1G2CA

Human respiratory syncytial virus fusion protein core
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
50
structure length
50
Chain Sequence
LEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of the human respiratory syncytial virus fusion protein core.
pubmed doi rcsb
source organism Human respiratory syncytial virus
molecule tags Viral protein
molecule keywords FUSION PROTEIN (F)
total genus 21
structure length 50
sequence length 50
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature
pdb deposition date 2000-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.300 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1g2cA00
1G2CA 1SVFA 3KPEA 3SWYA 4EIJA 3EFGA 1ZV8A 4N6JA 2FYZA
chains in the Genus database with same CATH superfamily
4R4LA 3CXHH 1SQXE 2WSFJ 1NKZB 2RH0A 1JB0J 1SQXD 4UB8E 1L4AB 2NPSA 1U57A 2R32A 2ZT9B 3B5NB 3BRTB 4U3FD 1KILE 1PIXA 1SFCC 3B8EB 4GODA 3V5BA 5AVZB 3W67A 2MJZA 3WUUA 1Q86Q 1KN7A 1FZEA 3I55P 2W6AA 3B71A 1NTMG 5EFWB 1LTSC 2Y0CA 2P7JA 2I1KA 1E79H 3P32A 1OMIA 4JBZA 2HYNA 2Q9IA 2OYIB 1S9KD 1CSBA 1P84I 2FY8A 2LKMA 3M0DC 2KNCB 4DJGA 2WT7A 1OIPA 3L73J 3SFEC 3ZDMA 1SQBE 1EDJA 1AV1A 2HG5D 1NTKD 1GK4A 2KSEA 2M3BA 2NZ2A 3TGUD 1IC2A 3E1IA 3L72G 1LGHB 1KYOE 1N7SD 1NAFA 3P8MC 1HGVA 3M0DA 2FXMA 2FYZA 3H1JD 4UB6H 2B89A 2JWDA 1USDA 3HRNA 5APSA 1HBWA 2V7QH 1SFCD 2FXOA 1RE3A 2N1TB 1ZR2A 1YJNP 4HJGH 1NGMB 2NRGA 2K9YA 1BE3G 1NKNA 2UWJE 1YQ4C 4YPCA 5AW9B 3G71P 4BXLA 2XV5A 3U59A 5KLVK 1MZ9A 1IZNB 4DCKA 3H1LG 1KB9I 3CCVP 1RY3A 2WSFH 2OYOA 2J58A 1QL2A 1S5LE 1RE3C 3U1AA 1FOSF 2O01J 1MKMA 1JY2P 3VP9A 1T8ZA 4DOJA 1LP1B 1X0TA 2IFMA 2ZAEB 3CCRP 1N7SB 2KS1B 2QJKC 3AEEC 3R2PA 3Q3DA 5KLVJ 4GOEA 1QGKB 2HPCB 2YIUC 1H0TB 4WWIA 1Y47A 1N73A 3B5NC 3H1KD 1CW5A 1L0ND 1BE3J 3CCJP 1FAVA 5CJ4A 2MKVA 4LC1A 1VPCA 2FYUE 2GUVA 3N4XA 3VMYA 2J5UA 2K9JA 5AW2B 1RF0C 2P1JA 3WU2E 3U1CA 1VQKP 1VQ6P 2KZIA 3AE1C 1N73C 2KXPB 2QVAA 1ZW0A 2W27A 1EXIA 5APTA 1Q2NA 3L74J 4OGQC 1DD3A 1H88A 1KTMA 2WWWA 1H0TA 4W80A 1HUCA 4YXDC 5KLIB 1VQMP 1N73B 4IFDK 3WUVA 1BGYG 1LT9B 2E75D 1FDMA 1NTMK 2JEEA 3F89A 4LLHA 1SQQE 3CCMP 2KOGA 3L36A 1YJWP 5CCHD 5AW7B 2QEXP 1YBKA 3AE6C 5APQA 3BCCG 1OVRA 2HFED 2BEZF 5DJUB 1QVGO 2QJYB 1N8RQ 2KB7P 3S4RA 1JCCA 1DD4A 1QL1A 4U3FJ 2O3JA 4YTPC 1GU4A 1S72P 4I2LC 3JCUH 1BSNA 4YXWH 1N7SC 2QJKB 4D6TJ 3RL0D 1KORA 1ZLLA 1SQBD 2I1JA 2R3CA 3H1HG 3AE4C 1CZQA 3IN6A 2C0XA 3PTZA 3TGUE 2QE7H 1GK6A 3VMZA 1NTZD 1P84H 3N7NA 1KILA 3CX5I 4PD4D 3TYYA 1RE4C 1GW3A 1PP9G 1ZOYC 2K3RA 3LW5H 4C7NA 2A45H 1W5CE 1FC2C 4EI2A 3B4SA 5KLIC 4AUWA 2KYVA 3IAOA 3VMAA 3TGUJ 2LR2A 2WSEH 1OXZA 5KJ7A 1X8YA 3L72E 2SPZA 2B88A 4H13B 1PPJD 3RGUA 3BASA 2WSCH 1HJ0A 1ZRTE 3H1ID 3H1JJ 1M56D 1FZFA 2M8RA 1WMKA 5GTHE 5KAFH 1D7MA 1KB9E 1HJBA 4JYCA 4IOIH 3L75J 3LIEA 3HE5A 1PGPA 4JYBA 1JY2N 2G8YA 2ZYDA 1AA0A 3H1HJ 3WUTA 2Y9ZA 1NU1D 3L74G 4RKUJ 5AW0B 4N3YB 2E43A 2ZXEB 5APXA 3Q1MA 4EYYQ 3BVHA 3KZIH 4XE5B 3PRJA 5H2FH 1BCCJ 2Z5HA 2O1KA 1VF5B 4PV1B 5B66H 1K8AQ 4UB8H 1BSHA 3L74E 2E76C 1EZVE 1G2CA 2L5GB 2Q3IA 4K3AA 4PD4E 2E74C 3L73G 1SLQA 3R4YA 4WY4B 2B87A 4PD4I 1M1JA 1PGQA 4H13C 3A0HE 2AXTH 5KLVG 5GTHH 5KAFE 1URQD 2R44A 4H0LC 1FOSE 2WQYC 1KD1Q 2WPVB 2ZJSE 2KZJA 3PH0A 3MP7B 1PGOA 2KP8A 3OJAB 5AVVB 1SQQK 1FDIA 1PP9J 1KYOI 1OWAA 2K37A 3BRVB 2HPCA 3HD7D 3KZIE 5H2FE 1NWQA 1NAYA 3I5CA 1BCCG 1YQ3C 1J1EB 3GF7A 1SQVD 2WPQA 4GOFA 1S4XA 2WSEJ 1L2PA 3SWFA 2QSIA 3BATA 4H44C 3WMM0 1GDTA 2HODB 2FXPA 1KFMA 2ZYGA 3AEAC 3C9IA 3VTPC 3I56P 3G6EP 1NU1K 1ZN5A 1PV3A 3L75G 4CPGA 2A06G 1L0LD 1NVOA 1HGZA 2D2CD 1JY2O 4H13D 3P7KA 1IO4A 1LNQA 4EIJA 1H8AA 3CD6P 5KLVE 1IK9A 2WVRA 1IFIA 1KB9H 4KT0J 1X22A 1E5WA 3H32B 3CWBE 1KQLA 2PRRA 4I7ZC 1SQQG 1S5LH 1YTZI 1ZR4A 1GU5A 1HF9A 3CWBD 1M90Q 4W7YA 3CXHI 1L4AD 2H8PD 3SWYA 3G4SP 1EZVD 1OX3A 2QIWA 2XZRA 3FXDA 3L71J 2E42A 1KV4A 1LT9A 2HODA 1M7LA 5BU5A 5KTBA 2LXCB 3PLNA 3VMXA 1IFDA 2FYNC 5M1BA 2IBZG 4HB1A 4OGQD 1U7JA 5TISH 1SQXJ 3NTNA 2W6JH 2M3EA 3SFDC 4D6TD 5AVUB 1Y8AA 2BCCG 1S3JA 2CK3H 3Q5PA 3IF4A 2FBWC 3BCCJ 3PJSK 2Z5IA 2BEQD 1NU1E 2BCCJ 2E75C 2HLOA 3H1IE 2DW3A 1FZBA 2FYUG 2E5YA 2IDBA 3L72D 3QWOC 4L73A 4Y99C 3O8ZA 4IL6H 1M8OB 5E79E 1VDFA 2Q3EA 3H1JG 3RK3D 2KI7B 2ZT9C 1KILB 4JQ0D 2WPSA 1L0NK 2OYHC 1FZAA 1KFNA 1LTJB 2N9BA 1P84E 3H1IJ 3L70D 3H1JE 3M9HA 1K9MQ 1JTHA 3MHVA 5CCGA 1VQ8P 2PGDA 1GZLA 4LGDE 1LJ2A 3CCEP 2M5AA 4IL6X 3RBXA 1T2KD 1LWUC 2KSJA 1JCDA 2NPSB 3AE9C 3OAKA 3HE4A 5KKZC 2JJLA 3CC2P 5AVRB 1L4AA 1NTKE 1YTZT 4DZOA 1AVOA 4ASVA 1VQOP 2QRXA 3GLMA 4K35A 1FZCB 1DX7A 1EC5A 4U3FG 2OYIA 1LWUA 2G3AA 3V2NA 3H1KJ 2W90A 2Q7CA 1VQPP 1KC8Q 4AQRD 2OGUA 4NPDA 4B86A 4EDFA 3KPEA 3RK2B 4EOTA 1KILD 1Q82Q 2P2UA 3NMDA 1PL5A 3AEDC 3VOPA 4DT0A 1VQ5P 1NYHA 1L4AC 3II6A 4U3FE 3E1RA 3GW6A 2K1AA 2WZ7A 2WMMA 4BRYA 3KDPB 4C7RA 5BU8B 2WITA 1EQ7A 1SQPJ 4WY4A 1LTJC 3HE4B 3H1HE 1S5LX 4I1LA 4RESB 4WY4D 3D71A 3RL0B 3CX5D 5AVQB 1WRGA 2H89C 1RH5B 2Y0DA 2A06E 2CPSA 1URQB 2IZ0A 2NPSC 3SWKA 2YXRB 4L76A 1SQXK 4Y99B 1LWUB 1IFNA 1JM0A 2WPRA 1NTME 3CXHD 3PP5A 3LW5J 2YKOA 3MTUE 1SFCB 2N1TD 1SP4A 3TNUB 4IL6E 2FFDC 2IPPA 2Q1KA 2OYHB 1L0LK 4C46A 4BRYB 4IFFA 2QJYC 1HVVA 1KQFB 4ZNCA 3Q5RA 3RK2C 1NJIQ 1SVFA 3H1LD 1WT6A 3IFMA 4U7JA 3UIAA 5GTIE 1VQ4P 3GHGB 1EDLA 1SQBK 2FFDA 3E7KA 1LP1A 3HUSA 4GIFA 5CCHC 2KS1A 2QA4P 3M06A 2D2CB 3V2PA 3NXSA 1SFCA 4W7ZA 2K88A 3TNUA 3EWKA 1YI2P 2H43A 3EFGA 1KZUB 2YKPA 3FWNA 3AECC 3T97B 2E5TA 1SQQJ 2E74B 1K73Q 1J1DC 2IBZI 1SQPG 3HUSC 2FYUJ 3KQGA 3O6QA 3P8CD 5CCHA 1GTWA 4O9BA 2K9JB 1G1IA 3M0AA 4IFMA 1EXJA 1BDCA 1SQBJ 2KLUA 3QH9A 4L75A 3GHGA 5GTIH 1T2KC 3V4QA 2WSCJ 5AW5B 1PFIA 3V2QA 3V6IA 1SQXG 5KAIH 3RL0g 1K04A 1T3JA 3H1LE 4GDOA 3CCQP 1RF1B 1Y9BA 1DEEG 3TF5A 4HKZH 4XFJA 2FYNB 2V4HA 3GHGC 3FX0A 4PJ0H 1G1JA 2RKLA 2W8ZA 1NTMD 1NTZK 1X9VA 2YIUB 4GT1A 3B5NA 3PHLA 1TU3F 5AVSB 1BGYD 4BWNA 1BE3E 1EDIA 4H44B 1GL2B 3M9BA 2AEMA 2E74D 2AEJA 2P58A 2N9YB 3RK3E 5K5GB 3CLQA 1HTLC 2FYUK 1AJYA 1NU1J 3CX5E 2KNCA 2XNDH 2Z4EA 1RF1A 3A0BE 1ZRTD 2O01H 5CMZA 5KJ7D 3LIDA 4UB6E 5CJ0A 3RK2D 1S1CX 4PD4H 3A3YB 2YO2A 1PPJE 4ZKUA 1M57D 1Z56A 3L71E 4TLFA 5TISE 1DEBA 1SQBG 2VRSA 3TK1A 1VQ7P 2YKQA 3GG2A 2H7HA 1SQVK 1QLED 2AEFA 2N1TA 1BE3D 2A45G 3D6YA 1FZCA 1KYOD 1NTZG 1YYCA 2QG4A 3KYQA 1ZXGA 4C7NB 1RF1C 1OW6A 3OA7A 1SQPE 1KMIZ 1ZP0C 2V7QJ 1NTZE 3G9RA 1BGYE 4H44D 3L71G 5KAIE 1RF0A 3G3ZA 3SSUA 1YHQP 1K05A 1VQ9P 1IK7A 1PZQA 1AVYA 2H88C 4OVNF 2N1TC 2YXQB 5E79H 3C8VA 5APVA 5AVYB 5AW3B 2IX7C 1FZCC 1PPJG 3C1LA 2GM4A 1L0LG 2QM7A 5C39A 3L37A 1N7SA 2POHA 1SQVJ 1S9KE 4ASWA 1KQSO 5AW8B 1PGJA 4AYCA 3VN0A 1LTGC 1RHZB 3H6PA 3H1KG 2BASA 1L0NG 1N2DC 1SS1A 4M3LA 1RE4A 4MN4C 3CWBG 4R4MA 4ZKPA 5BVZA 2RMZA 2C9NY 5AW6B 1M1JB 1OVVA 3TDKA 1G2CB 2ZVNB 2ZYAA 1SQVE 2JO1A 4JPZB 1YJ9P 1NTKG 1MUUA 1CI6A 1Q81Q 1FZGA 3L73D 5KJ7C 2FKWB 2XKMA 1JMMA 3TGUG 3WU2H 2A45I 1N86A 5AVWB 4OGQB 1T6AA 4NPEA 4PV1C 2BCCD 5KLVD 3CX5H 2FFDB 4ZMDA 2Y9YA 3FXEA 3S9OA 4D6TE 5B5EE 4NPFX 3AEGC 3D6ZA 1VL2A 1JUNA 2FYUD 4JF7A 1OFCX 1KILC 3A5TA 1L0NE 3CMEP 3Q5SA 1EZVI 1BCCE 1FJPA 5AW1B 1A02J 1BCCD 2O1JA 3AE3C 3BCCD 3CXHE 2JKVA 2R3SA 3CL3D 1NH4A 3M9QA 4GKGA 4QMAA 1GD2E 1BDDA 2KK7A 2PFXA 3L70G 1JEKA 1M1JC 3AE8C 2RN0A 3RK3B 3L72J 3VP8A 1FBMA 1L0NJ 2Y0EA 2YNYA 3AE7C 2JP3A 3B5ND 1RQUA 3KXDA 3L75D 1OVUA 5CBOA 2QJPC 3L73E 3H1HD 1NHLA 2ITAA 1W2BO 5APYA 3L4FA 2C0WA 1BGYJ 1ZMEC 2IBZE 2LXBA 1SQPK 3CC7P 1USEA 1ZV8A 1FJKA 1YITP 3GMAA 1PP9D 2CPBA 2IYPA 3JC22 3TSIA 3CCUP 2YMKA 1KQGB 4XA4A 1AFOA 5TJHA 3H25A 3CMAP 4N6JA 1JMBA 1GL2A 3A2AA 4A7PA 4KJMA 3AE5C 3FGAD 1FDOA 1LTIC 1S2EA 4Z1MH 2AXCA 3OW2O 1VQNP 4HYTB 1HH0A 2OQQA 1QX8A 5AW4B 3RL0C 1VF5C 1IFMA 1M1KQ 1JY3N 2YMYA 2ZXXA 1OW8A 3L74D 1GL2C 1LT1A 3EFFK 5B66E 2W83C 3L70E 3HE5B 3JSVC 1OZHA 3VYIA 2L91A 1J1EC 4WB4A 1A02F 1DIPA 2JWAA 1FU1A 1JTHB 2P67A 4KHXA 4OH8B 2WT7B 2OTJP 5AVXB 2WSSH 3IR9A 2AXTE 4WBAA 3AEFC 1JO5A 2QM8A 3USSA 5CHXA 1NOHA 3H1LJ 3RK3C 3S1KA 5APUA 2GA1A 3NFQA 2P10A 1KB9D 1UIIA 2ZVOB 3MZWB 2C9LY 1XTCC 2B87B 3HTKB 2IZ1A 5APWA 3AE2C 1X79B 2E76B 2HR3A 1R8EA 2R5BA 1NTKJ 1XTGB 3CWBJ 3ITKA 5KKZB 1GL2D 4Y28J 3AEBC 5L8RJ 5DJTB 3L75E 1H89A 4N78D 3A0BH 3RBZA 4H0LB 1NTZJ 5CBNA 1DH3A 2ZFCA 1LT9C 1J2JB 2XU6A 4RO0A 4OWFA 2WTYA 1URQC 1VF5D 2GUSA 2J59M 3H1IG 1CI6B 1EDKA 4HH2A 3HTKA 1VQLP 2W6BA 1W2EA 3CI9A 3F5HA 1IFJA 1T3UA 1P84D 2BCCE 2E76D 1NU1G 2PAJA 2OTKE 2O01N 1FE6A 2XDJA 3L35A 3M91A 2YO3A 1MV8A 1SQQD 1URQA 2I8DA 1PP9E 3H32A 3MGNA 3MUDA 4RJTA 3P8CE 1U7MA 1NTMJ 1RQVA 2XNXA 1EZVG 1FS0E 1Q90D 1R5SA 1YIJP 1NTKK 1Q7YQ 2OYIC 3EQ2A 3A0HH 3JCUE 3L70J 1AQTA 4I6MC 4PJ0E 1NO4A 2OYHA 1MFZA 2IBZD 2NPSD 2QJPB 3ABVC 1MFTA 4WVZA 2D2CC 3MUDC 2JR8A 1N7LA 5CCGC 3A7OA 4D6TG 1JNMA 1KYOH 4PV1D 2M0BA 3V4WA 1IJDB 1OW7A 4TT3H 1R5LA 1GMJA 2R5DA 3HD7B 4WY4C 3D70A 1IFPA 2Q6QA 3BCCE 1JY3O 4I7ZB 3W68A 3CCSP 1UIXA 1QVFO 4L74A 2ZT9D 3KHUA 1J1DB 3HUSB 1QEXA 3V2RA 2B9BA 2KIKA 1L0LJ 3HD7C 1LTBC 2KUBA 5CCGD 3O6QB 1GW4A 1SQVG 2OARA 4N78E 1JY3P 3H1KE 2KLVA 3T97A 3Q2YA 3CC4P 1LTAC 3CPWO 2PP6A 3GF3A 3K5BA 5AVTB 2Q5UA 4H0LD 2IYOA 2IFNA 3FWLA 1SQPD 2JDIH 5B5EH 2OTLP 2A06D 1LTTC 3HD7A 1L0LE 2E75B 3MD0A 2M5AB 3MIWA 3L71D 3CCLP 1LTJA 1HWTC 1JOCA 1AQ5A
chains in the Genus database with same CATH topology
1NKZB 1L4AB 2NPSA 2R32A 3B5NB 3BRTB 3V5BA 3B8EB 1SFCC 5AVZB 2MJZA 1FZEA 2W6AA 1LTSC 2P7JA 2I1KA 3P32A 2HYNA 2Q9IA 2OYIB 1S9KD 1CSBA 3M0DC 2LKMA 2WT7A 2HG5D 1GK4A 2M3BA 1IC2A 3E1IA 1LGHB 1NAFA 1N7SD 3P8MC 1HGVA 3M0DA 2FXMA 2FYZA 3HRNA 1HBWA 5APSA 1SFCD 2N1TB 1RE3A 1ZR2A 1NKNA 5AW9B 2XV5A 3U59A 5KLVK 1MZ9A 1RY3A 2WSFH 2J58A 1QL2A 1RE3C 3U1AA 1FOSF 1JY2P 3VP9A 1T8ZA 4DOJA 2IFMA 1N7SB 3R2PA 2HPCB 1N73A 3B5NC 1CW5A 1FAVA 5CJ4A 4LC1A 1VPCA 2GUVA 3N4XA 3VMYA 5AW2B 1RF0C 2P1JA 3U1CA 1N73C 2W27A 5APTA 1H88A 2WWWA 4W80A 1HUCA 1N73B 4IFDK 1LT9B 1FDMA 1NTMK 2JEEA 4LLHA 2KOGA 3L36A 5CCHD 5AW7B 5APQA 2HFED 2KB7P 1JCCA 1QL1A 1GU4A 4I2LC 1N7SC 3RL0D 1ZLLA 2I1JA 2R3CA 1CZQA 2C0XA 1GK6A 3VMZA 3N7NA 1KILA 3TYYA 1RE4C 1GW3A 4C7NA 3LW5H 2A45H 4AUWA 2KYVA 2WSEH 1OXZA 5KJ7A 1X8YA 3BASA 2WSCH 1FZFA 2M8RA 1HJBA 4JYCA 3LIEA 3HE5A 4JYBA 1JY2N 5AW0B 4N3YB 2E43A 2ZXEB 5APXA 3BVHA 4XE5B 2Z5HA 2O1KA 1G2CA 2L5GB 2Q3IA 1SLQA 4WY4B 1M1JA 1URQD 1FOSE 3OJAB 2KP8A 5AVVB 1SQQK 1OWAA 3BRVB 2HPCA 3HD7D 1NWQA 3I5CA 3SWFA 1J1EB 1GDTA 2WPQA 3BATA 3WMM0 2HODB 3C9IA 1KFMA 3VTPC 1NU1K 1ZN5A 1HGZA 1JY2O 3P7KA 1IO4A 4EIJA 1H8AA 1IK9A 1IFIA 3RK2B 1E5WA 3H32B 1ZR4A 1KQLA 1GU5A 1YTZI 4W7YA 1L4AD 2H8PD 3SWYA 2XZRA 2E42A 1LT9A 2HODA 1M7LA 5BU5A 5KTBA 3VMXA 1IFDA 3NTNA 5AVUB 2Z5IA 2HLOA 1FZBA 4Y99C 3O8ZA 1VDFA 3RK3D 1KILB 2WPSA 1L0NK 2OYHC 1FZAA 1KFNA 1LTJB 2N9BA 3M9HA 1JTHA 5CCGA 1GZLA 4LGDE 1T2KD 1LWUC 2KSJA 1JCDA 2NPSB 3OAKA 3HE4A 2JJLA 5AVRB 1L4AA 1YTZT 4DZOA 1FZCB 1DX7A 2OYIA 1LWUA 3V2NA 2Q7CA 4AQRD 4B86A 4EOTA 3KPEA 1KILD 2P2UA 3NMDA 3VOPA 3II6A 1L4AC 2WZ7A 4C7RA 5BU8B 3KDPB 2WITA 1EQ7A 4WY4A 1LTJC 3HE4B 4I1LA 4RESB 4WY4D 3RL0B 5AVQB 1WRGA 2CPSA 1URQB 2NPSC 1SQXK 4Y99B 1LWUB 1IFNA 2WPRA 3PP5A 2YKOA 3MTUE 2N1TD 1SFCB 1SP4A 3TNUB 2FFDC 2IPPA 2OYHB 1L0LK 4C46A 4IFFA 1HVVA 3RK2C 1SVFA 1WT6A 3IFMA 3UIAA 3GHGB 1SQBK 2FFDA 4GIFA 3HUSA 5CCHC 3M06A 3V2PA 3NXSA 1SFCA 4W7ZA 3TNUA 2H43A 3EFGA 1KZUB 2YKPA 1J1DC 3HUSC 3KQGA 5CCHA 3P8CD 1GTWA 4O9BA 1G1IA 3M0AA 4IFMA 3GHGA 1T2KC 3V4QA 5AW5B 1PFIA 3V2QA 1T3JA 1RF1B 3GHGC 1G1JA 4GT1A 1NTZK 1X9VA 3B5NA 5AVSB 1GL2B 3M9BA 3CLQA 1HTLC 2FYUK 2Z4EA 1RF1A 2O01H 5CMZA 5KJ7D 3LIDA 5CJ0A 3RK2D 3A3YB 2YO2A 4ZKUA 1Z56A 1DEBA 2VRSA 3TK1A 2YKQA 2H7HA 1SQVK 2N1TA 2A45G 1FZCA 1YYCA 3KYQA 1RF1C 4C7NB 3OA7A 2C9NY 1RF0A 3G3ZA 2N1TC 5AW3B 5AVYB 5APVA 2IX7C 1FZCC 2GM4A 2QM7A 3L37A 1N7SA 2POHA 1S9KE 5AW8B 4AYCA 3VN0A 1LTGC 3H6PA 2BASA 1N2DC 4M3LA 5BVZA 1RE4A 4ZKPA 5AW6B 1M1JB 1G2CB 1MUUA 1CI6A 1FZGA 5KJ7C 2FKWB 2XKMA 1JMMA 2A45I 1N86A 5AVWB 2FFDB 1JUNA 4JF7A 1KILC 3A5TA 1FJPA 5AW1B 1A02J 2O1JA 4GKGA 3CL3D 1GD2E 3M9QA 1NH4A 1M1JC 3VP8A 3RK3B 1FBMA 2YNYA 3B5ND 1NHLA 5APYA 3L4FA 2C0WA 1SQPK 1ZV8A 1FJKA 3TSIA 2CPBA 4XA4A 1AFOA 4N6JA 1GL2A 3A2AA 1LTIC 4HYTB 1HH0A 5AW4B 3RL0C 1IFMA 1JY3N 2YMYA 1GL2C 3HE5B 3VYIA 4WB4A 1J1EC 1A02F 2P67A 1FU1A 1JTHB 4KHXA 4OH8B 2WT7B 5AVXB 4WBAA 3IR9A 1JO5A 2QM8A 5CHXA 1NOHA 3RK3C 5APUA 3NFQA 2C9LY 1XTCC 3HTKB 5APWA 1X79B 2R5BA 1XTGB 1GL2D 1H89A 4N78D 1DH3A 2ZFCA 1LT9C 1J2JB 2XU6A 2WTYA 1URQC 2GUSA 2J59M 1CI6B 4HH2A 3HTKA 2W6BA 1W2EA 3CI9A 1IFJA 1T3UA 3M91A 2PAJA 2XDJA 3L35A 2YO3A 1MV8A 1URQA 3H32A 3MUDA 3MGNA 3P8CE 2XNXA 2OYIC 1NTKK 3EQ2A 4I6MC 1NO4A 2OYHA 1MFZA 2NPSD 1N7LA 5CCGC 3A7OA 1JNMA 3V4WA 1IJDB 4WY4C 2R5DA 3HD7B 1JY3O 1J1DB 3HUSB 3V2RA 3HD7C 1LTBC 5CCGD 1GW4A 2OARA 4N78E 1JY3P 2KLVA 3T97A 1LTAC 2PP6A 5AVTB 2Q5UA 2IFNA 3MIWA 1LTTC 3HD7A 3MD0A 1LTJA 1HWTC 1JOCA 1AQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2C A;  1SVF A;  3KPE A;  3SWY A;  4EIJ A;  3EFG A;  1ZV8 A;  4N6J A;  2FYZ A; 
#chains in the Genus database with same CATH topology
 4R4L A;  3CXH H;  1SQX E;  2WSF J;  1NKZ B;  2RH0 A;  1JB0 J;  1SQX D;  4UB8 E;  1L4A B;  2NPS A;  1U57 A;  2R32 A;  2ZT9 B;  3B5N B;  3BRT B;  4U3F D;  1KIL E;  1PIX A;  1SFC C;  3B8E B;  4GOD A;  3V5B A;  5AVZ B;  3W67 A;  2MJZ A;  3WUU A;  1Q86 Q;  1KN7 A;  1FZE A;  3I55 P;  2W6A A;  3B71 A;  1NTM G;  5EFW B;  1LTS C;  2Y0C A;  2P7J A;  2I1K A;  1E79 H;  3P32 A;  1OMI A;  4JBZ A;  2HYN A;  2Q9I A;  2OYI B;  1S9K D;  1CSB A;  1P84 I;  2FY8 A;  2LKM A;  3M0D C;  2KNC B;  4DJG A;  2WT7 A;  1OIP A;  3L73 J;  3SFE C;  3ZDM A;  1SQB E;  1EDJ A;  1AV1 A;  2HG5 D;  1NTK D;  1GK4 A;  2KSE A;  2M3B A;  2NZ2 A;  3TGU D;  1IC2 A;  3E1I A;  3L72 G;  1LGH B;  1KYO E;  1N7S D;  1NAF A;  3P8M C;  1HGV A;  3M0D A;  2FXM A;  2FYZ A;  3H1J D;  4UB6 H;  2B89 A;  2JWD A;  1USD A;  3HRN A;  5APS A;  1HBW A;  2V7Q H;  1SFC D;  2FXO A;  1RE3 A;  2N1T B;  1ZR2 A;  1YJN P;  4HJG H;  1NGM B;  2NRG A;  2K9Y A;  1BE3 G;  1NKN A;  2UWJ E;  1YQ4 C;  4YPC A;  5AW9 B;  3G71 P;  4BXL A;  2XV5 A;  3U59 A;  5KLV K;  1MZ9 A;  1IZN B;  4DCK A;  3H1L G;  1KB9 I;  3CCV P;  1RY3 A;  2WSF H;  2OYO A;  2J58 A;  1QL2 A;  1S5L E;  1RE3 C;  3U1A A;  1FOS F;  2O01 J;  1MKM A;  1JY2 P;  3VP9 A;  1T8Z A;  4DOJ A;  1LP1 B;  1X0T A;  2IFM A;  2ZAE B;  3CCR P;  1N7S B;  2KS1 B;  2QJK C;  3AEE C;  3R2P A;  3Q3D A;  5KLV J;  4GOE A;  1QGK B;  2HPC B;  2YIU C;  1H0T B;  4WWI A;  1Y47 A;  1N73 A;  3B5N C;  3H1K D;  1CW5 A;  1L0N D;  1BE3 J;  3CCJ P;  1FAV A;  5CJ4 A;  2MKV A;  4LC1 A;  1VPC A;  2FYU E;  2GUV A;  3N4X A;  3VMY A;  2J5U A;  2K9J A;  5AW2 B;  1RF0 C;  2P1J A;  3WU2 E;  3U1C A;  1VQK P;  1VQ6 P;  2KZI A;  3AE1 C;  1N73 C;  2KXP B;  2QVA A;  1ZW0 A;  2W27 A;  1EXI A;  5APT A;  1Q2N A;  3L74 J;  4OGQ C;  1DD3 A;  1H88 A;  1KTM A;  2WWW A;  1H0T A;  4W80 A;  1HUC A;  4YXD C;  5KLI B;  1VQM P;  1N73 B;  4IFD K;  3WUV A;  1BGY G;  1LT9 B;  2E75 D;  1FDM A;  1NTM K;  2JEE A;  3F89 A;  4LLH A;  1SQQ E;  3CCM P;  2KOG A;  3L36 A;  1YJW P;  5CCH D;  5AW7 B;  2QEX P;  1YBK A;  3AE6 C;  5APQ A;  3BCC G;  1OVR A;  2HFE D;  2BEZ F;  5DJU B;  1QVG O;  2QJY B;  1N8R Q;  2KB7 P;  3S4R A;  1JCC A;  1DD4 A;  1QL1 A;  4U3F J;  2O3J A;  4YTP C;  1GU4 A;  1S72 P;  4I2L C;  3JCU H;  1BSN A;  4YXW H;  1N7S C;  2QJK B;  4D6T J;  3RL0 D;  1KOR A;  1ZLL A;  1SQB D;  2I1J A;  2R3C A;  3H1H G;  3AE4 C;  1CZQ A;  3IN6 A;  2C0X A;  3PTZ A;  3TGU E;  2QE7 H;  1GK6 A;  3VMZ A;  1NTZ D;  1P84 H;  3N7N A;  1KIL A;  3CX5 I;  4PD4 D;  3TYY A;  1RE4 C;  1GW3 A;  1PP9 G;  1ZOY C;  2K3R A;  3LW5 H;  4C7N A;  2A45 H;  1W5C E;  1FC2 C;  4EI2 A;  3B4S A;  5KLI C;  4AUW A;  2KYV A;  3IAO A;  3VMA A;  3TGU J;  2LR2 A;  2WSE H;  1OXZ A;  5KJ7 A;  1X8Y A;  3L72 E;  2SPZ A;  2B88 A;  4H13 B;  1PPJ D;  3RGU A;  3BAS A;  2WSC H;  1HJ0 A;  1ZRT E;  3H1I D;  3H1J J;  1M56 D;  1FZF A;  2M8R A;  1WMK A;  5GTH E;  5KAF H;  1D7M A;  1KB9 E;  1HJB A;  4JYC A;  4IOI H;  3L75 J;  3LIE A;  3HE5 A;  1PGP A;  4JYB A;  1JY2 N;  2G8Y A;  2ZYD A;  1AA0 A;  3H1H J;  3WUT A;  2Y9Z A;  1NU1 D;  3L74 G;  4RKU J;  5AW0 B;  4N3Y B;  2E43 A;  2ZXE B;  5APX A;  3Q1M A;  4EYY Q;  3BVH A;  3KZI H;  4XE5 B;  3PRJ A;  5H2F H;  1BCC J;  2Z5H A;  2O1K A;  1VF5 B;  4PV1 B;  5B66 H;  1K8A Q;  4UB8 H;  1BSH A;  3L74 E;  2E76 C;  1EZV E;  1G2C A;  2L5G B;  2Q3I A;  4K3A A;  4PD4 E;  2E74 C;  3L73 G;  1SLQ A;  3R4Y A;  4WY4 B;  2B87 A;  4PD4 I;  1M1J A;  1PGQ A;  4H13 C;  3A0H E;  2AXT H;  5KLV G;  5GTH H;  5KAF E;  1URQ D;  2R44 A;  4H0L C;  1FOS E;  2WQY C;  1KD1 Q;  2WPV B;  2ZJS E;  2KZJ A;  3PH0 A;  3MP7 B;  1PGO A;  2KP8 A;  3OJA B;  5AVV B;  1SQQ K;  1FDI A;  1PP9 J;  1KYO I;  1OWA A;  2K37 A;  3BRV B;  2HPC A;  3HD7 D;  3KZI E;  5H2F E;  1NWQ A;  1NAY A;  3I5C A;  1BCC G;  1YQ3 C;  1J1E B;  3GF7 A;  1SQV D;  2WPQ A;  4GOF A;  1S4X A;  2WSE J;  1L2P A;  3SWF A;  2QSI A;  3BAT A;  4H44 C;  3WMM 0;  1GDT A;  2HOD B;  2FXP A;  1KFM A;  2ZYG A;  3AEA C;  3C9I A;  3VTP C;  3I56 P;  3G6E P;  1NU1 K;  1ZN5 A;  1PV3 A;  3L75 G;  4CPG A;  2A06 G;  1L0L D;  1NVO A;  1HGZ A;  2D2C D;  1JY2 O;  4H13 D;  3P7K A;  1IO4 A;  1LNQ A;  4EIJ A;  1H8A A;  3CD6 P;  5KLV E;  1IK9 A;  2WVR A;  1IFI A;  1KB9 H;  4KT0 J;  1X22 A;  1E5W A;  3H32 B;  3CWB E;  1KQL A;  2PRR A;  4I7Z C;  1SQQ G;  1S5L H;  1YTZ I;  1ZR4 A;  1GU5 A;  1HF9 A;  3CWB D;  1M90 Q;  4W7Y A;  3CXH I;  1L4A D;  2H8P D;  3SWY A;  3G4S P;  1EZV D;  1OX3 A;  2QIW A;  2XZR A;  3FXD A;  3L71 J;  2E42 A;  1KV4 A;  1LT9 A;  2HOD A;  1M7L A;  5BU5 A;  5KTB A;  2LXC B;  3PLN A;  3VMX A;  1IFD A;  2FYN C;  5M1B A;  2IBZ G;  4HB1 A;  4OGQ D;  1U7J A;  5TIS H;  1SQX J;  3NTN A;  2W6J H;  2M3E A;  3SFD C;  4D6T D;  5AVU B;  1Y8A A;  2BCC G;  1S3J A;  2CK3 H;  3Q5P A;  3IF4 A;  2FBW C;  3BCC J;  3PJS K;  2Z5I A;  2BEQ D;  1NU1 E;  2BCC J;  2E75 C;  2HLO A;  3H1I E;  2DW3 A;  1FZB A;  2FYU G;  2E5Y A;  2IDB A;  3L72 D;  3QWO C;  4L73 A;  4Y99 C;  3O8Z A;  4IL6 H;  1M8O B;  5E79 E;  1VDF A;  2Q3E A;  3H1J G;  3RK3 D;  2KI7 B;  2ZT9 C;  1KIL B;  4JQ0 D;  2WPS A;  1L0N K;  2OYH C;  1FZA A;  1KFN A;  1LTJ B;  2N9B A;  1P84 E;  3H1I J;  3L70 D;  3H1J E;  3M9H A;  1K9M Q;  1JTH A;  3MHV A;  5CCG A;  1VQ8 P;  2PGD A;  1GZL A;  4LGD E;  1LJ2 A;  3CCE P;  2M5A A;  4IL6 X;  3RBX A;  1T2K D;  1LWU C;  2KSJ A;  1JCD A;  2NPS B;  3AE9 C;  3OAK A;  3HE4 A;  5KKZ C;  2JJL A;  3CC2 P;  5AVR B;  1L4A A;  1NTK E;  1YTZ T;  4DZO A;  1AVO A;  4ASV A;  1VQO P;  2QRX A;  3GLM A;  4K35 A;  1FZC B;  1DX7 A;  1EC5 A;  4U3F G;  2OYI A;  1LWU A;  2G3A A;  3V2N A;  3H1K J;  2W90 A;  2Q7C A;  1VQP P;  1KC8 Q;  4AQR D;  2OGU A;  4NPD A;  4B86 A;  4EDF A;  3KPE A;  3RK2 B;  4EOT A;  1KIL D;  1Q82 Q;  2P2U A;  3NMD A;  1PL5 A;  3AED C;  3VOP A;  4DT0 A;  1VQ5 P;  1NYH A;  1L4A C;  3II6 A;  4U3F E;  3E1R A;  3GW6 A;  2K1A A;  2WZ7 A;  2WMM A;  4BRY A;  3KDP B;  4C7R A;  5BU8 B;  2WIT A;  1EQ7 A;  1SQP J;  4WY4 A;  1LTJ C;  3HE4 B;  3H1H E;  1S5L X;  4I1L A;  4RES B;  4WY4 D;  3D71 A;  3RL0 B;  3CX5 D;  5AVQ B;  1WRG A;  2H89 C;  1RH5 B;  2Y0D A;  2A06 E;  2CPS A;  1URQ B;  2IZ0 A;  2NPS C;  3SWK A;  2YXR B;  4L76 A;  1SQX K;  4Y99 B;  1LWU B;  1IFN A;  1JM0 A;  2WPR A;  1NTM E;  3CXH D;  3PP5 A;  3LW5 J;  2YKO A;  3MTU E;  1SFC B;  2N1T D;  1SP4 A;  3TNU B;  4IL6 E;  2FFD C;  2IPP A;  2Q1K A;  2OYH B;  1L0L K;  4C46 A;  4BRY B;  4IFF A;  2QJY C;  1HVV A;  1KQF B;  4ZNC A;  3Q5R A;  3RK2 C;  1NJI Q;  1SVF A;  3H1L D;  1WT6 A;  3IFM A;  4U7J A;  3UIA A;  5GTI E;  1VQ4 P;  3GHG B;  1EDL A;  1SQB K;  2FFD A;  3E7K A;  1LP1 A;  3HUS A;  4GIF A;  5CCH C;  2KS1 A;  2QA4 P;  3M06 A;  2D2C B;  3V2P A;  3NXS A;  1SFC A;  4W7Z A;  2K88 A;  3TNU A;  3EWK A;  1YI2 P;  2H43 A;  3EFG A;  1KZU B;  2YKP A;  3FWN A;  3AEC C;  3T97 B;  2E5T A;  1SQQ J;  2E74 B;  1K73 Q;  1J1D C;  2IBZ I;  1SQP G;  3HUS C;  2FYU J;  3KQG A;  3O6Q A;  3P8C D;  5CCH A;  1GTW A;  4O9B A;  2K9J B;  1G1I A;  3M0A A;  4IFM A;  1EXJ A;  1BDC A;  1SQB J;  2KLU A;  3QH9 A;  4L75 A;  3GHG A;  5GTI H;  1T2K C;  3V4Q A;  2WSC J;  5AW5 B;  1PFI A;  3V2Q A;  3V6I A;  1SQX G;  5KAI H;  3RL0 g;  1K04 A;  1T3J A;  3H1L E;  4GDO A;  3CCQ P;  1RF1 B;  1Y9B A;  1DEE G;  3TF5 A;  4HKZ H;  4XFJ A;  2FYN B;  2V4H A;  3GHG C;  3FX0 A;  4PJ0 H;  1G1J A;  2RKL A;  2W8Z A;  1NTM D;  1NTZ K;  1X9V A;  2YIU B;  4GT1 A;  3B5N A;  3PHL A;  1TU3 F;  5AVS B;  1BGY D;  4BWN A;  1BE3 E;  1EDI A;  4H44 B;  1GL2 B;  3M9B A;  2AEM A;  2E74 D;  2AEJ A;  2P58 A;  2N9Y B;  3RK3 E;  5K5G B;  3CLQ A;  1HTL C;  2FYU K;  1AJY A;  1NU1 J;  3CX5 E;  2KNC A;  2XND H;  2Z4E A;  1RF1 A;  3A0B E;  1ZRT D;  2O01 H;  5CMZ A;  5KJ7 D;  3LID A;  4UB6 E;  5CJ0 A;  3RK2 D;  1S1C X;  4PD4 H;  3A3Y B;  2YO2 A;  1PPJ E;  4ZKU A;  1M57 D;  1Z56 A;  3L71 E;  4TLF A;  5TIS E;  1DEB A;  1SQB G;  2VRS A;  3TK1 A;  1VQ7 P;  2YKQ A;  3GG2 A;  2H7H A;  1SQV K;  1QLE D;  2AEF A;  2N1T A;  1BE3 D;  2A45 G;  3D6Y A;  1FZC A;  1KYO D;  1NTZ G;  1YYC A;  2QG4 A;  3KYQ A;  1ZXG A;  4C7N B;  1RF1 C;  1OW6 A;  3OA7 A;  1SQP E;  1KMI Z;  1ZP0 C;  2V7Q J;  1NTZ E;  3G9R A;  1BGY E;  4H44 D;  3L71 G;  5KAI E;  1RF0 A;  3G3Z A;  3SSU A;  1YHQ P;  1K05 A;  1VQ9 P;  1IK7 A;  1PZQ A;  1AVY A;  2H88 C;  4OVN F;  2N1T C;  2YXQ B;  5E79 H;  3C8V A;  5APV A;  5AVY B;  5AW3 B;  2IX7 C;  1FZC C;  1PPJ G;  3C1L A;  2GM4 A;  1L0L G;  2QM7 A;  5C39 A;  3L37 A;  1N7S A;  2POH A;  1SQV J;  1S9K E;  4ASW A;  1KQS O;  5AW8 B;  1PGJ A;  4AYC A;  3VN0 A;  1LTG C;  1RHZ B;  3H6P A;  3H1K G;  2BAS A;  1L0N G;  1N2D C;  1SS1 A;  4M3L A;  1RE4 A;  4MN4 C;  3CWB G;  4R4M A;  4ZKP A;  5BVZ A;  2RMZ A;  2C9N Y;  5AW6 B;  1M1J B;  1OVV A;  3TDK A;  1G2C B;  2ZVN B;  2ZYA A;  1SQV E;  2JO1 A;  4JPZ B;  1YJ9 P;  1NTK G;  1MUU A;  1CI6 A;  1Q81 Q;  1FZG A;  3L73 D;  5KJ7 C;  2FKW B;  2XKM A;  1JMM A;  3TGU G;  3WU2 H;  2A45 I;  1N86 A;  5AVW B;  4OGQ B;  1T6A A;  4NPE A;  4PV1 C;  2BCC D;  5KLV D;  3CX5 H;  2FFD B;  4ZMD A;  2Y9Y A;  3FXE A;  3S9O A;  4D6T E;  5B5E E;  4NPF X;  3AEG C;  3D6Z A;  1VL2 A;  1JUN A;  2FYU D;  4JF7 A;  1OFC X;  1KIL C;  3A5T A;  1L0N E;  3CME P;  3Q5S A;  1EZV I;  1BCC E;  1FJP A;  5AW1 B;  1A02 J;  1BCC D;  2O1J A;  3AE3 C;  3BCC D;  3CXH E;  2JKV A;  2R3S A;  3CL3 D;  1NH4 A;  3M9Q A;  4GKG A;  4QMA A;  1GD2 E;  1BDD A;  2KK7 A;  2PFX A;  3L70 G;  1JEK A;  1M1J C;  3AE8 C;  2RN0 A;  3RK3 B;  3L72 J;  3VP8 A;  1FBM A;  1L0N J;  2Y0E A;  2YNY A;  3AE7 C;  2JP3 A;  3B5N D;  1RQU A;  3KXD A;  3L75 D;  1OVU A;  5CBO A;  2QJP C;  3L73 E;  3H1H D;  1NHL A;  2ITA A;  1W2B O;  5APY A;  3L4F A;  2C0W A;  1BGY J;  1ZME C;  2IBZ E;  2LXB A;  1SQP K;  3CC7 P;  1USE A;  1ZV8 A;  1FJK A;  1YIT P;  3GMA A;  1PP9 D;  2CPB A;  2IYP A;  3JC2 2;  3TSI A;  3CCU P;  2YMK A;  1KQG B;  4XA4 A;  1AFO A;  5TJH A;  3H25 A;  3CMA P;  4N6J A;  1JMB A;  1GL2 A;  3A2A A;  4A7P A;  4KJM A;  3AE5 C;  3FGA D;  1FDO A;  1LTI C;  1S2E A;  4Z1M H;  2AXC A;  3OW2 O;  1VQN P;  4HYT B;  1HH0 A;  2OQQ A;  1QX8 A;  5AW4 B;  3RL0 C;  1VF5 C;  1IFM A;  1M1K Q;  1JY3 N;  2YMY A;  2ZXX A;  1OW8 A;  3L74 D;  1GL2 C;  1LT1 A;  3EFF K;  5B66 E;  2W83 C;  3L70 E;  3HE5 B;  3JSV C;  1OZH A;  3VYI A;  2L91 A;  1J1E C;  4WB4 A;  1A02 F;  1DIP A;  2JWA A;  1FU1 A;  1JTH B;  2P67 A;  4KHX A;  4OH8 B;  2WT7 B;  2OTJ P;  5AVX B;  2WSS H;  3IR9 A;  2AXT E;  4WBA A;  3AEF C;  1JO5 A;  2QM8 A;  3USS A;  5CHX A;  1NOH A;  3H1L J;  3RK3 C;  3S1K A;  5APU A;  2GA1 A;  3NFQ A;  2P10 A;  1KB9 D;  1UII A;  2ZVO B;  3MZW B;  2C9L Y;  1XTC C;  2B87 B;  3HTK B;  2IZ1 A;  5APW A;  3AE2 C;  1X79 B;  2E76 B;  2HR3 A;  1R8E A;  2R5B A;  1NTK J;  1XTG B;  3CWB J;  3ITK A;  5KKZ B;  1GL2 D;  4Y28 J;  3AEB C;  5L8R J;  5DJT B;  3L75 E;  1H89 A;  4N78 D;  3A0B H;  3RBZ A;  4H0L B;  1NTZ J;  5CBN A;  1DH3 A;  2ZFC A;  1LT9 C;  1J2J B;  2XU6 A;  4RO0 A;  4OWF A;  2WTY A;  1URQ C;  1VF5 D;  2GUS A;  2J59 M;  3H1I G;  1CI6 B;  1EDK A;  4HH2 A;  3HTK A;  1VQL P;  2W6B A;  1W2E A;  3CI9 A;  3F5H A;  1IFJ A;  1T3U A;  1P84 D;  2BCC E;  2E76 D;  1NU1 G;  2PAJ A;  2OTK E;  2O01 N;  1FE6 A;  2XDJ A;  3L35 A;  3M91 A;  2YO3 A;  1MV8 A;  1SQQ D;  1URQ A;  2I8D A;  1PP9 E;  3H32 A;  3MGN A;  3MUD A;  4RJT A;  3P8C E;  1U7M A;  1NTM J;  1RQV A;  2XNX A;  1EZV G;  1FS0 E;  1Q90 D;  1R5S A;  1YIJ P;  1NTK K;  1Q7Y Q;  2OYI C;  3EQ2 A;  3A0H H;  3JCU E;  3L70 J;  1AQT A;  4I6M C;  4PJ0 E;  1NO4 A;  2OYH A;  1MFZ A;  2IBZ D;  2NPS D;  2QJP B;  3ABV C;  1MFT A;  4WVZ A;  2D2C C;  3MUD C;  2JR8 A;  1N7L A;  5CCG C;  3A7O A;  4D6T G;  1JNM A;  1KYO H;  4PV1 D;  2M0B A;  3V4W A;  1IJD B;  1OW7 A;  4TT3 H;  1R5L A;  1GMJ A;  2R5D A;  3HD7 B;  4WY4 C;  3D70 A;  1IFP A;  2Q6Q A;  3BCC E;  1JY3 O;  4I7Z B;  3W68 A;  3CCS P;  1UIX A;  1QVF O;  4L74 A;  2ZT9 D;  3KHU A;  1J1D B;  3HUS B;  1QEX A;  3V2R A;  2B9B A;  2KIK A;  1L0L J;  3HD7 C;  1LTB C;  2KUB A;  5CCG D;  3O6Q B;  1GW4 A;  1SQV G;  2OAR A;  4N78 E;  1JY3 P;  3H1K E;  2KLV A;  3T97 A;  3Q2Y A;  3CC4 P;  1LTA C;  3CPW O;  2PP6 A;  3GF3 A;  3K5B A;  5AVT B;  2Q5U A;  4H0L D;  2IYO A;  2IFN A;  3FWL A;  1SQP D;  2JDI H;  5B5E H;  2OTL P;  2A06 D;  1LTT C;  3HD7 A;  1L0L E;  2E75 B;  3MD0 A;  2M5A B;  3MIW A;  3L71 D;  3CCL P;  1LTJ A;  1HWT C;  1JOC A;  1AQ5 A; 
#chains in the Genus database with same CATH homology
 1NKZ B;  1L4A B;  2NPS A;  2R32 A;  3B5N B;  3BRT B;  3V5B A;  3B8E B;  1SFC C;  5AVZ B;  2MJZ A;  1FZE A;  2W6A A;  1LTS C;  2P7J A;  2I1K A;  3P32 A;  2HYN A;  2Q9I A;  2OYI B;  1S9K D;  1CSB A;  3M0D C;  2LKM A;  2WT7 A;  2HG5 D;  1GK4 A;  2M3B A;  1IC2 A;  3E1I A;  1LGH B;  1NAF A;  1N7S D;  3P8M C;  1HGV A;  3M0D A;  2FXM A;  2FYZ A;  3HRN A;  1HBW A;  5APS A;  1SFC D;  2N1T B;  1RE3 A;  1ZR2 A;  1NKN A;  5AW9 B;  2XV5 A;  3U59 A;  5KLV K;  1MZ9 A;  1RY3 A;  2WSF H;  2J58 A;  1QL2 A;  1RE3 C;  3U1A A;  1FOS F;  1JY2 P;  3VP9 A;  1T8Z A;  4DOJ A;  2IFM A;  1N7S B;  3R2P A;  2HPC B;  1N73 A;  3B5N C;  1CW5 A;  1FAV A;  5CJ4 A;  4LC1 A;  1VPC A;  2GUV A;  3N4X A;  3VMY A;  5AW2 B;  1RF0 C;  2P1J A;  3U1C A;  1N73 C;  2W27 A;  5APT A;  1H88 A;  2WWW A;  4W80 A;  1HUC A;  1N73 B;  4IFD K;  1LT9 B;  1FDM A;  1NTM K;  2JEE A;  4LLH A;  2KOG A;  3L36 A;  5CCH D;  5AW7 B;  5APQ A;  2HFE D;  2KB7 P;  1JCC A;  1QL1 A;  1GU4 A;  4I2L C;  1N7S C;  3RL0 D;  1ZLL A;  2I1J A;  2R3C A;  1CZQ A;  2C0X A;  1GK6 A;  3VMZ A;  3N7N A;  1KIL A;  3TYY A;  1RE4 C;  1GW3 A;  4C7N A;  3LW5 H;  2A45 H;  4AUW A;  2KYV A;  2WSE H;  1OXZ A;  5KJ7 A;  1X8Y A;  3BAS A;  2WSC H;  1FZF A;  2M8R A;  1HJB A;  4JYC A;  3LIE A;  3HE5 A;  4JYB A;  1JY2 N;  5AW0 B;  4N3Y B;  2E43 A;  2ZXE B;  5APX A;  3BVH A;  4XE5 B;  2Z5H A;  2O1K A;  1G2C A;  2L5G B;  2Q3I A;  1SLQ A;  4WY4 B;  1M1J A;  1URQ D;  1FOS E;  3OJA B;  2KP8 A;  5AVV B;  1SQQ K;  1OWA A;  3BRV B;  2HPC A;  3HD7 D;  1NWQ A;  3I5C A;  3SWF A;  1J1E B;  1GDT A;  2WPQ A;  3BAT A;  3WMM 0;  2HOD B;  3C9I A;  1KFM A;  3VTP C;  1NU1 K;  1ZN5 A;  1HGZ A;  1JY2 O;  3P7K A;  1IO4 A;  4EIJ A;  1H8A A;  1IK9 A;  1IFI A;  3RK2 B;  1E5W A;  3H32 B;  1ZR4 A;  1KQL A;  1GU5 A;  1YTZ I;  4W7Y A;  1L4A D;  2H8P D;  3SWY A;  2XZR A;  2E42 A;  1LT9 A;  2HOD A;  1M7L A;  5BU5 A;  5KTB A;  3VMX A;  1IFD A;  3NTN A;  5AVU B;  2Z5I A;  2HLO A;  1FZB A;  4Y99 C;  3O8Z A;  1VDF A;  3RK3 D;  1KIL B;  2WPS A;  1L0N K;  2OYH C;  1FZA A;  1KFN A;  1LTJ B;  2N9B A;  3M9H A;  1JTH A;  5CCG A;  1GZL A;  4LGD E;  1T2K D;  1LWU C;  2KSJ A;  1JCD A;  2NPS B;  3OAK A;  3HE4 A;  2JJL A;  5AVR B;  1L4A A;  1YTZ T;  4DZO A;  1FZC B;  1DX7 A;  2OYI A;  1LWU A;  3V2N A;  2Q7C A;  4AQR D;  4B86 A;  4EOT A;  3KPE A;  1KIL D;  2P2U A;  3NMD A;  3VOP A;  3II6 A;  1L4A C;  2WZ7 A;  4C7R A;  5BU8 B;  3KDP B;  2WIT A;  1EQ7 A;  4WY4 A;  1LTJ C;  3HE4 B;  4I1L A;  4RES B;  4WY4 D;  3RL0 B;  5AVQ B;  1WRG A;  2CPS A;  1URQ B;  2NPS C;  1SQX K;  4Y99 B;  1LWU B;  1IFN A;  2WPR A;  3PP5 A;  2YKO A;  3MTU E;  2N1T D;  1SFC B;  1SP4 A;  3TNU B;  2FFD C;  2IPP A;  2OYH B;  1L0L K;  4C46 A;  4IFF A;  1HVV A;  3RK2 C;  1SVF A;  1WT6 A;  3IFM A;  3UIA A;  3GHG B;  1SQB K;  2FFD A;  4GIF A;  3HUS A;  5CCH C;  3M06 A;  3V2P A;  3NXS A;  1SFC A;  4W7Z A;  3TNU A;  2H43 A;  3EFG A;  1KZU B;  2YKP A;  1J1D C;  3HUS C;  3KQG A;  5CCH A;  3P8C D;  1GTW A;  4O9B A;  1G1I A;  3M0A A;  4IFM A;  3GHG A;  1T2K C;  3V4Q A;  5AW5 B;  1PFI A;  3V2Q A;  1T3J A;  1RF1 B;  3GHG C;  1G1J A;  4GT1 A;  1NTZ K;  1X9V A;  3B5N A;  5AVS B;  1GL2 B;  3M9B A;  3CLQ A;  1HTL C;  2FYU K;  2Z4E A;  1RF1 A;  2O01 H;  5CMZ A;  5KJ7 D;  3LID A;  5CJ0 A;  3RK2 D;  3A3Y B;  2YO2 A;  4ZKU A;  1Z56 A;  1DEB A;  2VRS A;  3TK1 A;  2YKQ A;  2H7H A;  1SQV K;  2N1T A;  2A45 G;  1FZC A;  1YYC A;  3KYQ A;  1RF1 C;  4C7N B;  3OA7 A;  2C9N Y;  1RF0 A;  3G3Z A;  2N1T C;  5AW3 B;  5AVY B;  5APV A;  2IX7 C;  1FZC C;  2GM4 A;  2QM7 A;  3L37 A;  1N7S A;  2POH A;  1S9K E;  5AW8 B;  4AYC A;  3VN0 A;  1LTG C;  3H6P A;  2BAS A;  1N2D C;  4M3L A;  5BVZ A;  1RE4 A;  4ZKP A;  5AW6 B;  1M1J B;  1G2C B;  1MUU A;  1CI6 A;  1FZG A;  5KJ7 C;  2FKW B;  2XKM A;  1JMM A;  2A45 I;  1N86 A;  5AVW B;  2FFD B;  1JUN A;  4JF7 A;  1KIL C;  3A5T A;  1FJP A;  5AW1 B;  1A02 J;  2O1J A;  4GKG A;  3CL3 D;  1GD2 E;  3M9Q A;  1NH4 A;  1M1J C;  3VP8 A;  3RK3 B;  1FBM A;  2YNY A;  3B5N D;  1NHL A;  5APY A;  3L4F A;  2C0W A;  1SQP K;  1ZV8 A;  1FJK A;  3TSI A;  2CPB A;  4XA4 A;  1AFO A;  4N6J A;  1GL2 A;  3A2A A;  1LTI C;  4HYT B;  1HH0 A;  5AW4 B;  3RL0 C;  1IFM A;  1JY3 N;  2YMY A;  1GL2 C;  3HE5 B;  3VYI A;  4WB4 A;  1J1E C;  1A02 F;  2P67 A;  1FU1 A;  1JTH B;  4KHX A;  4OH8 B;  2WT7 B;  5AVX B;  4WBA A;  3IR9 A;  1JO5 A;  2QM8 A;  5CHX A;  1NOH A;  3RK3 C;  5APU A;  3NFQ A;  2C9L Y;  1XTC C;  3HTK B;  5APW A;  1X79 B;  2R5B A;  1XTG B;  1GL2 D;  1H89 A;  4N78 D;  1DH3 A;  2ZFC A;  1LT9 C;  1J2J B;  2XU6 A;  2WTY A;  1URQ C;  2GUS A;  2J59 M;  1CI6 B;  4HH2 A;  3HTK A;  2W6B A;  1W2E A;  3CI9 A;  1IFJ A;  1T3U A;  3M91 A;  2PAJ A;  2XDJ A;  3L35 A;  2YO3 A;  1MV8 A;  1URQ A;  3H32 A;  3MUD A;  3MGN A;  3P8C E;  2XNX A;  2OYI C;  1NTK K;  3EQ2 A;  4I6M C;  1NO4 A;  2OYH A;  1MFZ A;  2NPS D;  1N7L A;  5CCG C;  3A7O A;  1JNM A;  3V4W A;  1IJD B;  4WY4 C;  2R5D A;  3HD7 B;  1JY3 O;  1J1D B;  3HUS B;  3V2R A;  3HD7 C;  1LTB C;  5CCG D;  1GW4 A;  2OAR A;  4N78 E;  1JY3 P;  2KLV A;  3T97 A;  1LTA C;  2PP6 A;  5AVT B;  2Q5U A;  2IFN A;  3MIW A;  1LTT C;  3HD7 A;  3MD0 A;  1LTJ A;  1HWT C;  1JOC A;  1AQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...