2HG5D

Cs+ complex of a k channel with an amide to ester substitution in the selectivity filter
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
43
structure length
43
Chain Sequence
DLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords FAB HEAVY CHAIN
publication title Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
pubmed doi rcsb
total genus 16
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2006-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hg5D00
3HD7D 1SFCA 1URQA 2M8RA 3B5NA 1SFCB 3M0DC 3RK3D 1N7SC 3KYQA 3PP5A 1SFCD 1URQD 3B5ND 2N1TA 1KILC 1T3JA 5CCHA 2YMYA 5CCGC 1L4AC 1GL2A 5KJ7D 1URQB 2H8PD 1N7SA 3B5NB 2N1TD 1GL2B 2KOGA 3HD7C 3RK2B 5CCHD 3HTKB 2NPSA 3RK3C 1KILA 4OH8B 1GL2D 3RK2D 2NPSB 3RL0B 4LGDE 1N7SD 2N1TB 4WY4A 1SFCC 4WY4B 2NPSD 3RL0D 2PP6A 1N7SB 3P8CE 4WY4D 5KJ7C 2WZ7A 3TSIA 2HG5D 4JF7A 5CCHC 1KILB 4W80A 1URQC 3B5NC 4W7ZA 5CCGA 4W7YA 3VOPA 1L4AA 1GL2C 1XTGB 3RK2C 4N78E 1NHLA 1L4AB 3HD7A 1JTHA 1KILD 2XDJA 5KJ7A 3HD7B 1JTHB 2NPSC 3RL0C 5CCGD 2N1TC 1HVVA 1L4AD 2HFED 3RK3B 4WY4C
chains in the Genus database with same CATH superfamily
3L4FA 4WVZA 1M1JC 3II6A 1SFCB 3S4RA 1ZLLA 4KHXA 1AQTA 2SPZA 2O1JA 3L73D 5KAFH 2B87B 1NTZE 1LTTC 2WPRA 1BE3G 1GD2E 1KYOE 1N7LA 1VQNP 1GK6A 4IFMA 1KQFB 5C39A 3AECC 1LTIC 1S72P 3RK3C 3QH9A 3CX5H 2FYUK 4D6TJ 2QM7A 2BCCE 1ZXGA 4TLFA 3RL0D 1FAVA 4GODA 3FXEA 2QM8A 3L70D 5KLVK 1MUUA 1OZHA 2WT7B 1NTKG 4BRYA 2IFNA 3CCLP 4EOTA 3RK2C 3ABVC 3P32A 1NTME 2E75B 3GF3A 1WRGA 3I56P 4MN4C 2ZVNB 1FS0E 1X22A 2ZJSE 5EFWB 3H1ID 5APXA 2N1TC 1IFJA 3TNUA 1FJPA 1H89A 3H32A 1EZVD 2KUBA 1YJNP 1SQVE 1DIPA 1HTLC 3M0DC 2I8DA 1PPJE 1GW4A 1KB9E 4RKUJ 2FFDC 2C0XA 1MFTA 3SWYA 3A0HE 1JMBA 1IFNA 2A45I 1BSNA 1M1JA 3N7NA 2J58A 2B9BA 3G3ZA 2WSSH 2N1TD 1GL2B 2XU6A 4B86A 1NJIQ 1NAYA 4RO0A 4IFDK 1JY2O 1EDJA 3WUVA 3CD6P 5AW7B 2O01N 2AXCA 5GTIH 3VN0A 2POHA 3WU2E 4ASWA 1SFCC 1L0LG 2HLOA 3V6IA 1FZCB 2OGUA 2AXTE 5AW9B 3Q5PA 1NKZB 2ZXXA 1E5WA 1L2PA 1BSHA 5KJ7C 3KHUA 5CJ0A 2I1JA 1VQ5P 2QRXA 1LTJA 1FU1A 4W7ZA 4D6TE 1JUNA 1NHLA 1W5CE 1L4AB 1M57D 3NTNA 1KQLA 4NPEA 1KQGB 3L75G 1AQ5A 4UB8E 3CX5D 3MUDC 1PV3A 2HFED 4ZKUA 3U1AA 1FE6A 2CPBA 1KD1Q 3AE5C 4OWFA 2FYZA 3RK3E 3IN6A 3H1JJ 2N1TA 3JCUE 2M0BA 2P1JA 3H1KD 1AA0A 3H1KJ 1MKMA 3AE7C 3IAOA 2E75C 1S1CX 1NYHA 3M0DA 1BDCA 3B5NB 3KZIH 2KOGA 4NPFX 3TK1A 2FFDA 2PRRA 1N2DC 1SQVK 3USSA 2W8ZA 1LNQA 2JJLA 1VPCA 4EIJA 3KQGA 1WMKA 2CK3H 1H0TB 3AE2C 4U3FJ 2KS1B 2HPCA 1Q7YQ 2A06D 1IJDB 3L74J 1PGPA 3VP9A 3VMAA 1SQPK 4M3LA 1J2JB 1NVOA 4PV1B 3W68A 1Y47A 2IBZE 3VMYA 1KYOH 1SQQD 1KILB 1GL2C 4N78E 2B87A 1JTHA 1PP9G 1VF5D 5KJ7A 1L0NJ 3EQ2A 1RF0C 1JY2P 4GOEA 5AVRB 3MHVA 1K05A 2OYHB 1FZCC 1S5LE 1WT6A 2XV5A 3CCQP 3CCMP 5APSA 1AVYA 4GT1A 3HRNA 4TT3H 3BCCD 1FZGA 5L8RJ 4IL6E 1QX8A 3G9RA 1CI6B 1ZOYC 2R3SA 3MUDA 5KLVD 3L72J 5KTBA 1G2CB 5H2FE 1T3JA 1OW7A 2YMKA 2KLUA 3WUUA 2K9JB 5CCGC 1S2EA 1L4AC 5AVWB 4C46A 1JOCA 2ZAEB 2KZJA 3MZWB 2W6JH 1ZRTD 1DEBA 2D2CB 3HTKB 2P10A 2WSCH 1YJ9P 2G3AA 3H1JE 1S4XA 3MIWA 3H1KE 3MP7B 1DD3A 2KI7B 1P84D 1KB9H 1VDFA 2M5AB 4Y99B 1RE4A 1Y8AA 2WSFJ 1S3JA 3IR9A 3A0HH 2JDIH 3TYYA 2LR2A 1KQSO 4PD4I 5AVZB 3B5NC 3FWNA 1IFIA 3VOPA 1N73C 3V4QA 4U3FE 1LJ2A 3O6QB 3L74E 1YQ3C 2QJKB 2MKVA 5E79E 5APVA 2Y9YA 2YO2A 3P8MC 3C9IA 2H89C 3WU2H 1HGVA 2W83C 4HKZH 1QEXA 1FOSF 3V2QA 1MZ9A 1RY3A 2AXTH 3TF5A 1DEEG 1VQ4P 1JY3N 3CCUP 1OVRA 1JNMA 1SQPG 3AEDC 4PV1C 1NTZD 2WSEJ 1PP9J 1RF0A 3B5ND 1LTGC 1CSBA 1L0NE 1KILC 1QVGO 1KYOD 1OVVA 1FZCA 2XZRA 3C8VA 3B4SA 1KTMA 2P2UA 4GIFA 4HYTB 3M91A 4DOJA 3L73G 4O9BA 2IPPA 2R5DA 5AVTB 4UB8H 4H13B 1IC2A 2OYHC 2FXOA 1T6AA 1NO4A 3B8EB 2BCCD 3L72E 4YXWH 2Y0CA 3A0BE 4WY4B 3TGUG 3D6YA 1M90Q 4IFFA 3SFDC 1BGYD 3JCUH 1BGYJ 3FXDA 2QA4P 3Q3DA 2IFMA 2W6BA 2WPVB 3L70G 1CW5A 3RBXA 1NTMD 1DH3A 4K35A 1YTZI 2D2CC 3G4SP 1PGOA 3AE8C 1P84E 1LP1B 3NMDA 3HE5A 2K9YA 1VQPP 1VQ8P 2BEQD 3M06A 1OW8A 3RBZA 1AJYA 3D71A 1SQVD 1PZQA 3B5NA 1N73A 1PPJD 1KB9D 2XNDH 3MGNA 4Y99C 3H1IG 3CXHI 3P7KA 3H1LJ 3UIAA 3R4YA 1EZVG 3QWOC 2KIKA 4H44D 3LIEA 1HJBA 2YKPA 1SQXG 1URQB 2H8PD 2QJKC 4L76A 1SQQK 1KILA 2UWJE 1PP9E 2QVAA 1S5LH 1YI2P 2N9BA 1RE3C 5GTHE 1L0NK 3CWBG 4IL6H 3GW6A 2YXRB 3AE3C 3KDPB 5KAIE 2OYHA 2Z5HA 2CPSA 5H2FH 1EDKA 4JF7A 4YTPC 5CCHC 3OAKA 1HUCA 3A7OA 4D6TD 5AW3B 4H0LB 3Q2YA 1HGZA 1CI6A 2WTYA 2K37A 4H13C 1M56D 1KILE 3HD7B 5APQA 4OVNF 1QL2A 4PJ0E 1BGYE 4WY4C 1NU1J 3WMM0 2NZ2A 3RK3D 1FOSE 2V7QJ 2QG4A 3JSVC 2K1AA 1VQLP 3VMZA 3FGAD 2GUSA 1U7MA 1SQBG 2ZYDA 3CL3D 3TDKA 4ASVA 1BCCG 5AVSB 2JR8A 2R44A 1GK4A 1S5LX 1ZMEC 5E79H 1K73Q 2O3JA 1Q81Q 3H1LE 3RK2D 2NPSB 3OA7A 3L71G 5B5EE 4IL6X 2KSEA 1DX7A 3W67A 2E42A 1VQ6P 1PGJA 3O6QA 3PJSK 2ZT9B 2C0WA 2KNCA 2QSIA 1SQXJ 2RKLA 4ZNCA 4JYBA 4JBZA 4IOIH 1G1IA 1LT9B 3TSIA 2IBZD 1EZVI 1JEKA 2A06G 3GF7A 1GW3A 2XNXA 2O01J 2JKVA 1URQC 1RE3A 4N78D 5DJUB 4EDFA 1BE3J 1SP4A 2KK7A 1DD4A 1NTZK 3CWBJ 1NKNA 1OIPA 1U57A 2R5BA 3V5BA 2Q3IA 1NAFA 3A0BH 4DZOA 1LTAC 4JQ0D 3T97A 1OW6A 3E1IA 1SFCD 1URQD 2QJYB 4L73A 4H0LC 2FYUG 2YMYA 1NTKJ 4OGQB 3CCSP 5KJ7D 2R3CA 2XKMA 1NU1E 3HD7C 5KLVG 1H88A 1VQ7P 1P84H 4GDOA 1X8YA 5CBNA 1FZBA 3H1JD 1NH4A 4OH8B 1JM0A 1NTMK 2IYPA 3OW2O 2WSFH 4AYCA 2GUVA 2PFXA 2WVRA 1BCCJ 2Y0DA 4HB1A 1LP1A 3E1RA 1SS1A 3CX5I 2N9YB 1Q90D 4RJTA 2IYOA 1N8RQ 4C7NB 2LKMA 1ZN5A 4W80A 3L71J 1SLQA 5TJHA 4U3FD 1R8EA 3L74D 3V2PA 1SQXE 3HE4A 4UB6E 2NPSC 1FZFA 2WSEH 2E75D 2K3RA 1R5LA 2E76B 1SFCA 1URQA 3EWKA 2ZT9C 3JC22 5GTHH 1L0LJ 1BE3E 5K5GB 1KC8Q 3A5TA 4YPCA 1LT9C 4KJMA 1L0ND 1QVFO 5KAIH 1QGKB 3CWBE 1R5SA 2YKQA 5AW6B 3M9BA 1U7JA 1T8ZA 2LXCB 3SWFA 5AW4B 1GTWA 4XA4A 2QEXP 1FZEA 3L75D 3L72D 3L75J 4PJ0H 1GL2D 2QIWA 2KXPB 1K8AQ 3ZDMA 2FYUJ 2JEEA 1NTKE 2ZXEB 2E74B 2C9LY 2OYOA 2QJYC 2WT7A 1KFMA 3P8CE 2Q9IA 3L35A 3OJAB 2FYNB 1TU3F 4OGQC 2WPQA 4BRYB 1KMIZ 4N6JA 3V2NA 1BCCE 3AEAC 3PLNA 2GM4A 5CCGD 3Q5SA 1L4AD 5B5EH 4DJGA 5BVZA 1X79B 3TNUB 2YNYA 3H1HG 2M8RA 1IK9A 2NRGA 1YYCA 3L71E 4U7JA 3S1KA 3PP5A 1OXZA 2V4HA 1SQVG 2KSJA 2PGDA 4N3YB 1GL2A 2YO3A 4I7ZB 1GU5A 4LLHA 1L0LE 4R4LA 5AVXB 2WITA 1PP9D 3VYIA 2E76C 2C9NY 3RL0B 2WWWA 1FBMA 1FZAA 1K9MQ 1FJKA 1ZR4A 4WBAA 2BASA 1IFMA 3IF4A 5BU5A 1J1DB 1ZV8A 3L75E 3Q1MA 2AEFA 5CCGA 1LTJB 2IX7C 4PV1D 1L4AA 5APYA 2FYUE 2J5UA 2QJPB 3M0AA 1KILD 2HODB 2XDJA 2RN0A 1HF9A 1EQ7A 2V7QH 3CC7P 1KYOI 2E43A 4D6TG 4NPDA 1NTKK 1Q2NA 2PAJA 3VP8A 3F89A 1YITP 3I55P 1T2KC 2E74C 2W90A 5TISE 3FX0A 2A45H 2P58A 4PD4E 1G1JA 2YKOA 1LWUB 2FXPA 1FDOA 5APWA 2FYNC 3CLQA 2DW3A 3M9HA 5AW2B 3U59A 1EXIA 2ZVOB 2B88A 2E5TA 1RF1B 2FBWC 3H1HJ 3BATA 1IFPA 1S9KE 2M3BA 4C7NA 4UB6H 2YIUB 3H1LD 3K5BA 1H0TA 2I1KA 2P7JA 1D7MA 2KS1A 1HJ0A 2D2CD 3LW5J 2QE7H 3BRVB 2O01H 1HWTC 2HPCB 1HH0A 2ZYAA 1QLED 1N7SB 2E5YA 1ZW0A 1SQPJ 5AVVB 3CCVP 1ZP0C 5AVYB 1JY3O 1L0LK 2KZIA 1KB9I 4I7ZC 5AW5B 1GZLA 5KLIB 2IBZG 3L73J 1LTSC 2K88A 1JTHB 1X0TA 3RL0C 3AE9C 1FDMA 5KKZB 1MV8A 2OTKE 2WMMA 1M1KQ 2AEJA 3KYQA 3TGUD 3TGUJ 5CMZA 1G2CA 1J1DC 3GHGB 2Q5UA 4WWIA 1NGMB 2K9JA 1LTJC 3U1CA 3AEGC 4I1LA 4I6MC 1NU1D 2QJPC 1FDIA 3L70J 3HTKA 1Y9BA 3F5HA 5CCHD 2OQQA 3N4XA 1J1EB 5CBOA 3SWKA 1LGHB 3CXHE 3CC4P 1GDTA 1A02F 1BDDA 4H13D 4AQRD 2ZFCA 1LWUC 1T3UA 2G8YA 1VQMP 3KXDA 2M5AA 2Y0EA 3L36A 3H1HE 3H1JG 3R2PA 3CPWO 3SSUA 4WY4D 3H1IJ 3A3YB 3H1KG 2OTLP 2HG5D 2Q7CA 1RF1C 1JCDA 1VF5B 2OYIB 1USEA 5AW1B 3H25A 1X9VA 1SQXD 2YIUC 4DT0A 1HBWA 3HUSB 2H43A 3AEFC 4U3FG 2Q1KA 1SQPE 3MTUE 3AE1C 1VL2A 3L74G 2BEZF 3Q5RA 1BE3D 4Z1MH 1JMMA 3G6EP 1N7SC 1JO5A 1IFDA 1OVUA 1PGQA 3PTZA 3CWBD 4BXLA 3L73E 1SQQG 2Z5IA 3VMXA 1GU4A 3C1LA 3EFFK 2KB7P 4WB4A 1OWAA 5CCHA 1GMJA 1JY3P 5KLIC 3PHLA 1A02J 2GA1A 4HH2A 1L0NG 3V4WA 4KT0J 1PFIA 2IBZI 1KORA 3TGUE 5APUA 2Q6QA 1JCCA 5KKZC 4LGDE 1N7SD 3V2RA 2WQYC 4WY4A 1NTKD 1K04A 3BCCG 5TISH 2L91A 2HODA 4LC1A 4PD4H 3BASA 3P8CD 2H88C 5B66E 2Q3EA 1KV4A 3L72G 3L70E 3GHGC 4GOFA 1OMIA 2FXMA 3E7KA 1YJWP 1YHQP 1SQBD 1SQBJ 3B71A 3M9QA 2ITAA 3NFQA 2M3EA 2JWAA 1LWUA 4W7YA 1XTCC 1XTGB 1BCCD 2IZ1A 1NWQA 3GMAA 2LXBA 5BU8B 1LT1A 2B89A 1J1EC 1KN7A 1IZNB 4H0LD 1M8OB 3AEEC 3GLMA 3HE5B 3H1IE 1RF1A 3CMAP 3EFGA 2RMZA 3HD7D 3L71D 4QMAA 1EZVE 3CCEP 4RESB 4C7RA 1N73B 3KPEA 4A7PA 1RE4C 2MJZA 1PIXA 1VQOP 1AVOA 1NOHA 1W2BO 1VF5C 3ITKA 3LIDA 1QL1A 1USDA 2OYIC 3PRJA 2ZYGA 2HYNA 1YTZT 3NXSA 1EXJA 1KZUB 5AVQB 1N7SA 1L0LD 3HUSC 3CCJP 4ZKPA 1AV1A 1UIIA 1UIXA 2O1KA 1SQQJ 3WUTA 5DJTB 4L75A 2NPSD 1NTZG 5KAFE 2W6AA 2HR3A 1EDIA 2ZT9D 2OARA 2R32A 3D6ZA 4JPZB 3BVHA 2P67A 3CMEP 2KLVA 3RGUA 2FYUD 3S9OA 1EDLA 2Z4EA 3BCCJ 3HD7A 3GHGA 1Q82Q 2Y9ZA 5KLVJ 2BCCG 1RQUA 1HVVA 2WPSA 3CX5E 3CXHH 4YXDC 1NU1K 5AW8B 1SQBE 4PD4D 1ZR2A 4ZMDA 3VTPC 2IZ0A 3CC2P 2RH0A 1BGYG 4H44B 5CJ4A 1NTMG 4XFJA 4Y28J 2OTJP 4EYYQ 1S9KD 3H32B 3O8ZA 3LW5H 3CCRP 1Z56A 5AW0B 1VQ9P 4OGQD 1RHZB 1AFOA 2NPSA 1YIJP 4JYCA 2OYIA 1PPJG 3GG2A 4K3AA 1SQXK 3IFMA 1P84I 4EI2A 3HUSA 1M1JB 1YBKA 3H1LG 2A06E 1LT9A 2JO1A 2KNCB 2H7HA 1EC5A 3I5CA 1IK7A 1W2EA 4AUWA 1MFZA 3BRTB 4L74A 3L37A 3G71P 1SQQE 5M1BA 4BWNA 2VRSA 2FY8A 1NTZJ 2IDBA 2JP3A 5GTIE 3RK3B 2FKWB 1VQKP 3PH0A 1PL5A 4HJGH 4GKGA 2YXQB 5B66H 2E76D 3MD0A 5CHXA 3FWLA 3BCCE 1Q86Q 3T97B 1OX3A 3H6PA 2KYVA 2JWDA 2AEMA 5KLVE 3AEBC 2BCCJ 1M7LA 3D70A 3SFEC 3AE6C 3RL0g 1JB0J 1OFCX 4R4MA 3RK2B 1CZQA 2J59M 5AVUB 1SQBK 1ZRTE 3CXHD 3AE4C 1RQVA 1YQ4C 1SVFA 1NU1G 2N1TB 3CI9A 1NTMJ 1IO4A 2W27A 4H44C 1LTBC 3H1HD 1E79H 2PP6A 4CPGA 2WSCJ 1KFNA 1FC2C 1T2KD 2KP8A 2FFDB 2WZ7A 2E74D 2A45G 1SQVJ 2L5GB 5APTA 3A2AA 4I2LC 3KZIE 4DCKA 1H8AA 1N86A 4XE5B 1RH5B 3HE4B 1SQPD 1JY2N
chains in the Genus database with same CATH topology
1SFCA 1URQA 3L4FA 1FOSF 1M1JC 3II6A 3V2QA 1SFCB 1JMMA 1MZ9A 1ZLLA 1RY3A 4KHXA 1N7SC 1JO5A 1JY3N 1IFDA 3A5TA 1JNMA 1LT9C 2O1JA 1RF0A 3B5ND 1LTGC 1CSBA 2Z5IA 3VMXA 1GU4A 1KILC 2YKQA 5AW6B 1LTTC 2WPRA 1FZCA 1GD2E 2KB7P 2XZRA 4WB4A 1OWAA 5CCHA 1N7LA 3M9BA 2P2UA 4GIFA 1JY3P 4HYTB 1GK6A 3M91A 4IFMA 4DOJA 1A02J 1T8ZA 4HH2A 3SWFA 3V4WA 4O9BA 5AW4B 1GTWA 4XA4A 2IPPA 2R5DA 1LTIC 5AVTB 1PFIA 1FZEA 1IC2A 3RK3C 2OYHC 5APUA 1GL2D 1JCCA 1NO4A 4LGDE 3B8EB 1N7SD 3V2RA 4WY4A 2FYUK 2QM7A 4WY4B 2HODA 2JEEA 4LC1A 2ZXEB 3RL0D 1FAVA 2C9LY 2QM8A 5KLVK 3BASA 3P8CD 2WT7A 3GHGC 1KFMA 1MUUA 3P8CE 4IFFA 2Q9IA 3L35A 3OJAB 2WT7B 2FXMA 2IFMA 2WPQA 2W6BA 3M9QA 2IFNA 3NFQA 1CW5A 4N6JA 1LWUA 3V2NA 1DH3A 4W7YA 1XTCC 1XTGB 4EOTA 3RK2C 3P32A 1NWQA 1YTZI 5BU8B 1WRGA 1J1EC 3NMDA 3HE5A 2GM4A 5CCGD 5APXA 2N1TC 1L4AD 1IFJA 3HE5B 3TNUA 1FJPA 5BVZA 3M06A 1H89A 1RF1A 3EFGA 1X79B 3H32A 3TNUB 2YNYA 3HD7D 2M8RA 3B5NA 1IK9A 1N73A 1YYCA 1HTLC 3M0DC 4RESB 4C7RA 1N73B 1GW4A 3MGNA 4Y99C 3KPEA 2FFDC 2C0XA 3PP5A 3P7KA 1OXZA 1RE4C 3UIAA 2MJZA 2KSJA 3SWYA 1NOHA 1IFNA 2A45I 3LIDA 1QL1A 3LIEA 2OYIC 1M1JA 1HJBA 2YKPA 3N7NA 2J58A 2HYNA 1YTZT 3G3ZA 3NXSA 4N3YB 1GL2A 1KZUB 1URQB 2H8PD 1N7SA 5AVQB 3HUSC 2N1TD 2YO3A 1GL2B 1GU5A 2XU6A 4B86A 4LLHA 5AVXB 4IFDK 1JY2O 2WITA 5AW7B 1SQQK 3VYIA 4ZKPA 1KILA 3VN0A 2C9NY 2POHA 3RL0B 2O1KA 2WWWA 1SFCC 1FBMA 1FZAA 2HLOA 2N9BA 1FZCB 1RE3C 2NPSD 1L0NK 5AW9B 1NKZB 1E5WA 1FJKA 3KDPB 5KJ7C 1ZR4A 2W6AA 2OYHA 2Z5HA 4WBAA 2CPSA 5CJ0A 2BASA 1IFMA 2I1JA 2OARA 2R32A 4JF7A 5BU5A 3BVHA 1J1DB 1LTJA 1ZV8A 2P67A 5CCHC 3OAKA 1HUCA 3A7OA 2KLVA 1FU1A 4W7ZA 1LTJB 2IX7C 5AW3B 5CCGA 1L4AA 1JUNA 5APYA 1NHLA 1HGZA 1CI6A 2WTYA 2Z4EA 1L4AB 3NTNA 3HD7A 3M0AA 1KILD 2HODB 2XDJA 1KQLA 3GHGA 1AQ5A 3HD7B 1EQ7A 5APQA 2E43A 1QL2A 1HVVA 1NTKK 2WPSA 2PAJA 2HFED 4ZKUA 3U1AA 3VP8A 4WY4C 1NU1K 5AW8B 2CPBA 1T2KC 1ZR2A 2A45H 3VTPC 3WMM0 1G1JA 2YKOA 2FYZA 3RK3D 1LWUB 1FOSE 5APWA 3CLQA 5CJ4A 3VMZA 2GUSA 2N1TA 3M9HA 3CL3D 5AW2B 3U59A 2P1JA 5AVSB 1RF1B 1S9KD 3H32B 3O8ZA 3LW5H 3M0DA 3BATA 1S9KE 3B5NB 2KOGA 1Z56A 1GK4A 3TK1A 2M3BA 2FFDA 5AW0B 4C7NA 1N2DC 1AFOA 1SQVK 2NPSA 2JJLA 4JYCA 3RK2D 2NPSB 3OA7A 2I1KA 2P7JA 1VPCA 4EIJA 3KQGA 2OYIA 1DX7A 3BRVB 2E42A 2HPCA 1SQXK 3IFMA 2O01H 1HWTC 1IJDB 3HUSA 1M1JB 2HPCB 1HH0A 2C0WA 3VP9A 1SQPK 1LT9A 4JYBA 1N7SB 4M3LA 1J2JB 1G1IA 2H7HA 3I5CA 1LT9B 1W2EA 5AVVB 3TSIA 4AUWA 1MFZA 5AVYB 3VMYA 3BRTB 1JY3O 1KILB 1L0LK 1GW3A 2XNXA 3L37A 1URQC 1RE3A 4N78D 1GL2C 4N78E 1SP4A 2VRSA 5AW5B 1NTZK 1GZLA 1JTHA 1NKNA 1LTSC 5KJ7A 1JTHB 3EQ2A 3RL0C 1RF0C 1JY2P 5AVRB 2R5BA 3V5BA 3RK3B 2OYHB 1FZCC 1FDMA 2Q3IA 1WT6A 2XV5A 1NAFA 2FKWB 1MV8A 5APSA 4GT1A 4GKGA 3HRNA 4DZOA 3KYQA 1FZGA 3MD0A 1LTAC 5CHXA 3T97A 5CMZA 3E1IA 1CI6B 1G2CA 1SFCD 1URQD 3MUDA 3H6PA 2KYVA 1J1DC 3GHGB 2Q5UA 1G2CB 5KTBA 1M7LA 1LTJC 1T3JA 3U1CA 2YMYA 5CCGC 4I1LA 1L4AC 5AVWB 4I6MC 4C46A 5KJ7D 1JOCA 2R3CA 2XKMA 3HD7C 3RK2B 1H88A 1CZQA 2J59M 3HTKA 5AVUB 1DEBA 5CCHD 3HTKB 1X8YA 3N4XA 1SQBK 1J1EB 1FZBA 2WSCH 1NH4A 4OH8B 1NTMK 1LGHB 1SVFA 2WSFH 4AYCA 2N1TB 1GDTA 2GUVA 1A02F 3CI9A 3MIWA 1IO4A 4AQRD 2ZFCA 1LWUC 1T3UA 2W27A 1LTBC 2PP6A 3L36A 1VDFA 3R2PA 1KFNA 4WY4D 4Y99B 1RE4A 1T2KD 2KP8A 2FFDB 3A3YB 2WZ7A 4C7NB 2HG5D 3IR9A 2A45G 3TYYA 2LKMA 2Q7CA 1RF1C 1ZN5A 1JCDA 2L5GB 4W80A 5AVZB 5APTA 1SLQA 3B5NC 1IFIA 3VOPA 2OYIB 1N73C 3A2AA 3V4QA 5AW1B 3V2PA 4I2LC 1X9VA 1HBWA 3HUSB 3HE4A 5APVA 2H43A 2NPSC 1FZFA 1H8AA 1N86A 4XE5B 2WSEH 3HE4B 2YO2A 3P8MC 3C9IA 3MTUE 1HGVA 1JY2N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HD7 D;  1SFC A;  1URQ A;  2M8R A;  3B5N A;  1SFC B;  3M0D C;  3RK3 D;  1N7S C;  3KYQ A;  3PP5 A;  1SFC D;  1URQ D;  3B5N D;  2N1T A;  1KIL C;  1T3J A;  5CCH A;  2YMY A;  5CCG C;  1L4A C;  1GL2 A;  5KJ7 D;  1URQ B;  2H8P D;  1N7S A;  3B5N B;  2N1T D;  1GL2 B;  2KOG A;  3HD7 C;  3RK2 B;  5CCH D;  3HTK B;  2NPS A;  3RK3 C;  1KIL A;  4OH8 B;  1GL2 D;  3RK2 D;  2NPS B;  3RL0 B;  4LGD E;  1N7S D;  2N1T B;  4WY4 A;  1SFC C;  4WY4 B;  2NPS D;  3RL0 D;  2PP6 A;  1N7S B;  3P8C E;  4WY4 D;  5KJ7 C;  2WZ7 A;  3TSI A;  2HG5 D;  4JF7 A;  5CCH C;  1KIL B;  4W80 A;  1URQ C;  3B5N C;  4W7Z A;  5CCG A;  4W7Y A;  3VOP A;  1L4A A;  1GL2 C;  1XTG B;  3RK2 C;  4N78 E;  1NHL A;  1L4A B;  3HD7 A;  1JTH A;  1KIL D;  2XDJ A;  5KJ7 A;  3HD7 B;  1JTH B;  2NPS C;  3RL0 C;  5CCG D;  2N1T C;  1HVV A;  1L4A D;  2HFE D;  3RK3 B;  4WY4 C; 
#chains in the Genus database with same CATH topology
 3L4F A;  4WVZ A;  1M1J C;  3II6 A;  1SFC B;  3S4R A;  1ZLL A;  4KHX A;  1AQT A;  2SPZ A;  2O1J A;  3L73 D;  5KAF H;  2B87 B;  1NTZ E;  1LTT C;  2WPR A;  1BE3 G;  1GD2 E;  1KYO E;  1N7L A;  1VQN P;  1GK6 A;  4IFM A;  1KQF B;  5C39 A;  3AEC C;  1LTI C;  1S72 P;  3RK3 C;  3QH9 A;  3CX5 H;  2FYU K;  4D6T J;  2QM7 A;  2BCC E;  1ZXG A;  4TLF A;  3RL0 D;  1FAV A;  4GOD A;  3FXE A;  2QM8 A;  3L70 D;  5KLV K;  1MUU A;  1OZH A;  2WT7 B;  1NTK G;  4BRY A;  2IFN A;  3CCL P;  4EOT A;  3RK2 C;  3ABV C;  3P32 A;  1NTM E;  2E75 B;  3GF3 A;  1WRG A;  3I56 P;  4MN4 C;  2ZVN B;  1FS0 E;  1X22 A;  2ZJS E;  5EFW B;  3H1I D;  5APX A;  2N1T C;  1IFJ A;  3TNU A;  1FJP A;  1H89 A;  3H32 A;  1EZV D;  2KUB A;  1YJN P;  1SQV E;  1DIP A;  1HTL C;  3M0D C;  2I8D A;  1PPJ E;  1GW4 A;  1KB9 E;  4RKU J;  2FFD C;  2C0X A;  1MFT A;  3SWY A;  3A0H E;  1JMB A;  1IFN A;  2A45 I;  1BSN A;  1M1J A;  3N7N A;  2J58 A;  2B9B A;  3G3Z A;  2WSS H;  2N1T D;  1GL2 B;  2XU6 A;  4B86 A;  1NJI Q;  1NAY A;  4RO0 A;  4IFD K;  1JY2 O;  1EDJ A;  3WUV A;  3CD6 P;  5AW7 B;  2O01 N;  2AXC A;  5GTI H;  3VN0 A;  2POH A;  3WU2 E;  4ASW A;  1SFC C;  1L0L G;  2HLO A;  3V6I A;  1FZC B;  2OGU A;  2AXT E;  5AW9 B;  3Q5P A;  1NKZ B;  2ZXX A;  1E5W A;  1L2P A;  1BSH A;  5KJ7 C;  3KHU A;  5CJ0 A;  2I1J A;  1VQ5 P;  2QRX A;  1LTJ A;  1FU1 A;  4W7Z A;  4D6T E;  1JUN A;  1NHL A;  1W5C E;  1L4A B;  1M57 D;  3NTN A;  1KQL A;  4NPE A;  1KQG B;  3L75 G;  1AQ5 A;  4UB8 E;  3CX5 D;  3MUD C;  1PV3 A;  2HFE D;  4ZKU A;  3U1A A;  1FE6 A;  2CPB A;  1KD1 Q;  3AE5 C;  4OWF A;  2FYZ A;  3RK3 E;  3IN6 A;  3H1J J;  2N1T A;  3JCU E;  2M0B A;  2P1J A;  3H1K D;  1AA0 A;  3H1K J;  1MKM A;  3AE7 C;  3IAO A;  2E75 C;  1S1C X;  1NYH A;  3M0D A;  1BDC A;  3B5N B;  3KZI H;  2KOG A;  4NPF X;  3TK1 A;  2FFD A;  2PRR A;  1N2D C;  1SQV K;  3USS A;  2W8Z A;  1LNQ A;  2JJL A;  1VPC A;  4EIJ A;  3KQG A;  1WMK A;  2CK3 H;  1H0T B;  3AE2 C;  4U3F J;  2KS1 B;  2HPC A;  1Q7Y Q;  2A06 D;  1IJD B;  3L74 J;  1PGP A;  3VP9 A;  3VMA A;  1SQP K;  4M3L A;  1J2J B;  1NVO A;  4PV1 B;  3W68 A;  1Y47 A;  2IBZ E;  3VMY A;  1KYO H;  1SQQ D;  1KIL B;  1GL2 C;  4N78 E;  2B87 A;  1JTH A;  1PP9 G;  1VF5 D;  5KJ7 A;  1L0N J;  3EQ2 A;  1RF0 C;  1JY2 P;  4GOE A;  5AVR B;  3MHV A;  1K05 A;  2OYH B;  1FZC C;  1S5L E;  1WT6 A;  2XV5 A;  3CCQ P;  3CCM P;  5APS A;  1AVY A;  4GT1 A;  3HRN A;  4TT3 H;  3BCC D;  1FZG A;  5L8R J;  4IL6 E;  1QX8 A;  3G9R A;  1CI6 B;  1ZOY C;  2R3S A;  3MUD A;  5KLV D;  3L72 J;  5KTB A;  1G2C B;  5H2F E;  1T3J A;  1OW7 A;  2YMK A;  2KLU A;  3WUU A;  2K9J B;  5CCG C;  1S2E A;  1L4A C;  5AVW B;  4C46 A;  1JOC A;  2ZAE B;  2KZJ A;  3MZW B;  2W6J H;  1ZRT D;  1DEB A;  2D2C B;  3HTK B;  2P10 A;  2WSC H;  1YJ9 P;  2G3A A;  3H1J E;  1S4X A;  3MIW A;  3H1K E;  3MP7 B;  1DD3 A;  2KI7 B;  1P84 D;  1KB9 H;  1VDF A;  2M5A B;  4Y99 B;  1RE4 A;  1Y8A A;  2WSF J;  1S3J A;  3IR9 A;  3A0H H;  2JDI H;  3TYY A;  2LR2 A;  1KQS O;  4PD4 I;  5AVZ B;  3B5N C;  3FWN A;  1IFI A;  3VOP A;  1N73 C;  3V4Q A;  4U3F E;  1LJ2 A;  3O6Q B;  3L74 E;  1YQ3 C;  2QJK B;  2MKV A;  5E79 E;  5APV A;  2Y9Y A;  2YO2 A;  3P8M C;  3C9I A;  2H89 C;  3WU2 H;  1HGV A;  2W83 C;  4HKZ H;  1QEX A;  1FOS F;  3V2Q A;  1MZ9 A;  1RY3 A;  2AXT H;  3TF5 A;  1DEE G;  1VQ4 P;  1JY3 N;  3CCU P;  1OVR A;  1JNM A;  1SQP G;  3AED C;  4PV1 C;  1NTZ D;  2WSE J;  1PP9 J;  1RF0 A;  3B5N D;  1LTG C;  1CSB A;  1L0N E;  1KIL C;  1QVG O;  1KYO D;  1OVV A;  1FZC A;  2XZR A;  3C8V A;  3B4S A;  1KTM A;  2P2U A;  4GIF A;  4HYT B;  3M91 A;  4DOJ A;  3L73 G;  4O9B A;  2IPP A;  2R5D A;  5AVT B;  4UB8 H;  4H13 B;  1IC2 A;  2OYH C;  2FXO A;  1T6A A;  1NO4 A;  3B8E B;  2BCC D;  3L72 E;  4YXW H;  2Y0C A;  3A0B E;  4WY4 B;  3TGU G;  3D6Y A;  1M90 Q;  4IFF A;  3SFD C;  1BGY D;  3JCU H;  1BGY J;  3FXD A;  2QA4 P;  3Q3D A;  2IFM A;  2W6B A;  2WPV B;  3L70 G;  1CW5 A;  3RBX A;  1NTM D;  1DH3 A;  4K35 A;  1YTZ I;  2D2C C;  3G4S P;  1PGO A;  3AE8 C;  1P84 E;  1LP1 B;  3NMD A;  3HE5 A;  2K9Y A;  1VQP P;  1VQ8 P;  2BEQ D;  3M06 A;  1OW8 A;  3RBZ A;  1AJY A;  3D71 A;  1SQV D;  1PZQ A;  3B5N A;  1N73 A;  1PPJ D;  1KB9 D;  2XND H;  3MGN A;  4Y99 C;  3H1I G;  3CXH I;  3P7K A;  3H1L J;  3UIA A;  3R4Y A;  1EZV G;  3QWO C;  2KIK A;  4H44 D;  3LIE A;  1HJB A;  2YKP A;  1SQX G;  1URQ B;  2H8P D;  2QJK C;  4L76 A;  1SQQ K;  1KIL A;  2UWJ E;  1PP9 E;  2QVA A;  1S5L H;  1YI2 P;  2N9B A;  1RE3 C;  5GTH E;  1L0N K;  3CWB G;  4IL6 H;  3GW6 A;  2YXR B;  3AE3 C;  3KDP B;  5KAI E;  2OYH A;  2Z5H A;  2CPS A;  5H2F H;  1EDK A;  4JF7 A;  4YTP C;  5CCH C;  3OAK A;  1HUC A;  3A7O A;  4D6T D;  5AW3 B;  4H0L B;  3Q2Y A;  1HGZ A;  1CI6 A;  2WTY A;  2K37 A;  4H13 C;  1M56 D;  1KIL E;  3HD7 B;  5APQ A;  4OVN F;  1QL2 A;  4PJ0 E;  1BGY E;  4WY4 C;  1NU1 J;  3WMM 0;  2NZ2 A;  3RK3 D;  1FOS E;  2V7Q J;  2QG4 A;  3JSV C;  2K1A A;  1VQL P;  3VMZ A;  3FGA D;  2GUS A;  1U7M A;  1SQB G;  2ZYD A;  3CL3 D;  3TDK A;  4ASV A;  1BCC G;  5AVS B;  2JR8 A;  2R44 A;  1GK4 A;  1S5L X;  1ZME C;  5E79 H;  1K73 Q;  2O3J A;  1Q81 Q;  3H1L E;  3RK2 D;  2NPS B;  3OA7 A;  3L71 G;  5B5E E;  4IL6 X;  2KSE A;  1DX7 A;  3W67 A;  2E42 A;  1VQ6 P;  1PGJ A;  3O6Q A;  3PJS K;  2ZT9 B;  2C0W A;  2KNC A;  2QSI A;  1SQX J;  2RKL A;  4ZNC A;  4JYB A;  4JBZ A;  4IOI H;  1G1I A;  1LT9 B;  3TSI A;  2IBZ D;  1EZV I;  1JEK A;  2A06 G;  3GF7 A;  1GW3 A;  2XNX A;  2O01 J;  2JKV A;  1URQ C;  1RE3 A;  4N78 D;  5DJU B;  4EDF A;  1BE3 J;  1SP4 A;  2KK7 A;  1DD4 A;  1NTZ K;  3CWB J;  1NKN A;  1OIP A;  1U57 A;  2R5B A;  3V5B A;  2Q3I A;  1NAF A;  3A0B H;  4DZO A;  1LTA C;  4JQ0 D;  3T97 A;  1OW6 A;  3E1I A;  1SFC D;  1URQ D;  2QJY B;  4L73 A;  4H0L C;  2FYU G;  2YMY A;  1NTK J;  4OGQ B;  3CCS P;  5KJ7 D;  2R3C A;  2XKM A;  1NU1 E;  3HD7 C;  5KLV G;  1H88 A;  1VQ7 P;  1P84 H;  4GDO A;  1X8Y A;  5CBN A;  1FZB A;  3H1J D;  1NH4 A;  4OH8 B;  1JM0 A;  1NTM K;  2IYP A;  3OW2 O;  2WSF H;  4AYC A;  2GUV A;  2PFX A;  2WVR A;  1BCC J;  2Y0D A;  4HB1 A;  1LP1 A;  3E1R A;  1SS1 A;  3CX5 I;  2N9Y B;  1Q90 D;  4RJT A;  2IYO A;  1N8R Q;  4C7N B;  2LKM A;  1ZN5 A;  4W80 A;  3L71 J;  1SLQ A;  5TJH A;  4U3F D;  1R8E A;  3L74 D;  3V2P A;  1SQX E;  3HE4 A;  4UB6 E;  2NPS C;  1FZF A;  2WSE H;  2E75 D;  2K3R A;  1R5L A;  2E76 B;  1SFC A;  1URQ A;  3EWK A;  2ZT9 C;  3JC2 2;  5GTH H;  1L0L J;  1BE3 E;  5K5G B;  1KC8 Q;  3A5T A;  4YPC A;  1LT9 C;  4KJM A;  1L0N D;  1QVF O;  5KAI H;  1QGK B;  3CWB E;  1R5S A;  2YKQ A;  5AW6 B;  3M9B A;  1U7J A;  1T8Z A;  2LXC B;  3SWF A;  5AW4 B;  1GTW A;  4XA4 A;  2QEX P;  1FZE A;  3L75 D;  3L72 D;  3L75 J;  4PJ0 H;  1GL2 D;  2QIW A;  2KXP B;  1K8A Q;  3ZDM A;  2FYU J;  2JEE A;  1NTK E;  2ZXE B;  2E74 B;  2C9L Y;  2OYO A;  2QJY C;  2WT7 A;  1KFM A;  3P8C E;  2Q9I A;  3L35 A;  3OJA B;  2FYN B;  1TU3 F;  4OGQ C;  2WPQ A;  4BRY B;  1KMI Z;  4N6J A;  3V2N A;  1BCC E;  3AEA C;  3PLN A;  2GM4 A;  5CCG D;  3Q5S A;  1L4A D;  5B5E H;  4DJG A;  5BVZ A;  1X79 B;  3TNU B;  2YNY A;  3H1H G;  2M8R A;  1IK9 A;  2NRG A;  1YYC A;  3L71 E;  4U7J A;  3S1K A;  3PP5 A;  1OXZ A;  2V4H A;  1SQV G;  2KSJ A;  2PGD A;  4N3Y B;  1GL2 A;  2YO3 A;  4I7Z B;  1GU5 A;  4LLH A;  1L0L E;  4R4L A;  5AVX B;  2WIT A;  1PP9 D;  3VYI A;  2E76 C;  2C9N Y;  3RL0 B;  2WWW A;  1FBM A;  1FZA A;  1K9M Q;  1FJK A;  1ZR4 A;  4WBA A;  2BAS A;  1IFM A;  3IF4 A;  5BU5 A;  1J1D B;  1ZV8 A;  3L75 E;  3Q1M A;  2AEF A;  5CCG A;  1LTJ B;  2IX7 C;  4PV1 D;  1L4A A;  5APY A;  2FYU E;  2J5U A;  2QJP B;  3M0A A;  1KIL D;  2HOD B;  2XDJ A;  2RN0 A;  1HF9 A;  1EQ7 A;  2V7Q H;  3CC7 P;  1KYO I;  2E43 A;  4D6T G;  4NPD A;  1NTK K;  1Q2N A;  2PAJ A;  3VP8 A;  3F89 A;  1YIT P;  3I55 P;  1T2K C;  2E74 C;  2W90 A;  5TIS E;  3FX0 A;  2A45 H;  2P58 A;  4PD4 E;  1G1J A;  2YKO A;  1LWU B;  2FXP A;  1FDO A;  5APW A;  2FYN C;  3CLQ A;  2DW3 A;  3M9H A;  5AW2 B;  3U59 A;  1EXI A;  2ZVO B;  2B88 A;  2E5T A;  1RF1 B;  2FBW C;  3H1H J;  3BAT A;  1IFP A;  1S9K E;  2M3B A;  4C7N A;  4UB6 H;  2YIU B;  3H1L D;  3K5B A;  1H0T A;  2I1K A;  2P7J A;  1D7M A;  2KS1 A;  1HJ0 A;  2D2C D;  3LW5 J;  2QE7 H;  3BRV B;  2O01 H;  1HWT C;  2HPC B;  1HH0 A;  2ZYA A;  1QLE D;  1N7S B;  2E5Y A;  1ZW0 A;  1SQP J;  5AVV B;  3CCV P;  1ZP0 C;  5AVY B;  1JY3 O;  1L0L K;  2KZI A;  1KB9 I;  4I7Z C;  5AW5 B;  1GZL A;  5KLI B;  2IBZ G;  3L73 J;  1LTS C;  2K88 A;  1JTH B;  1X0T A;  3RL0 C;  3AE9 C;  1FDM A;  5KKZ B;  1MV8 A;  2OTK E;  2WMM A;  1M1K Q;  2AEJ A;  3KYQ A;  3TGU D;  3TGU J;  5CMZ A;  1G2C A;  1J1D C;  3GHG B;  2Q5U A;  4WWI A;  1NGM B;  2K9J A;  1LTJ C;  3U1C A;  3AEG C;  4I1L A;  4I6M C;  1NU1 D;  2QJP C;  1FDI A;  3L70 J;  3HTK A;  1Y9B A;  3F5H A;  5CCH D;  2OQQ A;  3N4X A;  1J1E B;  5CBO A;  3SWK A;  1LGH B;  3CXH E;  3CC4 P;  1GDT A;  1A02 F;  1BDD A;  4H13 D;  4AQR D;  2ZFC A;  1LWU C;  1T3U A;  2G8Y A;  1VQM P;  3KXD A;  2M5A A;  2Y0E A;  3L36 A;  3H1H E;  3H1J G;  3R2P A;  3CPW O;  3SSU A;  4WY4 D;  3H1I J;  3A3Y B;  3H1K G;  2OTL P;  2HG5 D;  2Q7C A;  1RF1 C;  1JCD A;  1VF5 B;  2OYI B;  1USE A;  5AW1 B;  3H25 A;  1X9V A;  1SQX D;  2YIU C;  4DT0 A;  1HBW A;  3HUS B;  2H43 A;  3AEF C;  4U3F G;  2Q1K A;  1SQP E;  3MTU E;  3AE1 C;  1VL2 A;  3L74 G;  2BEZ F;  3Q5R A;  1BE3 D;  4Z1M H;  1JMM A;  3G6E P;  1N7S C;  1JO5 A;  1IFD A;  1OVU A;  1PGQ A;  3PTZ A;  3CWB D;  4BXL A;  3L73 E;  1SQQ G;  2Z5I A;  3VMX A;  1GU4 A;  3C1L A;  3EFF K;  2KB7 P;  4WB4 A;  1OWA A;  5CCH A;  1GMJ A;  1JY3 P;  5KLI C;  3PHL A;  1A02 J;  2GA1 A;  4HH2 A;  1L0N G;  3V4W A;  4KT0 J;  1PFI A;  2IBZ I;  1KOR A;  3TGU E;  5APU A;  2Q6Q A;  1JCC A;  5KKZ C;  4LGD E;  1N7S D;  3V2R A;  2WQY C;  4WY4 A;  1NTK D;  1K04 A;  3BCC G;  5TIS H;  2L91 A;  2HOD A;  4LC1 A;  4PD4 H;  3BAS A;  3P8C D;  2H88 C;  5B66 E;  2Q3E A;  1KV4 A;  3L72 G;  3L70 E;  3GHG C;  4GOF A;  1OMI A;  2FXM A;  3E7K A;  1YJW P;  1YHQ P;  1SQB D;  1SQB J;  3B71 A;  3M9Q A;  2ITA A;  3NFQ A;  2M3E A;  2JWA A;  1LWU A;  4W7Y A;  1XTC C;  1XTG B;  1BCC D;  2IZ1 A;  1NWQ A;  3GMA A;  2LXB A;  5BU8 B;  1LT1 A;  2B89 A;  1J1E C;  1KN7 A;  1IZN B;  4H0L D;  1M8O B;  3AEE C;  3GLM A;  3HE5 B;  3H1I E;  1RF1 A;  3CMA P;  3EFG A;  2RMZ A;  3HD7 D;  3L71 D;  4QMA A;  1EZV E;  3CCE P;  4RES B;  4C7R A;  1N73 B;  3KPE A;  4A7P A;  1RE4 C;  2MJZ A;  1PIX A;  1VQO P;  1AVO A;  1NOH A;  1W2B O;  1VF5 C;  3ITK A;  3LID A;  1QL1 A;  1USD A;  2OYI C;  3PRJ A;  2ZYG A;  2HYN A;  1YTZ T;  3NXS A;  1EXJ A;  1KZU B;  5AVQ B;  1N7S A;  1L0L D;  3HUS C;  3CCJ P;  4ZKP A;  1AV1 A;  1UII A;  1UIX A;  2O1K A;  1SQQ J;  3WUT A;  5DJT B;  4L75 A;  2NPS D;  1NTZ G;  5KAF E;  2W6A A;  2HR3 A;  1EDI A;  2ZT9 D;  2OAR A;  2R32 A;  3D6Z A;  4JPZ B;  3BVH A;  2P67 A;  3CME P;  2KLV A;  3RGU A;  2FYU D;  3S9O A;  1EDL A;  2Z4E A;  3BCC J;  3HD7 A;  3GHG A;  1Q82 Q;  2Y9Z A;  5KLV J;  2BCC G;  1RQU A;  1HVV A;  2WPS A;  3CX5 E;  3CXH H;  4YXD C;  1NU1 K;  5AW8 B;  1SQB E;  4PD4 D;  1ZR2 A;  4ZMD A;  3VTP C;  2IZ0 A;  3CC2 P;  2RH0 A;  1BGY G;  4H44 B;  5CJ4 A;  1NTM G;  4XFJ A;  4Y28 J;  2OTJ P;  4EYY Q;  1S9K D;  3H32 B;  3O8Z A;  3LW5 H;  3CCR P;  1Z56 A;  5AW0 B;  1VQ9 P;  4OGQ D;  1RHZ B;  1AFO A;  2NPS A;  1YIJ P;  4JYC A;  2OYI A;  1PPJ G;  3GG2 A;  4K3A A;  1SQX K;  3IFM A;  1P84 I;  4EI2 A;  3HUS A;  1M1J B;  1YBK A;  3H1L G;  2A06 E;  1LT9 A;  2JO1 A;  2KNC B;  2H7H A;  1EC5 A;  3I5C A;  1IK7 A;  1W2E A;  4AUW A;  1MFZ A;  3BRT B;  4L74 A;  3L37 A;  3G71 P;  1SQQ E;  5M1B A;  4BWN A;  2VRS A;  2FY8 A;  1NTZ J;  2IDB A;  2JP3 A;  5GTI E;  3RK3 B;  2FKW B;  1VQK P;  3PH0 A;  1PL5 A;  4HJG H;  4GKG A;  2YXQ B;  5B66 H;  2E76 D;  3MD0 A;  5CHX A;  3FWL A;  3BCC E;  1Q86 Q;  3T97 B;  1OX3 A;  3H6P A;  2KYV A;  2JWD A;  2AEM A;  5KLV E;  3AEB C;  2BCC J;  1M7L A;  3D70 A;  3SFE C;  3AE6 C;  3RL0 g;  1JB0 J;  1OFC X;  4R4M A;  3RK2 B;  1CZQ A;  2J59 M;  5AVU B;  1SQB K;  1ZRT E;  3CXH D;  3AE4 C;  1RQV A;  1YQ4 C;  1SVF A;  1NU1 G;  2N1T B;  3CI9 A;  1NTM J;  1IO4 A;  2W27 A;  4H44 C;  1LTB C;  3H1H D;  1E79 H;  2PP6 A;  4CPG A;  2WSC J;  1KFN A;  1FC2 C;  1T2K D;  2KP8 A;  2FFD B;  2WZ7 A;  2E74 D;  2A45 G;  1SQV J;  2L5G B;  5APT A;  3A2A A;  4I2L C;  3KZI E;  4DCK A;  1H8A A;  1N86 A;  4XE5 B;  1RH5 B;  3HE4 B;  1SQP D;  1JY2 N; 
#chains in the Genus database with same CATH homology
 1SFC A;  1URQ A;  3L4F A;  1FOS F;  1M1J C;  3II6 A;  3V2Q A;  1SFC B;  1JMM A;  1MZ9 A;  1ZLL A;  1RY3 A;  4KHX A;  1N7S C;  1JO5 A;  1JY3 N;  1IFD A;  3A5T A;  1JNM A;  1LT9 C;  2O1J A;  1RF0 A;  3B5N D;  1LTG C;  1CSB A;  2Z5I A;  3VMX A;  1GU4 A;  1KIL C;  2YKQ A;  5AW6 B;  1LTT C;  2WPR A;  1FZC A;  1GD2 E;  2KB7 P;  2XZR A;  4WB4 A;  1OWA A;  5CCH A;  1N7L A;  3M9B A;  2P2U A;  4GIF A;  1JY3 P;  4HYT B;  1GK6 A;  3M91 A;  4IFM A;  4DOJ A;  1A02 J;  1T8Z A;  4HH2 A;  3SWF A;  3V4W A;  4O9B A;  5AW4 B;  1GTW A;  4XA4 A;  2IPP A;  2R5D A;  1LTI C;  5AVT B;  1PFI A;  1FZE A;  1IC2 A;  3RK3 C;  2OYH C;  5APU A;  1GL2 D;  1JCC A;  1NO4 A;  4LGD E;  3B8E B;  1N7S D;  3V2R A;  4WY4 A;  2FYU K;  2QM7 A;  4WY4 B;  2HOD A;  2JEE A;  4LC1 A;  2ZXE B;  3RL0 D;  1FAV A;  2C9L Y;  2QM8 A;  5KLV K;  3BAS A;  3P8C D;  2WT7 A;  3GHG C;  1KFM A;  1MUU A;  3P8C E;  4IFF A;  2Q9I A;  3L35 A;  3OJA B;  2WT7 B;  2FXM A;  2IFM A;  2WPQ A;  2W6B A;  3M9Q A;  2IFN A;  3NFQ A;  1CW5 A;  4N6J A;  1LWU A;  3V2N A;  1DH3 A;  4W7Y A;  1XTC C;  1XTG B;  4EOT A;  3RK2 C;  3P32 A;  1NWQ A;  1YTZ I;  5BU8 B;  1WRG A;  1J1E C;  3NMD A;  3HE5 A;  2GM4 A;  5CCG D;  5APX A;  2N1T C;  1L4A D;  1IFJ A;  3HE5 B;  3TNU A;  1FJP A;  5BVZ A;  3M06 A;  1H89 A;  1RF1 A;  3EFG A;  1X79 B;  3H32 A;  3TNU B;  2YNY A;  3HD7 D;  2M8R A;  3B5N A;  1IK9 A;  1N73 A;  1YYC A;  1HTL C;  3M0D C;  4RES B;  4C7R A;  1N73 B;  1GW4 A;  3MGN A;  4Y99 C;  3KPE A;  2FFD C;  2C0X A;  3PP5 A;  3P7K A;  1OXZ A;  1RE4 C;  3UIA A;  2MJZ A;  2KSJ A;  3SWY A;  1NOH A;  1IFN A;  2A45 I;  3LID A;  1QL1 A;  3LIE A;  2OYI C;  1M1J A;  1HJB A;  2YKP A;  3N7N A;  2J58 A;  2HYN A;  1YTZ T;  3G3Z A;  3NXS A;  4N3Y B;  1GL2 A;  1KZU B;  1URQ B;  2H8P D;  1N7S A;  5AVQ B;  3HUS C;  2N1T D;  2YO3 A;  1GL2 B;  1GU5 A;  2XU6 A;  4B86 A;  4LLH A;  5AVX B;  4IFD K;  1JY2 O;  2WIT A;  5AW7 B;  1SQQ K;  3VYI A;  4ZKP A;  1KIL A;  3VN0 A;  2C9N Y;  2POH A;  3RL0 B;  2O1K A;  2WWW A;  1SFC C;  1FBM A;  1FZA A;  2HLO A;  2N9B A;  1FZC B;  1RE3 C;  2NPS D;  1L0N K;  5AW9 B;  1NKZ B;  1E5W A;  1FJK A;  3KDP B;  5KJ7 C;  1ZR4 A;  2W6A A;  2OYH A;  2Z5H A;  4WBA A;  2CPS A;  5CJ0 A;  2BAS A;  1IFM A;  2I1J A;  2OAR A;  2R32 A;  4JF7 A;  5BU5 A;  3BVH A;  1J1D B;  1LTJ A;  1ZV8 A;  2P67 A;  5CCH C;  3OAK A;  1HUC A;  3A7O A;  2KLV A;  1FU1 A;  4W7Z A;  1LTJ B;  2IX7 C;  5AW3 B;  5CCG A;  1L4A A;  1JUN A;  5APY A;  1NHL A;  1HGZ A;  1CI6 A;  2WTY A;  2Z4E A;  1L4A B;  3NTN A;  3HD7 A;  3M0A A;  1KIL D;  2HOD B;  2XDJ A;  1KQL A;  3GHG A;  1AQ5 A;  3HD7 B;  1EQ7 A;  5APQ A;  2E43 A;  1QL2 A;  1HVV A;  1NTK K;  2WPS A;  2PAJ A;  2HFE D;  4ZKU A;  3U1A A;  3VP8 A;  4WY4 C;  1NU1 K;  5AW8 B;  2CPB A;  1T2K C;  1ZR2 A;  2A45 H;  3VTP C;  3WMM 0;  1G1J A;  2YKO A;  2FYZ A;  3RK3 D;  1LWU B;  1FOS E;  5APW A;  3CLQ A;  5CJ4 A;  3VMZ A;  2GUS A;  2N1T A;  3M9H A;  3CL3 D;  5AW2 B;  3U59 A;  2P1J A;  5AVS B;  1RF1 B;  1S9K D;  3H32 B;  3O8Z A;  3LW5 H;  3M0D A;  3BAT A;  1S9K E;  3B5N B;  2KOG A;  1Z56 A;  1GK4 A;  3TK1 A;  2M3B A;  2FFD A;  5AW0 B;  4C7N A;  1N2D C;  1AFO A;  1SQV K;  2NPS A;  2JJL A;  4JYC A;  3RK2 D;  2NPS B;  3OA7 A;  2I1K A;  2P7J A;  1VPC A;  4EIJ A;  3KQG A;  2OYI A;  1DX7 A;  3BRV B;  2E42 A;  2HPC A;  1SQX K;  3IFM A;  2O01 H;  1HWT C;  1IJD B;  3HUS A;  1M1J B;  2HPC B;  1HH0 A;  2C0W A;  3VP9 A;  1SQP K;  1LT9 A;  4JYB A;  1N7S B;  4M3L A;  1J2J B;  1G1I A;  2H7H A;  3I5C A;  1LT9 B;  1W2E A;  5AVV B;  3TSI A;  4AUW A;  1MFZ A;  5AVY B;  3VMY A;  3BRT B;  1JY3 O;  1KIL B;  1L0L K;  1GW3 A;  2XNX A;  3L37 A;  1URQ C;  1RE3 A;  4N78 D;  1GL2 C;  4N78 E;  1SP4 A;  2VRS A;  5AW5 B;  1NTZ K;  1GZL A;  1JTH A;  1NKN A;  1LTS C;  5KJ7 A;  1JTH B;  3EQ2 A;  3RL0 C;  1RF0 C;  1JY2 P;  5AVR B;  2R5B A;  3V5B A;  3RK3 B;  2OYH B;  1FZC C;  1FDM A;  2Q3I A;  1WT6 A;  2XV5 A;  1NAF A;  2FKW B;  1MV8 A;  5APS A;  4GT1 A;  4GKG A;  3HRN A;  4DZO A;  3KYQ A;  1FZG A;  3MD0 A;  1LTA C;  5CHX A;  3T97 A;  5CMZ A;  3E1I A;  1CI6 B;  1G2C A;  1SFC D;  1URQ D;  3MUD A;  3H6P A;  2KYV A;  1J1D C;  3GHG B;  2Q5U A;  1G2C B;  5KTB A;  1M7L A;  1LTJ C;  1T3J A;  3U1C A;  2YMY A;  5CCG C;  4I1L A;  1L4A C;  5AVW B;  4I6M C;  4C46 A;  5KJ7 D;  1JOC A;  2R3C A;  2XKM A;  3HD7 C;  3RK2 B;  1H88 A;  1CZQ A;  2J59 M;  3HTK A;  5AVU B;  1DEB A;  5CCH D;  3HTK B;  1X8Y A;  3N4X A;  1SQB K;  1J1E B;  1FZB A;  2WSC H;  1NH4 A;  4OH8 B;  1NTM K;  1LGH B;  1SVF A;  2WSF H;  4AYC A;  2N1T B;  1GDT A;  2GUV A;  1A02 F;  3CI9 A;  3MIW A;  1IO4 A;  4AQR D;  2ZFC A;  1LWU C;  1T3U A;  2W27 A;  1LTB C;  2PP6 A;  3L36 A;  1VDF A;  3R2P A;  1KFN A;  4WY4 D;  4Y99 B;  1RE4 A;  1T2K D;  2KP8 A;  2FFD B;  3A3Y B;  2WZ7 A;  4C7N B;  2HG5 D;  3IR9 A;  2A45 G;  3TYY A;  2LKM A;  2Q7C A;  1RF1 C;  1ZN5 A;  1JCD A;  2L5G B;  4W80 A;  5AVZ B;  5APT A;  1SLQ A;  3B5N C;  1IFI A;  3VOP A;  2OYI B;  1N73 C;  3A2A A;  3V4Q A;  5AW1 B;  3V2P A;  4I2L C;  1X9V A;  1HBW A;  3HUS B;  3HE4 A;  5APV A;  2H43 A;  2NPS C;  1FZF A;  1H8A A;  1N86 A;  4XE5 B;  2WSE H;  3HE4 B;  2YO2 A;  3P8M C;  3C9I A;  3MTU E;  1HGV A;  1JY2 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...