFA 4USHA 1WSVA 1RT4B 1S0NA 5KOXA 4DR2F 3OXGA 3AEFC 2E5GA 2OYHC 3BB5A 4DU7A 4CP5A 5D4OA 4B3MF 4ZLNA 5KG7A 3A3YB 3KDOA 1SFCA 1T03A 1NJZA 2WSFJ 2FLOA 5CYQA 4WF9Q 4NLGA 4Y65A 5DZ6A 3SCIE 2OARA 1HARA 2IY5B 4P10A 1NTZG 1KMIZ 1B70B 3JYTB 5KFTA 5CABA 1LQ9A 3VGVA 1H3DA 4DR7F 2R5DA 2LQ9A 2PAJA 4WIIA 1RWVB 3GCXP 2I8EA 2QE5A 3CULA 4RW8B 1U09A 4KGXB 4KHMA 1HH0A 1NK5A 3SDEB 4KTQA 3L75G 1FEHA 4A46A 3K5PA 5KLVE 3FGVA 4MKVA 2V94A 3CJ3A 2AX1A 2VFVA 1WT6A 3KDNA 1CJTB 3I96A 4QU6A 3QNWB 2VOPA 4RBTA 2OTJS 1NUEA 2ZZTA 4NLOA 2CDQA 2C2NA 3MF5A 3NG8A 2WZ7A 3QSIA 2G9OA 4JYAJ 1VQKS 2ERRA 4RUAA 2L91A 2HNYA 2QMWA 4DV0F 1BE3G 3B4SA 2G2ZA 1A9NB 2RIJA 1WDTA 4DS4A 4PAAA 4EBCA 2P6SA 5HJXA 4XDDA 4C2MA 2FY8A 2OPPA 3KHUA 4W98A 1QJHA 1BWVA 3N6NA 3GTYX 5BYQA 2AGOA 1SJ1A 5KT5A 4BWJA 3CCQP 4DQIA 4UUXA 1N32F 3QRQA 3T97A 1H2TZ 1WUUA 4QPTA 1PP9J 1FA0A 1GMWD 4NMXA 3L74E 3A1YG 1FO1A 3NS5A 2EFNA 2HMIB 3GW6A 5KAFH 4JI3F 2HYNA 3CCRS 2Z2YB 2CQ1A 4RZRA 3RBXA 1VC5A 4LRBA 3NCRA 2BJ1A 4ZOSA 3TAMA 2W9BA 1DQ8A 4LBPA 4UOHA 2F7VA 3GG2A 1VLYA 2VKRA 3QT7A 1P6TA 1MMLA 4NXMF 2X7IA 2E5HA 3UQSA 3X3UA 3CX5D 2B88A 3CD7A 1FRKA 4C3MA 5CA5A 2GC8A 1R7IA 2FYUK 1NTKE 1ZAXA 1ZMEC 3BGLA 2XI2A 4J9VA 1X9VA 4DOJA 1REGX 2WBMA 1JLFA 2MZ1A 4YDXA 2E43A 1HA1A 3CXHD 1AV1A 3TUIC 3OPKA 3WC2A 4ATNA 4ZCMA 2K2PA 4M5GA 2QZ8A 1SQBG 2FLPA 3ZZ0A 4PUOA 3N5BA 4YS2A 3OLAA 2IFNA 2R2TA 5KTQA 2HZAA 3JS9A 1NSQA 4ICLB 5KG3A 1FWPA 4MTPA 2YY3A 1X4DA 4FBTA 1ZOTA 2IM3A 3C66A 4M94A 2B6AA 2EI5A 4NASA 3LF0A 4LF1A 2HBYB 3TZZA 3BR8A 1SVDA 1D3WA 4Y6IA 2R8HA 2ZZMA 2PI4A 3OL9A 3K57A 4R4MA 2POKA 3HD7C 1S3JA 1EDJA 3DRSB 3MUDA 1RTDA 3IMQJ 5BR8F 3B54A 4CO2A 2HVDA 3B4MA 1FU1A 2RKLA 1KB9H 3V2UC 3O6QA 4FKYA 3UR3C 2UXCF 3HXMA 3JSBA 3V6IA 1GU5A 4DXLA 2ZH2A 4IL6X 4CM2A 2UV8A 1NM2A 3HUSC 2HG5D 1GEHA 4OYIA 3QQCD 5E7OB 2V68A 4CO5A 2PN6A 2I1JA 3FFIB 2DNPA 3M8ZA 5AW3B 1LW2A 3MM7A 3TAQA 3B5NC 1KB9D 1VQ7P 1UKUA 2ZE2B 2GMJA 4KFBA 4P9SA 1HPZB 4OZJA 4WWIA 1WORA 3K59A 1RAHB 4LF9F 3FQKA 3GIMA 1HNVB 3AQOA 4LJMA 1I5OB 2GIQA 1TL5A 1KKHA 4F4XA 4JOUA 2EVZA 3WIUA 1FJGJ 4X64J 3H4DA 5AW7B 1NBEB 2F1FA 1YITP 2AYEA 3H1LJ 4X66F 1T2KC 2HS4A 4P71A 1JX4A 4OL8A 3D71A 3CJ2A 2UU9F 1AQ5A 4DPYA 2FVSA 3WUTA 4ZDNA 3PW2A 5DJTB 3VAIA 2VBYA 3GFZA 4X4SA 1XNQF 4IL6E 2PA3A 1SL1A 3KZIE 2QJYC 2JWNA 3H7HB 3BEGB 4F3QA 4AYBD 3RAXA 4EEYA 5H9FJ 3LTOA 3QMQA 2GMHA 3QWPA 2DR9A 2FXMA 4N78D 2BA9A 2KT2A 1M5PC 2D1CA 4H0LB 5F8MA 1DQAA 3TNVA 1BLUA 4MIWA 3TGUD 3UD4P 4ZVGA 5L9XA 1SC6A 1Q5YA 3HE5A 3TQEA 3MXHP 2W7AA 5L8RC 1RQVA 2HODB 3HMJG 2WTYA 2C9NY 4PCQA 2DNHA 3E8OA 3QT5A 2AMCB 1SLQA 4H44B 1JTHB 4H13D 4DR1F 5APVA 2UP1A 1RAIB 5CYMA 3FQLA 5J2QB 1DH3A 4DL2A 1TMMA 5BU8B 2EKYA 1X31C 5DGBA 5GAEU 4NA2A 2J0XA 4DSIA 2E5IA 4UY8T 2YO2A 4OYOA 4WU3A 3DM2A 4M3LA 3OJSA 1IK7A 1IFMA 2R7SA 3I0SA 3PHEA 1NTMD 2IPOB 2R3VA 3A8IA 1S9GB 3NNHA 3TEGA 4PEOA 3GIJA 4UQGA 2FVCA 4I6MC 2B9XA 4FXDA 3THPA 3UWTA 1EAYC 5E33A 4H4KC 3MTJA 2M0BA 1DTTB 3C8YA 4R5PB 3CWBE 1PV3A 5GADU 2EXUA 4W90B 4B3TJ 1IFNA 4M5IA 3V6DA 2G2OA 2RAQA 3G86A 4B9MA 1NSPA 3PO4A 3EWGA 3RB3A 3UFCX 2CPYA 4UTGA 1FDBA 2FY1A 5AVUB 1P27B 3TNUA 2HPCA 2AD9A 3ZXWA 4KR0B 2ZJRQ 2I9SA 2OD6A 5CCGA 1FJPA 1HHTP 2HFZA 3PIOQ 1Q0NA 4ECQA 1YRTA 3PM9A 2W2NP 4F4YA 4L3KA 1QLED 4B3OB 2ABYA 1JY3P 5D78A 1S5ZA 4ZPCA 3PX0A 3BN7A 5KFVA 5HO4A 3ZZTA 2Y9HA 3VALA 4O0IA 3R2PA 5IQQA 3Q22A 3PRDA 1LEOA 1W25A 2ZDPA 5CZXA 2FKWB 3ENAA 1CJKB 2QX0A 3CI9A 2WPVB 4YEAA 1JLEB 1UEVA 2HQFA 4RX6A 2IM0A 3KG1A 1R8CA 1DTQB 2CJXB 3M9BA 4ZCLA 3MMBA 1FJEB 3DLJA 3JTNA 5C42A 1PAEX 2OEKA 2BM1A 2YNFB 1LWCA 3PKMA 2AXTE 5HQ8A 4ECXA 4ZK7M 2BDPA 4B9UA 3G4SP 4QR0A 4IOCQ 1U02A 1IR1A 2WOMA 1WC4A 2QYGA 3TA2A 2DKOB 5KFYA 1NTZJ 2ZWPA 3CJKA 3RYLA 4FVMA 5KT3A 1YZ7A 3KLGA 4FXVA 3DXBA 2GHVC 2KJVA 2JC0A 4PWDB 5KJ7A 1HI8A 4KO0A 3HD2A 1GTHA 2XMMA 3P96A 2B87B 1TELA 4FBUA 4FF4A 3I4PA 4F4WA 1TUGB 3PLNA 4U3FD 2LP4A 3R97A 2NZCA 4I6WA 1CC7A 1DQ9A 3L75J 4K59A 1N5QA 3KLHA 3W9HA 2P8IA 1W2EA 4X65J 3S7RA 1KILD 3R5CA 4OV6A 5F9LA 4KT0J 4I7ZB 3AB4B 3AA9A 3NFQA 2Q1LA 5IV3A 1CJVB 4J9PA 1SJFA 2FYUD 1JLAB 2ZJQQ 3IG1B 5AVVB 2GVZA 2KG1A 5C24B 1VQNS 4ZMMA 4OQJA 2FGOA 2DIUA 4PG6A 5APTA 1Q90D 3MHVA 1FRLA 4RU9A 3CJTA 1JY2O 4KGKA 2NR0A 2CQIA 5HP1A 2Z56B 1YZ6A 3OR1A 3CCVS 3OSNA 4I2PB 3ZZRA 4QYZJ 2E76C 3I5CA 3WU2H 2HZCA 1N4LA 2POHA 2PT0A 4WFAQ 1RAFB 3WHIA 3MEGA 1BQMB 2IYIA 2GVDB 1M90T 4K4VA 1ROFA 1WC6A 2H7HA 1KVIA 2W2QP 3P32A 2P9CA 4ZMDA 3I31A 2EPIA 2RKIB 2BE9B 2V4JB 1U6ZA 5HLFB 1HBMB 2Y0CA 2GO9A 4EGLA 4RL1A 4OVNF 2A06E 4D6TE 2UUAF 1VRUA 1QAYA 4UOFA 2QA4G 3DLGA 2VICA 1HWUA 4ASVA 5HROA 1I51B 3MCSA 2A3JA 2AGPA 2CQ3A 3GIIA 2KK7A 2FXPA 3GJQB 4AXJA 1HNWJ 4CWBA 1LWUA 1H0TB 1S1VA 3I5BA 1LTJB 2RF2B 2RSQA 3MECB 3GJSB 1U45A 2IIHA 4EYHB 4MYUA 1WI6A 2YNHA 2E76D 5CQGA 3MGJA 3MD3A 1RF0A 3RL0g 3VP8A 3BYRA 4NLPA 2GIRA 3OQ2A 2PP6A 4ZS6A 1HWLA 4WBAA 2C3PA 3Q8PB 1L0LG 4OJ1A 3J80Y 2R8JA 3U27A 2Y1IA 4CH7A 2M3EA 1HTLC 3AE7C 2M2BA 3Q8SB 1WOSA 1X9SA 2KNCA 2KI2A 5F8NA 1SV5A 2GS8A 2QLJB 1FJ7A 1VQKP 3G8TA 1MNEA 2GIFA 4J5OA 3PH0A 2Q6BA 2Y9YA 4UB6H 2UUCJ 4JBZA 2HVEA 2P58A 4J9RA 3IF4A 2K7KA 3ZZUA 5KFIA 1IN0A 2MZRA 4WKRA 4NZ6A 4QJVA 1N33F 3SFGA 1NU1G 1IKVA 2DNMA 3CIZA 1SUQB 1BGXT 2RB7A 1WHXA 1WHWA 3BSOA 2IBKA 2VBZA 1RH5B 1AW0A 1MZ9A 3MIWA 2MQPA 1YJWS 1Q86T 2XC9A 3CCRP 1IJFB 8AT1B 2E74C 1F3FA 4A4JA 1YJTA 3U1CA 1BWEA 4V19J 1FHTA 1WMKA 3RK3C 1H8AA 1WG1A 2PD1A 3P49B 2CNNB 4GOEA 1U0SA 2ZAEB 4BBYA 2MQOA 2I5JA 3T5HA 4HYKA 3D6HB 2UUBJ 4Q0BA 7AT1B 2ROEA 1T9YA 1RXOB 2EBEA 3AD9C 2I1KA 3TJ9A 3F73A 3C6TB 2J0QD 3OL6A 1PPJG 2O3DA 3LH2S 2IBZD 2LXIA 2WVFA 4DG1A 2GA7A 2D9OA 1RWNB 4ZP9A 1ELOA 3MM8B 4KC5A 4OJ3A 2Q79A 3BASA 2D3UA 4WWSA 2MYFA 2ZOMA 4MJKA 1VYAA 2CVEA 4PJ0E 2P9EA 3D3CJ 4QZVB 3R7BB 1LV5A 3BZQA 2UVWA 1WI8A 4ELVA 3H2VE 5AW1B 3SWFA 1VQPS 3PIPQ 4YR2A 1C0UB 4QIVA 1HYSA 5KG5A 1CPZA 5DM7Q 1VRTB 3D0HE 2WITA 3CMQA 1JLQA 5A0YB 2ZWOA 5IT9U 1SIZA 2DNLA 5D4PA 1MWZA 1XK8A 1CJUA 3C15A 2CQDA 5ETRA 4JP8A 1LT9B 2CJYB 3G87A 3SWYA 5D4NA 3L74J 2XSFA 5KAIH 3G2XA 4IYQA 4PG8A 3AODA 3I0RA 2FJWA 1BQNB 3BH6B 4NLDA 3CX5E 4KV8A 4JI0F 1R5LA 1VCTA 1QGKB 4LF8J 3A8EA 3MEEA 3F44A 1YJ7A 5H9FK 3DMJA 5D6GA 2IAJB 4BRYA 2VG7A 2DNKA 1R8AA 5T41A 4QIEA 1HNIA 2JKVA 1NAQA 2Z0GA 3GF7A 4YHHF 2R7RA 2XCAA 3Q86A 1J2VA 5FLXY 3CXHE 2N9YB 3MAQA 3G8SA 4OMFG 2LEBA 1RTJB 2B89A 4BLGA 1L4AC 3GCWP 3EXCX 4OJGA 3M7VA 2AJQA 2KS1B 4NPFX 3SBMA 3HK2A 4DU8A 2J58A 2MLXA 2B9BA 4G65A 5E79H 1H6KX 1S59A 2BE2A 4I7FA 3DOKB 4J9KA 1HUCA 3DRRB 2QG4A 4DI6A 2WSFC 2MKHA 2MB0B 2VHGA 3H2LA 3KUHA 4Y0FA 4RNOA 2B9EA 4CO0A 4P52A 1PO6A 2GQCA 3KJVB 2PFFB 2RS2A 2DR6A 1IWGA 2QSWA 1IC2A 2R7UA 1GK8A 5A8WA 4FS1A 4JI1F 4GVBB 4CLYA 1D1UA 4QWAA 2KIKA 2DTJA 2UVUA 1RE3C 5F0UA 5L1LA 5KFMA 4YTPC 2FYXA 1PZQA 3KK2A 4OHXA 1C1BB 5IWAF 2W27A 4LF5F 1N7SC 4KPYA 4TLRA 3TARA 3HUSB 1FZEA 5BU5A 4J9NA 1RTZA 3CD5A 4YQWA 3A8KA 3IRWP 4JUZA 3HF5A 2DR7A 3B5NB 1RWOB 2AJFE 2JOQA 4TU8A 3KHGA 4WU2A 1URRA 3W5XA 3J81Y 5D3GB 4P6QA 2IC3A 1W5CE 2KZJA 2OI2A 4G1QB 2OKQA 1AXQA 4H13B 5D0HA 2WMMA 5FDLA 1WRGA 3AJ1A 4AQRD 3BGFA 2CJKA 4J90A 1HL6A 2YX1A 3E01A 3ZNUA 1TL7A 1N34F 2MKJA 5K8PA 2IVFB 2XMJA 3KJNB 2G8YA 4TLFA 3K5BA 4N78E 1NH7A 1RWXB 1A02J 3JQKA 1CG2A 2A10A 5I3QA 1ZOYC 3IN5A 3TGUE 2QJYB 3DRPA 4B9VA 2NXNA 1SQQE 1WEXA 3J7ZT 3UO0A 2CRLA 5AT1B 4NZ0A 3HJFA 3SCLE 2OAUA 3NGDA 2QFJA 1J5EF 2QA1A 5GMEA 4I2LC 2LKMA 1JM0A 4PV1C 1FDAA 3VAHA 3R4YA 4DL5A 1NGMB 1FX2A 4KYZA 1NTZK 2EK1A 3D6MB 5GTHE 2WONB 1R27B 4YFUA 1S79A 1X4GA 2DY1A 1RT2A 2UXDJ 4HTJA 1H0HB 2MSSA 1OVUA 3MM6B 1PP9D 4MMOA 3OVSA 1L2PA 3KLFB 3RUBL 4I2QB 3AEDC 1LWFB 2AEMA 1EETA 3OD2A 1DY3A 3O2IA 3L36A 4C3LA 1GMUA 3GPAA 1NTME 1TK0A 2P1JA 1IO4A 3AHPA 2OTLP 3QLHA 3UVJB 1UZHA 2W6AA 4BC9A 3V6HA 1KYOH 1NHUA 3M6XA 4K4TA 1N0VC 1RBLA 1RKJA 2WW8A 3JC22 2QGFB 2OEMA 5F41A 1PL5A 2JJ4D 1SIWB 1BE4A 1M5KC 2JWDA 4MYTA 3V2PA 4ID5B 3CMAS 2ZXEB 4IH6A 4PV1D 1PGJA 1REVB 3GONA 1A6LA 1CI6A 2C0WA 1YJNP 1EP4B 1DX7A 3NOGA 1JKHA 1Y4ZB 2MQQA 1DURA 4DL6A 2UUTA 4C4WA 4QYZK 1F5AA 4OZ2A 2KSJA 2V6AA 5AXKA 5IM0B 4DUYF 3TANA 1Q8IA 3QIDA 4UQTA 1N7LA 3RZAA 1GFWB 2YQ0A 3KMQA 2JC1A 3P8CD 4Y00A 3M9NB 1Z56A 3POTA 2APOA 3Q5RA 1UVIA 2L3MA 3SQGB 1QE1A 3AY0A 1L0LJ 2K3RA 1N36J 4LRCA 1JLBA 5D15A 1VF5D 2CJAA 3CJ8A 4UY85 2OUGA 4NCAA 3TYYA 4FDFA 4NA3A 2FHJD 3MZWB 2ZH7A 2QIWA 2E1CA 2ADCA 2XS7A 2WZ1A 1YWXA 3V5RA 3D6TB 3C2PA 1O8BA 1HHQA 3P7KA 1P84E 4OI4A 1AUSL 2XBPA 4AUWA 3EZ5A 3OVAA 1FE6A 4MK9A 1JK9B 1SQBK 4ECYA 4UT4A 4JV0A 1I94J 2B43A 1KILB 4A8FA 4R8UA 3ITHA 2E7WA 3CCVP 1NU1J 2C2OB 3NNCA 4HI1A 1D9FA 1DEBA 1RP5A 4DR4F 2G13A 5AW2B 1YVFA 5APUA 2IDLA 1SFCC 3M06A 1L3VA 2RQ4A 1TK5A 4JV5J 2LXCB 2W2OP 2K9JA 4I6AA 1B3TA 5T7LB 4PD4E 4YXDC 3NAIA 1Y9BA 4HI2A 2M5AB 1RQUA 5IZHA 1FRXA 3P8MC 3QIPA 1OMSA 4FZVA 3DGPB 3H1LD 4C9DA 5GTIE 4A8KA 4KHPJ 2JEFA 2A2CA 3CSKA 1N8RQ 2YKAA 2OPSA 2VJVA 4WZMA 4A47A 1MKMA 3CO0P 2QEXP 2FYUE 1EB0A 2UXBF 2VQFF 1M5VC 4EO8A 2DCUB 2BACA 3VQTA 4WCEQ 4LF6F 1XR7A 3V4MA 2XY5A 1SFCD 3B82A 3FMBA 2YNGA 4H54A 1K44A 2XULA 4ZPAA 1S76D 5EGYA 4FVCA 3AE1C 3D68A 5E3PA 2FQQB 3D1OA 2GHWA 2IDEA 4DDFA 5E3AA 4EFAC 2JLEA 1UJ4A 2WQYC 4RW4B 2KHDA 3T1YF 2E76B 1KVJA 3AEGC 2JVOA 3Q8VA 5CJ0A 4F04B 4R0JA 2GHPA 4DL3A 4UOGA 1VR6A 2ZD1A 2VPYB 5KFAA 2VONA 1QVGR 4ZN1A 5IXUA 2CK3H 1TV6A 5ETKA 3EVOA 1CBKA 3DHXA 3FBEA 1FVQA 4NOHA 1E6YA 2E66A 1WF0A 1RU2A 1KTQA 4LSLA 2CZVC 1F60B 1MU2B 4K4UA 4KJMA 3CNQP 4YP3A 2P2CB 2KKHA 4C7RA 4ECUA 3IWNC 5FIIA 4D6TJ 2L9DA 1NDPA 2ASYA 1TFYA 2ZHBA 3L73E 4EYYQ 1WJ9A 2BE7D 2YWGA 4LQ3A 4M5JA 1ZLLA 2Q3EA 3B4DA 3HKZD 4G1IA 1Q8KA 3KXDA 4ECWA 2RT3A 2AEJA 2KO1A 1PG5B 4WK1A 3M8SA 4JPZB 2FJVA 2YX7A 4NEZA 2DNZA 4ZPBA 1KFMA 1S57A 2UWJE 5APSA 4UZBA 5DDQC 1OSCA 1T3UA 1B64A 4E0DA 2FB0A 1DD3A 5KG0A 3ZTOA 2XTJP 5EWFA 3LO3A 4RESB 3G6XA 3AECC 2QM8A 1LWEB 2HHTA 1YX2A 4AL6A 1RT4A 3D67A 4DL7A 4Q8EA 4L6V3 2VZ9A 5LOQA 5U47A 4Y34A 2B5JB 3GZ7A 1KD1T 1N52B 3M8QA 4IDKB 1M1GA 1WKJA 1NEEA 2ZYAA 2YIUC 2NYIA 1EARA 2WCXA 2AJ2A 5GMKa 3I56S 4DV4J 3MUDC 3A12A 3A0HH 1QM9A 2QJPC 2EFQA 3CCLP 4X2BA 4B9NA 2PDAA 1G2EA 2BZ2A 3Q89A 1XMBA 4MK7A 3JYTA 1VQPP 3CD6P 1QAJA 3W9JA 4GC7A 1S9FA 2M52A 1H89A 4KT0C 4RW8A 1ZA1B 5CXTA 1FDIA 4CNZA 1C0TA 3N6MA 1NWQA 4DZOA 3NTNA 1ZZFA 4LBHA 5CHCB 2HFSA 2HFUA 3SDEA 4F0HA 2E74B 1JUNA 1NTZD 2DXFA 1Q2NA 2ROGA 2HRUA 4HR2A 1MN7A 3UPFA 4W92B 2B4PA 5LT5A 3EXYA 2BEZF 3DOMB 1URQD 4QWCA 2YKMB 1S5LE 3C16B 2IBZE 1VC6A 1SQVG 3S4RA 1VBZA 2OSRA 3BGUA 3M2VB 4P72A 2CPFA 4UZCA 3JSVC 3TK1A 4JI6F 1W7WA 3E1RA 1XEZA 1QL1A 3WBZA 1WD6A 4CZCA 3L75D 2CQ4A 4KHRA 3PCOB 5ETVA 5APQA 4ZCKA 2JZ5A 2HBZB 3RL0D 1W2BR 1RISA 4W7YA 1FRJA 2PE8A 1VQ5S 2Z2MA 4IRKA 5AXLA 1CEZA 2J59M 2PEHA 2OPRB 2XV5A 4Q45A 1NDKA 2L41A 3PEJA 1T7PA 4DV6F 3CCTA 2JX2A 5RUBA 1HQEA 2XG8A 4GKJJ 4NI2B 1U49A 3D70A 1Q8LA 2JR8A 2EC0A 1HNXF 2LVWA 3PW4A 3CIMA 1DJ0A 4CH1A 3P3DA 1CSJA 1KRPA 1OZHA 1TR0A 5GADI 3ETMA 4ID8A 1F3VA 3T1YJ 3VMAA 1FTRA 2KZZA 3OHAA 2HRYA 3G9RA 2V7QJ 1XN9A 3MUMP 1VLOA 5JUMA 2IJNA 1SXLA 5B0AA 2WPRA 1FDNA 4IG0A 4OYPA 1QVGO 2XNDH 4Y3CA 3IR7B 4BWMA 3AE5C 3KPEA 5E5NA 1HNZF 4ZP8A 2N1TA 2AYGA 2DH7A 4RNNA 2CNLB 2R3CA 4DBQA 3DU6A 3S1KA 4J7CA 3CJ5A 2KN4A 4NLVA 2ZVNB 4TY8B 1AVOA 1S72S 4CO4A 4ICLA 2J8SA 5EX0A 5BJRA 1S2EA 3MMCB 2J9EA 2DGWA 3M2RB 1KC8Q 1VQ9S 3W63A 1RLDA 2NPSD 3DLEB 2KOGA 4MAKA 3G82A 3VYIA 5DETA 3AXMA 1XMQF 3PG9A 2FZGB 1UWBA 4HACB 3GMAA 1N5TA 3H1HG 5B0GA 1D0EA 3TZWA 2V8PA 1UEKA 3DRSA 3WC0A 4H4OA 4NYOA 4ANEA 2ZEJA 5KAKA 1K0VA 3GV5B 1RT7B 5CCGC 1VQ4P 1VQOP 2MDAA 3NGUA 2VC1A 2C3UA 2BJ7A 4CH0S 3M91A 3DDIA 1B7YB 3Q8QB 4JI5J 1N88A 2WSSH 2ZH5A 1JY3O 5D8HB 3ZO7A 3RR8A 3TUPA 4IG3B 3TWZA 4ILMA 5ETLA 3BSNA 2J5UA 1U1OA 2P9GA 5IC4B 3FFIA 3HSDA 2ASDA 3FCWA 3KLEB 1ZM4A 3A3NB 2GQQA 1HBUA 1NU4A 1UAWA 1LK7A 4TVAB 4TKTA 2ZE2A 2W4DA 2V2VA 4PG4A 4TYBA 1KORA 1OIPA 5I4MA 2E1RA 2ZUAA 1M56D 3A3PB 4WY4A 2HHQA 2H8PD 3HSZA 4DV3F 1TKDA 3R27A 5AVXB 2DGOA 1SB6A 3CDEA 1O51A 1R8EA 3IRXB 1RCOB 2JLFA 4A48A 4EBEA 4Y2AA 1TL1B 5CBOA 2RUGA 3H1IG 3ISND 1QUPA 5CCGD 5KG2A 4NXNF 5HBMB 1NDLA 3BV8A 2CADA 1L0LK 4DSJA 1LKZA 4GVLA 1FK9B 4GC6A 2QA4S 4PPZA 2ZJPQ 3V6KA 2FDNA 1J1DC 5KJ7C 5HVFA 1RUSA 2CPIA 2IM1A 3IAOA 3M4XA 3VCDA 1NKBA 3H40A 2PMZD 2E44A 1KS2A 5A8KB 1TMJA 3QRRA 1I6JA 2DRBA 4OLOA 3P45B 2HFVA 4LFAJ 4E2FB 1FERA 2HODA 2LEAA 2H54B 2R7VA 1KSPA 4FYDA 3DI6B 3CWJA 5G0RB 1NU1K 2XNXA 2K06A 1JTHA 2QO3A 1AUDA 1UFKA 3BH7B 1L3SA 2BOAA 1W2BO 3CMES 1ZV8A 1O5JA 1SQQJ 4KH0B 1PP9E 3HVWA 1FXRA 1BCCG 3NEKA 3M6VA 4PV1B 1YBKA 2MKVA 3ILOA 2ZVSA 4GT1A 4TU9A 4JV1A 1TP7A 4EO6A 4KSEB 3UCGA 5A76A 2XYHB 2BYCA 2VBXA 4DS5A 3MPUB 3ENWA 1S9GA 2D2CC 4IR1A 2BM0A 5LMUJ 1DLOA 2UVVA 2F8MA 5KFRA 4Y2MA 2B4OA 2EFOA 2CZ4A 3M2UB 1IXKA 1FXDA 2FZCB 5ETTA 2V4RA 3L74D 2DGUA 1LJ2A 4X62J 4DR5F 3DLKB 1NHKL 3NMRA 1DTTA 1ULRA 2BCCG 3O44A 4DSLA 1VIXA 3CUNA 3F0NA 4WE1A 2K7JA 3TVYA 4EYIB 1HGVA 4DL4A 2Q9IA 4HJGH 1VHFA 2XO7A 3FUYA 2AZ3A 4ILRA 4GKKJ 4U8YA 1N54B 2V0NA 4OX6A 5D0EA 1RYRA 5CHXA 2JWAA 3R3TA 3TZXA 1G1IA 3FK4A 4IH5A 3UE2A 2E5LF 3BBFA 4BHQA 1YBUA 1VJWA 3V4IA 1S6OA 1UA1A 3GILA 3NKYA 3J7Z5 1RB0A 5L8RJ 1S1XB 3WX4A 5KT6A 2C28A 1RGVA 1JXVA 2EC2A 1VBXA 4B3OA 4X4TA 1RY3A 4IOIH 3DKDA 1QLNA 4C8YA 1BMQB 1GXUA 4BXLA 5E3QA 3P8CE 1LWUC 2FJAB 8RUCA 4RO0A 2RMLA 5A2QY 4ED8A 1RWWB 2PSZA 1AYEA 3HVTB 2GQ2A 1UW4A 2Y0SD 2C3YA 4LSNA 2HFNA 1S6QB 1X4CA 3FCHA 1KZUB 4OJHA 1RF0C 3MFIA 3K8WA 2IMWP 1YQ4C 1JY3N 3N01A 1CJKA 5HJYA 2MGZB 3C46A 2CNKB 3W2VA 2QVAA 4R25A 2HHHJ 2EFGA 2SXLA 5AW4B 1SP4A 2OIHA 5KFSA 4PWWA 2DEIA 3KJFB 2YNFA 3PP5A 1T3OA 1VIOA 2KM8C 4N8NA 1AJYA 4OFZA 5IT4A 1X8DA 2C2KB 5E2QA 1W26A 4MK8A 3ET6B 1YJVA 1IKYA 3W62A 2YNYA 1TAUA 2LECA 3VQSA 4EOTA 3ITKA 1U6FA 4AT1B 1PAUB 2FJXA 1YSJA 2Q6CA 1OVVA 4DV2J 4PWDA 3M1VA 4A8YA 2RS8A 2MY7A 4PQUB 4EWTA 2B87A 3KYQA 1M1KQ 4DR3F 1TUWA 1PIXA 3DDNA 1OJ4A 3KHLA 3DLBA 3VAGA 1NK7A 1SFCB 4J9SA 1M5OC 3ULHA 4FKXA 3NMAA 2KRBA 2XYPB 1RT5A 3IFEA 4ZHRB 2DO0A 1EC5A 1T9VA 2OSQA 4O3PA 3RGIA 3H1LE 2AJ4A 1X0FA 4B3RJ 2KTQA 3WUUA 1SL0A 1NKEA 4HT7A 2QLFB 4IL6H 2GM4A 1WELA 5DQGA 1SQVJ 3KZIH 1S0MA 2VG5A 2FBWC 2PA8D 4YR0A 3H2UB 1CJVA 1LFWA 1JLAA 3IG1A 3ILLA 1FNXH 3L4BC 1XMOJ 4OLPA 4DR6J 5EWEA 2BOPA 2HNDB 1KN7A 1O6XA 4M8LA 3DU5A 2EW9A 3BO2A 2DGQA 5ETMA 4C46A 4HL9A 1H2VZ 1RADB 4I2PA 4Q5VA 1RTIB 2O1KA 4XA4A 2AP6A 2H5IB 2F9JA 5FLXU 3ZC4A 4WP9A 2DNNA 1FF2A 5D0RA 1BHNA 4CLKA 3F5HA 3S6EA 1FZGA 2HWHA 3BCCG 3MURP 2H48B 2HNYB 4ZLJA 4NWBA 2HS0A 2CZ9A 1EKRA 1X0PA 3BM7A 1FRMA 2XI3A 4K4SA 3Q8RB 2RKIA 5GAHU 4WZQA 2V4JA 1HR0F 2BKOA 2JNJA 5HLFA 4DV5J 4JBCA 1HBMA 2HQCA 4RW6B 2F4VJ 5D0GA 3T97B 3RK2C 2V8DA 3EPIA 4USIA 1RT3A 3RTVA 5APWA 2JEJA 4Z1MH 3MR6A 1D8ZA 5E3RA 5CZVA 3GSDA 2HZVA 1H7WA 3R2DJ 3QGPA 3ILIA 3N28A 3GWCA 5HMYA 2QL7B 3PY8A 5AW8B 5AVZB 5B0CA 2WVBA 4JI2F 4AXIA 1H0TA 4U9RA 3TAMB 2W9BB 2KLVA 1LTJA 2C42A 3MFHA 3MECA 3JAMY 5DZ7A 2F65A 1IBLF 1Q7YQ 1KR4A 5J1EA 3C19A 4WYWA 3VGUA 3K7RA 2BJ8A 4LLHA 4IFFA 4ZJQA 5SZTA 3HHLA 1N5YB 1C4AA 1UW9A 4J9QA 3T9NA 2D3O1 5DLFA 2MPUA 2CQ0A 1EXJA 2R7QA 2NXUA 2PIIA 2BKNA 3CD0A 3HHKA 1JLFB 4B17A 2W7PA 2HFED 5HQMA 3R2CJ 3L73J 1YQ3C 1XQIA 1AFIA 4DQSA 1X0TA 1BUXA 1D8YA 4NX9A 3H1HJ 2K1RB 1F2GA 4HH2A 1ZTWA 1ICEB 4CRJA 2HYIB 2IX7C 1B7FA 2DGSA 3ZFVA 2E9RX 3QAUA 1SH2A 3GQCA 2QRRA 2K1AA 3IM8A 2B6AB 3P4UB 1R0AA 1QSYA 1URQB 2KT5A 2FLLA 1MFZA 1F9FA 1VQ5P 4R4LA 3T19A 3FSYA 3JTOA 4N41A 3PR5B 1RTDB 2AW0A 2QJPB 5M2UA 3MR2A 3GJRB 4CLLA 2R2SA 3GU0A 5GVQA 3RL0B 1U2RA 3N79A 4V1Ak 1NU1D 2KYVA 3MTUE 1NTZE 2CA9A 1GMWA 4I6YA 1ZRTD 1SI9A 1G1JA 1MMDA 1DZ5A 1NKNA 2JH3A 2PMWA 5CCHD 3QFWA 5HATA 1LW2B 4ALZA 3R6LB 4C7QA 1NH8A 3A3OB 4AFFA 4KFBB 4QWEA 2ROPA 4FXWA 1P9QC 3PYDA 3OVBA 3IM9A 1VQMS 3MM8A 1WF2A 4ED4A 1GZLA 4WFZA 3ELHA 5KFBA 3L75E 1Y47A 5AVRB 1FX4A 1JOCA 5KFFA 1FZFA 1TKZA 5BVZA 2D41A 1S72P 2HFOA 2Y3YA 3VAFA 3RBEA 1RHMB 1S1UB 1VQ9P 4ZIWA 3RB6A 3N0VA 3CDBA 2DR8A 3MR7A 4JYAF 1SJ4P 1BE3E 3VMZA 1RLCL 4JI4J 1C0UA 3SV3A 2RH3A 3TEHB 2O1JA 4UF4A 4OYMA 3FKBA 4KBIA 1ZETA 3PZPA 1S10A 3OFGA 2GW8A 3RR7A 2O01N 2N3OA 2LXUA 3KG0A 3NXSA 4Y99C 1OPZA 5APYA 3WIVA 1LT9A 4K2XA 3NGKA 1WDDA 1ZS6A 1BCCJ 3G6ES 2NPSB 1BQNA 3H25A 1UWAA 2HK2A 3HE5B 1S1WB 3W60A 2BR0A 3KQGA 2IAJA 2X1AA 1HWIA 5DG7A 2BVZA 2N4CA 4X4QA 1P1TA 1B0PA 6FDRA 2Y9ZA 3TX8A 4OGQC 1VQSA 4IFMA 5CYMB 2ZH8A 1FE0A 1IR2A 1KQFB 3TVZA 2C9LY 1CW5A 5TJHA 3TI0A 2RUSA 2BCCJ 4DZDA 2GGPB 4OI1A 2OO4A 3T5JA 4JI2J 3DOKA 2Y0EA 9RUBA 4C3KA 4XPEA 1FI4A 2XSJA 1SQQK 1KBRA 2AWZA 2CQGA 1IQTA 2A06D 4D6TD 1SQBE 1SKWA 4KY3A 3BYPA 1UP1A 3C14A 1KWMA 2YNIB 2V63A 3H8YA 3V81A 4KHXA 3PEHA 3PHLA 1ZYQA 2VRSA 4X4PA 1N56A 1L0NG 3J7A1 2FVQA 4GVBA 1Y8AA 1FD2A 4OX9J 2QA4P 4YMEA 4ZVUB 2A0FB 4L72B 3G6YA 3RRGA 3TNUB 2HPCB 4OGQD 2B0GA 3CO9A 3PXGa 5F8GA 4OYBA 5C39A 5L1KA 3O1LA 2IZ1A 1N73B 1JMTA 1EIYB 2HQ3A 4BC7A 4YXWH 2BEQD 3O8ZA 1K8AQ 3QT6A 1X4FA 2CVIA 1QD1A 4LUBA 5DO2A 1K1SA 1JLCA 3PR4A 2VU5A 2VQEJ 3CCUP 4C11B 1X8YA 1GAOA 1FNOA 2C22A 5B66E 2OYIA 3MPWA 2Z4PA 2Q3PA 2FYZA 2JO1A 2QLXA 2QV6A 3W8PA 2J9CA 2CJBA 2HK3A 1S49A 4OI3A 1NMEB 4HB1A 3I32A 1FZCB 5D3GA 2KXPB 1AZSB 4RR5A 2OP5A 5KFEA 5DQIA 4X4OA 3SFUA 1CLFA 2G0JA 4C7NB 2IVMA 5C42B 4DPOA 3O5TB 2XHCA 3NOCA 5JMNA 4U7JA 1OY8A 1LWCB 2VJUA 5AXNA 3IXQA 2L9NA 3NXZA 3LP1B 1FJGF 2M7SA 1FZAA 4X64F 3L09A 4RKUC 2HLUA 1PSDA 2YWEA 2JFDA 4U3FG 5KKZB 2R2UA 2IBOA 3H1KG 1U1NA 3NCQA 2J5AA 3CJKB 2VFRA 3LGMA 3KDPB 1U1MA 1DHMA 1T3NA 2W9CA 2Z2LA 3OHBA 1VFJA 5KFLA 4KPCA 3PFOA 3QSYB 3SIPB 5IT0A 2ATCB 2B8QA 1A0OB 4DX5A 3MGNA 4ZPWR 4ZITA 4AL5A 3I9V9 4PJ0H 3S1TA 3H0PA 4B3SJ 1T05B 1PBAA 3MM6A 2UV8G 5LSRA 5LMNJ 3KLHB 2MQ8A 3M6WA 2ALZA 2ZJSE 3QJPA 3KLFA 2NUHA 4I2QA 1LWFA 2GV1A 5KFCA 3PJWA 3MCMA 1FS0E 3B8HA 4C6AA 2BV3A 3VVTA 3PYGA 4FYWB 4DF8A 3RBZA 1F9HA 2NRGA 4WJBA 1NZ8A 2D3OR 3CCMP 3BCCJ 2V7QH 4F3MA 1AA1B 1VK8A 3CC4P 2OLWA 3NBPB 3WZ0A 5J1NA 3LP0A 5HP1B 2D2CB 4QW8A 3CX5H 4K0KJ 4W4MA 3OR1B 3QFHA 1SQVK 3OA7A 1RTHB 2FHKA 4UOCA 4JV2A 4FPIA 5KAIE 4WKYA 3BPDA 1N5SA 4ID5A 1LP1A 2AKWB 2CPDA 4CO3A 1IJEB 3SYZA 2F4FA 1REVA 1FWKA 3M9MB 3MEGB 3CXHH 2ACYA 1YI2P 1CULB 1CQNA 2HIQA 2XCPA 1T9WA 2PO4A 3OBIA 1M5SA 1RWUA 3MMAA 1L3KA 1RHQB 1RACB 3IAS9 3KLVA 4WFYA 2V4HA 4OX8A 4B3TF 3W64A 1NB2A 4A7PA 2FYNC 1VRUB 3DLGB 3PKYA 2AYMA 2HEKA 2FTRA 2QA2A 1LTTC 3LWMA 4TN2A 4AQYJ 3FEXB 4DT0A 1KFSA 2DT9A 3SQGA 3CCJS 4WVZA 1J2JB 1CQMA 2LXBA 4ERDA 1G1XA 4ANCA 1S6PA 2YNHB 1QTMA 1NPKA 2HS3A 2JDJA 2ZT9C 1JXEA 3E7KA 3H1JG 4ED0A 3BATA 3M6UA 2ASJA 3M9QA 1RWMB 2HLOA 4HHJA 1S0VA 1S4XA 3PX4A 5KFGA 2YQ3A 1U25A 1H74A 3ZDMA 1JMBA 5LJ3Y 2DIVA 4LRDA 4ZVEA 1KILA 2QMXA 2Q5UA 1UTAA 3HSJA 1NK8A 2E7XA 2XZWA 2HGMA 4JYBA 4NLYA 3KLIB 1ZR2A 5BYSA 2KM8B 4QU7A 1HGZA 1SV5B 2HSEB 4RJTA 3G96A 1DRZA 3EUNA 1FJCA 4UW2A 3NP5A 4C98A 2KDOA 1S9EA 2QL9B 5K5MA 3J7YI 2C2MB 4O9BA 1VQLS 1FAVA 1IKVB 3KYLA 1VQ8S 3H5SA 1JMMA 1GQEA 3A5TA 1WG5A 3EFGA 4QOTA 1Y3KA 3G8QA 2CQBA 3M8RA 2AJ1A 1LGHB 3PTWA 1S4EA 3QO9A 5B0FA 2GFFA 5DDPC 4DFKA 3KK1B 3HD7D 2RHSB 2YXQB 2LU2A 1U7JA 3D28A 2KXNB 3UI3A 4Q0BB 2WPQA 2L48A 1YQHA 1Q78A 1ZPVA 2LYVA 2FPHX 2XMTA 3C1LA 4X65F 3UN3A 2KZIA 2XO6A 1VOMA 3QWOC 4RWXA 4W80A 1PC4A 5BXIA 3EZUA 1YBTA 4DG1B 1WTFA 3U7JA 4LVNP 2RQMA 4O44B 1N8RT 4RW4A 1G4CA 1HF9A 4FYYB 1SJ3P 5GTHH 4LF4F 4DSEA 2FD2A 3VGTA 3LIDA 4P2XA 3OFFA 5HMWA 3B5ND 2JEIA 2XMWA 3F89A 4USTA 1SQQD 3MWBA 3EM1A 3MD0A 1RU1A 1X4EA 1TU0B 3JQMA 1TVRB 1GL2A 4YB7A 3QGIA 1NXIA 4LIRA 2WT7B 2NLWA 5CCMA 3H32B 3KG4A 1KQLA 2QSIA 1VQYA 3L72G 2NS1B 2V2KA 3NY0A 2B4VA 4X4RA 2FIUA 1IQZA 1HYSB 2R7WA 3MR3A 3RK2B 2VFTA 2KI7B 1T2KD 1FESA 1NZAA 4OZ5A 4NYZA 1KB9I 1LXNA 3AE3C 2KXHA 1SJQA 4I68A 4ASWA 1FBMA 3I0RB 2DEJA 4LRAA 3HULA 1H7XA 1U26A 2W01A 4TLQA 2RRNA 3HE4B 2MSTA 2N1TC 1RF1A 3BQ0A 1M8OB 1EZVG 1HNIB 4DV7J 1HNWF 4J9UE 2ZDOA 1VHIA 2KL8A 2OH2A 1NDCA 3L70G 3BKTA 3PACA 2PI5A 2XLKA 2QL5B 4FS2A 4NLSA 1U8SA 5BYRA 2L5GB 1VQMP 3CCQS 1PILA 1L0NJ 3DOLA 1SL2A 1Y5IB 2BQUA 4I7FB 3JQJA 1X9MA 1L0LE 1EJ7L 3GFHA 3D0GE 3OUYB 1NAYA 4I4BA 5AJ3J 5LJ5Y 1OQ6A 4MFBA 1XNRJ 3CJSA 1WEZA 1RWPB 2G4BA 3L3CA 3JXOA 3OL7A 2CAJA 4O0NA 3D4JA 3LA0A 2HBRB 3LALA 4CQ1A 4EUVA 1G2CB 3CXCR 4KJIA
chains in the Genus database with same CATH topology
2NYIA 2ZH3A 2WCXA 3UDCA 5GMKa 3I56S 2BW2A 3EX7B 2YH0A 1FKOB 3QWUA 1K04A 2UUCF 1QM9A 4USHA 2QYCA 3D1QA 2QJPC 5EWGA 2EFQA 1RT4B 1S0NA 2F3JA 4X2BA 3PW7A 5C25B 3F56A 5KOXA 4DR2F 3BO4A 4B9NA 3D6ZA 2PDAA 3OXGA 1G2EA 3AEFC 2E5GA 2O66A 4IKAA 3BB5A 2BABA 2BZ2A 4MK7A 1XMBA 3JYTA 2DD8S 1QAJA 1JLCB 4GC7A 5D4OA 1ZRTE 2ZBIA 1S9FA 2M52A 4B3MF 3DNCA 3QGHA 5KG7A 3HZGA 4X4VA 1X9WA 1T03A 1NJZA 3CF5Q 4IRCA 2WSFJ 4KT0C 3KK2B 2KG0A 2FLOA 4RW8A 5CYQA <