1G2CA

Human respiratory syncytial virus fusion protein core
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
50
structure length
50
Chain Sequence
LEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FUSION PROTEIN (F)
publication title Structural characterization of the human respiratory syncytial virus fusion protein core.
pubmed doi rcsb
source organism Human respiratory syncytial virus
molecule tags Viral protein
total genus 21
structure length 50
sequence length 50
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature
pdb deposition date 2000-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.300 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1g2cA00
1SVFA 4N6JA 1ZV8A 2FYZA 1G2CA 3KPEA 3EFGA 3SWYA 4EIJA
chains in the Genus database with same CATH superfamily
2N9YB 3L71G 2WSCJ 3VMAA 2R5DA 1IFDA 1SQVJ 2M8RA 3C9IA 2L91A 2ZYGA 3GG2A 1CW5A 4YXWH 3CCQP 2R3SA 2KNCB 2B88A 2KK7A 5BU8B 2K88A 1YJWP 5K5GB 4JBZA 1OMIA 1VL2A 2LXBA 1IFJA 1JMMA 3D70A 3TNUA 5AVRB 1SFCB 2XV5A 2WSCH 1BE3E 2QE7H 3AE3C 3VTPC 1CZQA 3H1KD 2K3RA 3G6EP 3D71A 4H13B 3CCLP 2OYHC 3G9RA 4C46A 3WUVA 3SWKA 2MKVA 2IBZI 2A06E 3L73J 2ITAA 4H0LD 1NWQA 2W90A 3AEDC 3TNUB 5TISE 1H0TA 1OW7A 4C7NA 2KLUA 3FXDA 2XKMA 2SPZA 1M7LA 3GLMA 3H1HE 3L74E 1NTZE 5DJTB 5KJ7C 1M8OB 2ZT9D 1RF0C 1VQ9P 5B66H 1KYOI 3H1LJ 3A7OA 1JCCA 5AVVB 2FBWC 2I1JA 2ZYAA 1EXIA 3RK2D 4D6TJ 4IL6X 2OYIA 2BEQD 4TT3H 1GD2E 2WITA 4A7PA 1SQPK 4C7NB 3MIWA 3WU2E 3AE1C 5EFWB 2IBZD 3H1IJ 2BCCD 5L8RJ 4KJMA 3KZIH 1Q2NA 3AEFC 4PV1D 1SQBD 1BGYJ 5APQA 2GM4A 4U3FD 2Z5IA 2NRGA 2KOGA 2QJPB 3EFGA 1GL2C 2FYUD 3HUSA 3M91A 3UIAA 1URQA 1AA0A 2Q6QA 2KI7B 3MZWB 1NTKD 1J1EB 1M1JA 4GODA 1L4AA 2BASA 1KYOD 1HJ0A 1M57D 3A0BE 3CCJP 5KJ7D 2WWWA 1KILD 2FYZA 2QM8A 1DD3A 2XDJA 1BCCD 2J58A 2WSEH 1URQB 2FFDB 1OWAA 1BSHA 3PH0A 2XU6A 4WBAA 4EOTA 1FS0E 1LT9B 2O3JA 3IFMA 5AVXB 4O9BA 5AW1B 3AE6C 1KMIZ 3L72G 1SQXD 5APYA 3L75J 1SQQG 2E76C 3AEEC 2D2CC 3HRNA 2P67A 1BE3J 3HTKA 3ABVC 5AW4B 1VQMP 3U59A 1PPJG 5M1BA 1CI6A 5GTIE 3I55P 2GUSA 1H88A 1MV8A 2O1KA 2IBZE 3NTNA 3SFEC 2BCCE 1K04A 3GF3A 4ZKPA 3O6QA 4CPGA 1SQBE 2PAJA 3HTKB 4U3FE 2KS1A 3QH9A 2FYUE 1DIPA 1SQPG 1VF5C 1G1IA 1AFOA 1L0ND 3BCCD 3L74J 1NTKE 3CCVP 1NTZJ 3WUTA 2V4HA 2JWAA 3Q5SA 2A45G 3F89A 3II6A 1M90Q 1VDFA 1NTMD 1BDCA 2YXRB 1KZUB 3CMAP 4L75A 1R8EA 1ZR2A 3L71D 2KZJA 2KS1B 1IFMA 1YBKA 4JYCA 1KB9H 3WMM0 1UIXA 2C9LY 2E74C 1KV4A 2OYIC 1GL2D 2O01N 1SS1A 2YKPA 2AEJA 1JY2P 2H8PD 3RK2B 2V7QJ 4I2LC 2AEFA 3NXSA 1S5LX 3ITKA 2W27A 3M06A 1NJIQ 2QVAA 1KQGB 4Y99C 2Z5HA 1Y9BA 1Z56A 4PV1B 1KILA 3TYYA 2N9BA 1FAVA 3HUSC 1EDLA 3C1LA 3AE5C 1M1JC 1PP9G 1L4AC 5AW0B 2ZJSE 3KYQA 2UWJE 2V7QH 4OWFA 3RBXA 3CI9A 3N7NA 5KAIE 4DCKA 2W6JH 2YIUB 3CXHH 2IFMA 3VMYA 4XFJA 5KLVK 2Y0EA 1FDMA 1L0NE 3PP5A 1T6AA 3BASA 3BCCE 4KT0J 2D2CD 2G8YA 1LTIC 1OIPA 2HG5D 4OH8B 1IZNB 3PRJA 2CK3H 4BXLA 2QG4A 3A0HE 3KQGA 4IL6E 2KSEA 1N73C 1SQVK 1KFNA 1NTME 1N7LA 2GA1A 3KHUA 3RK3C 1XTCC 1JM0A 4R4MA 1KQLA 1QLED 1T3UA 4GIFA 1Q90D 2M5AA 4PD4H 3JCUH 2BCCJ 3V4WA 2IYOA 5AVYB 3V4QA 2NPSA 1T3JA 5CJ4A 1VF5D 2OYHB 1G2CA 2CPSA 1RF0A 5E79E 1NTKJ 3AECC 3Q3DA 3H32A 5GTIH 3M0DA 4H0LC 4Y28J 5H2FE 2B87A 1PFIA 2XZRA 5AW9B 5AW6B 2OYOA 2WPRA 4GKGA 1SQXG 3CCEP 2YNYA 2W8ZA 3KXDA 1YI2P 1E5WA 2QJYC 3VYIA 1EZVG 1YYCA 2ZT9C 1G2CB 1IFPA 3KDPB 2P10A 2WPSA 3H32B 4M3LA 3RL0g 2WQYC 2R32A 1WRGA 1H89A 2LKMA 4AYCA 3L72D 4HB1A 2Q1KA 2AEMA 1SQQD 3GHGA 4LGDE 1OVRA 2AXTH 1S1CX 2A45I 5APSA 3GMAA 4XA4A 1HUCA 2Q7CA 4K35A 1PPJD 3IR9A 1JEKA 4DZOA 3CWBG 1GL2B 1L4AD 2YXQB 3AE2C 3CCSP 1JY2N 4L76A 5KLVJ 1H8AA 1KQSO 2IZ0A 1FZFA 4GOFA 1L0LJ 4JYBA 1SQVG 1KILC 1NAFA 5CHXA 4RKUJ 2WT7A 4DOJA 1SQPD 3MHVA 1NH4A 1FBMA 3BCCJ 2G3AA 4YXDC 1IK7A 1LTJA 3OA7A 2C0WA 1LTGC 4OGQC 1NTMJ 1WMKA 3RK3D 2IFNA 1MUUA 1HJBA 2WT7B 5KAIH 1U7JA 3S1KA 1EDJA 2YMYA 2E76B 3P8MC 1K05A 2D2CB 2M3BA 1RH5B 3L73G 2I8DA 4B86A 1XTGB 1SQQE 3A0HH 3RL0B 5KTBA 2E75D 3MUDC 2E43A 3HE5A 3AEGC 1LWUA 2NPSC 3IN6A 2K9JA 3USSA 1LGHB 1JUNA 3CCMP 1FZGA 3CD6P 2LXCB 1ZXGA 2Q5UA 1PP9D 1VF5B 4YPCA 1VQ5P 3M0DC 1ZP0C 1M1KQ 1OVUA 4D6TG 4UB8E 3CX5H 1HGZA 4WY4C 2NZ2A 5E79H 1NTZK 3VP8A 1H0TB 5H2FH 3L37A 1ZRTD 1SQPE 3EFFK 1S9KD 4JF7A 1X9VA 1BGYG 3U1CA 1IJDB 5DJUB 3Q1MA 1JMBA 1NU1G 2JR8A 5CCGA 1KORA 5CMZA 2E74B 1M56D 2Y0DA 1YITP 3RK3E 2R44A 3GHGC 1R5SA 2OYIB 4KHXA 2RN0A 1EZVI 1N2DC 1VQLP 4U7JA 2K37A 2J5UA 1DH3A 5AVQB 3H1KE 1ZR4A 2XNXA 1CSBA 4N3YB 1EC5A 4Y99B 1FJPA 1JOCA 1P84I 5AVTB 4R4LA 1FZCA 3HUSB 1T8ZA 1K8AQ 2O1JA 1M1JB 1GW3A 3MD0A 1L4AB 2JWDA 3L75G 3TSIA 1N73A 4NPEA 4OGQD 5KAFE 1KQFB 4DT0A 3CCRP 1LTTC 1BE3G 3L36A 3T97A 3TGUG 3ZDMA 1EZVD 3FWLA 4QMAA 3HE4A 1T2KC 1BSNA 2ZFCA 1LTJC 1RQVA 3SSUA 3FX0A 3E1IA 3V2PA 1X22A 1N73B 1P84D 4HJGH 1S9KE 1SQQJ 2IZ1A 3RK3B 3CLQA 2NPSD 2K9YA 3HE4B 4GT1A 3L74G 1J1DC 5BVZA 3GF7A 1CI6B 1JB0J 3H1HJ 3CWBD 3WUUA 1N8RQ 3L70G 1KYOE 4PJ0E 1LWUC 3CL3D 2WVRA 4WY4D 4EI2A 1Y8AA 4H0LB 1KTMA 2B9BA 1PGOA 1FDIA 2RH0A 3O6QB 1NTKK 1KILE 1SQVD 2J59M 3AE4C 5TISH 3M0AA 4ASVA 2O01J 1BCCE 3BVHA 2WMMA 4WWIA 3P7KA 2QJYB 2ZT9B 1HBWA 4HKZH 1JNMA 1QX8A 5APTA 2HFED 2JDIH 1SQXE 1JY2O 1KN7A 1EZVE 2N1TA 1PGPA 2CPBA 1JY3P 1ZN5A 5AVUB 1AV1A 3WU2H 2O01H 2DW3A 2R3CA 4MN4C 5CCGC 3H1KJ 2PP6A 3L73D 3U1AA 1VQ8P 2P58A 1GTWA 2HPCA 1P84E 3HD7C 3R4YA 2JEEA 3H1JG 1MZ9A 2H43A 2KSJA 4EIJA 1NAYA 4LLHA 1IO4A 3MGNA 1RE4A 4I1LA 3A0BH 1AVYA 1KILB 1FZCC 3CPWO 3BRTB 2HPCB 1L2PA 3CWBE 1L0LK 5BU5A 1N7SC 4NPDA 1T2KD 4D6TD 1GK6A 4AUWA 1U7MA 1ZOYC 4YTPC 2ZVNB 3K5BA 3W67A 1SQVE 2B89A 1X79B 1IFNA 4OGQB 3L71E 2HYNA 1YIJP 2KZIA 2Y9ZA 1BGYD 3L4FA 3PLNA 2YO2A 5KAFH 3FWNA 2OTJP 1NTMK 3MUDA 4H44C 1QVFO 1NU1D 2C0XA 3QWOC 4L73A 3VOPA 1SQBJ 4U3FJ 2OTKE 1FZAA 3B5NA 1Q86Q 2FYUJ 2E42A 3C8VA 4ZMDA 2OTLP 2AXCA 2E75C 1MKMA 3CCUP 2M5AB 5B66E 4WY4A 3SFDC 4Z1MH 2NPSB 5CCHA 1D7MA 1EXJA 2QRXA 1LP1A 3L73E 2PRRA 1JTHA 2P1JA 1E79H 1BCCJ 2POHA 1A02F 1IFIA 1ZW0A 1S2EA 1HF9A 3L75D 2B87B 5B5EE 1KB9I 4W7YA 1NVOA 1KYOH 4PJ0H 4WY4B 3E1RA 1SQXJ 3IAOA 3IF4A 3BATA 2ZAEB 2QM7A 1BE3D 1PV3A 3TGUD 1N86A 1RE3A 3BRVB 1JTHB 1G1JA 2MJZA 2H88C 4UB6E 1KFMA 1S3JA 4I6MC 3G4SP 5CCGD 3H6PA 4BRYA 2RKLA 3HD7D 5KKZC 1R5LA 2FYNC 5KLIC 5KLVG 3M9QA 3GHGB 2N1TC 1BGYE 1L0LG 2ZXXA 1OX3A 1KB9D 1NU1E 1YQ3C 3O8ZA 1GU4A 1QVGO 1JY3N 3L74D 5C39A 3GW6A 2Z4EA 4BRYB 5AW5B 3V2RA 1VQKP 4EYYQ 3PJSK 1X8YA 1VQPP 3CXHI 2QEXP 2XNDH 1IK9A 1N7SD 4N78D 1L0NJ 3CWBJ 4WVZA 4DJGA 3L70D 1LNQA 2E5YA 2HLOA 4GDOA 1W5CE 1YTZI 1AQ5A 3LIEA 1VQ7P 1RE4C 1SFCA 4XE5B 1HWTC 1S4XA 1U57A 3CC2P 3L71J 2WZ7A 4AQRD 2GUVA 1MFTA 1FC2C 1NGMB 4H44D 1GDTA 3L75E 4PD4I 5CJ0A 2K1AA 1LTJB 3L72E 1LTBC 3CXHD 4IL6H 1S5LE 1X0TA 1TU3F 3AEBC 3TGUE 1QGKB 2W6AA 5CBNA 3TK1A 3A3YB 1SQQK 1YQ4C 2RMZA 3W68A 2VRSA 3V5BA 1ZV8A 1PPJE 3RGUA 2JP3A 1YHQP 2YKOA 3B5NC 3R2PA 3A5TA 1S72P 1J1DB 3H1LG 1Q7YQ 1JO5A 1USEA 3VMZA 3H1JD 2QJKC 2QSIA 4JQ0D 2KXPB 1NO4A 1RF1C 2WTYA 4PD4D 4C7RA 1UIIA 5CBOA 1KB9E 3HE5B 1VQNP 1LWUB 3H1IG 1YJ9P 5CCHC 2K9JB 1MFZA 1OW6A 4I7ZC 3EQ2A 2FXPA 4W7ZA 4WB4A 3E7KA 3S4RA 4N78E 3L70E 1K73Q 1LJ2A 3Q5PA 2ZYDA 2Q3EA 1JCDA 2P2UA 2IDBA 1Y47A 1GMJA 3HD7A 5B5EH 1OXZA 1IC2A 2N1TD 1RE3C 2FKWB 1FOSE 4ASWA 1BDDA 2FY8A 2HODA 2WSEJ 1NU1J 4UB6H 2FFDA 1FZEA 4RO0A 3V6IA 1Q81Q 1LT9A 3CXHE 1QEXA 3HD7B 2KB7P 1N7SA 1PL5A 2Q9IA 1K9MQ 1NYHA 2OGUA 2P7JA 1HTLC 2HODB 3B4SA 3L35A 4EDFA 5AW8B 1J2JB 1PP9E 4IFDK 1FZCB 3H1JE 1DEBA 1N7SB 1PGQA 1AQTA 4PD4E 1HGVA 3JCUE 2WSFJ 1EDIA 1SFCC 2A06G 5APXA 3L72J 3OAKA 1ZRTE 3LIDA 3NFQA 2R5BA 3FGAD 4H13C 3TGUJ 3T97B 2WPVB 3RBZA 1GZLA 3AEAC 1KD1Q 1LTAC 2L5GB 3RL0C 4H44B 3S9OA 3H1HG 1NTZG 3B5ND 1PIXA 4RESB 1SVFA 2KYVA 5KLVD 2WSFH 1VQ4P 5AW7B 1SQBK 1L0LD 1RY3A 2FXMA 1S5LH 2E75B 2FYUK 2I1KA 1A02J 3P8CD 1PGJA 5CCHD 2IYPA 1RHZB 1NOHA 3CX5I 1SQPJ 3TF5A 5GTHE 3Q5RA 1YJNP 3VMXA 1FE6A 2W6BA 2Y9YA 3M9HA 3L70J 3VP9A 3AE8C 2AXTE 4IOIH 3SWYA 1GU5A 1NHLA 3V2NA 2YMKA 4TLFA 1FU1A 1OFCX 4UB8H 4RJTA 1FDOA 1ZMEC 4K3AA 3B71A 1ZLLA 2ZVOB 2ZXEB 5AW3B 3H1KG 1JY3O 2QJPC 1SQXK 3OW2O 1J1EC 2YO3A 2KIKA 2A45H 1DD4A 3TDKA 3CX5D 2JO1A 2JJLA 5KKZB 2FYNB 5KLIB 1SP4A 2N1TB 5KJ7A 2H7HA 2QIWA 1URQC 2H89C 2FFDC 4W80A 1EQ7A 2OQQA 4ZKUA 5TJHA 1LT9C 2YKQA 1OW8A 3H1LD 4OVNF 3P32A 5KLVE 3G3ZA 3PTZA 3I56P 1PP9J 3SWFA 1L0LE 1USDA 3H1JJ 4L74A 2C9NY 1Q82Q 1EDKA 3OJAB 1QL2A 1OZHA 2E5TA 1DX7A 3M9BA 3P8CE 3H1ID 1L0NK 1WT6A 1SFCD 2E76D 2KLVA 2IBZG 2BCCG 2IX7C 2LR2A 4H13D 1OVVA 3MP7B 2W83C 1GK4A 1HH0A 3JC22 1VQOP 1SQBG 2WPQA 1YTZT 1LTSC 4U3FG 2OYHA 1LT1A 1GW4A 3RL0D 3LW5J 2FYUG 1NKNA 5AVSB 5AVZB 1NTKG 4ZNCA 5APWA 2PGDA 2WSSH 3Q2YA 4BWNA 2QA4P 3EWKA 3PHLA 3H25A 3D6ZA 3CMEP 4LC1A 4HYTB 1RF1A 1RQUA 1KC8Q 5APVA 3JSVC 3AE9C 1FZBA 2Y0CA 3KPEA 1AVOA 1BCCG 3CX5E 3LW5H 4HH2A 3I5CA 3B5NB 4N6JA 3B8EB 1W2EA 1VPCA 1QL1A 2QJKB 1NKZB 3CC7P 1RF1B 3KZIE 2FXOA 3VN0A 3D6YA 4JPZB 1FJKA 4IFMA 1DEEG 1LP1B 1HVVA 5APUA 2M0BA 4I7ZB 3H1LE 3NMDA 2E74D 3G71P 4NPFX 3F5HA 2OARA 4D6TE 3RK2C 5GTHH 3N4XA 2M3EA 1GL2A 1VQ6P 3H1IE 2Q3IA 2A06D 1FOSF 1SLQA 2IPPA 1W2BO 5AW2B 5AVWB 4PV1C 3AE7C 4IFFA 3MTUE 2BEZF 2KP8A 2HR3A 1PZQA 1URQD 4GOEA 3H1HD 1NTZD 1L0NG 3BCCG 3A2AA 2KNCA 3V2QA 1NU1K 1AJYA 2JKVA 2KUBA 2YIUC 3CC4P 2PFXA 1P84H 3FXEA 1NTMG
chains in the Genus database with same CATH topology
1IC2A 2N1TD 1RE3C 2FKWB 1NTKK 1FOSE 2J59M 3V4WA 5AVYB 3V4QA 2NPSA 2R5DA 1IFDA 2M8RA 3C9IA 3M0AA 2HODA 1T3JA 1CW5A 3BVHA 3P7KA 5CJ4A 2FFDA 1FZEA 2OYHB 5BU8B 1HBWA 1G2CA 1JNMA 2CPSA 1LT9A 1RF0A 5APTA 2HFED 3H32A 3HD7B 3M0DA 2KB7P 1PFIA 1N7SA 1IFJA 1JMMA 2XZRA 5AW9B 2Q9IA 5AW6B 2WPRA 4GKGA 1JY2O 3TNUA 5AVRB 1SFCB 2XV5A 2P7JA 1HTLC 2N1TA 2WSCH 2CPBA 2HODB 1JY3P 1ZN5A 2YNYA 5AVUB 1E5WA 3VTPC 2O01H 1CZQA 3L35A 2R3CA 3VYIA 2OYHC 1YYCA 1G2CB 5CCGC 5AW8B 4C46A 1J2JB 2PP6A 3KDPB 3U1AA 4IFDK 1FZCB 1GTWA 1DEBA 2HPCA 2WPSA 3H32B 4M3LA 3HD7C 2R32A 1N7SB 1WRGA 1H89A 2LKMA 1HGVA 4AYCA 2JEEA 1NWQA 3TNUB 1SFCC 1MZ9A 3GHGA 5APXA 4LGDE 2H43A 2KSJA 3OAKA 4EIJA 4C7NA 3LIDA 4LLHA 3NFQA 2R5BA 1IO4A 2A45I 2XKMA 3MGNA 5APSA 1M7LA 4XA4A 1RE4A 4I1LA 1HUCA 2Q7CA 5KJ7C 1GZLA 1KILB 1RF0C 1FZCC 1LTAC 2L5GB 3BRTB 2HPCB 3IR9A 3RL0C 1L0LK 5BU5A 1N7SC 1T2KD 3A7OA 1JCCA 5AVVB 3B5ND 1GK6A 4DZOA 4AUWA 4RESB 2I1JA 1SVFA 2KYVA 1GL2B 1L4AD 3RK2D 2WSFH 2OYIA 1GD2E 2WITA 1SQPK 4C7NB 5AW7B 3MIWA 1SQBK 1JY2N 1RY3A 1H8AA 1X79B 2FXMA 1IFNA 1FZFA 2HYNA 4JYBA 2FYUK 2I1KA 1A02J 3P8CD 3L4FA 5CCHD 1KILC 2YO2A 1NAFA 5CHXA 2WT7A 1NTMK 3MUDA 4DOJA 1NOHA 2GM4A 5APQA 2C0XA 3VOPA 1NH4A 2Z5IA 1FBMA 2KOGA 3EFGA 1GL2C 3M91A 3HUSA 3UIAA 1URQA 3VMXA 2W6BA 3M9HA 1FZAA 3VP9A 1J1EB 3B5NA 1M1JA 1LTJA 1L4AA 3OA7A 2BASA 2E42A 2C0WA 3SWYA 1GU5A 1NHLA 1LTGC 3V2NA 3RK3D 2IFNA 1MUUA 5KJ7D 2WWWA 1FU1A 1HJBA 2WT7B 1KILD 4WY4A 2FYZA 2YMYA 2QM8A 2NPSB 5CCHA 3P8MC 1ZLLA 2ZXEB 5AW3B 2M3BA 2XDJA 1JY3O 1JTHA 1SQXK 2J58A 1URQB 2WSEH 2FFDB 1OWAA 2XU6A 4WBAA 1J1EC 2YO3A 2P1JA 4EOTA 2POHA 2A45H 1IFIA 1A02F 1LT9B 3IFMA 5AVXB 4B86A 1XTGB 4O9BA 5AW1B 3RL0B 4W7YA 5KTBA 2JJLA 5APYA 2E43A 4WY4B 3HE5A 1LWUA 1SP4A 2NPSC 3BATA 2N1TB 5KJ7A 1LGHB 2H7HA 1JUNA 2QM7A 1FZGA 1N86A 1RE3A 3HRNA 3BRVB 1JTHB 1G1JA 2MJZA 2P67A 1URQC 2FFDC 1KFMA 3HTKA 4W80A 4I6MC 5AW4B 3U59A 1EQ7A 2Q5UA 4ZKUA 1LT9C 5CCGD 2YKQA 3H6PA 3P32A 3G3ZA 1CI6A 3M0DC 3SWFA 2GUSA 1H88A 3HD7D 1MV8A 2O1KA 2C9NY 1HGZA 4WY4C 3NTNA 3OJAB 1NTZK 1QL2A 3M9QA 3VP8A 3GHGB 2N1TC 3M9BA 3P8CE 1DX7A 4ZKPA 1L0NK 1WT6A 1SFCD 2KLVA 3L37A 1S9KD 4JF7A 2PAJA 1X9VA 3HTKB 3O8ZA 1GU4A 2IX7C 1JY3N 3U1CA 1IJDB 2Z4EA 1GK4A 5AW5B 1HH0A 3V2RA 1G1IA 2WPQA 1AFOA 1YTZT 1LTSC 1X8YA 2OYHA 1GW4A 3RL0D 2A45G 5CCGA 5CMZA 1IK9A 1N7SD 4N78D 1NKNA 3II6A 5AVSB 5AVZB 3GHGC 5APWA 2OYIB 1VDFA 2HLOA 4KHXA 1YTZI 1KZUB 1N2DC 3LIEA 1AQ5A 1RE4C 4LC1A 1SFCA 1ZR2A 4XE5B 1IFMA 1HWTC 4HYTB 1RF1A 1DH3A 4JYCA 5AVQB 5APVA 1ZR4A 2XNXA 2WZ7A 4AQRD 3WMM0 1CSBA 4N3YB 2GUVA 4Y99B 1FJPA 1FZBA 1JOCA 2C9LY 3KPEA 5AVTB 1GDTA 3LW5H 1FZCA 3HUSB 1T8ZA 5CJ0A 4HH2A 2OYIC 1GL2D 3I5CA 2O1JA 3B5NB 1M1JB 4N6JA 1GW3A 1LTJB 3B8EB 2YKPA 3MD0A 1L4AB 1JY2P 1W2EA 2H8PD 3RK2B 1VPCA 1LTBC 1QL1A 4I2LC 3NXSA 3TSIA 1N73A 1NKZB 1RF1B 2W6AA 2W27A 3M06A 3VN0A 3TK1A 1FJKA 4Y99C 2Z5HA 1LTTC 3L36A 4IFMA 3A3YB 3T97A 1Z56A 5APUA 1HVVA 1SQQK 1KILA 2VRSA 2N9BA 1ZV8A 3NMDA 3TYYA 3V5BA 1FAVA 3HUSC 3HE4A 1T2KC 2OARA 2YKOA 2ZFCA 3B5NC 1M1JC 1LTJC 3R2PA 3A5TA 1J1DB 1L4AC 3RK2C 5AW0B 1JO5A 3KYQA 3E1IA 3N4XA 1GL2A 3V2PA 3VMZA 1N73B 2Q3IA 1NO4A 1RF1C 2WTYA 4C7RA 1S9KE 3CI9A 3N7NA 1FOSF 3HE5B 3RK3B 1SLQA 1LWUB 2IFMA 2IPPA 3VMYA 3CLQA 5CCHC 5AW2B 1MFZA 5AVWB 5KLVK 2NPSD 3EQ2A 4IFFA 3MTUE 1FDMA 3PP5A 3HE4B 2KP8A 3BASA 4W7ZA 4WB4A 4GT1A 1URQD 1LTIC 4N78E 1J1DC 2HG5D 4OH8B 5BVZA 3A2AA 1CI6B 3KQGA 1N73C 3V2QA 1SQVK 1KFNA 1JCDA 1N7LA 1NU1K 2P2UA 3RK3C 1XTCC 1LWUC 3CL3D 4WY4D 3HD7A 1KQLA 1OXZA 1T3UA 4GIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SVF A;  4N6J A;  1ZV8 A;  2FYZ A;  1G2C A;  3KPE A;  3EFG A;  3SWY A;  4EIJ A; 
#chains in the Genus database with same CATH topology
 2N9Y B;  3L71 G;  2WSC J;  3VMA A;  2R5D A;  1IFD A;  1SQV J;  2M8R A;  3C9I A;  2L91 A;  2ZYG A;  3GG2 A;  1CW5 A;  4YXW H;  3CCQ P;  2R3S A;  2KNC B;  2B88 A;  2KK7 A;  5BU8 B;  2K88 A;  1YJW P;  5K5G B;  4JBZ A;  1OMI A;  1VL2 A;  2LXB A;  1IFJ A;  1JMM A;  3D70 A;  3TNU A;  5AVR B;  1SFC B;  2XV5 A;  2WSC H;  1BE3 E;  2QE7 H;  3AE3 C;  3VTP C;  1CZQ A;  3H1K D;  2K3R A;  3G6E P;  3D71 A;  4H13 B;  3CCL P;  2OYH C;  3G9R A;  4C46 A;  3WUV A;  3SWK A;  2MKV A;  2IBZ I;  2A06 E;  3L73 J;  2ITA A;  4H0L D;  1NWQ A;  2W90 A;  3AED C;  3TNU B;  5TIS E;  1H0T A;  1OW7 A;  4C7N A;  2KLU A;  3FXD A;  2XKM A;  2SPZ A;  1M7L A;  3GLM A;  3H1H E;  3L74 E;  1NTZ E;  5DJT B;  5KJ7 C;  1M8O B;  2ZT9 D;  1RF0 C;  1VQ9 P;  5B66 H;  1KYO I;  3H1L J;  3A7O A;  1JCC A;  5AVV B;  2FBW C;  2I1J A;  2ZYA A;  1EXI A;  3RK2 D;  4D6T J;  4IL6 X;  2OYI A;  2BEQ D;  4TT3 H;  1GD2 E;  2WIT A;  4A7P A;  1SQP K;  4C7N B;  3MIW A;  3WU2 E;  3AE1 C;  5EFW B;  2IBZ D;  3H1I J;  2BCC D;  5L8R J;  4KJM A;  3KZI H;  1Q2N A;  3AEF C;  4PV1 D;  1SQB D;  1BGY J;  5APQ A;  2GM4 A;  4U3F D;  2Z5I A;  2NRG A;  2KOG A;  2QJP B;  3EFG A;  1GL2 C;  2FYU D;  3HUS A;  3M91 A;  3UIA A;  1URQ A;  1AA0 A;  2Q6Q A;  2KI7 B;  3MZW B;  1NTK D;  1J1E B;  1M1J A;  4GOD A;  1L4A A;  2BAS A;  1KYO D;  1HJ0 A;  1M57 D;  3A0B E;  3CCJ P;  5KJ7 D;  2WWW A;  1KIL D;  2FYZ A;  2QM8 A;  1DD3 A;  2XDJ A;  1BCC D;  2J58 A;  2WSE H;  1URQ B;  2FFD B;  1OWA A;  1BSH A;  3PH0 A;  2XU6 A;  4WBA A;  4EOT A;  1FS0 E;  1LT9 B;  2O3J A;  3IFM A;  5AVX B;  4O9B A;  5AW1 B;  3AE6 C;  1KMI Z;  3L72 G;  1SQX D;  5APY A;  3L75 J;  1SQQ G;  2E76 C;  3AEE C;  2D2C C;  3HRN A;  2P67 A;  1BE3 J;  3HTK A;  3ABV C;  5AW4 B;  1VQM P;  3U59 A;  1PPJ G;  5M1B A;  1CI6 A;  5GTI E;  3I55 P;  2GUS A;  1H88 A;  1MV8 A;  2O1K A;  2IBZ E;  3NTN A;  3SFE C;  2BCC E;  1K04 A;  3GF3 A;  4ZKP A;  3O6Q A;  4CPG A;  1SQB E;  2PAJ A;  3HTK B;  4U3F E;  2KS1 A;  3QH9 A;  2FYU E;  1DIP A;  1SQP G;  1VF5 C;  1G1I A;  1AFO A;  1L0N D;  3BCC D;  3L74 J;  1NTK E;  3CCV P;  1NTZ J;  3WUT A;  2V4H A;  2JWA A;  3Q5S A;  2A45 G;  3F89 A;  3II6 A;  1M90 Q;  1VDF A;  1NTM D;  1BDC A;  2YXR B;  1KZU B;  3CMA P;  4L75 A;  1R8E A;  1ZR2 A;  3L71 D;  2KZJ A;  2KS1 B;  1IFM A;  1YBK A;  4JYC A;  1KB9 H;  3WMM 0;  1UIX A;  2C9L Y;  2E74 C;  1KV4 A;  2OYI C;  1GL2 D;  2O01 N;  1SS1 A;  2YKP A;  2AEJ A;  1JY2 P;  2H8P D;  3RK2 B;  2V7Q J;  4I2L C;  2AEF A;  3NXS A;  1S5L X;  3ITK A;  2W27 A;  3M06 A;  1NJI Q;  2QVA A;  1KQG B;  4Y99 C;  2Z5H A;  1Y9B A;  1Z56 A;  4PV1 B;  1KIL A;  3TYY A;  2N9B A;  1FAV A;  3HUS C;  1EDL A;  3C1L A;  3AE5 C;  1M1J C;  1PP9 G;  1L4A C;  5AW0 B;  2ZJS E;  3KYQ A;  2UWJ E;  2V7Q H;  4OWF A;  3RBX A;  3CI9 A;  3N7N A;  5KAI E;  4DCK A;  2W6J H;  2YIU B;  3CXH H;  2IFM A;  3VMY A;  4XFJ A;  5KLV K;  2Y0E A;  1FDM A;  1L0N E;  3PP5 A;  1T6A A;  3BAS A;  3BCC E;  4KT0 J;  2D2C D;  2G8Y A;  1LTI C;  1OIP A;  2HG5 D;  4OH8 B;  1IZN B;  3PRJ A;  2CK3 H;  4BXL A;  2QG4 A;  3A0H E;  3KQG A;  4IL6 E;  2KSE A;  1N73 C;  1SQV K;  1KFN A;  1NTM E;  1N7L A;  2GA1 A;  3KHU A;  3RK3 C;  1XTC C;  1JM0 A;  4R4M A;  1KQL A;  1QLE D;  1T3U A;  4GIF A;  1Q90 D;  2M5A A;  4PD4 H;  3JCU H;  2BCC J;  3V4W A;  2IYO A;  5AVY B;  3V4Q A;  2NPS A;  1T3J A;  5CJ4 A;  1VF5 D;  2OYH B;  1G2C A;  2CPS A;  1RF0 A;  5E79 E;  1NTK J;  3AEC C;  3Q3D A;  3H32 A;  5GTI H;  3M0D A;  4H0L C;  4Y28 J;  5H2F E;  2B87 A;  1PFI A;  2XZR A;  5AW9 B;  5AW6 B;  2OYO A;  2WPR A;  4GKG A;  1SQX G;  3CCE P;  2YNY A;  2W8Z A;  3KXD A;  1YI2 P;  1E5W A;  2QJY C;  3VYI A;  1EZV G;  1YYC A;  2ZT9 C;  1G2C B;  1IFP A;  3KDP B;  2P10 A;  2WPS A;  3H32 B;  4M3L A;  3RL0 g;  2WQY C;  2R32 A;  1WRG A;  1H89 A;  2LKM A;  4AYC A;  3L72 D;  4HB1 A;  2Q1K A;  2AEM A;  1SQQ D;  3GHG A;  4LGD E;  1OVR A;  2AXT H;  1S1C X;  2A45 I;  5APS A;  3GMA A;  4XA4 A;  1HUC A;  2Q7C A;  4K35 A;  1PPJ D;  3IR9 A;  1JEK A;  4DZO A;  3CWB G;  1GL2 B;  1L4A D;  2YXQ B;  3AE2 C;  3CCS P;  1JY2 N;  4L76 A;  5KLV J;  1H8A A;  1KQS O;  2IZ0 A;  1FZF A;  4GOF A;  1L0L J;  4JYB A;  1SQV G;  1KIL C;  1NAF A;  5CHX A;  4RKU J;  2WT7 A;  4DOJ A;  1SQP D;  3MHV A;  1NH4 A;  1FBM A;  3BCC J;  2G3A A;  4YXD C;  1IK7 A;  1LTJ A;  3OA7 A;  2C0W A;  1LTG C;  4OGQ C;  1NTM J;  1WMK A;  3RK3 D;  2IFN A;  1MUU A;  1HJB A;  2WT7 B;  5KAI H;  1U7J A;  3S1K A;  1EDJ A;  2YMY A;  2E76 B;  3P8M C;  1K05 A;  2D2C B;  2M3B A;  1RH5 B;  3L73 G;  2I8D A;  4B86 A;  1XTG B;  1SQQ E;  3A0H H;  3RL0 B;  5KTB A;  2E75 D;  3MUD C;  2E43 A;  3HE5 A;  3AEG C;  1LWU A;  2NPS C;  3IN6 A;  2K9J A;  3USS A;  1LGH B;  1JUN A;  3CCM P;  1FZG A;  3CD6 P;  2LXC B;  1ZXG A;  2Q5U A;  1PP9 D;  1VF5 B;  4YPC A;  1VQ5 P;  3M0D C;  1ZP0 C;  1M1K Q;  1OVU A;  4D6T G;  4UB8 E;  3CX5 H;  1HGZ A;  4WY4 C;  2NZ2 A;  5E79 H;  1NTZ K;  3VP8 A;  1H0T B;  5H2F H;  3L37 A;  1ZRT D;  1SQP E;  3EFF K;  1S9K D;  4JF7 A;  1X9V A;  1BGY G;  3U1C A;  1IJD B;  5DJU B;  3Q1M A;  1JMB A;  1NU1 G;  2JR8 A;  5CCG A;  1KOR A;  5CMZ A;  2E74 B;  1M56 D;  2Y0D A;  1YIT P;  3RK3 E;  2R44 A;  3GHG C;  1R5S A;  2OYI B;  4KHX A;  2RN0 A;  1EZV I;  1N2D C;  1VQL P;  4U7J A;  2K37 A;  2J5U A;  1DH3 A;  5AVQ B;  3H1K E;  1ZR4 A;  2XNX A;  1CSB A;  4N3Y B;  1EC5 A;  4Y99 B;  1FJP A;  1JOC A;  1P84 I;  5AVT B;  4R4L A;  1FZC A;  3HUS B;  1T8Z A;  1K8A Q;  2O1J A;  1M1J B;  1GW3 A;  3MD0 A;  1L4A B;  2JWD A;  3L75 G;  3TSI A;  1N73 A;  4NPE A;  4OGQ D;  5KAF E;  1KQF B;  4DT0 A;  3CCR P;  1LTT C;  1BE3 G;  3L36 A;  3T97 A;  3TGU G;  3ZDM A;  1EZV D;  3FWL A;  4QMA A;  3HE4 A;  1T2K C;  1BSN A;  2ZFC A;  1LTJ C;  1RQV A;  3SSU A;  3FX0 A;  3E1I A;  3V2P A;  1X22 A;  1N73 B;  1P84 D;  4HJG H;  1S9K E;  1SQQ J;  2IZ1 A;  3RK3 B;  3CLQ A;  2NPS D;  2K9Y A;  3HE4 B;  4GT1 A;  3L74 G;  1J1D C;  5BVZ A;  3GF7 A;  1CI6 B;  1JB0 J;  3H1H J;  3CWB D;  3WUU A;  1N8R Q;  3L70 G;  1KYO E;  4PJ0 E;  1LWU C;  3CL3 D;  2WVR A;  4WY4 D;  4EI2 A;  1Y8A A;  4H0L B;  1KTM A;  2B9B A;  1PGO A;  1FDI A;  2RH0 A;  3O6Q B;  1NTK K;  1KIL E;  1SQV D;  2J59 M;  3AE4 C;  5TIS H;  3M0A A;  4ASV A;  2O01 J;  1BCC E;  3BVH A;  2WMM A;  4WWI A;  3P7K A;  2QJY B;  2ZT9 B;  1HBW A;  4HKZ H;  1JNM A;  1QX8 A;  5APT A;  2HFE D;  2JDI H;  1SQX E;  1JY2 O;  1KN7 A;  1EZV E;  2N1T A;  1PGP A;  2CPB A;  1JY3 P;  1ZN5 A;  5AVU B;  1AV1 A;  3WU2 H;  2O01 H;  2DW3 A;  2R3C A;  4MN4 C;  5CCG C;  3H1K J;  2PP6 A;  3L73 D;  3U1A A;  1VQ8 P;  2P58 A;  1GTW A;  2HPC A;  1P84 E;  3HD7 C;  3R4Y A;  2JEE A;  3H1J G;  1MZ9 A;  2H43 A;  2KSJ A;  4EIJ A;  1NAY A;  4LLH A;  1IO4 A;  3MGN A;  1RE4 A;  4I1L A;  3A0B H;  1AVY A;  1KIL B;  1FZC C;  3CPW O;  3BRT B;  2HPC B;  1L2P A;  3CWB E;  1L0L K;  5BU5 A;  1N7S C;  4NPD A;  1T2K D;  4D6T D;  1GK6 A;  4AUW A;  1U7M A;  1ZOY C;  4YTP C;  2ZVN B;  3K5B A;  3W67 A;  1SQV E;  2B89 A;  1X79 B;  1IFN A;  4OGQ B;  3L71 E;  2HYN A;  1YIJ P;  2KZI A;  2Y9Z A;  1BGY D;  3L4F A;  3PLN A;  2YO2 A;  5KAF H;  3FWN A;  2OTJ P;  1NTM K;  3MUD A;  4H44 C;  1QVF O;  1NU1 D;  2C0X A;  3QWO C;  4L73 A;  3VOP A;  1SQB J;  4U3F J;  2OTK E;  1FZA A;  3B5N A;  1Q86 Q;  2FYU J;  2E42 A;  3C8V A;  4ZMD A;  2OTL P;  2AXC A;  2E75 C;  1MKM A;  3CCU P;  2M5A B;  5B66 E;  4WY4 A;  3SFD C;  4Z1M H;  2NPS B;  5CCH A;  1D7M A;  1EXJ A;  2QRX A;  1LP1 A;  3L73 E;  2PRR A;  1JTH A;  2P1J A;  1E79 H;  1BCC J;  2POH A;  1A02 F;  1IFI A;  1ZW0 A;  1S2E A;  1HF9 A;  3L75 D;  2B87 B;  5B5E E;  1KB9 I;  4W7Y A;  1NVO A;  1KYO H;  4PJ0 H;  4WY4 B;  3E1R A;  1SQX J;  3IAO A;  3IF4 A;  3BAT A;  2ZAE B;  2QM7 A;  1BE3 D;  1PV3 A;  3TGU D;  1N86 A;  1RE3 A;  3BRV B;  1JTH B;  1G1J A;  2MJZ A;  2H88 C;  4UB6 E;  1KFM A;  1S3J A;  4I6M C;  3G4S P;  5CCG D;  3H6P A;  4BRY A;  2RKL A;  3HD7 D;  5KKZ C;  1R5L A;  2FYN C;  5KLI C;  5KLV G;  3M9Q A;  3GHG B;  2N1T C;  1BGY E;  1L0L G;  2ZXX A;  1OX3 A;  1KB9 D;  1NU1 E;  1YQ3 C;  3O8Z A;  1GU4 A;  1QVG O;  1JY3 N;  3L74 D;  5C39 A;  3GW6 A;  2Z4E A;  4BRY B;  5AW5 B;  3V2R A;  1VQK P;  4EYY Q;  3PJS K;  1X8Y A;  1VQP P;  3CXH I;  2QEX P;  2XND H;  1IK9 A;  1N7S D;  4N78 D;  1L0N J;  3CWB J;  4WVZ A;  4DJG A;  3L70 D;  1LNQ A;  2E5Y A;  2HLO A;  4GDO A;  1W5C E;  1YTZ I;  1AQ5 A;  3LIE A;  1VQ7 P;  1RE4 C;  1SFC A;  4XE5 B;  1HWT C;  1S4X A;  1U57 A;  3CC2 P;  3L71 J;  2WZ7 A;  4AQR D;  2GUV A;  1MFT A;  1FC2 C;  1NGM B;  4H44 D;  1GDT A;  3L75 E;  4PD4 I;  5CJ0 A;  2K1A A;  1LTJ B;  3L72 E;  1LTB C;  3CXH D;  4IL6 H;  1S5L E;  1X0T A;  1TU3 F;  3AEB C;  3TGU E;  1QGK B;  2W6A A;  5CBN A;  3TK1 A;  3A3Y B;  1SQQ K;  1YQ4 C;  2RMZ A;  3W68 A;  2VRS A;  3V5B A;  1ZV8 A;  1PPJ E;  3RGU A;  2JP3 A;  1YHQ P;  2YKO A;  3B5N C;  3R2P A;  3A5T A;  1S72 P;  1J1D B;  3H1L G;  1Q7Y Q;  1JO5 A;  1USE A;  3VMZ A;  3H1J D;  2QJK C;  2QSI A;  4JQ0 D;  2KXP B;  1NO4 A;  1RF1 C;  2WTY A;  4PD4 D;  4C7R A;  1UII A;  5CBO A;  1KB9 E;  3HE5 B;  1VQN P;  1LWU B;  3H1I G;  1YJ9 P;  5CCH C;  2K9J B;  1MFZ A;  1OW6 A;  4I7Z C;  3EQ2 A;  2FXP A;  4W7Z A;  4WB4 A;  3E7K A;  3S4R A;  4N78 E;  3L70 E;  1K73 Q;  1LJ2 A;  3Q5P A;  2ZYD A;  2Q3E A;  1JCD A;  2P2U A;  2IDB A;  1Y47 A;  1GMJ A;  3HD7 A;  5B5E H;  1OXZ A;  1IC2 A;  2N1T D;  1RE3 C;  2FKW B;  1FOS E;  4ASW A;  1BDD A;  2FY8 A;  2HOD A;  2WSE J;  1NU1 J;  4UB6 H;  2FFD A;  1FZE A;  4RO0 A;  3V6I A;  1Q81 Q;  1LT9 A;  3CXH E;  1QEX A;  3HD7 B;  2KB7 P;  1N7S A;  1PL5 A;  2Q9I A;  1K9M Q;  1NYH A;  2OGU A;  2P7J A;  1HTL C;  2HOD B;  3B4S A;  3L35 A;  4EDF A;  5AW8 B;  1J2J B;  1PP9 E;  4IFD K;  1FZC B;  3H1J E;  1DEB A;  1N7S B;  1PGQ A;  1AQT A;  4PD4 E;  1HGV A;  3JCU E;  2WSF J;  1EDI A;  1SFC C;  2A06 G;  5APX A;  3L72 J;  3OAK A;  1ZRT E;  3LID A;  3NFQ A;  2R5B A;  3FGA D;  4H13 C;  3TGU J;  3T97 B;  2WPV B;  3RBZ A;  1GZL A;  3AEA C;  1KD1 Q;  1LTA C;  2L5G B;  3RL0 C;  4H44 B;  3S9O A;  3H1H G;  1NTZ G;  3B5N D;  1PIX A;  4RES B;  1SVF A;  2KYV A;  5KLV D;  2WSF H;  1VQ4 P;  5AW7 B;  1SQB K;  1L0L D;  1RY3 A;  2FXM A;  1S5L H;  2E75 B;  2FYU K;  2I1K A;  1A02 J;  3P8C D;  1PGJ A;  5CCH D;  2IYP A;  1RHZ B;  1NOH A;  3CX5 I;  1SQP J;  3TF5 A;  5GTH E;  3Q5R A;  1YJN P;  3VMX A;  1FE6 A;  2W6B A;  2Y9Y A;  3M9H A;  3L70 J;  3VP9 A;  3AE8 C;  2AXT E;  4IOI H;  3SWY A;  1GU5 A;  1NHL A;  3V2N A;  2YMK A;  4TLF A;  1FU1 A;  1OFC X;  4UB8 H;  4RJT A;  1FDO A;  1ZME C;  4K3A A;  3B71 A;  1ZLL A;  2ZVO B;  2ZXE B;  5AW3 B;  3H1K G;  1JY3 O;  2QJP C;  1SQX K;  3OW2 O;  1J1E C;  2YO3 A;  2KIK A;  2A45 H;  1DD4 A;  3TDK A;  3CX5 D;  2JO1 A;  2JJL A;  5KKZ B;  2FYN B;  5KLI B;  1SP4 A;  2N1T B;  5KJ7 A;  2H7H A;  2QIW A;  1URQ C;  2H89 C;  2FFD C;  4W80 A;  1EQ7 A;  2OQQ A;  4ZKU A;  5TJH A;  1LT9 C;  2YKQ A;  1OW8 A;  3H1L D;  4OVN F;  3P32 A;  5KLV E;  3G3Z A;  3PTZ A;  3I56 P;  1PP9 J;  3SWF A;  1L0L E;  1USD A;  3H1J J;  4L74 A;  2C9N Y;  1Q82 Q;  1EDK A;  3OJA B;  1QL2 A;  1OZH A;  2E5T A;  1DX7 A;  3M9B A;  3P8C E;  3H1I D;  1L0N K;  1WT6 A;  1SFC D;  2E76 D;  2KLV A;  2IBZ G;  2BCC G;  2IX7 C;  2LR2 A;  4H13 D;  1OVV A;  3MP7 B;  2W83 C;  1GK4 A;  1HH0 A;  3JC2 2;  1VQO P;  1SQB G;  2WPQ A;  1YTZ T;  1LTS C;  4U3F G;  2OYH A;  1LT1 A;  1GW4 A;  3RL0 D;  3LW5 J;  2FYU G;  1NKN A;  5AVS B;  5AVZ B;  1NTK G;  4ZNC A;  5APW A;  2PGD A;  2WSS H;  3Q2Y A;  4BWN A;  2QA4 P;  3EWK A;  3PHL A;  3H25 A;  3D6Z A;  3CME P;  4LC1 A;  4HYT B;  1RF1 A;  1RQU A;  1KC8 Q;  5APV A;  3JSV C;  3AE9 C;  1FZB A;  2Y0C A;  3KPE A;  1AVO A;  1BCC G;  3CX5 E;  3LW5 H;  4HH2 A;  3I5C A;  3B5N B;  4N6J A;  3B8E B;  1W2E A;  1VPC A;  1QL1 A;  2QJK B;  1NKZ B;  3CC7 P;  1RF1 B;  3KZI E;  2FXO A;  3VN0 A;  3D6Y A;  4JPZ B;  1FJK A;  4IFM A;  1DEE G;  1LP1 B;  1HVV A;  5APU A;  2M0B A;  4I7Z B;  3H1L E;  3NMD A;  2E74 D;  3G71 P;  4NPF X;  3F5H A;  2OAR A;  4D6T E;  3RK2 C;  5GTH H;  3N4X A;  2M3E A;  1GL2 A;  1VQ6 P;  3H1I E;  2Q3I A;  2A06 D;  1FOS F;  1SLQ A;  2IPP A;  1W2B O;  5AW2 B;  5AVW B;  4PV1 C;  3AE7 C;  4IFF A;  3MTU E;  2BEZ F;  2KP8 A;  2HR3 A;  1PZQ A;  1URQ D;  4GOE A;  3H1H D;  1NTZ D;  1L0N G;  3BCC G;  3A2A A;  2KNC A;  3V2Q A;  1NU1 K;  1AJY A;  2JKV A;  2KUB A;  2YIU C;  3CC4 P;  2PFX A;  1P84 H;  3FXE A;  1NTM G; 
#chains in the Genus database with same CATH homology
 1IC2 A;  2N1T D;  1RE3 C;  2FKW B;  1NTK K;  1FOS E;  2J59 M;  3V4W A;  5AVY B;  3V4Q A;  2NPS A;  2R5D A;  1IFD A;  2M8R A;  3C9I A;  3M0A A;  2HOD A;  1T3J A;  1CW5 A;  3BVH A;  3P7K A;  5CJ4 A;  2FFD A;  1FZE A;  2OYH B;  5BU8 B;  1HBW A;  1G2C A;  1JNM A;  2CPS A;  1LT9 A;  1RF0 A;  5APT A;  2HFE D;  3H32 A;  3HD7 B;  3M0D A;  2KB7 P;  1PFI A;  1N7S A;  1IFJ A;  1JMM A;  2XZR A;  5AW9 B;  2Q9I A;  5AW6 B;  2WPR A;  4GKG A;  1JY2 O;  3TNU A;  5AVR B;  1SFC B;  2XV5 A;  2P7J A;  1HTL C;  2N1T A;  2WSC H;  2CPB A;  2HOD B;  1JY3 P;  1ZN5 A;  2YNY A;  5AVU B;  1E5W A;  3VTP C;  2O01 H;  1CZQ A;  3L35 A;  2R3C A;  3VYI A;  2OYH C;  1YYC A;  1G2C B;  5CCG C;  5AW8 B;  4C46 A;  1J2J B;  2PP6 A;  3KDP B;  3U1A A;  4IFD K;  1FZC B;  1GTW A;  1DEB A;  2HPC A;  2WPS A;  3H32 B;  4M3L A;  3HD7 C;  2R32 A;  1N7S B;  1WRG A;  1H89 A;  2LKM A;  1HGV A;  4AYC A;  2JEE A;  1NWQ A;  3TNU B;  1SFC C;  1MZ9 A;  3GHG A;  5APX A;  4LGD E;  2H43 A;  2KSJ A;  3OAK A;  4EIJ A;  4C7N A;  3LID A;  4LLH A;  3NFQ A;  2R5B A;  1IO4 A;  2A45 I;  2XKM A;  3MGN A;  5APS A;  1M7L A;  4XA4 A;  1RE4 A;  4I1L A;  1HUC A;  2Q7C A;  5KJ7 C;  1GZL A;  1KIL B;  1RF0 C;  1FZC C;  1LTA C;  2L5G B;  3BRT B;  2HPC B;  3IR9 A;  3RL0 C;  1L0L K;  5BU5 A;  1N7S C;  1T2K D;  3A7O A;  1JCC A;  5AVV B;  3B5N D;  1GK6 A;  4DZO A;  4AUW A;  4RES B;  2I1J A;  1SVF A;  2KYV A;  1GL2 B;  1L4A D;  3RK2 D;  2WSF H;  2OYI A;  1GD2 E;  2WIT A;  1SQP K;  4C7N B;  5AW7 B;  3MIW A;  1SQB K;  1JY2 N;  1RY3 A;  1H8A A;  1X79 B;  2FXM A;  1IFN A;  1FZF A;  2HYN A;  4JYB A;  2FYU K;  2I1K A;  1A02 J;  3P8C D;  3L4F A;  5CCH D;  1KIL C;  2YO2 A;  1NAF A;  5CHX A;  2WT7 A;  1NTM K;  3MUD A;  4DOJ A;  1NOH A;  2GM4 A;  5APQ A;  2C0X A;  3VOP A;  1NH4 A;  2Z5I A;  1FBM A;  2KOG A;  3EFG A;  1GL2 C;  3M91 A;  3HUS A;  3UIA A;  1URQ A;  3VMX A;  2W6B A;  3M9H A;  1FZA A;  3VP9 A;  1J1E B;  3B5N A;  1M1J A;  1LTJ A;  1L4A A;  3OA7 A;  2BAS A;  2E42 A;  2C0W A;  3SWY A;  1GU5 A;  1NHL A;  1LTG C;  3V2N A;  3RK3 D;  2IFN A;  1MUU A;  5KJ7 D;  2WWW A;  1FU1 A;  1HJB A;  2WT7 B;  1KIL D;  4WY4 A;  2FYZ A;  2YMY A;  2QM8 A;  2NPS B;  5CCH A;  3P8M C;  1ZLL A;  2ZXE B;  5AW3 B;  2M3B A;  2XDJ A;  1JY3 O;  1JTH A;  1SQX K;  2J58 A;  1URQ B;  2WSE H;  2FFD B;  1OWA A;  2XU6 A;  4WBA A;  1J1E C;  2YO3 A;  2P1J A;  4EOT A;  2POH A;  2A45 H;  1IFI A;  1A02 F;  1LT9 B;  3IFM A;  5AVX B;  4B86 A;  1XTG B;  4O9B A;  5AW1 B;  3RL0 B;  4W7Y A;  5KTB A;  2JJL A;  5APY A;  2E43 A;  4WY4 B;  3HE5 A;  1LWU A;  1SP4 A;  2NPS C;  3BAT A;  2N1T B;  5KJ7 A;  1LGH B;  2H7H A;  1JUN A;  2QM7 A;  1FZG A;  1N86 A;  1RE3 A;  3HRN A;  3BRV B;  1JTH B;  1G1J A;  2MJZ A;  2P67 A;  1URQ C;  2FFD C;  1KFM A;  3HTK A;  4W80 A;  4I6M C;  5AW4 B;  3U59 A;  1EQ7 A;  2Q5U A;  4ZKU A;  1LT9 C;  5CCG D;  2YKQ A;  3H6P A;  3P32 A;  3G3Z A;  1CI6 A;  3M0D C;  3SWF A;  2GUS A;  1H88 A;  3HD7 D;  1MV8 A;  2O1K A;  2C9N Y;  1HGZ A;  4WY4 C;  3NTN A;  3OJA B;  1NTZ K;  1QL2 A;  3M9Q A;  3VP8 A;  3GHG B;  2N1T C;  3M9B A;  3P8C E;  1DX7 A;  4ZKP A;  1L0N K;  1WT6 A;  1SFC D;  2KLV A;  3L37 A;  1S9K D;  4JF7 A;  2PAJ A;  1X9V A;  3HTK B;  3O8Z A;  1GU4 A;  2IX7 C;  1JY3 N;  3U1C A;  1IJD B;  2Z4E A;  1GK4 A;  5AW5 B;  1HH0 A;  3V2R A;  1G1I A;  2WPQ A;  1AFO A;  1YTZ T;  1LTS C;  1X8Y A;  2OYH A;  1GW4 A;  3RL0 D;  2A45 G;  5CCG A;  5CMZ A;  1IK9 A;  1N7S D;  4N78 D;  1NKN A;  3II6 A;  5AVS B;  5AVZ B;  3GHG C;  5APW A;  2OYI B;  1VDF A;  2HLO A;  4KHX A;  1YTZ I;  1KZU B;  1N2D C;  3LIE A;  1AQ5 A;  1RE4 C;  4LC1 A;  1SFC A;  1ZR2 A;  4XE5 B;  1IFM A;  1HWT C;  4HYT B;  1RF1 A;  1DH3 A;  4JYC A;  5AVQ B;  5APV A;  1ZR4 A;  2XNX A;  2WZ7 A;  4AQR D;  3WMM 0;  1CSB A;  4N3Y B;  2GUV A;  4Y99 B;  1FJP A;  1FZB A;  1JOC A;  2C9L Y;  3KPE A;  5AVT B;  1GDT A;  3LW5 H;  1FZC A;  3HUS B;  1T8Z A;  5CJ0 A;  4HH2 A;  2OYI C;  1GL2 D;  3I5C A;  2O1J A;  3B5N B;  1M1J B;  4N6J A;  1GW3 A;  1LTJ B;  3B8E B;  2YKP A;  3MD0 A;  1L4A B;  1JY2 P;  1W2E A;  2H8P D;  3RK2 B;  1VPC A;  1LTB C;  1QL1 A;  4I2L C;  3NXS A;  3TSI A;  1N73 A;  1NKZ B;  1RF1 B;  2W6A A;  2W27 A;  3M06 A;  3VN0 A;  3TK1 A;  1FJK A;  4Y99 C;  2Z5H A;  1LTT C;  3L36 A;  4IFM A;  3A3Y B;  3T97 A;  1Z56 A;  5APU A;  1HVV A;  1SQQ K;  1KIL A;  2VRS A;  2N9B A;  1ZV8 A;  3NMD A;  3TYY A;  3V5B A;  1FAV A;  3HUS C;  3HE4 A;  1T2K C;  2OAR A;  2YKO A;  2ZFC A;  3B5N C;  1M1J C;  1LTJ C;  3R2P A;  3A5T A;  1J1D B;  1L4A C;  3RK2 C;  5AW0 B;  1JO5 A;  3KYQ A;  3E1I A;  3N4X A;  1GL2 A;  3V2P A;  3VMZ A;  1N73 B;  2Q3I A;  1NO4 A;  1RF1 C;  2WTY A;  4C7R A;  1S9K E;  3CI9 A;  3N7N A;  1FOS F;  3HE5 B;  3RK3 B;  1SLQ A;  1LWU B;  2IFM A;  2IPP A;  3VMY A;  3CLQ A;  5CCH C;  5AW2 B;  1MFZ A;  5AVW B;  5KLV K;  2NPS D;  3EQ2 A;  4IFF A;  3MTU E;  1FDM A;  3PP5 A;  3HE4 B;  2KP8 A;  3BAS A;  4W7Z A;  4WB4 A;  4GT1 A;  1URQ D;  1LTI C;  4N78 E;  1J1D C;  2HG5 D;  4OH8 B;  5BVZ A;  3A2A A;  1CI6 B;  3KQG A;  1N73 C;  3V2Q A;  1SQV K;  1KFN A;  1JCD A;  1N7L A;  1NU1 K;  2P2U A;  3RK3 C;  1XTC C;  1LWU C;  3CL3 D;  4WY4 D;  3HD7 A;  1KQL A;  1OXZ A;  1T3U A;  4GIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...