1G2CA

Human respiratory syncytial virus fusion protein core
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
50
structure length
50
Chain Sequence
LEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords FUSION PROTEIN (F)
publication title Structural characterization of the human respiratory syncytial virus fusion protein core.
pubmed doi rcsb
source organism Human respiratory syncytial virus
total genus 21
structure length 50
sequence length 50
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature
pdb deposition date 2000-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.300 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1g2cA00
1SVFA 2FYZA 1ZV8A 1G2CA 3EFGA 3SWYA 4EIJA 4N6JA 3KPEA
chains in the Genus database with same CATH superfamily
3L73D 4D6TG 1N7SC 2IBZI 1PP9E 4K35A 1P84I 4Y99B 1PZQA 3KPEA 2E43A 1LT9B 2P58A 2XU6A 3A0BE 4JBZA 1ZRTD 2HR3A 3K5BA 1X79B 3SWYA 2MJZA 2HYNA 5E79E 3CC7P 3AEDC 1USDA 3VMAA 1NH4A 2BCCG 4YXDC 2K1AA 1CI6B 1BGYD 1SQVE 1KQSO 2NZ2A 1LWUB 1NU1G 4H13C 1NTMG 2P1JA 1KILC 1SQBK 3CWBG 5APYA 1S5LH 2Q5UA 1FOSE 1XTCC 2JP3A 1H88A 1AJYA 2JO1A 2QJKC 1KZUB 1N73B 3H1KG 4QMAA 4PJ0E 2LR2A 3HE4B 2OTJP 2YMKA 1AVOA 3O8ZA 3S4RA 1N7SA 3D6YA 4H44C 1Y47A 4YPCA 1SQPD 3P7KA 3H1IE 3QH9A 3PLNA 3WU2E 2D2CD 3L4FA 1RQUA 3CCVP 4EI2A 2RMZA 1HUCA 1EZVD 3B5NC 4CPGA 2OYHA 1YJNP 1IFIA 1DIPA 1KN7A 3A0HH 3L71J 3U59A 5TJHA 4Z1MH 4D6TE 2HPCA 2QG4A 1FDMA 3RL0D 2GM4A 3H25A 4N6JA 3KZIH 3V4QA 3D70A 5KAFE 3OW2O 1YTZT 5CBNA 1Z56A 2D2CB 1JY2N 1M1JA 2Y9ZA 3P8CE 1QEXA 3TF5A 3L70J 3TDKA 4O9BA 1KORA 4C7NA 2CPSA 1BCCE 1N2DC 3BCCE 1JY3O 3CPWO 1KILA 1FU1A 3RL0B 2B88A 2W6AA 4PV1C 1ZP0C 2IZ0A 2FXMA 4I6MC 4RKUJ 3CCMP 1IFJA 1FDOA 1NTZE 2JJLA 3OAKA 5AVTB 4BWNA 5AW2B 2JEEA 2IBZE 1JMBA 3H32A 4L75A 2QE7H 3L73E 5AW5B 2K37A 3M06A 1VQNP 3B5NA 1HH0A 1XTGB 3EWKA 4C7RA 4JYCA 3TGUJ 2M0BA 4DZOA 1FZCC 3G9RA 1M57D 5BVZA 1NHLA 2H8PD 1L0LK 2WT7A 2OYOA 1ZRTE 2Z5HA 5APQA 3AECC 3MHVA 1YI2P 1RH5B 1YJWP 5L8RJ 3VYIA 1JY2P 1U57A 4GKGA 4W7YA 1R5SA 1J2JB 1L0NJ 3L71D 3W68A 1X0TA 1BGYE 3T97A 1K73Q 2K88A 2FKWB 1HF9A 5CCGC 3OA7A 1N7SD 2POHA 5E79H 2KOGA 3BVHA 4WB4A 3CXHI 3L70D 3VP8A 2YXRB 1N86A 1NKNA 2FYUK 3EFFK 2N1TC 1PGOA 1J1DC 1GMJA 1YBKA 2V4HA 2ZVNB 1SQPE 1NGMB 2K3RA 1NAYA 1FZCA 1N7SB 3RBZA 2PP6A 1PL5A 4AYCA 1EZVE 5AW8B 1QL2A 3D6ZA 1OIPA 2J5UA 1N7LA 3IN6A 2KNCA 3KQGA 3G3ZA 1T2KD 3H1IJ 1L4AC 2L91A 4H13D 3WU2H 2KB7P 3CCLP 1KILD 2P7JA 5KAIE 3TGUD 4LLHA 2Z5IA 3PP5A 3H1LD 3ZDMA 2G8YA 1NTKJ 1KYOI 1RE3C 1GW3A 4R4MA 5CCGA 1M1JB 1M56D 1FDIA 4H44D 3VTPC 5KAFH 4H13B 4C7NB 5CCHC 2K9JA 2YKOA 2BEZF 1SQVK 1KILB 2N1TA 1L0ND 3B5ND 3U1CA 4U3FE 1HBWA 5APXA 3BCCJ 2A45H 1S3JA 4HH2A 2XV5A 3L72J 1BDDA 4GOFA 1S5LE 4H44B 3PHLA 2Q6QA 1X8YA 2WVRA 1MZ9A 2FY8A 3H32B 2FBWC 3BRTB 2Z4EA 4LGDE 5AW9B 2WSCJ 2B89A 2WSCH 1JY3N 3TGUG 2Q3EA 1YQ4C 4PD4D 5C39A 1G1IA 1L4AA 3B5NB 1P84H 3M9QA 3L73J 3LIDA 4I2LC 3U1AA 4I7ZC 5B5EH 2PRRA 2AXTE 1MFTA 3VMZA 4KT0J 4PV1D 3IAOA 3B4SA 4EDFA 3CMAP 2WT7B 1HTLC 3I55P 1RE3A 4XFJA 5KLIB 4OVNF 3L71E 1KMIZ 3CXHE 3H1ID 2WITA 3P8MC 1GL2D 5B66H 2R3SA 3USSA 2C0WA 1KQFB 1GW4A 3V2NA 4PV1B 3T97B 1PV3A 2B87A 4OGQC 2KLVA 4IL6X 3L70E 5AVYB 3TSIA 1NTKD 3PJSK 1JEKA 2Q9IA 1SQXE 2WPVB 2XZRA 3N7NA 1NU1K 1Q82Q 1NTMK 2OTKE 3CCSP 1D7MA 3L75J 1JY3P 2G3AA 2W90A 2E75B 1FBMA 3CCQP 3BCCD 3G71P 1FZCB 1G1JA 3E7KA 3JSVC 2YKPA 5APSA 1R8EA 1URQA 3L72D 3KHUA 2E42A 3H1IG 3RK3C 5CCGD 3LW5H 1VF5C 1KILE 1HWTC 3TGUE 2KNCB 2M3EA 1CZQA 1RY3A 3H1LE 3MTUE 5AVWB 1P84D 1T8ZA 4OWFA 4WY4C 2N1TD 1NTKG 1KB9I 2ZYGA 1SQBJ 1AVYA 1QVGO 1VQLP 2E74C 3FXDA 2QA4P 3HTKA 1BSNA 1VDFA 1IJDB 1R5LA 5KAIH 4XE5B 1LTSC 1L0NE 1S9KD 1JMMA 2OYHC 3H1HE 2I8DA 2UWJE 1LTJA 3AEFC 1S4XA 5BU5A 3GF7A 2A45G 2K9JB 1BCCG 2HG5D 3BCCG 3SSUA 2NPSC 2N1TB 3IR9A 1JUNA 1J1DB 1L4AD 4ZMDA 2QJPC 1VQPP 3RK2B 2KZJA 2QJYC 4NPFX 2YIUC 1NTZG 1M1JC 4H0LC 1Y9BA 1AQTA 4U3FJ 2XNXA 4R4LA 4PD4E 1DD4A 3G4SP 2IBZG 1YITP 2AEMA 2W6BA 4AUWA 2QM8A 3M0DC 4Y28J 3W67A 3L73G 1DD3A 5AVSB 5AW6B 1L4AB 1QGKB 4W80A 2QVAA 1VQOP 3L75D 5CCHD 3CCUP 4WY4A 4NPDA 2XDJA 5APVA 3KYQA 2M8RA 2AXTH 4ZKPA 4JPZB 1FZEA 1AA0A 1SQQE 1VQKP 1IK9A 1OMIA 3AEBC 2BEQD 3D71A 1UIIA 4TLFA 1NTKE 2Q1KA 2AEFA 2NPSA 1PGPA 2LXBA 3CXHH 2B87B 3IF4A 1BGYG 3V2PA 1SQBD 4EYYQ 5KLIC 3CC2P 2E5YA 5M1BA 3WMM0 1W2EA 4A7PA 3M9HA 1VQ8P 2QSIA 3FWNA 1L0LJ 1SQXJ 2QIWA 1PFIA 2IYOA 1FS0E 3M0DA 3A7OA 3M91A 1EDJA 1OXZA 3L72E 1SQPG 3H6PA 4I7ZB 2H7HA 1URQB 3Q5RA 1QL1A 2OARA 4U3FD 4OGQD 1EZVG 3VOPA 1EQ7A 1P84E 4N3YB 3CLQA 2NRGA 5B5EE 3RGUA 1JCDA 2FYZA 3N4XA 5KJ7C 4UB6E 1FE6A 1KYOH 3UIAA 2E75C 1KC8Q 1PPJD 1X9VA 2SPZA 3H1LJ 1VQ9P 1IFPA 1S9KE 3M9BA 1GDTA 2JDIH 4OGQB 3SFEC 2O01N 2KK7A 3HTKB 1GU5A 3L74J 3FWLA 2WPSA 5B66E 4N78D 3HUSC 3GMAA 1KQGB 4U7JA 1LTJB 2M5AA 3RK3D 1AQ5A 1VF5D 2GUVA 1EDIA 1S5LX 1K05A 3MGNA 3H1HJ 2W8ZA 3PRJA 3P32A 3OJAB 1BDCA 3CXHD 3E1RA 4U3FG 3CD6P 4WBAA 1OWAA 4WY4D 3Q5SA 3GHGA 4TT3H 3CX5I 1Q7YQ 3F5HA 3FGAD 2RKLA 2J58A 2MKVA 3RK3B 3L75E 3NXSA 1OVRA 1ZR4A 1Q90D 2E5TA 1VF5B 1PPJG 1L0LD 1QVFO 1SQXD 1DEEG 1OVUA 4PD4H 5KJ7A 2C9NY 3S9OA 4BXLA 3RK2C 5AVZB 1EC5A 2NPSD 4WY4B 3O6QA 1M1KQ 2N9YB 1A02F 2VRSA 5AVVB 2E74B 1LJ2A 3NMDA 1T3JA 1LTAC 4ZNCA 4HJGH 4H0LD 2P10A 1JOCA 3HUSA 3L71G 1HVVA 4L76A 5DJTB 1KYOD 2OYHB 3ABVC 1SQBE 3C8VA 3H1JJ 1SQQJ 2HPCB 1DEBA 2WPRA 3A5TA 3QWOC 4AQRD 2NPSB 4DOJA 4ZKUA 5AW4B 2QJPB 2FYUD 1YQ3C 2I1KA 2WSEJ 4L74A 2ITAA 3L70G 2QJYB 2WSEH 2YIUB 2CK3H 2CPBA 4H0LB 3L74D 3Q5PA 5KLVJ 3NFQA 1X22A 2ZXXA 1SQXG 1OX3A 5AW3B 2GA1A 1H89A 1LP1A 3AE2C 3F89A 1K9MQ 1KQLA 4YXWH 1MKMA 2WSSH 1GK4A 1J1EC 3H1HD 4IFMA 1BSHA 3VMYA 1M8OB 3II6A 1BE3J 2Y0EA 2ZT9C 1VQ4P 2YKQA 1S72P 1A02J 2N9BA 1RF1A 1YHQP 2Q3IA 3RL0g 1PPJE 1KB9H 1YYCA 3WUVA 5AW0B 2IFNA 3FXEA 4JQ0D 3VP9A 1W2BO 3H1LG 1SP4A 1VPCA 1NKZB 4N78E 1URQC 4UB6H 4M3LA 2JR8A 3L74G 1NU1J 5APWA 5GTHE 2WQYC 1NTKK 1WRGA 2OYIC 1KFMA 2GUSA 3RK3E 2WZ7A 1SVFA 2L5GB 3CWBJ 3HD7C 1RE4C 4JF7A 4IOIH 1NYHA 2A06D 2WTYA 1L0NG 1LT1A 2M5AB 1RHZB 2KI7B 4IFFA 3H1HG 3H1KJ 5EFWB 2QEXP 1SLQA 2IZ1A 3H1JD 3MD0A 1SQQD 4ASVA 2KP8A 1AFOA 5KJ7D 2E75D 1MFZA 1NJIQ 1HGZA 3GHGB 1L0LE 1H8AA 1K8AQ 1DX7A 1E79H 1NTZK 2Y0DA 1LTJC 4W7ZA 5KLVD 3A2AA 2E76C 5AW7B 5KKZC 1PGJA 3GG2A 1UIXA 1MV8A 1KV4A 1IZNB 3GW6A 3O6QB 2YO3A 2ZXEB 1BE3D 1LGHB 3MP7B 3KXDA 1FC2C 1PIXA 1KYOE 5CJ0A 2OYIA 2V7QJ 2ZFCA 2YO2A 3HD7A 1KB9D 1RE4A 2V7QH 2XKMA 1HJBA 1NAFA 3B71A 3HUSB 2Q7CA 1IO4A 4K3AA 1EXJA 3HE5A 1SQQG 1GK6A 4YTPC 2IYPA 2FYUE 1YTZI 2BASA 4I1LA 1TU3F 2A45I 1N8RQ 3V6IA 1DH3A 2O01J 3L74E 2OTLP 2W27A 3BATA 2O01H 2LKMA 3RK2D 5GTIE 1NU1D 3SFDC 5CHXA 2YXQB 3CC4P 3CWBD 1T3UA 1QLED 1GZLA 2M3BA 2AXCA 3AE7C 1LP1B 3AEAC 2J59M 1CW5A 3H1KD 1E5WA 3A3YB 1U7JA 1BE3G 3L72G 3AEGC 3CCEP 1K04A 2DW3A 3AE3C 5AVQB 1Y8AA 1NVOA 2JWAA 2HFED 1IFDA 1SQPK 2FXPA 1RF1B 3AE5C 1JM0A 3NTNA 1LTIC 1OZHA 1KTMA 4DJGA 1ZR2A 3TNUA 4C46A 2JKVA 1T2KC 1FZGA 3TK1A 5TISH 3M0AA 3V2RA 1FZBA 1IC2A 1IK7A 4IL6E 2I1JA 1HGVA 2A06E 1YIJP 2P2UA 2OQQA 5BU8B 1VQ6P 3AE1C 2ZT9D 1OW6A 4LC1A 3H1JE 2ZYDA 3MZWB 1FJPA 5AW1B 5GTHH 2C9LY 4B86A 2FFDC 2H43A 3CX5H 3B8EB 4DT0A 1J1EB 3E1IA 2O3JA 5KLVE 3PH0A 2JWDA 1Q86Q 3EQ2A 1NOHA 2ZT9B 1URQD 5APTA 3Q2YA 3V5BA 2ZVOB 1ZV8A 4L73A 1OVVA 1EZVI 3KDPB 2IFMA 3HD7D 3Q3DA 3L75G 1JTHA 2R32A 2P67A 1ZN5A 2IX7C 1BE3E 5KTBA 3AE8C 1SFCC 1ZOYC 1HJ0A 1KD1Q 3GHGC 3AE6C 1KB9E 4JYBA 1Q81Q 2HODA 2ZYAA 4UB8E 4WWIA 2OYIB 4MN4C 1W5CE 3HD7B 2O1JA 2BCCE 1WMKA 1T6AA 1ZW0A 3CCJP 3HE5B 1LTBC 2KS1A 1U7MA 3HRNA 1OW7A 2E76D 3MUDC 1NU1E 1SQBG 2FYNC 1NTME 4EIJA 1JNMA 4BRYA 2FFDA 1GL2C 2O1KA 2FYUJ 3CWBE 2R3CA 1RF0C 2AEJA 3BASA 3H1KE 2QM7A 1FOSF 2PAJA 5GTIH 1VL2A 2IPPA 2YNYA 4KJMA 1FZFA 3C9IA 2E76B 5KKZB 1ZMEC 1SQXK 3CCRP 2W6JH 3CX5D 1M7LA 3MIWA 2KZIA 1PP9J 3IFMA 3JCUE 1OFCX 1SFCA 2R5BA 4ASWA 1G2CA 1M90Q 1VQ5P 2E74D 3A0BH 3R4YA 1ZXGA 2RH0A 3TYYA 5AVXB 1MUUA 4Y99C 1JCCA 3TNUB 1LT9C 1FAVA 3MUDA 3Q1MA 4GDOA 2B9BA 3BRVB 2KLUA 1GL2A 1L2PA 1SQVJ 2YMYA 1RF1C 5H2FE 1RF0A 2RN0A 2XNDH 3S1KA 3V2QA 4KHXA 3VN0A 1H0TA 1IFMA 4IL6H 4RESB 1GTWA 2ZAEB 5K5GB 1LWUC 1KFNA 1SS1A 4EOTA 2HLOA 1L0NK 1S2EA 1LNQA 3C1LA 4PJ0H 1LTTC 1GD2E 5AVRB 2PGDA 1NWQA 4HYTB 1N73C 5CMZA 1QX8A 3AEEC 1L0LG 4GOEA 1EXIA 2H89C 4D6TJ 1JTHB 1YJ9P 2Y0CA 3EFGA 3I56P 3PTZA 4WVZA 1ZLLA 2LXCB 1LT9A 3WUUA 3SWFA 1FJKA 1PP9D 1JO5A 5APUA 2OGUA 2HODB 2R44A 3AE4C 3FX0A 1FZAA 2WWWA 5TISE 1BCCJ 3SWKA 3G6EP 2QJKB 2D2CC 4HKZH 2WSFJ 4UB8H 1CI6A 2KS1B 3AE9C 2WSFH 3GLMA 2BCCJ 2KIKA 2FYUG 1NTZJ 2WMMA 1SQQK 1LWUA 2Y9YA 3L37A 4BRYB 2FFDB 2ZJSE 2KXPB 1OW8A 1SFCD 4IFDK 3RL0C 1NTMJ 1IFNA 1SQVD 3L36A 1USEA 2W83C 1N73A 3CX5E 5KLVK 3HE4A 1RQVA 4NPEA 1WT6A 1AV1A 1EDLA 2KUBA 4PD4I 3CMEP 1Q2NA 1JB0J 1PP9G 2R5DA 1CSBA 3A0HE 1JY2O 2WPQA 1SFCB 2KYVA 3KZIE 1G2CB 3CL3D 4GIFA 5CCHA 2KSJA 5DJUB 1VQMP 3JCUH 2K9YA 1LTGC 2C0XA 4D6TD 4GT1A 1BGYJ 1EDKA 2H88C 4HB1A 3RBXA 4RJTA 2FXOA 5CBOA 1SQVG 2FYNB 3CI9A 4DCKA 1GL2B 3P8CD 2A06G 4RO0A 2KSEA 1H0TB 1VQ7P 1BCCD 2QRXA 3H1JG 1SQPJ 3L35A 5AVUB 5H2FH 2IDBA 1GU4A 3ITKA 4XA4A 3I5CA 3LW5J 3JC22 3R2PA 2BCCD 3WUTA 1NTZD 3V4WA 2PFXA 3GF3A 4OH8B 3VMXA 2IBZD 1PGQA 5KLVG 1NTMD 4GODA 1NO4A 5CJ4A 1S1CX 3LIEA
chains in the Genus database with same CATH topology
1G1IA 1ZV8A 1L4AA 3B5NB 3KDPB 2IFMA 3M9QA 3LIDA 1N7SC 3HD7D 4I2LC 3U1AA 1JTHA 5KJ7A 2C9NY 2R32A 2P67A 3RK2C 1ZN5A 5AVZB 3VMZA 2IX7C 5KTBA 1SFCC 4Y99B 3KPEA 2NPSD 4WY4B 2E43A 2WT7B 1HTLC 1LT9B 1RE3A 3GHGC 1A02F 2VRSA 5AVVB 4JYBA 2XU6A 2HODA 3NMDA 1T3JA 1LTAC 2OYIB 2WITA 1X79B 1JOCA 3HUSA 3SWYA 3P8MC 1HVVA 1GL2D 3HD7B 2MJZA 2O1JA 2OYHB 2HYNA 3HE5B 2C0WA 1LTBC 1GW4A 3HRNA 3V2NA 2HPCB 1DEBA 1NH4A 2WPRA 1CI6B 3A5TA 2KLVA 4AQRD 2NPSB 4DOJA 4ZKUA 5AVYB 3TSIA 4EIJA 5AW4B 1JNMA 2FFDA 1GL2C 2O1KA 2I1KA 1LWUB 2R3CA 2WSEH 2Q9IA 2P1JA 1RF0C 2CPBA 3BASA 1KILC 1SQBK 5APYA 3NFQA 2Q5UA 1FOSE 1XTCC 5AW3B 2XZRA 1H88A 3N7NA 1NU1K 2QM7A 1H89A 1NTMK 1FOSF 2PAJA 1KQLA 1KZUB 1N73B 2IPPA 2YNYA 1JY3P 1GK4A 1FZFA 3C9IA 3HE4B 3O8ZA 1FBMA 1N7SA 1SQXK 1J1EC 1FZCB 1G1JA 1M7LA 4IFMA 3MIWA 3P7KA 3VMYA 2YKPA 5APSA 1URQA 3II6A 3IFMA 3L4FA 1SFCA 2R5BA 2E42A 2YKQA 1G2CA 3RK3C 5CCGD 1A02J 3LW5H 1HUCA 2N9BA 1RF1A 3B5NC 1HWTC 2OYHA 1IFIA 2Q3IA 1CZQA 3U59A 2HPCA 1RY3A 1YYCA 3MTUE 5AVWB 1FDMA 1T8ZA 5AW0B 3RL0D 2GM4A 2IFNA 3TYYA 5AVXB 1MUUA 4Y99C 4N6JA 3VP9A 3V4QA 4WY4C 2N1TD 1JCCA 3TNUB 1LT9C 1SP4A 1VPCA 1YTZT 1NKZB 1FAVA 1Z56A 4N78E 1JY2N 1M1JA 1URQC 3MUDA 3P8CE 4M3LA 3HTKA 5APWA 1VDFA 1IJDB 4O9BA 4XE5B 3BRVB 1NTKK 1WRGA 2OYIC 1GL2A 1KFMA 1LTSC 2GUSA 2YMYA 2WZ7A 1SVFA 2L5GB 1RF1C 3HD7C 1S9KD 4C7NA 2CPSA 1RE4C 1JMMA 4JF7A 2OYHC 1N2DC 1RF0A 1JY3O 1LTJA 1KILA 1FU1A 5BU5A 3V2QA 4KHXA 2WTYA 3RL0B 3VN0A 2W6AA 1IFMA 2A45G 2HG5D 4IFFA 4RESB 2NPSC 1GTWA 2N1TB 3IR9A 2FXMA 4I6MC 1J1DB 1L4AD 1JUNA 1SLQA 1IFJA 2JJLA 3OAKA 3MD0A 5AVTB 1LWUC 2KP8A 3RK2B 1KFNA 1AFOA 5KJ7D 5AW2B 4EOTA 2JEEA 2HLOA 1L0NK 1M1JC 1LTTC 1GD2E 5AVRB 3H32A 1MFZA 2XNXA 1HGZA 3GHGB 1NWQA 5AW5B 2W6BA 1H8AA 1DX7A 4HYTB 4AUWA 2QM8A 1NTZK 3M0DC 1N73C 3M06A 1LTJC 4W7ZA 5CMZA 3A2AA 3B5NA 1HH0A 1XTGB 5AVSB 4C7RA 5AW7B 4JYCA 5AW6B 1L4AB 4DZOA 1FZCC 4W80A 5BVZA 1JTHB 5CCHD 1MV8A 1NHLA 3EFGA 2H8PD 1L0LK 4WY4A 2WT7A 1ZLLA 2XDJA 1LT9A 2Z5HA 5APQA 3SWFA 1FJKA 5APVA 2YO3A 2ZXEB 3KYQA 1JO5A 1LGHB 5APUA 2M8RA 3VYIA 1JY2P 4ZKPA 2HODB 1FZEA 5CJ0A 2OYIA 1FZAA 2ZFCA 2YO2A 4GKGA 4W7YA 1IK9A 1J2JB 2WWWA 3HD7A 1RE4A 2XKMA 1NAFA 1HJBA 2Q7CA 3HUSB 1IO4A 3HE5A 1GK6A 3T97A 1YTZI 1CI6A 2BASA 4I1LA 2NPSA 2FKWB 2WSFH 5CCGC 2A45I 3OA7A 1DH3A 3V2PA 1N7SD 1SQQK 1LWUA 2W27A 3BATA 3L37A 2FFDB 2POHA 2O01H 2KOGA 3BVHA 2LKMA 3RK2D 4WB4A 3WMM0 1W2EA 3VP8A 1N86A 1SFCD 3M9HA 5CHXA 4IFDK 3RL0C 1IFNA 1NKNA 2FYUK 1T3UA 3L36A 2N1TC 1J1DC 1GZLA 2M3BA 1PFIA 3M0DA 1N73A 3A7OA 5KLVK 3HE4A 3M91A 1WT6A 1OXZA 2J59M 1CW5A 1FZCA 3H6PA 2R5DA 1N7SB 3A3YB 1E5WA 1CSBA 2PP6A 2H7HA 4AYCA 1JY2O 2WPQA 5AW8B 5AVQB 1URQB 1QL2A 1SFCB 1QL1A 2OARA 2HFED 1IFDA 2KYVA 1SQPK 3VOPA 1EQ7A 1G2CB 1N7LA 4N3YB 3KQGA 3G3ZA 1T2KD 3CL3D 1RF1B 1L4AC 3CLQA 4GIFA 3NTNA 5CCHA 1JCDA 2FYZA 1LTIC 3N4XA 2KB7P 2KSJA 5KJ7C 3UIAA 1KILD 2P7JA 4LLHA 1ZR2A 2Z5IA 3TNUA 4C46A 1X9VA 3PP5A 1LTGC 1T2KC 1FZGA 2C0XA 3TK1A 4GT1A 3M0AA 3V2RA 1FZBA 1RE3C 1IC2A 1GW3A 1S9KE 3M9BA 5CCGA 1GDTA 2I1JA 1M1JB 1HGVA 3HTKB 3CI9A 1GU5A 3VTPC 2WPSA 2P2UA 4N78D 1GL2B 3HUSC 5BU8B 3P8CD 4C7NB 5CCHC 2YKOA 1SQVK 1LTJB 4LC1A 1KILB 3RK3D 1AQ5A 1FJPA 2N1TA 5AW1B 2C9LY 3B5ND 2GUVA 3U1CA 4B86A 3MGNA 1HBWA 5APXA 2A45H 3L35A 3P32A 5AVUB 2FFDC 3OJAB 4HH2A 1GU4A 2H43A 2XV5A 3B8EB 4XA4A 3I5CA 3R2PA 1J1EB 1X8YA 4WBAA 1OWAA 4WY4D 3V4WA 3E1IA 3GHGA 1MZ9A 3H32B 4OH8B 3BRTB 2Z4EA 4LGDE 5AW9B 3VMXA 3EQ2A 1NOHA 1URQD 2J58A 5APTA 1NO4A 1JY3N 2WSCH 3RK3B 3NXSA 5CJ4A 3LIEA 3V5BA 1ZR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SVF A;  2FYZ A;  1ZV8 A;  1G2C A;  3EFG A;  3SWY A;  4EIJ A;  4N6J A;  3KPE A; 
#chains in the Genus database with same CATH topology
 3L73 D;  4D6T G;  1N7S C;  2IBZ I;  1PP9 E;  4K35 A;  1P84 I;  4Y99 B;  1PZQ A;  3KPE A;  2E43 A;  1LT9 B;  2P58 A;  2XU6 A;  3A0B E;  4JBZ A;  1ZRT D;  2HR3 A;  3K5B A;  1X79 B;  3SWY A;  2MJZ A;  2HYN A;  5E79 E;  3CC7 P;  3AED C;  1USD A;  3VMA A;  1NH4 A;  2BCC G;  4YXD C;  2K1A A;  1CI6 B;  1BGY D;  1SQV E;  1KQS O;  2NZ2 A;  1LWU B;  1NU1 G;  4H13 C;  1NTM G;  2P1J A;  1KIL C;  1SQB K;  3CWB G;  5APY A;  1S5L H;  2Q5U A;  1FOS E;  1XTC C;  2JP3 A;  1H88 A;  1AJY A;  2JO1 A;  2QJK C;  1KZU B;  1N73 B;  3H1K G;  4QMA A;  4PJ0 E;  2LR2 A;  3HE4 B;  2OTJ P;  2YMK A;  1AVO A;  3O8Z A;  3S4R A;  1N7S A;  3D6Y A;  4H44 C;  1Y47 A;  4YPC A;  1SQP D;  3P7K A;  3H1I E;  3QH9 A;  3PLN A;  3WU2 E;  2D2C D;  3L4F A;  1RQU A;  3CCV P;  4EI2 A;  2RMZ A;  1HUC A;  1EZV D;  3B5N C;  4CPG A;  2OYH A;  1YJN P;  1IFI A;  1DIP A;  1KN7 A;  3A0H H;  3L71 J;  3U59 A;  5TJH A;  4Z1M H;  4D6T E;  2HPC A;  2QG4 A;  1FDM A;  3RL0 D;  2GM4 A;  3H25 A;  4N6J A;  3KZI H;  3V4Q A;  3D70 A;  5KAF E;  3OW2 O;  1YTZ T;  5CBN A;  1Z56 A;  2D2C B;  1JY2 N;  1M1J A;  2Y9Z A;  3P8C E;  1QEX A;  3TF5 A;  3L70 J;  3TDK A;  4O9B A;  1KOR A;  4C7N A;  2CPS A;  1BCC E;  1N2D C;  3BCC E;  1JY3 O;  3CPW O;  1KIL A;  1FU1 A;  3RL0 B;  2B88 A;  2W6A A;  4PV1 C;  1ZP0 C;  2IZ0 A;  2FXM A;  4I6M C;  4RKU J;  3CCM P;  1IFJ A;  1FDO A;  1NTZ E;  2JJL A;  3OAK A;  5AVT B;  4BWN A;  5AW2 B;  2JEE A;  2IBZ E;  1JMB A;  3H32 A;  4L75 A;  2QE7 H;  3L73 E;  5AW5 B;  2K37 A;  3M06 A;  1VQN P;  3B5N A;  1HH0 A;  1XTG B;  3EWK A;  4C7R A;  4JYC A;  3TGU J;  2M0B A;  4DZO A;  1FZC C;  3G9R A;  1M57 D;  5BVZ A;  1NHL A;  2H8P D;  1L0L K;  2WT7 A;  2OYO A;  1ZRT E;  2Z5H A;  5APQ A;  3AEC C;  3MHV A;  1YI2 P;  1RH5 B;  1YJW P;  5L8R J;  3VYI A;  1JY2 P;  1U57 A;  4GKG A;  4W7Y A;  1R5S A;  1J2J B;  1L0N J;  3L71 D;  3W68 A;  1X0T A;  1BGY E;  3T97 A;  1K73 Q;  2K88 A;  2FKW B;  1HF9 A;  5CCG C;  3OA7 A;  1N7S D;  2POH A;  5E79 H;  2KOG A;  3BVH A;  4WB4 A;  3CXH I;  3L70 D;  3VP8 A;  2YXR B;  1N86 A;  1NKN A;  2FYU K;  3EFF K;  2N1T C;  1PGO A;  1J1D C;  1GMJ A;  1YBK A;  2V4H A;  2ZVN B;  1SQP E;  1NGM B;  2K3R A;  1NAY A;  1FZC A;  1N7S B;  3RBZ A;  2PP6 A;  1PL5 A;  4AYC A;  1EZV E;  5AW8 B;  1QL2 A;  3D6Z A;  1OIP A;  2J5U A;  1N7L A;  3IN6 A;  2KNC A;  3KQG A;  3G3Z A;  1T2K D;  3H1I J;  1L4A C;  2L91 A;  4H13 D;  3WU2 H;  2KB7 P;  3CCL P;  1KIL D;  2P7J A;  5KAI E;  3TGU D;  4LLH A;  2Z5I A;  3PP5 A;  3H1L D;  3ZDM A;  2G8Y A;  1NTK J;  1KYO I;  1RE3 C;  1GW3 A;  4R4M A;  5CCG A;  1M1J B;  1M56 D;  1FDI A;  4H44 D;  3VTP C;  5KAF H;  4H13 B;  4C7N B;  5CCH C;  2K9J A;  2YKO A;  2BEZ F;  1SQV K;  1KIL B;  2N1T A;  1L0N D;  3B5N D;  3U1C A;  4U3F E;  1HBW A;  5APX A;  3BCC J;  2A45 H;  1S3J A;  4HH2 A;  2XV5 A;  3L72 J;  1BDD A;  4GOF A;  1S5L E;  4H44 B;  3PHL A;  2Q6Q A;  1X8Y A;  2WVR A;  1MZ9 A;  2FY8 A;  3H32 B;  2FBW C;  3BRT B;  2Z4E A;  4LGD E;  5AW9 B;  2WSC J;  2B89 A;  2WSC H;  1JY3 N;  3TGU G;  2Q3E A;  1YQ4 C;  4PD4 D;  5C39 A;  1G1I A;  1L4A A;  3B5N B;  1P84 H;  3M9Q A;  3L73 J;  3LID A;  4I2L C;  3U1A A;  4I7Z C;  5B5E H;  2PRR A;  2AXT E;  1MFT A;  3VMZ A;  4KT0 J;  4PV1 D;  3IAO A;  3B4S A;  4EDF A;  3CMA P;  2WT7 B;  1HTL C;  3I55 P;  1RE3 A;  4XFJ A;  5KLI B;  4OVN F;  3L71 E;  1KMI Z;  3CXH E;  3H1I D;  2WIT A;  3P8M C;  1GL2 D;  5B66 H;  2R3S A;  3USS A;  2C0W A;  1KQF B;  1GW4 A;  3V2N A;  4PV1 B;  3T97 B;  1PV3 A;  2B87 A;  4OGQ C;  2KLV A;  4IL6 X;  3L70 E;  5AVY B;  3TSI A;  1NTK D;  3PJS K;  1JEK A;  2Q9I A;  1SQX E;  2WPV B;  2XZR A;  3N7N A;  1NU1 K;  1Q82 Q;  1NTM K;  2OTK E;  3CCS P;  1D7M A;  3L75 J;  1JY3 P;  2G3A A;  2W90 A;  2E75 B;  1FBM A;  3CCQ P;  3BCC D;  3G71 P;  1FZC B;  1G1J A;  3E7K A;  3JSV C;  2YKP A;  5APS A;  1R8E A;  1URQ A;  3L72 D;  3KHU A;  2E42 A;  3H1I G;  3RK3 C;  5CCG D;  3LW5 H;  1VF5 C;  1KIL E;  1HWT C;  3TGU E;  2KNC B;  2M3E A;  1CZQ A;  1RY3 A;  3H1L E;  3MTU E;  5AVW B;  1P84 D;  1T8Z A;  4OWF A;  4WY4 C;  2N1T D;  1NTK G;  1KB9 I;  2ZYG A;  1SQB J;  1AVY A;  1QVG O;  1VQL P;  2E74 C;  3FXD A;  2QA4 P;  3HTK A;  1BSN A;  1VDF A;  1IJD B;  1R5L A;  5KAI H;  4XE5 B;  1LTS C;  1L0N E;  1S9K D;  1JMM A;  2OYH C;  3H1H E;  2I8D A;  2UWJ E;  1LTJ A;  3AEF C;  1S4X A;  5BU5 A;  3GF7 A;  2A45 G;  2K9J B;  1BCC G;  2HG5 D;  3BCC G;  3SSU A;  2NPS C;  2N1T B;  3IR9 A;  1JUN A;  1J1D B;  1L4A D;  4ZMD A;  2QJP C;  1VQP P;  3RK2 B;  2KZJ A;  2QJY C;  4NPF X;  2YIU C;  1NTZ G;  1M1J C;  4H0L C;  1Y9B A;  1AQT A;  4U3F J;  2XNX A;  4R4L A;  4PD4 E;  1DD4 A;  3G4S P;  2IBZ G;  1YIT P;  2AEM A;  2W6B A;  4AUW A;  2QM8 A;  3M0D C;  4Y28 J;  3W67 A;  3L73 G;  1DD3 A;  5AVS B;  5AW6 B;  1L4A B;  1QGK B;  4W80 A;  2QVA A;  1VQO P;  3L75 D;  5CCH D;  3CCU P;  4WY4 A;  4NPD A;  2XDJ A;  5APV A;  3KYQ A;  2M8R A;  2AXT H;  4ZKP A;  4JPZ B;  1FZE A;  1AA0 A;  1SQQ E;  1VQK P;  1IK9 A;  1OMI A;  3AEB C;  2BEQ D;  3D71 A;  1UII A;  4TLF A;  1NTK E;  2Q1K A;  2AEF A;  2NPS A;  1PGP A;  2LXB A;  3CXH H;  2B87 B;  3IF4 A;  1BGY G;  3V2P A;  1SQB D;  4EYY Q;  5KLI C;  3CC2 P;  2E5Y A;  5M1B A;  3WMM 0;  1W2E A;  4A7P A;  3M9H A;  1VQ8 P;  2QSI A;  3FWN A;  1L0L J;  1SQX J;  2QIW A;  1PFI A;  2IYO A;  1FS0 E;  3M0D A;  3A7O A;  3M91 A;  1EDJ A;  1OXZ A;  3L72 E;  1SQP G;  3H6P A;  4I7Z B;  2H7H A;  1URQ B;  3Q5R A;  1QL1 A;  2OAR A;  4U3F D;  4OGQ D;  1EZV G;  3VOP A;  1EQ7 A;  1P84 E;  4N3Y B;  3CLQ A;  2NRG A;  5B5E E;  3RGU A;  1JCD A;  2FYZ A;  3N4X A;  5KJ7 C;  4UB6 E;  1FE6 A;  1KYO H;  3UIA A;  2E75 C;  1KC8 Q;  1PPJ D;  1X9V A;  2SPZ A;  3H1L J;  1VQ9 P;  1IFP A;  1S9K E;  3M9B A;  1GDT A;  2JDI H;  4OGQ B;  3SFE C;  2O01 N;  2KK7 A;  3HTK B;  1GU5 A;  3L74 J;  3FWL A;  2WPS A;  5B66 E;  4N78 D;  3HUS C;  3GMA A;  1KQG B;  4U7J A;  1LTJ B;  2M5A A;  3RK3 D;  1AQ5 A;  1VF5 D;  2GUV A;  1EDI A;  1S5L X;  1K05 A;  3MGN A;  3H1H J;  2W8Z A;  3PRJ A;  3P32 A;  3OJA B;  1BDC A;  3CXH D;  3E1R A;  4U3F G;  3CD6 P;  4WBA A;  1OWA A;  4WY4 D;  3Q5S A;  3GHG A;  4TT3 H;  3CX5 I;  1Q7Y Q;  3F5H A;  3FGA D;  2RKL A;  2J58 A;  2MKV A;  3RK3 B;  3L75 E;  3NXS A;  1OVR A;  1ZR4 A;  1Q90 D;  2E5T A;  1VF5 B;  1PPJ G;  1L0L D;  1QVF O;  1SQX D;  1DEE G;  1OVU A;  4PD4 H;  5KJ7 A;  2C9N Y;  3S9O A;  4BXL A;  3RK2 C;  5AVZ B;  1EC5 A;  2NPS D;  4WY4 B;  3O6Q A;  1M1K Q;  2N9Y B;  1A02 F;  2VRS A;  5AVV B;  2E74 B;  1LJ2 A;  3NMD A;  1T3J A;  1LTA C;  4ZNC A;  4HJG H;  4H0L D;  2P10 A;  1JOC A;  3HUS A;  3L71 G;  1HVV A;  4L76 A;  5DJT B;  1KYO D;  2OYH B;  3ABV C;  1SQB E;  3C8V A;  3H1J J;  1SQQ J;  2HPC B;  1DEB A;  2WPR A;  3A5T A;  3QWO C;  4AQR D;  2NPS B;  4DOJ A;  4ZKU A;  5AW4 B;  2QJP B;  2FYU D;  1YQ3 C;  2I1K A;  2WSE J;  4L74 A;  2ITA A;  3L70 G;  2QJY B;  2WSE H;  2YIU B;  2CK3 H;  2CPB A;  4H0L B;  3L74 D;  3Q5P A;  5KLV J;  3NFQ A;  1X22 A;  2ZXX A;  1SQX G;  1OX3 A;  5AW3 B;  2GA1 A;  1H89 A;  1LP1 A;  3AE2 C;  3F89 A;  1K9M Q;  1KQL A;  4YXW H;  1MKM A;  2WSS H;  1GK4 A;  1J1E C;  3H1H D;  4IFM A;  1BSH A;  3VMY A;  1M8O B;  3II6 A;  1BE3 J;  2Y0E A;  2ZT9 C;  1VQ4 P;  2YKQ A;  1S72 P;  1A02 J;  2N9B A;  1RF1 A;  1YHQ P;  2Q3I A;  3RL0 g;  1PPJ E;  1KB9 H;  1YYC A;  3WUV A;  5AW0 B;  2IFN A;  3FXE A;  4JQ0 D;  3VP9 A;  1W2B O;  3H1L G;  1SP4 A;  1VPC A;  1NKZ B;  4N78 E;  1URQ C;  4UB6 H;  4M3L A;  2JR8 A;  3L74 G;  1NU1 J;  5APW A;  5GTH E;  2WQY C;  1NTK K;  1WRG A;  2OYI C;  1KFM A;  2GUS A;  3RK3 E;  2WZ7 A;  1SVF A;  2L5G B;  3CWB J;  3HD7 C;  1RE4 C;  4JF7 A;  4IOI H;  1NYH A;  2A06 D;  2WTY A;  1L0N G;  1LT1 A;  2M5A B;  1RHZ B;  2KI7 B;  4IFF A;  3H1H G;  3H1K J;  5EFW B;  2QEX P;  1SLQ A;  2IZ1 A;  3H1J D;  3MD0 A;  1SQQ D;  4ASV A;  2KP8 A;  1AFO A;  5KJ7 D;  2E75 D;  1MFZ A;  1NJI Q;  1HGZ A;  3GHG B;  1L0L E;  1H8A A;  1K8A Q;  1DX7 A;  1E79 H;  1NTZ K;  2Y0D A;  1LTJ C;  4W7Z A;  5KLV D;  3A2A A;  2E76 C;  5AW7 B;  5KKZ C;  1PGJ A;  3GG2 A;  1UIX A;  1MV8 A;  1KV4 A;  1IZN B;  3GW6 A;  3O6Q B;  2YO3 A;  2ZXE B;  1BE3 D;  1LGH B;  3MP7 B;  3KXD A;  1FC2 C;  1PIX A;  1KYO E;  5CJ0 A;  2OYI A;  2V7Q J;  2ZFC A;  2YO2 A;  3HD7 A;  1KB9 D;  1RE4 A;  2V7Q H;  2XKM A;  1HJB A;  1NAF A;  3B71 A;  3HUS B;  2Q7C A;  1IO4 A;  4K3A A;  1EXJ A;  3HE5 A;  1SQQ G;  1GK6 A;  4YTP C;  2IYP A;  2FYU E;  1YTZ I;  2BAS A;  4I1L A;  1TU3 F;  2A45 I;  1N8R Q;  3V6I A;  1DH3 A;  2O01 J;  3L74 E;  2OTL P;  2W27 A;  3BAT A;  2O01 H;  2LKM A;  3RK2 D;  5GTI E;  1NU1 D;  3SFD C;  5CHX A;  2YXQ B;  3CC4 P;  3CWB D;  1T3U A;  1QLE D;  1GZL A;  2M3B A;  2AXC A;  3AE7 C;  1LP1 B;  3AEA C;  2J59 M;  1CW5 A;  3H1K D;  1E5W A;  3A3Y B;  1U7J A;  1BE3 G;  3L72 G;  3AEG C;  3CCE P;  1K04 A;  2DW3 A;  3AE3 C;  5AVQ B;  1Y8A A;  1NVO A;  2JWA A;  2HFE D;  1IFD A;  1SQP K;  2FXP A;  1RF1 B;  3AE5 C;  1JM0 A;  3NTN A;  1LTI C;  1OZH A;  1KTM A;  4DJG A;  1ZR2 A;  3TNU A;  4C46 A;  2JKV A;  1T2K C;  1FZG A;  3TK1 A;  5TIS H;  3M0A A;  3V2R A;  1FZB A;  1IC2 A;  1IK7 A;  4IL6 E;  2I1J A;  1HGV A;  2A06 E;  1YIJ P;  2P2U A;  2OQQ A;  5BU8 B;  1VQ6 P;  3AE1 C;  2ZT9 D;  1OW6 A;  4LC1 A;  3H1J E;  2ZYD A;  3MZW B;  1FJP A;  5AW1 B;  5GTH H;  2C9L Y;  4B86 A;  2FFD C;  2H43 A;  3CX5 H;  3B8E B;  4DT0 A;  1J1E B;  3E1I A;  2O3J A;  5KLV E;  3PH0 A;  2JWD A;  1Q86 Q;  3EQ2 A;  1NOH A;  2ZT9 B;  1URQ D;  5APT A;  3Q2Y A;  3V5B A;  2ZVO B;  1ZV8 A;  4L73 A;  1OVV A;  1EZV I;  3KDP B;  2IFM A;  3HD7 D;  3Q3D A;  3L75 G;  1JTH A;  2R32 A;  2P67 A;  1ZN5 A;  2IX7 C;  1BE3 E;  5KTB A;  3AE8 C;  1SFC C;  1ZOY C;  1HJ0 A;  1KD1 Q;  3GHG C;  3AE6 C;  1KB9 E;  4JYB A;  1Q81 Q;  2HOD A;  2ZYA A;  4UB8 E;  4WWI A;  2OYI B;  4MN4 C;  1W5C E;  3HD7 B;  2O1J A;  2BCC E;  1WMK A;  1T6A A;  1ZW0 A;  3CCJ P;  3HE5 B;  1LTB C;  2KS1 A;  1U7M A;  3HRN A;  1OW7 A;  2E76 D;  3MUD C;  1NU1 E;  1SQB G;  2FYN C;  1NTM E;  4EIJ A;  1JNM A;  4BRY A;  2FFD A;  1GL2 C;  2O1K A;  2FYU J;  3CWB E;  2R3C A;  1RF0 C;  2AEJ A;  3BAS A;  3H1K E;  2QM7 A;  1FOS F;  2PAJ A;  5GTI H;  1VL2 A;  2IPP A;  2YNY A;  4KJM A;  1FZF A;  3C9I A;  2E76 B;  5KKZ B;  1ZME C;  1SQX K;  3CCR P;  2W6J H;  3CX5 D;  1M7L A;  3MIW A;  2KZI A;  1PP9 J;  3IFM A;  3JCU E;  1OFC X;  1SFC A;  2R5B A;  4ASW A;  1G2C A;  1M90 Q;  1VQ5 P;  2E74 D;  3A0B H;  3R4Y A;  1ZXG A;  2RH0 A;  3TYY A;  5AVX B;  1MUU A;  4Y99 C;  1JCC A;  3TNU B;  1LT9 C;  1FAV A;  3MUD A;  3Q1M A;  4GDO A;  2B9B A;  3BRV B;  2KLU A;  1GL2 A;  1L2P A;  1SQV J;  2YMY A;  1RF1 C;  5H2F E;  1RF0 A;  2RN0 A;  2XND H;  3S1K A;  3V2Q A;  4KHX A;  3VN0 A;  1H0T A;  1IFM A;  4IL6 H;  4RES B;  1GTW A;  2ZAE B;  5K5G B;  1LWU C;  1KFN A;  1SS1 A;  4EOT A;  2HLO A;  1L0N K;  1S2E A;  1LNQ A;  3C1L A;  4PJ0 H;  1LTT C;  1GD2 E;  5AVR B;  2PGD A;  1NWQ A;  4HYT B;  1N73 C;  5CMZ A;  1QX8 A;  3AEE C;  1L0L G;  4GOE A;  1EXI A;  2H89 C;  4D6T J;  1JTH B;  1YJ9 P;  2Y0C A;  3EFG A;  3I56 P;  3PTZ A;  4WVZ A;  1ZLL A;  2LXC B;  1LT9 A;  3WUU A;  3SWF A;  1FJK A;  1PP9 D;  1JO5 A;  5APU A;  2OGU A;  2HOD B;  2R44 A;  3AE4 C;  3FX0 A;  1FZA A;  2WWW A;  5TIS E;  1BCC J;  3SWK A;  3G6E P;  2QJK B;  2D2C C;  4HKZ H;  2WSF J;  4UB8 H;  1CI6 A;  2KS1 B;  3AE9 C;  2WSF H;  3GLM A;  2BCC J;  2KIK A;  2FYU G;  1NTZ J;  2WMM A;  1SQQ K;  1LWU A;  2Y9Y A;  3L37 A;  4BRY B;  2FFD B;  2ZJS E;  2KXP B;  1OW8 A;  1SFC D;  4IFD K;  3RL0 C;  1NTM J;  1IFN A;  1SQV D;  3L36 A;  1USE A;  2W83 C;  1N73 A;  3CX5 E;  5KLV K;  3HE4 A;  1RQV A;  4NPE A;  1WT6 A;  1AV1 A;  1EDL A;  2KUB A;  4PD4 I;  3CME P;  1Q2N A;  1JB0 J;  1PP9 G;  2R5D A;  1CSB A;  3A0H E;  1JY2 O;  2WPQ A;  1SFC B;  2KYV A;  3KZI E;  1G2C B;  3CL3 D;  4GIF A;  5CCH A;  2KSJ A;  5DJU B;  1VQM P;  3JCU H;  2K9Y A;  1LTG C;  2C0X A;  4D6T D;  4GT1 A;  1BGY J;  1EDK A;  2H88 C;  4HB1 A;  3RBX A;  4RJT A;  2FXO A;  5CBO A;  1SQV G;  2FYN B;  3CI9 A;  4DCK A;  1GL2 B;  3P8C D;  2A06 G;  4RO0 A;  2KSE A;  1H0T B;  1VQ7 P;  1BCC D;  2QRX A;  3H1J G;  1SQP J;  3L35 A;  5AVU B;  5H2F H;  2IDB A;  1GU4 A;  3ITK A;  4XA4 A;  3I5C A;  3LW5 J;  3JC2 2;  3R2P A;  2BCC D;  3WUT A;  1NTZ D;  3V4W A;  2PFX A;  3GF3 A;  4OH8 B;  3VMX A;  2IBZ D;  1PGQ A;  5KLV G;  1NTM D;  4GOD A;  1NO4 A;  5CJ4 A;  1S1C X;  3LIE A; 
#chains in the Genus database with same CATH homology
 1G1I A;  1ZV8 A;  1L4A A;  3B5N B;  3KDP B;  2IFM A;  3M9Q A;  3LID A;  1N7S C;  3HD7 D;  4I2L C;  3U1A A;  1JTH A;  5KJ7 A;  2C9N Y;  2R32 A;  2P67 A;  3RK2 C;  1ZN5 A;  5AVZ B;  3VMZ A;  2IX7 C;  5KTB A;  1SFC C;  4Y99 B;  3KPE A;  2NPS D;  4WY4 B;  2E43 A;  2WT7 B;  1HTL C;  1LT9 B;  1RE3 A;  3GHG C;  1A02 F;  2VRS A;  5AVV B;  4JYB A;  2XU6 A;  2HOD A;  3NMD A;  1T3J A;  1LTA C;  2OYI B;  2WIT A;  1X79 B;  1JOC A;  3HUS A;  3SWY A;  3P8M C;  1HVV A;  1GL2 D;  3HD7 B;  2MJZ A;  2O1J A;  2OYH B;  2HYN A;  3HE5 B;  2C0W A;  1LTB C;  1GW4 A;  3HRN A;  3V2N A;  2HPC B;  1DEB A;  1NH4 A;  2WPR A;  1CI6 B;  3A5T A;  2KLV A;  4AQR D;  2NPS B;  4DOJ A;  4ZKU A;  5AVY B;  3TSI A;  4EIJ A;  5AW4 B;  1JNM A;  2FFD A;  1GL2 C;  2O1K A;  2I1K A;  1LWU B;  2R3C A;  2WSE H;  2Q9I A;  2P1J A;  1RF0 C;  2CPB A;  3BAS A;  1KIL C;  1SQB K;  5APY A;  3NFQ A;  2Q5U A;  1FOS E;  1XTC C;  5AW3 B;  2XZR A;  1H88 A;  3N7N A;  1NU1 K;  2QM7 A;  1H89 A;  1NTM K;  1FOS F;  2PAJ A;  1KQL A;  1KZU B;  1N73 B;  2IPP A;  2YNY A;  1JY3 P;  1GK4 A;  1FZF A;  3C9I A;  3HE4 B;  3O8Z A;  1FBM A;  1N7S A;  1SQX K;  1J1E C;  1FZC B;  1G1J A;  1M7L A;  4IFM A;  3MIW A;  3P7K A;  3VMY A;  2YKP A;  5APS A;  1URQ A;  3II6 A;  3IFM A;  3L4F A;  1SFC A;  2R5B A;  2E42 A;  2YKQ A;  1G2C A;  3RK3 C;  5CCG D;  1A02 J;  3LW5 H;  1HUC A;  2N9B A;  1RF1 A;  3B5N C;  1HWT C;  2OYH A;  1IFI A;  2Q3I A;  1CZQ A;  3U59 A;  2HPC A;  1RY3 A;  1YYC A;  3MTU E;  5AVW B;  1FDM A;  1T8Z A;  5AW0 B;  3RL0 D;  2GM4 A;  2IFN A;  3TYY A;  5AVX B;  1MUU A;  4Y99 C;  4N6J A;  3VP9 A;  3V4Q A;  4WY4 C;  2N1T D;  1JCC A;  3TNU B;  1LT9 C;  1SP4 A;  1VPC A;  1YTZ T;  1NKZ B;  1FAV A;  1Z56 A;  4N78 E;  1JY2 N;  1M1J A;  1URQ C;  3MUD A;  3P8C E;  4M3L A;  3HTK A;  5APW A;  1VDF A;  1IJD B;  4O9B A;  4XE5 B;  3BRV B;  1NTK K;  1WRG A;  2OYI C;  1GL2 A;  1KFM A;  1LTS C;  2GUS A;  2YMY A;  2WZ7 A;  1SVF A;  2L5G B;  1RF1 C;  3HD7 C;  1S9K D;  4C7N A;  2CPS A;  1RE4 C;  1JMM A;  4JF7 A;  2OYH C;  1N2D C;  1RF0 A;  1JY3 O;  1LTJ A;  1KIL A;  1FU1 A;  5BU5 A;  3V2Q A;  4KHX A;  2WTY A;  3RL0 B;  3VN0 A;  2W6A A;  1IFM A;  2A45 G;  2HG5 D;  4IFF A;  4RES B;  2NPS C;  1GTW A;  2N1T B;  3IR9 A;  2FXM A;  4I6M C;  1J1D B;  1L4A D;  1JUN A;  1SLQ A;  1IFJ A;  2JJL A;  3OAK A;  3MD0 A;  5AVT B;  1LWU C;  2KP8 A;  3RK2 B;  1KFN A;  1AFO A;  5KJ7 D;  5AW2 B;  4EOT A;  2JEE A;  2HLO A;  1L0N K;  1M1J C;  1LTT C;  1GD2 E;  5AVR B;  3H32 A;  1MFZ A;  2XNX A;  1HGZ A;  3GHG B;  1NWQ A;  5AW5 B;  2W6B A;  1H8A A;  1DX7 A;  4HYT B;  4AUW A;  2QM8 A;  1NTZ K;  3M0D C;  1N73 C;  3M06 A;  1LTJ C;  4W7Z A;  5CMZ A;  3A2A A;  3B5N A;  1HH0 A;  1XTG B;  5AVS B;  4C7R A;  5AW7 B;  4JYC A;  5AW6 B;  1L4A B;  4DZO A;  1FZC C;  4W80 A;  5BVZ A;  1JTH B;  5CCH D;  1MV8 A;  1NHL A;  3EFG A;  2H8P D;  1L0L K;  4WY4 A;  2WT7 A;  1ZLL A;  2XDJ A;  1LT9 A;  2Z5H A;  5APQ A;  3SWF A;  1FJK A;  5APV A;  2YO3 A;  2ZXE B;  3KYQ A;  1JO5 A;  1LGH B;  5APU A;  2M8R A;  3VYI A;  1JY2 P;  4ZKP A;  2HOD B;  1FZE A;  5CJ0 A;  2OYI A;  1FZA A;  2ZFC A;  2YO2 A;  4GKG A;  4W7Y A;  1IK9 A;  1J2J B;  2WWW A;  3HD7 A;  1RE4 A;  2XKM A;  1NAF A;  1HJB A;  2Q7C A;  3HUS B;  1IO4 A;  3HE5 A;  1GK6 A;  3T97 A;  1YTZ I;  1CI6 A;  2BAS A;  4I1L A;  2NPS A;  2FKW B;  2WSF H;  5CCG C;  2A45 I;  3OA7 A;  1DH3 A;  3V2P A;  1N7S D;  1SQQ K;  1LWU A;  2W27 A;  3BAT A;  3L37 A;  2FFD B;  2POH A;  2O01 H;  2KOG A;  3BVH A;  2LKM A;  3RK2 D;  4WB4 A;  3WMM 0;  1W2E A;  3VP8 A;  1N86 A;  1SFC D;  3M9H A;  5CHX A;  4IFD K;  3RL0 C;  1IFN A;  1NKN A;  2FYU K;  1T3U A;  3L36 A;  2N1T C;  1J1D C;  1GZL A;  2M3B A;  1PFI A;  3M0D A;  1N73 A;  3A7O A;  5KLV K;  3HE4 A;  3M91 A;  1WT6 A;  1OXZ A;  2J59 M;  1CW5 A;  1FZC A;  3H6P A;  2R5D A;  1N7S B;  3A3Y B;  1E5W A;  1CSB A;  2PP6 A;  2H7H A;  4AYC A;  1JY2 O;  2WPQ A;  5AW8 B;  5AVQ B;  1URQ B;  1QL2 A;  1SFC B;  1QL1 A;  2OAR A;  2HFE D;  1IFD A;  2KYV A;  1SQP K;  3VOP A;  1EQ7 A;  1G2C B;  1N7L A;  4N3Y B;  3KQG A;  3G3Z A;  1T2K D;  3CL3 D;  1RF1 B;  1L4A C;  3CLQ A;  4GIF A;  3NTN A;  5CCH A;  1JCD A;  2FYZ A;  1LTI C;  3N4X A;  2KB7 P;  2KSJ A;  5KJ7 C;  3UIA A;  1KIL D;  2P7J A;  4LLH A;  1ZR2 A;  2Z5I A;  3TNU A;  4C46 A;  1X9V A;  3PP5 A;  1LTG C;  1T2K C;  1FZG A;  2C0X A;  3TK1 A;  4GT1 A;  3M0A A;  3V2R A;  1FZB A;  1RE3 C;  1IC2 A;  1GW3 A;  1S9K E;  3M9B A;  5CCG A;  1GDT A;  2I1J A;  1M1J B;  1HGV A;  3HTK B;  3CI9 A;  1GU5 A;  3VTP C;  2WPS A;  2P2U A;  4N78 D;  1GL2 B;  3HUS C;  5BU8 B;  3P8C D;  4C7N B;  5CCH C;  2YKO A;  1SQV K;  1LTJ B;  4LC1 A;  1KIL B;  3RK3 D;  1AQ5 A;  1FJP A;  2N1T A;  5AW1 B;  2C9L Y;  3B5N D;  2GUV A;  3U1C A;  4B86 A;  3MGN A;  1HBW A;  5APX A;  2A45 H;  3L35 A;  3P32 A;  5AVU B;  2FFD C;  3OJA B;  4HH2 A;  1GU4 A;  2H43 A;  2XV5 A;  3B8E B;  4XA4 A;  3I5C A;  3R2P A;  1J1E B;  1X8Y A;  4WBA A;  1OWA A;  4WY4 D;  3V4W A;  3E1I A;  3GHG A;  1MZ9 A;  3H32 B;  4OH8 B;  3BRT B;  2Z4E A;  4LGD E;  5AW9 B;  3VMX A;  3EQ2 A;  1NOH A;  1URQ D;  2J58 A;  5APT A;  1NO4 A;  1JY3 N;  2WSC H;  3RK3 B;  3NXS A;  5CJ4 A;  3LIE A;  3V5B A;  1ZR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...