2HG5D

Cs+ complex of a k channel with an amide to ester substitution in the selectivity filter
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
43
structure length
43
Chain Sequence
b'DLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB HEAVY CHAIN
publication title Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
pubmed doi rcsb
molecule tags Membrane protein
total genus 16
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2006-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hg5D00
3M0DC 5CCGC 3HD7A 1L4AB 1SFCD 2NPSD 2M8RA 3HD7D 1SFCC 3HTKB 1KILC 1N7SD 3KYQA 1SFCB 1KILB 1N7SC 1L4AA 3B5NC 5CCGA 1N7SB 4JF7A 3B5NB 3P8CE 1L4AD 1T3JA 5CCGD 1SFCA 1KILA 1L4AC 2N1TB 4W7YA 1N7SA 1KILD 3B5NA 3B5ND 2PP6A 2N1TA 3VOPA 4W80A 3RK3C 2N1TD 5KJ7D 3RK3B 1URQD 2N1TC 5KJ7C 1NHLA 5CCHD 1URQC 4WY4D 5CCHC 1URQB 4WY4C 4WY4B 3TSIA 1GL2B 2YMYA 1XTGB 4W7ZA 3RK3D 5KJ7A 1JTHB 1URQA 4OH8B 3RL0B 5CCHA 4WY4A 1GL2A 2XDJA 4LGDE 1JTHA 1GL2D 2NPSC 4N78E 2HG5D 1GL2C 2KOGA 2NPSB 3HD7C 3RK2D 3RL0D 3HD7B 2WZ7A 3RK2C 1HVVA 3RL0C 3PP5A 2H8PD 2HFED 3RK2B 2NPSA
chains in the Genus database with same CATH superfamily
1A02J 1EQ7A 1NKNA 5AW7B 5GTIE 2C9LY 1MZ9A 2ITAA 1HWTC 1KILC 1JY2P 3CCEP 2A06D 3L70J 1VQ7P 2IYOA 4JBZA 3RL0g 3CCUP 2CPSA 3B5NB 2OYIA 2QM8A 2E76D 3Q5PA 3L70E 2QJKC 1AQ5A 2JEEA 2PAJA 2B87A 3L74J 1EDLA 1VQNP 1QVGO 3A0BH 1YJ9P 5H2FE 1JM0A 4D6TG 1QX8A 3RK3B 3L74E 2ZYDA 1YHQP 1NGMB 4H0LC 1X22A 2JWAA 2KIKA 4RKUJ 3SFEC 2WPQA 1FZEA 4CPGA 2E75B 1YQ3C 2E74B 1Q7YQ 3H1LD 2A45H 3RL0B 1Y8AA 3S1KA 1YTZI 4U3FG 1KYOD 1OVUA 1T6AA 2JJLA 2K9JB 4NPDA 4UB6E 3I56P 4R4LA 1M8OB 5AVYB 3S9OA 1GW4A 2OTJP 1U7MA 1YTZT 1M1KQ 3CXHI 5CCGC 2L5GB 3S4RA 2OYIB 3A0HE 2WTYA 1W2BO 1VF5B 2E5YA 1ZLLA 1EXJA 3Q2YA 3KPEA 1GU5A 1JCCA 1AJYA 2B87B 1U7JA 2FXPA 1QEXA 1NTZG 3PRJA 1K05A 4UB8E 3V4WA 1DEEG 2N1TA 3B8EB 3CCVP 2GM4A 3Q5RA 4DZOA 2WVRA 1SQQK 5B5EH 2WSEH 1VQ6P 4H44B 2IBZI 2KI7B 3TSIA 4I1LA 2OGUA 4PD4E 1KFNA 1ZRTE 1KQSO 1P84I 1SP4A 4RJTA 3JCUH 2WQYC 2WSFJ 3II6A 4M3LA 2N9YB 4LC1A 1UIXA 3AE6C 2Y0DA 2HPCA 3W68A 3K5BA 1SQVJ 4U3FJ 2E75C 1L0ND 1LT9C 3VMYA 1SQPD 3RL0C 3H1JJ 4PV1B 1SQQJ 1AA0A 2RMZA 1SQVE 4U3FE 4EOTA 3M0DC 3V4QA 4XFJA 3HD7A 1VF5D 3BASA 2C9NY 2A06G 1SQXK 1JY2O 3BCCG 3H1JE 1SQQE 3A3YB 4WWIA 2Y9ZA 1LTJA 2R44A 5AW3B 2OTKE 4JF7A 1NJIQ 4RO0A 3HE4A 1BE3D 1HGVA 3H1ID 2N1TB 3AEDC 2OYOA 2OYIC 4YXDC 1ZR4A 2VRSA 1L0LK 1RE4A 1NTZJ 1OMIA 5AVQB 2BCCD 1M56D 1FZFA 3L72G 5APQA 3D71A 4OWFA 1NU1G 2A45I 2M0BA 2JR8A 4EI2A 1NTKJ 1BGYD 2P67A 5KAFE 3H32A 5AVRB 2HPCB 5TJHA 1NTKE 2RN0A 2Q6QA 3I55P 3AEEC 2HG5D 5CJ4A 2O1JA 1Q90D 4PV1D 2CK3H 2WZ7A 3HD7B 2JKVA 2FXMA 4A7PA 3QH9A 5APXA 3GHGA 5KTBA 3CLQA 1YBKA 3CD6P 2QVAA 2NPSA 1R8EA 3U1CA 1LTJB 2QRXA 1GU4A 2J58A 3HE4B 1NWQA 3GW6A 5KAIE 2Y0CA 1LT1A 4ZMDA 3BCCJ 1HBWA 3O6QA 3PHLA 1KILA 2MJZA 3ITKA 2FBWC 1VQPP 3FWNA 5GTIH 2A06E 3D70A 3BCCE 2J5UA 3P8MC 1LP1A 3CCRP 3CXHD 1KB9E 2N1TC 1DH3A 2O01N 3PH0A 3CX5I 3H32B 1N73B 2O3JA 2KSEA 2XNDH 3IR9A 2FYUD 4WBAA 3N7NA 5H2FH 5AVWB 1VQOP 1OW6A 5CBNA 2J59M 2O01J 2Y9YA 1KZUB 3H1LJ 1EXIA 1GZLA 1BSNA 1NTMG 1PGPA 3GHGB 4N78E 2SPZA 2NPSB 5AVTB 3H1LE 3AEFC 4HH2A 3RK2C 1KYOE 1LJ2A 3SWFA 3CCLP 1LTAC 2QA4P 2W27A 5AVUB 2IBZD 2IZ1A 1IFNA 4UB6H 5AVVB 3L4FA 2D2CC 4AYCA 1SFCC 2YKPA 1P84D 3P7KA 3O6QB 1G1JA 1KILB 1BE3G 4OGQB 5CCGA 2OTLP 1GW3A 1L4AD 1PGQA 1H0TA 3L70G 1LTJC 3CI9A 1LP1B 4TT3H 3FXEA 2QJKB 3OW2O 1JUNA 1EC5A 3AE5C 1OW8A 3A0HH 1N86A 1IO4A 3L73G 4ZNCA 1L0NK 3L74G 3IF4A 2XNXA 3G71P 1JY3N 1SQPK 1URQC 3CCQP 1K73Q 1IJDB 3GF3A 4ASWA 2YIUC 3MUDC 1LTSC 4H0LB 4UB8H 4XA4A 3M06A 3AE9C 1QL2A 2KK7A 5DJTB 1ZN5A 4ZKPA 3VP8A 1IZNB 2WPSA 3BRVB 3AE2C 2XDJA 3IAOA 1N73C 1GL2D 1M1JC 2YKOA 2P1JA 2FY8A 2QJYC 1GDTA 1SLQA 4PD4H 2FYNB 3CC4P 1L0NJ 3WMM0 4NPFX 5CJ0A 3IN6A 5AVSB 3CCJP 3P8CD 1SQPJ 1LT9A 3L75D 1L0NE 4HJGH 2YNYA 1H0TB 3KYQA 1SQPE 1PIXA 3M0DA 5CBOA 1KQGB 4Y99C 3EFFK 4W7YA 1BE3J 3SSUA 1LGHB 1FDOA 3H1IJ 3CWBD 1UIIA 4JYBA 4OGQC 4B86A 5CHXA 4AQRD 3E1IA 1M57D 2XV5A 1YI2P 1BE3E 2OARA 3VMZA 3H1IE 1TU3F 5L8RJ 1QGKB 5KJ7C 2BCCJ 1JEKA 2Q5UA 5CCHC 4Z1MH 2JWDA 3L73J 1HGZA 1KV4A 2XZRA 2IX7C 2BCCE 1EZVI 5C39A 3UIAA 3L73E 2WSCJ 4JQ0D 3QWOC 1KN7A 1BGYE 2KP8A 1SQBK 1PP9D 1FOSF 4RESB 1Q2NA 5KAFH 5M1BA 4I7ZC 1LT9B 4HB1A 5GTHE 3CX5D 1SQVG 3L36A 1E5WA 3RGUA 1FAVA 4EYYQ 3H1KD 3H1JG 1H8AA 1SQQG 1T3UA 3MTUE 1Q86Q 1S72P 2FYNC 1FZCC 4GOEA 4R4MA 1ZW0A 2H7HA 1PGOA 3FWLA 1IFMA 2FYUK 2FXOA 3OAKA 1KMIZ 1VQ4P 3N4XA 2KNCA 3B5ND 5KAIH 2M3EA 2H89C 1NKZB 3AE8C 1J1DC 2ZVNB 5B66E 1N2DC 2ZYAA 5KLIB 2GA1A 2OYHC 3JC22 1S2EA 3CXHE 2YMYA 1FBMA 3RK3D 1SQXG 3L71D 3MHVA 2Z5HA 3KZIE 2N9BA 1FDIA 2JDIH 1NTKG 5AVXB 1KB9H 2KLUA 1S3JA 1G2CA 3TYYA 1RQVA 4LGDE 3A7OA 1ZXGA 1JTHA 4GDOA 4L75A 2E75D 2E74D 3BRTB 1FZGA 3AE1C 3RL0D 2W6BA 1L0LG 3MGNA 1MUUA 3HRNA 1KTMA 2QJPB 1DD3A 1BCCD 1NH4A 3CPWO 4GKGA 4DOJA 2O01H 2P10A 3H6PA 1KYOH 2IBZE 2I1KA 1Z56A 1SFCA 4GIFA 2KNCB 1P84E 5AW0B 3F89A 1RF0C 5APSA 2DW3A 2Y0EA 1YJWP 1RHZB 3WU2E 1J1EB 3VTPC 2YMKA 3CCMP 4L74A 2ZXEB 1KQLA 5K5GB 1H89A 3AEAC 3Q5SA 2NZ2A 1G2CB 1S4XA 3E7KA 1YJNP 1OIPA 1W5CE 3G3ZA 2IYPA 1JTHB 1URQA 2QIWA 1FE6A 3MUDA 4QMAA 4H44D 5KLIC 3LIEA 3L37A 1RF1C 1SQXJ 1IFJA 4IFMA 1NVOA 1K9MQ 3T97A 2KOGA 3H1LG 1OZHA 2R32A 2QG4A 4HKZH 1SQXE 3PP5A 2H8PD 1N73A 3RK2B 3TF5A 1M1JA 2V7QJ 3AEGC 1JO5A 2MKVA 2W8ZA 1EZVD 1L0LJ 2D2CB 1SFCB 2WITA 2XU6A 2OQQA 2W83C 5KLVK 3EWKA 3JSVC 3P8CE 1A02F 1T3JA 2NRGA 3AE3C 2QJPC 1L0LE 1KC8Q 1JB0J 3L75E 3AE7C 2BEQD 2JO1A 4IL6X 2H88C 1QL1A 4WB4A 2H43A 1PL5A 4Y28J 1T2KC 3A2AA 1USDA 2N1TD 1H88A 1WMKA 1AFOA 2WMMA 1NHLA 1GD2E 3GLMA 4I6MC 1SQBD 3CWBE 1URQB 2K3RA 1PZQA 1BDDA 2PRRA 2YIUB 1HJBA 5KJ7A 1PGJA 3G9RA 1GK4A 3G6EP 1J1EC 5CCHA 3T97B 1HUCA 1FJKA 5AW9B 3CCSP 2HODA 4H13C 4DJGA 3VN0A 1USEA 4HYTB 2Q3IA 1M1JB 3RK2D 3O8ZA 2E5TA 2C0WA 2QJYB 2IFMA 1JMMA 1PP9J 2AEFA 4ASVA 5BU8B 1GK6A 2HLOA 1SFCD 1T8ZA 1PP9E 2G8YA 2R5DA 1L0NG 3HD7D 1EDJA 3B71A 2WSCH 2LXCB 2YO2A 1SQPG 1JY2N 3H1KJ 1N7SC 1FC2C 3CX5E 1ZP0C 4BRYA 3LW5J 1R5LA 3M91A 3WUUA 5GTHH 3TK1A 4D6TD 1RH5B 3H1KE 4Y99B 1FZCA 1LWUC 1GMJA 5APUA 4IFFA 1AV1A 3VOPA 4C46A 1CSBA 1DIPA 5APYA 2K37A 3H1IG 1URQD 3MZWB 2QE7H 1U57A 1ZR2A 4JPZB 3SFDC 2K88A 1WRGA 2P7JA 2BCCG 2HODB 4DT0A 4MN4C 2OYHA 2XKMA 1AVYA 1Q82Q 2FFDC 1IK7A 2ZVOB 1ZMEC 5B66H 1BGYG 2KYVA 2LKMA 3RK3E 2KZIA 3L71E 3CXHH 1OVRA 2KLVA 1HVVA 2K9YA 3ABVC 2IPPA 3KZIH 2ZT9C 2Z4EA 4I7ZB 1R5SA 4GT1A 2NPSD 2KSJA 3I5CA 4IL6E 1NTZD 4BRYB 3KQGA 2KS1B 2YXRB 1IFDA 1BCCJ 2KZJA 3KDPB 1CZQA 2QM7A 1FZCB 4U7JA 3CMEP 1IFIA 1BCCE 1XTCC 1FS0E 1KILD 4OGQD 1PPJD 2ZXXA 2HR3A 3R4YA 1JNMA 3V6IA 2L91A 1NO4A 4KHXA 3L35A 2FYZA 4W80A 3Q3DA 5KJ7D 1SQBG 3V2RA 5CCHD 1RF0A 2Q1KA 5BU5A 1J1DB 1P84H 4NPEA 4WY4C 2OYHB 1SVFA 4KJMA 5DJUB 2PGDA 4N3YB 1YIJP 1LTTC 1M7LA 2M3BA 1OXZA 3V2PA 3WU2H 3H25A 3KHUA 4H0LD 5APTA 5KLVD 2FYUG 1S5LX 4O9BA 3BCCD 4I2LC 2Z5IA 1S9KD 1RF1A 3OA7A 1BGYJ 3V2QA 1YQ4C 1RQUA 1KB9D 5AW2B 1VQKP 3M9BA 5TISE 1LTIC 4K35A 3WUVA 3TDKA 2KB7P 5AW6B 1FU1A 4C7RA 1VQMP 2UWJE 2IBZG 1K04A 5CCGD 3NMDA 1VQ8P 2CPBA 2ZFCA 2E76C 3L72D 1EZVE 2YKQA 5E79E 2B89A 3U1AA 1KD1Q 1WT6A 2P58A 1NU1D 1LTGC 1AVOA 4N78D 2V7QH 3FX0A 3G4SP 3GG2A 3NFQA 4EDFA 1JY3P 1E79H 1FJPA 5KKZB 4WVZA 2B9BA 2AXTE 1OX3A 5APVA 1SQBJ 1X0TA 1NYHA 3AE4C 2R5BA 3HUSC 3TGUD 2WPRA 1SQBE 2V4HA 3WUTA 4BXLA 1MFZA 3W67A 1RF1B 1J2JB 1VQ5P 3PJSK 2RH0A 1IK9A 3F5HA 3C9IA 2G3AA 3IFMA 2FYUJ 3H1HD 1GTWA 4PD4I 1X79B 1HTLC 1ZOYC 2QSIA 5EFWB 3GF7A 1SQVK 2FYUE 2WSSH 2BASA 1FDMA 4GODA 5AW4B 2GUVA 3B5NC 5AW5B 2A45G 4YPCA 5AW1B 3L75G 1PPJG 4BWNA 3Q1MA 1QVFO 1OVVA 1N7SA 3M0AA 4D6TJ 4LLHA 2ZYGA 4PJ0E 3RK3C 3CX5H 3U59A 2KXPB 4D6TE 1LWUA 4ZKUA 3CWBG 3D6YA 1S5LE 1EDKA 3LW5H 3USSA 1MKMA 1NTMD 2E74C 1NTZK 4K3AA 3A5TA 5KKZC 3KXDA 2Q9IA 2W6JH 2W6AA 5KLVG 4H13B 3M9QA 1BDCA 1EDIA 1NTKK 2E42A 5APWA 2R3CA 3MD0A 1AQTA 2FFDA 4N6JA 1N8RQ 2AEMA 2IFNA 4KT0J 2PFXA 1CW5A 1JCDA 3L70D 1PP9G 1NAYA 2M8RA 3TNUA 2IZ0A 1VF5C 3A0BE 3AEBC 4L76A 1KFMA 1MV8A 1L4AA 1LTBC 3E1RA 1N7SB 2M5AA 1JOCA 3VMXA 3HTKA 3L73D 1YYCA 2WT7A 3H1KG 3FXDA 2Q3EA 3L74D 1DD4A 1NTZE 1S1CX 1VPCA 4IL6H 1N7LA 1LWUB 1T2KD 3L75J 1JY3O 1M90Q 3GMAA 2AXCA 1KILE 4H44C 1PPJE 2QEXP 3LIDA 3VMAA 2GUSA 1XTGB 3TGUG 1PV3A 3CWBJ 4IFDK 1RE3A 3FGAD 3MIWA 4DCKA 4H13D 4WY4A 1GL2A 2R3SA 2P2UA 3BVHA 1K8AQ 2FFDB 3CL3D 4OVNF 3VYIA 1FOSE 1KB9I 3L71G 1NU1K 1KORA 5KLVJ 1ZV8A 3H1HG 4PV1C 2HFED 3TNUB 3NXSA 4YXWH 2ZT9B 1L4AB 3SWKA 5KLVE 2M5AB 2YXQB 2WWWA 3HTKB 1N7SD 2WSEJ 1S9KE 2WT7B 1OWAA 2YO3A 4JYCA 1VQ9P 5B5EE 1OW7A 1BCCG 1IFPA 4EIJA 2D2CD 5BVZA 5TISH 1KYOI 3VP9A 3SWYA 2ZJSE 3L72J 1X8YA 1SS1A 2PP6A 1NU1J 3R2PA 4AUWA 4PD4D 3M9HA 3JCUE 3P32A 1ZRTD 2FKWB 2Q7CA 3L72E 2KS1A 3RBXA 1DX7A 1NU1E 1OFCX 2LR2A 5E79H 3CMAP 3V2NA 4WY4B 1GL2B 1JMBA 4IOIH 1QLED 1NOHA 3ZDMA 5CMZA 1BSHA 2I1JA 1RY3A 1CI6A 3TGUJ 2AEJA 3V5BA 1SQVD 4U3FD 2AXTH 1G1IA 1FZAA 3HUSA 1HF9A 1Y47A 3HD7C 3NTNA 3H1JD 5AVZB 1YITP 1SQQD 2ZT9D 3TGUE 2I8DA 1D7MA 1VL2A 3PTZA 4C7NA 3L71J 3BATA 1Y9BA 3HE5A 1Q81Q 3EFGA 4GOFA 2WPVB 3H1HJ 1FZBA 4YTPC 2B88A 1VQLP 4TLFA 2O1KA 3RBZA 2ZAEB 1NTMK 3H1HE 1RE4C 3AECC 2E43A 1L4AC 1IC2A 1EZVG 2E76B 1HJ0A 3B5NA 2BEZF 2HYNA 1HH0A 3B4SA 3C8VA 4XE5B 1KQFB 1SQXD 1L2PA 1DEBA 4L73A 4WY4D 1PFIA 1NTKD 1X9VA 3C1LA 2W90A 2IDBA 3CC7P 3CC2P 4W7ZA 1CI6B 2JP3A 3MP7B 1NTMJ 1VDFA 4PJ0H 4OH8B 2KUBA 5AW8B 2LXBA 3HUSB 2RKLA 1L0LD 3EQ2A 1MFTA 3GHGC 1RE3C 1NTME 1LNQA 2C0XA 2NPSC 2K1AA 2POHA 1S5LH 2WSFH 1GL2C 4C7NB 3OJAB 1NAFA 1W2EA 2K9JA 3HE5B 3D6ZA 3PLNA
chains in the Genus database with same CATH topology
1A02J 1EQ7A 1NKNA 1GTWA 1JO5A 5AW7B 1X79B 1HTLC 1IFNA 5AVVB 2C9LY 3L4FA 4AYCA 1MZ9A 1SFCC 2YKPA 3P7KA 1HWTC 1KILC 1JY2P 1SQVK 1G1JA 1SFCB 2WITA 2XU6A 2BASA 1KILB 1FDMA 5AW4B 2GUVA 5KLVK 3B5NC 5CCGA 5AW5B 2A45G 2CPSA 3B5NB 3P8CE 2OYIA 1GW3A 1A02F 2QM8A 1L4AD 1T3JA 5AW1B 1LTJC 1AQ5A 3CI9A 1N7SA 3M0AA 2JEEA 2PAJA 1JUNA 1QL1A 4LLHA 1N86A 4WB4A 2H43A 1T2KC 3A2AA 1IO4A 3RK3C 3U59A 2N1TD 1H88A 1L0NK 1LWUA 3RK3B 1AFOA 4ZKUA 2XNXA 1NHLA 1JY3N 1GD2E 1SQPK 1URQC 4I6MC 1IJDB 1URQB 1LTSC 3LW5H 2WPQA 1HJBA 1FZEA 4XA4A 5KJ7A 1NTZK 3M06A 1GK4A 1QL2A 1J1EC 2A45H 4ZKPA 1ZN5A 3RL0B 3VP8A 5CCHA 3A5TA 1HUCA 1FJKA 1YTZI 2WPSA 3BRVB 5AW9B 2Q9IA 2JJLA 2W6AA 2XDJA 2HODA 1N73C 1GL2D 3VN0A 3M9QA 1M1JC 2YKOA 4HYTB 2P1JA 2Q3IA 1NTKK 1M1JB 2E42A 5APWA 3RK2D 3O8ZA 1GDTA 2R3CA 3MD0A 1SLQA 5AVYB 2C0WA 2FFDA 4N6JA 2IFMA 1JMMA 1GW4A 3WMM0 1YTZT 5CJ0A 5AVSB 5BU8B 3P8CD 1GK6A 2IFNA 5CCGC 2HLOA 1CW5A 1SFCD 2L5GB 1JCDA 1T8ZA 1LT9A 2M8RA 3TNUA 2R5DA 3HD7D 2OYIB 2YNYA 2WTYA 2WSCH 2YO2A 3KYQA 1JY2N 1KFMA 1MV8A 1N7SC 1L4AA 1ZLLA 3M0DA 1LTBC 1N7SB 1JOCA 3KPEA 3VMXA 1GU5A 3HTKA 1JCCA 3M91A 3TK1A 1YYCA 4Y99C 2WT7A 4W7YA 1LGHB 4Y99B 1FZCA 1LWUC 1VPCA 5APUA 4IFFA 1N7LA 4JYBA 1LWUB 3V4WA 1T2KD 2N1TA 3B8EB 3VOPA 5CHXA 4AQRD 4B86A 3E1IA 2XV5A 1CSBA 4C46A 2OARA 2GM4A 1JY3O 5APYA 3VMZA 1URQD 4DZOA 1SQQK 5KJ7C 2WSEH 1ZR2A 2Q5UA 5CCHC 3LIDA 1HGZA 1WRGA 2P7JA 2XZRA 3TSIA 4I1LA 2IX7C 2GUSA 1XTGB 2HODB 1KFNA 3UIAA 1SP4A 4IFDK 1RE3A 3MIWA 2OYHA 2XKMA 4M3LA 3II6A 4WY4A 1GL2A 4LC1A 2FFDC 2P2UA 3BVHA 2FFDB 2HPCA 3CL3D 3VYIA 1FOSE 2KYVA 2LKMA 2KP8A 1SQBK 1FOSF 4RESB 1NU1K 1LT9C 2KLVA 1ZV8A 1HVVA 3VMYA 3RL0C 2IPPA 2HFED 1LT9B 3TNUB 3NXSA 2Z4EA 4EOTA 3M0DC 3V4QA 3HD7A 3L36A 1E5WA 1L4AB 3BASA 4GT1A 2C9NY 2NPSD 2KSJA 1FAVA 1SQXK 3I5CA 1JY2O 2WWWA 3KQGA 3HTKB 1N7SD 1H8AA 1T3UA 3MTUE 1IFDA 3A3YB 1S9KE 1FZCC 1LTJA 2WT7B 3KDPB 5AW3B 1CZQA 2QM7A 1OWAA 1FZCB 2H7HA 4JF7A 2YO3A 4JYCA 3HE4A 1IFMA 2FYUK 1IFIA 1HGVA 4EIJA 2N1TB 1XTCC 3OAKA 5BVZA 2OYIC 1KILD 3VP9A 1ZR4A 3SWYA 1X8YA 2VRSA 1L0LK 3N4XA 3B5ND 2PP6A 1JNMA 1NO4A 1RE4A 3R2PA 4KHXA 3L35A 2FYZA 4W80A 4AUWA 3M9HA 5AVQB 5KJ7D 3P32A 1FZFA 3V2RA 2FKWB 5APQA 2Q7CA 1NKZB 1DX7A 5CCHD 1J1DC 1N2DC 1RF0A 5BU5A 1J1DB 2OYHC 2A45I 4WY4C 2OYHB 1SVFA 3V2NA 4WY4B 1GL2B 2P67A 2YMYA 1FBMA 3RK3D 1NOHA 4N3YB 2Z5HA 3H32A 5AVRB 2HPCB 2N9BA 1LTTC 1M7LA 2M3BA 5CMZA 1OXZA 3V2PA 2I1JA 5AVXB 1G2CA 3TYYA 1RY3A 4LGDE 3A7OA 1CI6A 3V5BA 1JTHA 1G1IA 1FZAA 3HUSA 5APTA 2HG5D 5CJ4A 2O1JA 4O9BA 3HD7C 3NTNA 3BRTB 1FZGA 5AVZB 3RL0D 3HD7B 2WZ7A 4I2LC 2FXMA 2Z5IA 1S9KD 2W6BA 5APXA 1RF1A 3GHGA 3OA7A 3CLQA 5KTBA 2NPSA 3MGNA 3V2QA 1MUUA 4C7NA 3HRNA 3U1CA 3BATA 5AW2B 3M9BA 1LTJB 3HE5A 3EFGA 1LTIC 1GU4A 1FZBA 1NH4A 2KB7P 5AW6B 2J58A 3HE4B 1FU1A 4GKGA 4DOJA 1NWQA 2O01H 4C7RA 2O1KA 3H6PA 1NTMK 2I1KA 1HBWA 5CCGD 3NMDA 1Z56A 1RE4C 1SFCA 2CPBA 4GIFA 2E43A 1KILA 2MJZA 1L4AC 1IC2A 2ZFCA 2YKQA 3U1AA 1WT6A 3B5NA 5AW0B 1LTGC 2HYNA 1RF0C 4N78D 5APSA 3P8MC 1HH0A 4XE5B 3NFQA 1J1EB 1JY3P 3VTPC 2N1TC 1FJPA 1DEBA 1DH3A 2ZXEB 4WY4D 1PFIA 1X9VA 1KQLA 1H89A 3H32B 1N73B 5APVA 1G2CB 3IR9A 4W7ZA 1CI6B 2R5BA 3G3ZA 4WBAA 3N7NA 1JTHB 5AVWB 1URQA 3HUSC 1VDFA 4OH8B 5AW8B 2J59M 3HUSB 2WPRA 3MUDA 1KZUB 3EQ2A 3LIEA 3L37A 1RF1C 1MFZA 1GZLA 1RE3C 3GHGC 2C0XA 2NPSC 1IFJA 4IFMA 3GHGB 1RF1B 2POHA 4N78E 1J2JB 3T97A 2WSFH 1GL2C 2KOGA 2NPSB 1IK9A 5AVTB 4C7NB 3OJAB 2R32A 1NAFA 4HH2A 1W2EA 3HE5B 3C9IA 3RK2C 3PP5A 3SWFA 2H8PD 1LTAC 1N73A 3RK2B 3IFMA 1M1JA 2W27A 5AVUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0D C;  5CCG C;  3HD7 A;  1L4A B;  1SFC D;  2NPS D;  2M8R A;  3HD7 D;  1SFC C;  3HTK B;  1KIL C;  1N7S D;  3KYQ A;  1SFC B;  1KIL B;  1N7S C;  1L4A A;  3B5N C;  5CCG A;  1N7S B;  4JF7 A;  3B5N B;  3P8C E;  1L4A D;  1T3J A;  5CCG D;  1SFC A;  1KIL A;  1L4A C;  2N1T B;  4W7Y A;  1N7S A;  1KIL D;  3B5N A;  3B5N D;  2PP6 A;  2N1T A;  3VOP A;  4W80 A;  3RK3 C;  2N1T D;  5KJ7 D;  3RK3 B;  1URQ D;  2N1T C;  5KJ7 C;  1NHL A;  5CCH D;  1URQ C;  4WY4 D;  5CCH C;  1URQ B;  4WY4 C;  4WY4 B;  3TSI A;  1GL2 B;  2YMY A;  1XTG B;  4W7Z A;  3RK3 D;  5KJ7 A;  1JTH B;  1URQ A;  4OH8 B;  3RL0 B;  5CCH A;  4WY4 A;  1GL2 A;  2XDJ A;  4LGD E;  1JTH A;  1GL2 D;  2NPS C;  4N78 E;  2HG5 D;  1GL2 C;  2KOG A;  2NPS B;  3HD7 C;  3RK2 D;  3RL0 D;  3HD7 B;  2WZ7 A;  3RK2 C;  1HVV A;  3RL0 C;  3PP5 A;  2H8P D;  2HFE D;  3RK2 B;  2NPS A; 
#chains in the Genus database with same CATH topology
 1A02 J;  1EQ7 A;  1NKN A;  5AW7 B;  5GTI E;  2C9L Y;  1MZ9 A;  2ITA A;  1HWT C;  1KIL C;  1JY2 P;  3CCE P;  2A06 D;  3L70 J;  1VQ7 P;  2IYO A;  4JBZ A;  3RL0 g;  3CCU P;  2CPS A;  3B5N B;  2OYI A;  2QM8 A;  2E76 D;  3Q5P A;  3L70 E;  2QJK C;  1AQ5 A;  2JEE A;  2PAJ A;  2B87 A;  3L74 J;  1EDL A;  1VQN P;  1QVG O;  3A0B H;  1YJ9 P;  5H2F E;  1JM0 A;  4D6T G;  1QX8 A;  3RK3 B;  3L74 E;  2ZYD A;  1YHQ P;  1NGM B;  4H0L C;  1X22 A;  2JWA A;  2KIK A;  4RKU J;  3SFE C;  2WPQ A;  1FZE A;  4CPG A;  2E75 B;  1YQ3 C;  2E74 B;  1Q7Y Q;  3H1L D;  2A45 H;  3RL0 B;  1Y8A A;  3S1K A;  1YTZ I;  4U3F G;  1KYO D;  1OVU A;  1T6A A;  2JJL A;  2K9J B;  4NPD A;  4UB6 E;  3I56 P;  4R4L A;  1M8O B;  5AVY B;  3S9O A;  1GW4 A;  2OTJ P;  1U7M A;  1YTZ T;  1M1K Q;  3CXH I;  5CCG C;  2L5G B;  3S4R A;  2OYI B;  3A0H E;  2WTY A;  1W2B O;  1VF5 B;  2E5Y A;  1ZLL A;  1EXJ A;  3Q2Y A;  3KPE A;  1GU5 A;  1JCC A;  1AJY A;  2B87 B;  1U7J A;  2FXP A;  1QEX A;  1NTZ G;  3PRJ A;  1K05 A;  4UB8 E;  3V4W A;  1DEE G;  2N1T A;  3B8E B;  3CCV P;  2GM4 A;  3Q5R A;  4DZO A;  2WVR A;  1SQQ K;  5B5E H;  2WSE H;  1VQ6 P;  4H44 B;  2IBZ I;  2KI7 B;  3TSI A;  4I1L A;  2OGU A;  4PD4 E;  1KFN A;  1ZRT E;  1KQS O;  1P84 I;  1SP4 A;  4RJT A;  3JCU H;  2WQY C;  2WSF J;  3II6 A;  4M3L A;  2N9Y B;  4LC1 A;  1UIX A;  3AE6 C;  2Y0D A;  2HPC A;  3W68 A;  3K5B A;  1SQV J;  4U3F J;  2E75 C;  1L0N D;  1LT9 C;  3VMY A;  1SQP D;  3RL0 C;  3H1J J;  4PV1 B;  1SQQ J;  1AA0 A;  2RMZ A;  1SQV E;  4U3F E;  4EOT A;  3M0D C;  3V4Q A;  4XFJ A;  3HD7 A;  1VF5 D;  3BAS A;  2C9N Y;  2A06 G;  1SQX K;  1JY2 O;  3BCC G;  3H1J E;  1SQQ E;  3A3Y B;  4WWI A;  2Y9Z A;  1LTJ A;  2R44 A;  5AW3 B;  2OTK E;  4JF7 A;  1NJI Q;  4RO0 A;  3HE4 A;  1BE3 D;  1HGV A;  3H1I D;  2N1T B;  3AED C;  2OYO A;  2OYI C;  4YXD C;  1ZR4 A;  2VRS A;  1L0L K;  1RE4 A;  1NTZ J;  1OMI A;  5AVQ B;  2BCC D;  1M56 D;  1FZF A;  3L72 G;  5APQ A;  3D71 A;  4OWF A;  1NU1 G;  2A45 I;  2M0B A;  2JR8 A;  4EI2 A;  1NTK J;  1BGY D;  2P67 A;  5KAF E;  3H32 A;  5AVR B;  2HPC B;  5TJH A;  1NTK E;  2RN0 A;  2Q6Q A;  3I55 P;  3AEE C;  2HG5 D;  5CJ4 A;  2O1J A;  1Q90 D;  4PV1 D;  2CK3 H;  2WZ7 A;  3HD7 B;  2JKV A;  2FXM A;  4A7P A;  3QH9 A;  5APX A;  3GHG A;  5KTB A;  3CLQ A;  1YBK A;  3CD6 P;  2QVA A;  2NPS A;  1R8E A;  3U1C A;  1LTJ B;  2QRX A;  1GU4 A;  2J58 A;  3HE4 B;  1NWQ A;  3GW6 A;  5KAI E;  2Y0C A;  1LT1 A;  4ZMD A;  3BCC J;  1HBW A;  3O6Q A;  3PHL A;  1KIL A;  2MJZ A;  3ITK A;  2FBW C;  1VQP P;  3FWN A;  5GTI H;  2A06 E;  3D70 A;  3BCC E;  2J5U A;  3P8M C;  1LP1 A;  3CCR P;  3CXH D;  1KB9 E;  2N1T C;  1DH3 A;  2O01 N;  3PH0 A;  3CX5 I;  3H32 B;  1N73 B;  2O3J A;  2KSE A;  2XND H;  3IR9 A;  2FYU D;  4WBA A;  3N7N A;  5H2F H;  5AVW B;  1VQO P;  1OW6 A;  5CBN A;  2J59 M;  2O01 J;  2Y9Y A;  1KZU B;  3H1L J;  1EXI A;  1GZL A;  1BSN A;  1NTM G;  1PGP A;  3GHG B;  4N78 E;  2SPZ A;  2NPS B;  5AVT B;  3H1L E;  3AEF C;  4HH2 A;  3RK2 C;  1KYO E;  1LJ2 A;  3SWF A;  3CCL P;  1LTA C;  2QA4 P;  2W27 A;  5AVU B;  2IBZ D;  2IZ1 A;  1IFN A;  4UB6 H;  5AVV B;  3L4F A;  2D2C C;  4AYC A;  1SFC C;  2YKP A;  1P84 D;  3P7K A;  3O6Q B;  1G1J A;  1KIL B;  1BE3 G;  4OGQ B;  5CCG A;  2OTL P;  1GW3 A;  1L4A D;  1PGQ A;  1H0T A;  3L70 G;  1LTJ C;  3CI9 A;  1LP1 B;  4TT3 H;  3FXE A;  2QJK B;  3OW2 O;  1JUN A;  1EC5 A;  3AE5 C;  1OW8 A;  3A0H H;  1N86 A;  1IO4 A;  3L73 G;  4ZNC A;  1L0N K;  3L74 G;  3IF4 A;  2XNX A;  3G71 P;  1JY3 N;  1SQP K;  1URQ C;  3CCQ P;  1K73 Q;  1IJD B;  3GF3 A;  4ASW A;  2YIU C;  3MUD C;  1LTS C;  4H0L B;  4UB8 H;  4XA4 A;  3M06 A;  3AE9 C;  1QL2 A;  2KK7 A;  5DJT B;  1ZN5 A;  4ZKP A;  3VP8 A;  1IZN B;  2WPS A;  3BRV B;  3AE2 C;  2XDJ A;  3IAO A;  1N73 C;  1GL2 D;  1M1J C;  2YKO A;  2P1J A;  2FY8 A;  2QJY C;  1GDT A;  1SLQ A;  4PD4 H;  2FYN B;  3CC4 P;  1L0N J;  3WMM 0;  4NPF X;  5CJ0 A;  3IN6 A;  5AVS B;  3CCJ P;  3P8C D;  1SQP J;  1LT9 A;  3L75 D;  1L0N E;  4HJG H;  2YNY A;  1H0T B;  3KYQ A;  1SQP E;  1PIX A;  3M0D A;  5CBO A;  1KQG B;  4Y99 C;  3EFF K;  4W7Y A;  1BE3 J;  3SSU A;  1LGH B;  1FDO A;  3H1I J;  3CWB D;  1UII A;  4JYB A;  4OGQ C;  4B86 A;  5CHX A;  4AQR D;  3E1I A;  1M57 D;  2XV5 A;  1YI2 P;  1BE3 E;  2OAR A;  3VMZ A;  3H1I E;  1TU3 F;  5L8R J;  1QGK B;  5KJ7 C;  2BCC J;  1JEK A;  2Q5U A;  5CCH C;  4Z1M H;  2JWD A;  3L73 J;  1HGZ A;  1KV4 A;  2XZR A;  2IX7 C;  2BCC E;  1EZV I;  5C39 A;  3UIA A;  3L73 E;  2WSC J;  4JQ0 D;  3QWO C;  1KN7 A;  1BGY E;  2KP8 A;  1SQB K;  1PP9 D;  1FOS F;  4RES B;  1Q2N A;  5KAF H;  5M1B A;  4I7Z C;  1LT9 B;  4HB1 A;  5GTH E;  3CX5 D;  1SQV G;  3L36 A;  1E5W A;  3RGU A;  1FAV A;  4EYY Q;  3H1K D;  3H1J G;  1H8A A;  1SQQ G;  1T3U A;  3MTU E;  1Q86 Q;  1S72 P;  2FYN C;  1FZC C;  4GOE A;  4R4M A;  1ZW0 A;  2H7H A;  1PGO A;  3FWL A;  1IFM A;  2FYU K;  2FXO A;  3OAK A;  1KMI Z;  1VQ4 P;  3N4X A;  2KNC A;  3B5N D;  5KAI H;  2M3E A;  2H89 C;  1NKZ B;  3AE8 C;  1J1D C;  2ZVN B;  5B66 E;  1N2D C;  2ZYA A;  5KLI B;  2GA1 A;  2OYH C;  3JC2 2;  1S2E A;  3CXH E;  2YMY A;  1FBM A;  3RK3 D;  1SQX G;  3L71 D;  3MHV A;  2Z5H A;  3KZI E;  2N9B A;  1FDI A;  2JDI H;  1NTK G;  5AVX B;  1KB9 H;  2KLU A;  1S3J A;  1G2C A;  3TYY A;  1RQV A;  4LGD E;  3A7O A;  1ZXG A;  1JTH A;  4GDO A;  4L75 A;  2E75 D;  2E74 D;  3BRT B;  1FZG A;  3AE1 C;  3RL0 D;  2W6B A;  1L0L G;  3MGN A;  1MUU A;  3HRN A;  1KTM A;  2QJP B;  1DD3 A;  1BCC D;  1NH4 A;  3CPW O;  4GKG A;  4DOJ A;  2O01 H;  2P10 A;  3H6P A;  1KYO H;  2IBZ E;  2I1K A;  1Z56 A;  1SFC A;  4GIF A;  2KNC B;  1P84 E;  5AW0 B;  3F89 A;  1RF0 C;  5APS A;  2DW3 A;  2Y0E A;  1YJW P;  1RHZ B;  3WU2 E;  1J1E B;  3VTP C;  2YMK A;  3CCM P;  4L74 A;  2ZXE B;  1KQL A;  5K5G B;  1H89 A;  3AEA C;  3Q5S A;  2NZ2 A;  1G2C B;  1S4X A;  3E7K A;  1YJN P;  1OIP A;  1W5C E;  3G3Z A;  2IYP A;  1JTH B;  1URQ A;  2QIW A;  1FE6 A;  3MUD A;  4QMA A;  4H44 D;  5KLI C;  3LIE A;  3L37 A;  1RF1 C;  1SQX J;  1IFJ A;  4IFM A;  1NVO A;  1K9M Q;  3T97 A;  2KOG A;  3H1L G;  1OZH A;  2R32 A;  2QG4 A;  4HKZ H;  1SQX E;  3PP5 A;  2H8P D;  1N73 A;  3RK2 B;  3TF5 A;  1M1J A;  2V7Q J;  3AEG C;  1JO5 A;  2MKV A;  2W8Z A;  1EZV D;  1L0L J;  2D2C B;  1SFC B;  2WIT A;  2XU6 A;  2OQQ A;  2W83 C;  5KLV K;  3EWK A;  3JSV C;  3P8C E;  1A02 F;  1T3J A;  2NRG A;  3AE3 C;  2QJP C;  1L0L E;  1KC8 Q;  1JB0 J;  3L75 E;  3AE7 C;  2BEQ D;  2JO1 A;  4IL6 X;  2H88 C;  1QL1 A;  4WB4 A;  2H43 A;  1PL5 A;  4Y28 J;  1T2K C;  3A2A A;  1USD A;  2N1T D;  1H88 A;  1WMK A;  1AFO A;  2WMM A;  1NHL A;  1GD2 E;  3GLM A;  4I6M C;  1SQB D;  3CWB E;  1URQ B;  2K3R A;  1PZQ A;  1BDD A;  2PRR A;  2YIU B;  1HJB A;  5KJ7 A;  1PGJ A;  3G9R A;  1GK4 A;  3G6E P;  1J1E C;  5CCH A;  3T97 B;  1HUC A;  1FJK A;  5AW9 B;  3CCS P;  2HOD A;  4H13 C;  4DJG A;  3VN0 A;  1USE A;  4HYT B;  2Q3I A;  1M1J B;  3RK2 D;  3O8Z A;  2E5T A;  2C0W A;  2QJY B;  2IFM A;  1JMM A;  1PP9 J;  2AEF A;  4ASV A;  5BU8 B;  1GK6 A;  2HLO A;  1SFC D;  1T8Z A;  1PP9 E;  2G8Y A;  2R5D A;  1L0N G;  3HD7 D;  1EDJ A;  3B71 A;  2WSC H;  2LXC B;  2YO2 A;  1SQP G;  1JY2 N;  3H1K J;  1N7S C;  1FC2 C;  3CX5 E;  1ZP0 C;  4BRY A;  3LW5 J;  1R5L A;  3M91 A;  3WUU A;  5GTH H;  3TK1 A;  4D6T D;  1RH5 B;  3H1K E;  4Y99 B;  1FZC A;  1LWU C;  1GMJ A;  5APU A;  4IFF A;  1AV1 A;  3VOP A;  4C46 A;  1CSB A;  1DIP A;  5APY A;  2K37 A;  3H1I G;  1URQ D;  3MZW B;  2QE7 H;  1U57 A;  1ZR2 A;  4JPZ B;  3SFD C;  2K88 A;  1WRG A;  2P7J A;  2BCC G;  2HOD B;  4DT0 A;  4MN4 C;  2OYH A;  2XKM A;  1AVY A;  1Q82 Q;  2FFD C;  1IK7 A;  2ZVO B;  1ZME C;  5B66 H;  1BGY G;  2KYV A;  2LKM A;  3RK3 E;  2KZI A;  3L71 E;  3CXH H;  1OVR A;  2KLV A;  1HVV A;  2K9Y A;  3ABV C;  2IPP A;  3KZI H;  2ZT9 C;  2Z4E A;  4I7Z B;  1R5S A;  4GT1 A;  2NPS D;  2KSJ A;  3I5C A;  4IL6 E;  1NTZ D;  4BRY B;  3KQG A;  2KS1 B;  2YXR B;  1IFD A;  1BCC J;  2KZJ A;  3KDP B;  1CZQ A;  2QM7 A;  1FZC B;  4U7J A;  3CME P;  1IFI A;  1BCC E;  1XTC C;  1FS0 E;  1KIL D;  4OGQ D;  1PPJ D;  2ZXX A;  2HR3 A;  3R4Y A;  1JNM A;  3V6I A;  2L91 A;  1NO4 A;  4KHX A;  3L35 A;  2FYZ A;  4W80 A;  3Q3D A;  5KJ7 D;  1SQB G;  3V2R A;  5CCH D;  1RF0 A;  2Q1K A;  5BU5 A;  1J1D B;  1P84 H;  4NPE A;  4WY4 C;  2OYH B;  1SVF A;  4KJM A;  5DJU B;  2PGD A;  4N3Y B;  1YIJ P;  1LTT C;  1M7L A;  2M3B A;  1OXZ A;  3V2P A;  3WU2 H;  3H25 A;  3KHU A;  4H0L D;  5APT A;  5KLV D;  2FYU G;  1S5L X;  4O9B A;  3BCC D;  4I2L C;  2Z5I A;  1S9K D;  1RF1 A;  3OA7 A;  1BGY J;  3V2Q A;  1YQ4 C;  1RQU A;  1KB9 D;  5AW2 B;  1VQK P;  3M9B A;  5TIS E;  1LTI C;  4K35 A;  3WUV A;  3TDK A;  2KB7 P;  5AW6 B;  1FU1 A;  4C7R A;  1VQM P;  2UWJ E;  2IBZ G;  1K04 A;  5CCG D;  3NMD A;  1VQ8 P;  2CPB A;  2ZFC A;  2E76 C;  3L72 D;  1EZV E;  2YKQ A;  5E79 E;  2B89 A;  3U1A A;  1KD1 Q;  1WT6 A;  2P58 A;  1NU1 D;  1LTG C;  1AVO A;  4N78 D;  2V7Q H;  3FX0 A;  3G4S P;  3GG2 A;  3NFQ A;  4EDF A;  1JY3 P;  1E79 H;  1FJP A;  5KKZ B;  4WVZ A;  2B9B A;  2AXT E;  1OX3 A;  5APV A;  1SQB J;  1X0T A;  1NYH A;  3AE4 C;  2R5B A;  3HUS C;  3TGU D;  2WPR A;  1SQB E;  2V4H A;  3WUT A;  4BXL A;  1MFZ A;  3W67 A;  1RF1 B;  1J2J B;  1VQ5 P;  3PJS K;  2RH0 A;  1IK9 A;  3F5H A;  3C9I A;  2G3A A;  3IFM A;  2FYU J;  3H1H D;  1GTW A;  4PD4 I;  1X79 B;  1HTL C;  1ZOY C;  2QSI A;  5EFW B;  3GF7 A;  1SQV K;  2FYU E;  2WSS H;  2BAS A;  1FDM A;  4GOD A;  5AW4 B;  2GUV A;  3B5N C;  5AW5 B;  2A45 G;  4YPC A;  5AW1 B;  3L75 G;  1PPJ G;  4BWN A;  3Q1M A;  1QVF O;  1OVV A;  1N7S A;  3M0A A;  4D6T J;  4LLH A;  2ZYG A;  4PJ0 E;  3RK3 C;  3CX5 H;  3U59 A;  2KXP B;  4D6T E;  1LWU A;  4ZKU A;  3CWB G;  3D6Y A;  1S5L E;  1EDK A;  3LW5 H;  3USS A;  1MKM A;  1NTM D;  2E74 C;  1NTZ K;  4K3A A;  3A5T A;  5KKZ C;  3KXD A;  2Q9I A;  2W6J H;  2W6A A;  5KLV G;  4H13 B;  3M9Q A;  1BDC A;  1EDI A;  1NTK K;  2E42 A;  5APW A;  2R3C A;  3MD0 A;  1AQT A;  2FFD A;  4N6J A;  1N8R Q;  2AEM A;  2IFN A;  4KT0 J;  2PFX A;  1CW5 A;  1JCD A;  3L70 D;  1PP9 G;  1NAY A;  2M8R A;  3TNU A;  2IZ0 A;  1VF5 C;  3A0B E;  3AEB C;  4L76 A;  1KFM A;  1MV8 A;  1L4A A;  1LTB C;  3E1R A;  1N7S B;  2M5A A;  1JOC A;  3VMX A;  3HTK A;  3L73 D;  1YYC A;  2WT7 A;  3H1K G;  3FXD A;  2Q3E A;  3L74 D;  1DD4 A;  1NTZ E;  1S1C X;  1VPC A;  4IL6 H;  1N7L A;  1LWU B;  1T2K D;  3L75 J;  1JY3 O;  1M90 Q;  3GMA A;  2AXC A;  1KIL E;  4H44 C;  1PPJ E;  2QEX P;  3LID A;  3VMA A;  2GUS A;  1XTG B;  3TGU G;  1PV3 A;  3CWB J;  4IFD K;  1RE3 A;  3FGA D;  3MIW A;  4DCK A;  4H13 D;  4WY4 A;  1GL2 A;  2R3S A;  2P2U A;  3BVH A;  1K8A Q;  2FFD B;  3CL3 D;  4OVN F;  3VYI A;  1FOS E;  1KB9 I;  3L71 G;  1NU1 K;  1KOR A;  5KLV J;  1ZV8 A;  3H1H G;  4PV1 C;  2HFE D;  3TNU B;  3NXS A;  4YXW H;  2ZT9 B;  1L4A B;  3SWK A;  5KLV E;  2M5A B;  2YXQ B;  2WWW A;  3HTK B;  1N7S D;  2WSE J;  1S9K E;  2WT7 B;  1OWA A;  2YO3 A;  4JYC A;  1VQ9 P;  5B5E E;  1OW7 A;  1BCC G;  1IFP A;  4EIJ A;  2D2C D;  5BVZ A;  5TIS H;  1KYO I;  3VP9 A;  3SWY A;  2ZJS E;  3L72 J;  1X8Y A;  1SS1 A;  2PP6 A;  1NU1 J;  3R2P A;  4AUW A;  4PD4 D;  3M9H A;  3JCU E;  3P32 A;  1ZRT D;  2FKW B;  2Q7C A;  3L72 E;  2KS1 A;  3RBX A;  1DX7 A;  1NU1 E;  1OFC X;  2LR2 A;  5E79 H;  3CMA P;  3V2N A;  4WY4 B;  1GL2 B;  1JMB A;  4IOI H;  1QLE D;  1NOH A;  3ZDM A;  5CMZ A;  1BSH A;  2I1J A;  1RY3 A;  1CI6 A;  3TGU J;  2AEJ A;  3V5B A;  1SQV D;  4U3F D;  2AXT H;  1G1I A;  1FZA A;  3HUS A;  1HF9 A;  1Y47 A;  3HD7 C;  3NTN A;  3H1J D;  5AVZ B;  1YIT P;  1SQQ D;  2ZT9 D;  3TGU E;  2I8D A;  1D7M A;  1VL2 A;  3PTZ A;  4C7N A;  3L71 J;  3BAT A;  1Y9B A;  3HE5 A;  1Q81 Q;  3EFG A;  4GOF A;  2WPV B;  3H1H J;  1FZB A;  4YTP C;  2B88 A;  1VQL P;  4TLF A;  2O1K A;  3RBZ A;  2ZAE B;  1NTM K;  3H1H E;  1RE4 C;  3AEC C;  2E43 A;  1L4A C;  1IC2 A;  1EZV G;  2E76 B;  1HJ0 A;  3B5N A;  2BEZ F;  2HYN A;  1HH0 A;  3B4S A;  3C8V A;  4XE5 B;  1KQF B;  1SQX D;  1L2P A;  1DEB A;  4L73 A;  4WY4 D;  1PFI A;  1NTK D;  1X9V A;  3C1L A;  2W90 A;  2IDB A;  3CC7 P;  3CC2 P;  4W7Z A;  1CI6 B;  2JP3 A;  3MP7 B;  1NTM J;  1VDF A;  4PJ0 H;  4OH8 B;  2KUB A;  5AW8 B;  2LXB A;  3HUS B;  2RKL A;  1L0L D;  3EQ2 A;  1MFT A;  3GHG C;  1RE3 C;  1NTM E;  1LNQ A;  2C0X A;  2NPS C;  2K1A A;  2POH A;  1S5L H;  2WSF H;  1GL2 C;  4C7N B;  3OJA B;  1NAF A;  1W2E A;  2K9J A;  3HE5 B;  3D6Z A;  3PLN A; 
#chains in the Genus database with same CATH homology
 1A02 J;  1EQ7 A;  1NKN A;  1GTW A;  1JO5 A;  5AW7 B;  1X79 B;  1HTL C;  1IFN A;  5AVV B;  2C9L Y;  3L4F A;  4AYC A;  1MZ9 A;  1SFC C;  2YKP A;  3P7K A;  1HWT C;  1KIL C;  1JY2 P;  1SQV K;  1G1J A;  1SFC B;  2WIT A;  2XU6 A;  2BAS A;  1KIL B;  1FDM A;  5AW4 B;  2GUV A;  5KLV K;  3B5N C;  5CCG A;  5AW5 B;  2A45 G;  2CPS A;  3B5N B;  3P8C E;  2OYI A;  1GW3 A;  1A02 F;  2QM8 A;  1L4A D;  1T3J A;  5AW1 B;  1LTJ C;  1AQ5 A;  3CI9 A;  1N7S A;  3M0A A;  2JEE A;  2PAJ A;  1JUN A;  1QL1 A;  4LLH A;  1N86 A;  4WB4 A;  2H43 A;  1T2K C;  3A2A A;  1IO4 A;  3RK3 C;  3U59 A;  2N1T D;  1H88 A;  1L0N K;  1LWU A;  3RK3 B;  1AFO A;  4ZKU A;  2XNX A;  1NHL A;  1JY3 N;  1GD2 E;  1SQP K;  1URQ C;  4I6M C;  1IJD B;  1URQ B;  1LTS C;  3LW5 H;  2WPQ A;  1HJB A;  1FZE A;  4XA4 A;  5KJ7 A;  1NTZ K;  3M06 A;  1GK4 A;  1QL2 A;  1J1E C;  2A45 H;  4ZKP A;  1ZN5 A;  3RL0 B;  3VP8 A;  5CCH A;  3A5T A;  1HUC A;  1FJK A;  1YTZ I;  2WPS A;  3BRV B;  5AW9 B;  2Q9I A;  2JJL A;  2W6A A;  2XDJ A;  2HOD A;  1N73 C;  1GL2 D;  3VN0 A;  3M9Q A;  1M1J C;  2YKO A;  4HYT B;  2P1J A;  2Q3I A;  1NTK K;  1M1J B;  2E42 A;  5APW A;  3RK2 D;  3O8Z A;  1GDT A;  2R3C A;  3MD0 A;  1SLQ A;  5AVY B;  2C0W A;  2FFD A;  4N6J A;  2IFM A;  1JMM A;  1GW4 A;  3WMM 0;  1YTZ T;  5CJ0 A;  5AVS B;  5BU8 B;  3P8C D;  1GK6 A;  2IFN A;  5CCG C;  2HLO A;  1CW5 A;  1SFC D;  2L5G B;  1JCD A;  1T8Z A;  1LT9 A;  2M8R A;  3TNU A;  2R5D A;  3HD7 D;  2OYI B;  2YNY A;  2WTY A;  2WSC H;  2YO2 A;  3KYQ A;  1JY2 N;  1KFM A;  1MV8 A;  1N7S C;  1L4A A;  1ZLL A;  3M0D A;  1LTB C;  1N7S B;  1JOC A;  3KPE A;  3VMX A;  1GU5 A;  3HTK A;  1JCC A;  3M91 A;  3TK1 A;  1YYC A;  4Y99 C;  2WT7 A;  4W7Y A;  1LGH B;  4Y99 B;  1FZC A;  1LWU C;  1VPC A;  5APU A;  4IFF A;  1N7L A;  4JYB A;  1LWU B;  3V4W A;  1T2K D;  2N1T A;  3B8E B;  3VOP A;  5CHX A;  4AQR D;  4B86 A;  3E1I A;  2XV5 A;  1CSB A;  4C46 A;  2OAR A;  2GM4 A;  1JY3 O;  5APY A;  3VMZ A;  1URQ D;  4DZO A;  1SQQ K;  5KJ7 C;  2WSE H;  1ZR2 A;  2Q5U A;  5CCH C;  3LID A;  1HGZ A;  1WRG A;  2P7J A;  2XZR A;  3TSI A;  4I1L A;  2IX7 C;  2GUS A;  1XTG B;  2HOD B;  1KFN A;  3UIA A;  1SP4 A;  4IFD K;  1RE3 A;  3MIW A;  2OYH A;  2XKM A;  4M3L A;  3II6 A;  4WY4 A;  1GL2 A;  4LC1 A;  2FFD C;  2P2U A;  3BVH A;  2FFD B;  2HPC A;  3CL3 D;  3VYI A;  1FOS E;  2KYV A;  2LKM A;  2KP8 A;  1SQB K;  1FOS F;  4RES B;  1NU1 K;  1LT9 C;  2KLV A;  1ZV8 A;  1HVV A;  3VMY A;  3RL0 C;  2IPP A;  2HFE D;  1LT9 B;  3TNU B;  3NXS A;  2Z4E A;  4EOT A;  3M0D C;  3V4Q A;  3HD7 A;  3L36 A;  1E5W A;  1L4A B;  3BAS A;  4GT1 A;  2C9N Y;  2NPS D;  2KSJ A;  1FAV A;  1SQX K;  3I5C A;  1JY2 O;  2WWW A;  3KQG A;  3HTK B;  1N7S D;  1H8A A;  1T3U A;  3MTU E;  1IFD A;  3A3Y B;  1S9K E;  1FZC C;  1LTJ A;  2WT7 B;  3KDP B;  5AW3 B;  1CZQ A;  2QM7 A;  1OWA A;  1FZC B;  2H7H A;  4JF7 A;  2YO3 A;  4JYC A;  3HE4 A;  1IFM A;  2FYU K;  1IFI A;  1HGV A;  4EIJ A;  2N1T B;  1XTC C;  3OAK A;  5BVZ A;  2OYI C;  1KIL D;  3VP9 A;  1ZR4 A;  3SWY A;  1X8Y A;  2VRS A;  1L0L K;  3N4X A;  3B5N D;  2PP6 A;  1JNM A;  1NO4 A;  1RE4 A;  3R2P A;  4KHX A;  3L35 A;  2FYZ A;  4W80 A;  4AUW A;  3M9H A;  5AVQ B;  5KJ7 D;  3P32 A;  1FZF A;  3V2R A;  2FKW B;  5APQ A;  2Q7C A;  1NKZ B;  1DX7 A;  5CCH D;  1J1D C;  1N2D C;  1RF0 A;  5BU5 A;  1J1D B;  2OYH C;  2A45 I;  4WY4 C;  2OYH B;  1SVF A;  3V2N A;  4WY4 B;  1GL2 B;  2P67 A;  2YMY A;  1FBM A;  3RK3 D;  1NOH A;  4N3Y B;  2Z5H A;  3H32 A;  5AVR B;  2HPC B;  2N9B A;  1LTT C;  1M7L A;  2M3B A;  5CMZ A;  1OXZ A;  3V2P A;  2I1J A;  5AVX B;  1G2C A;  3TYY A;  1RY3 A;  4LGD E;  3A7O A;  1CI6 A;  3V5B A;  1JTH A;  1G1I A;  1FZA A;  3HUS A;  5APT A;  2HG5 D;  5CJ4 A;  2O1J A;  4O9B A;  3HD7 C;  3NTN A;  3BRT B;  1FZG A;  5AVZ B;  3RL0 D;  3HD7 B;  2WZ7 A;  4I2L C;  2FXM A;  2Z5I A;  1S9K D;  2W6B A;  5APX A;  1RF1 A;  3GHG A;  3OA7 A;  3CLQ A;  5KTB A;  2NPS A;  3MGN A;  3V2Q A;  1MUU A;  4C7N A;  3HRN A;  3U1C A;  3BAT A;  5AW2 B;  3M9B A;  1LTJ B;  3HE5 A;  3EFG A;  1LTI C;  1GU4 A;  1FZB A;  1NH4 A;  2KB7 P;  5AW6 B;  2J58 A;  3HE4 B;  1FU1 A;  4GKG A;  4DOJ A;  1NWQ A;  2O01 H;  4C7R A;  2O1K A;  3H6P A;  1NTM K;  2I1K A;  1HBW A;  5CCG D;  3NMD A;  1Z56 A;  1RE4 C;  1SFC A;  2CPB A;  4GIF A;  2E43 A;  1KIL A;  2MJZ A;  1L4A C;  1IC2 A;  2ZFC A;  2YKQ A;  3U1A A;  1WT6 A;  3B5N A;  5AW0 B;  1LTG C;  2HYN A;  1RF0 C;  4N78 D;  5APS A;  3P8M C;  1HH0 A;  4XE5 B;  3NFQ A;  1J1E B;  1JY3 P;  3VTP C;  2N1T C;  1FJP A;  1DEB A;  1DH3 A;  2ZXE B;  4WY4 D;  1PFI A;  1X9V A;  1KQL A;  1H89 A;  3H32 B;  1N73 B;  5APV A;  1G2C B;  3IR9 A;  4W7Z A;  1CI6 B;  2R5B A;  3G3Z A;  4WBA A;  3N7N A;  1JTH B;  5AVW B;  1URQ A;  3HUS C;  1VDF A;  4OH8 B;  5AW8 B;  2J59 M;  3HUS B;  2WPR A;  3MUD A;  1KZU B;  3EQ2 A;  3LIE A;  3L37 A;  1RF1 C;  1MFZ A;  1GZL A;  1RE3 C;  3GHG C;  2C0X A;  2NPS C;  1IFJ A;  4IFM A;  3GHG B;  1RF1 B;  2POH A;  4N78 E;  1J2J B;  3T97 A;  2WSF H;  1GL2 C;  2KOG A;  2NPS B;  1IK9 A;  5AVT B;  4C7N B;  3OJA B;  2R32 A;  1NAF A;  4HH2 A;  1W2E A;  3HE5 B;  3C9I A;  3RK2 C;  3PP5 A;  3SWF A;  2H8P D;  1LTA C;  1N73 A;  3RK2 B;  3IFM A;  1M1J A;  2W27 A;  5AVU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...