4UB6H

Native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
total genus 13
structure length 65
sequence length 65
chains with identical sequence h
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 4ub6H01
3WU2H 3A0HH 1S5LH 3KZIH 4IL6H 4PJ0H 5GTHH 5H2FH 5GTIH 2AXTH 4UB8H 5E79H 5TISH 4UB6H 3JCUH 5B5EH 5KAIH 5KAFH 5B66H 3A0BH
chains in the Genus database with same CATH superfamily
2K3RA 3C1LA 2ZJSE 3BCCE 2OQQA 2Q6QA 1RHZB 5AVVB 3I55P 3G71P 2AEFA 4AUWA 3P7KA 1E5WA 3AEBC 4L73A 1SQBE 2J58A 3L75G 1SQQK 1X0TA 2KB7P 1K04A 4H44D 2O01J 1FOSF 3HE4A 4H0LC 3I56P 1BCCJ 1JCDA 1SQQD 2FYNC 4TLFA 1EDLA 4ZMDA 3H1LG 2BASA 1SQVE 1N73B 3E7KA 3AEGC 3V4WA 1OW8A 1S3JA 2KIKA 1PPJE 1U7MA 3A7OA 1WT6A 3N7NA 3OJAB 4WY4A 4XE5B 4Y99C 3B5ND 1S5LE 3SWFA 2IZ0A 1JUNA 4JYBA 4DZOA 1KQLA 1Q90D 2PAJA 4UB6E 5GTHH 1T2KC 2HYNA 3KPEA 1JCCA 1NO4A 4R4MA 5KAIH 1GD2E 2ZAEB 4LC1A 1RE4A 4IFMA 1OX3A 2N1TB 3H1KG 1GL2D 3TGUG 2FY8A 3A0HH 3MD0A 4WY4B 2G8YA 5L8RJ 2WPSA 2WPQA 1QX8A 3B5NC 5CCGD 5APUA 1FJKA 3RBXA 3CMEP 1KTMA 4BRYA 3FXDA 1KD1Q 1VQ4P 3MIWA 4A7PA 2XDJA 2HPCB 2E75B 1DX7A 1L0LK 5KLIC 1RF0C 1X79B 1L4AB 3C9IA 3TDKA 4YXWH 4H0LD 1MFZA 1SLQA 2JR8A 1JEKA 1E79H 2GA1A 1KFMA 1NH4A 4KJMA 3MP7B 2Z4EA 1GDTA 1QVGO 3KZIH 2PFXA 3V2NA 1EZVD 1KYOD 4HKZH 1JNMA 1M1JA 2M3EA 3L74G 4I1LA 3L36A 3W67A 1EXIA 2Z5IA 1RF1C 4ASVA 3AE5C 3MHVA 2QJYB 1SQPK 1KYOH 1M7LA 2KUBA 2N1TA 1S72P 1LTBC 2K37A 3TYYA 3OAKA 5B66H 1NU1G 4RJTA 3AEDC 3CXHH 3H1IE 1M8OB 4PV1B 5CBNA 1SQBD 1YTZT 2Y0DA 3RK3D 2WT7A 2OTLP 1AFOA 3MUDC 1QEXA 2NRGA 3HD7D 3H1HD 1NTME 4IFDK 3M0DC 1FS0E 1NHLA 3M9BA 4K3AA 2YMKA 2YKQA 1KILA 1LWUA 1NAYA 2H88C 3NXSA 3P32A 3FXEA 1RE3C 3MGNA 2W6JH 3TSIA 1Q81Q 3B5NB 2H7HA 2KS1A 1CW5A 3M91A 3PTZA 2NZ2A 4EYYQ 2JJLA 1AV1A 1JY3N 2QJPB 5KKZB 3RL0C 3WU2E 3LIDA 1HTLC 3RK2B 4ASWA 3L74J 1PIXA 3TGUD 3WUUA 1HBWA 3Q1MA 4C46A 5AVUB 3HUSB 2QG4A 3V4QA 1VQ6P 2I1KA 2M5AB 2OTKE 3CL3D 1SQBJ 1PV3A 1VPCA 2Q9IA 1KILD 1NTZG 1NTKG 1L0ND 1URQC 2E76C 2XV5A 3L71G 3O6QB 4L74A 4DJGA 5KJ7A 2Q3EA 3L73D 1H8AA 2YO3A 3M0DA 1IFJA 2FYZA 1CZQA 3BASA 3M06A 5DJUB 2ZYGA 5AVWB 2KSEA 2QE7H 2QJYC 5AVXB 1SQXG 1FZGA 5TJHA 2P58A 2LXBA 2YO2A 1KMIZ 1ZOYC 3HTKA 1N7SA 1DD4A 1EZVG 2GUVA 1LT1A 2IBZI 1BE3J 2KXPB 3GHGB 2L5GB 3JC22 4PV1C 5H2FE 2JWDA 1K8AQ 1HH0A 3OA7A 1LTJA 4HB1A 2OYIA 1DH3A 1VQPP 1S5LH 3JCUE 2IFMA 2RN0A 4N78D 1FDMA 4DOJA 3B4SA 3HTKB 3IN6A 2CPSA 1YI2P 1K9MQ 3CX5E 5KJ7D 1QLED 3HE5A 5CJ4A 3OW2O 1FZFA 1IFPA 5B5EH 3H1ID 2IDBA 3H1HG 3O8ZA 1U7JA 1WRGA 5EFWB 1PP9G 1IZNB 1S2EA 3RK3E 1SQBK 1J1DC 1EZVI 3BRVB 1KYOI 5AW6B 1URQB 1L0NK 2E76B 1NTMD 3CC4P 2WSEJ 1SFCD 2A45H 5CHXA 5B66E 3BCCG 3H1JG 2IFNA 1GTWA 1NJIQ 2LKMA 3FGAD 1KB9E 2K1AA 1SQVK 4O9BA 1JTHB 4H13B 2FFDC 3CCMP 1J1EC 1USDA 1L0LD 2K88A 4N78E 1FZCC 3D6YA 3A5TA 2IBZD 4JYCA 4D6TG 2HR3A 2WSFH 4W80A 2OARA 3CCRP 3SFEC 2OYHA 5CCHD 1S9KE 2Q5UA 1JY2O 2HFED 3GW6A 4YTPC 1W2BO 2BCCD 3CWBG 1N7LA 2KOGA 2NPSA 1GU5A 5CBOA 1FZAA 2PGDA 1LTJB 2AXTH 2K9JA 3K5BA 3G9RA 2W27A 1SQXD 3AE6C 1P84I 3GG2A 1A02F 5CCHA 1NTMJ 2HLOA 3CCUP 1RQVA 1FBMA 1ZR2A 3V2QA 1K73Q 3CXHE 1KB9D 1TU3F 3H1KJ 3H1LJ 3TGUJ 1PGPA 1HUCA 1L0LE 4GODA 3D71A 3AEEC 1AVOA 3SFDC 2R5DA 4RESB 5KLVD 1KFNA 3GF7A 3VN0A 2POHA 1H89A 1BE3D 1N7SB 3L74E 3M0AA 2E5TA 1RY3A 1GL2B 1IFNA 2QM7A 3HRNA 5APXA 5AVZB 3KYQA 1FAVA 1X8YA 1MUUA 1SQQE 1ZRTD 3E1RA 3L73J 3L37A 3U1AA 1DEBA 1VQOP 4H44B 3M9HA 1PP9J 1SQVD 1ZP0C 3HUSA 4DCKA 3CCQP 2ZYDA 1T8ZA 3L35A 1PPJD 1DD3A 1EC5A 1YQ3C 2ZYAA 2FXPA 3SWYA 3P8MC 2FXMA 3U1CA 1LTTC 3CCSP 4OVNF 4DT0A 3CXHD 5APSA 3QWOC 1HGVA 2M3BA 3W68A 3R2PA 1RF1B 3CCEP 1K05A 3E1IA 1BDCA 3H1JD 1LTIC 1IK9A 1IJDB 2CK3H 3CLQA 1P84D 1LTGC 2P7JA 2HODA 3KDPB 5K5GB 1BE3E 1DEEG 1FJPA 3CCJP 4K35A 1L0LG 5CMZA 3B5NA 1BDDA 1H0TA 3A0HE 1KB9I 2IBZG 2QVAA 4I7ZC 4D6TD 2JDIH 1R8EA 1OVUA 1KQSO 4JBZA 3AE7C 1R5LA 1N7SD 3Q5PA 2FYUK 1SQQG 1W5CE 1SP4A 2W8ZA 1FZEA 2HG5D 2FYUD 5KLVK 2D2CC 2OYOA 3AE9C 3HD7C 2WITA 3AE2C 2LR2A 3T97B 5TISH 3ZDMA 4WBAA 5KKZC 1OW6A 1SQPG 1ZXGA 2AEJA 1NU1J 2IX7C 2M0BA 3C8VA 2C0WA 2K9YA 2WSCJ 3L4FA 4U3FD 1KYOE 3BATA 4UB8E 5APQA 3RK3B 4NPFX 2W83C 1NU1K 2GUSA 3CPWO 1G1JA 2M8RA 3B8EB 1Q2NA 2LXCB 1NOHA 1PGQA 3CXHI 3IFMA 3H1KD 4XA4A 4NPDA 1BE3G 1YBKA 1EDJA 4GDOA 1S9KD 3KZIE 1N8RQ 1VF5B 2JO1A 3GHGA 1VQ8P 1H88A 3AE3C 2MJZA 3FWNA 3A2AA 4BXLA 2QEXP 3FWLA 2XNXA 1GW4A 2OYIB 3HD7A 5AW7B 3RK2C 2YXRB 2ZT9B 3H25A 1SQXE 4C7NB 2K9JB 1Q82Q 2KI7B 1PPJG 2KLVA 2O01H 3VOPA 3VMYA 2R3CA 1NKNA 1OVRA 5AW4B 5BU5A 3WU2H 2KS1B 1M1JB 1JMMA 1KILC 1LWUC 1NTMK 1URQD 2E74D 2E76D 1RF0A 4JQ0D 4U3FE 3R4YA 1W2EA 2FKWB 4H0LB 1IO4A 1PZQA 2JP3A 1PL5A 1T6AA 5CJ0A 5KLVE 5CCGC 3CCVP 1EDKA 2JWAA 5APWA 1NTKK 1JMBA 1IC2A 1NTZK 2C0XA 3H1KE 3H1LE 3PJSK 3L74D 1QL1A 5APVA 3RL0D 3TGUE 2WTYA 3B71A 1L0LJ 3N4XA 3H1JE 2RMZA 2ZVOB 3O6QA 1VQ7P 3NTNA 2H8PD 1RE4C 1JY2P 2HPCA 2QIWA 5AVQB 3GLMA 3CMAP 1T2KD 1KILE 1FZCA 3V2RA 1L0NE 1M90Q 2V4HA 2RKLA 5M1BA 2ZXEB 2ITAA 3L72D 1SQQJ 3L73E 4PJ0H 4UB8H 2W6BA 1PP9E 2FXOA 1OXZA 3CX5H 2B87A 3WUVA 1QVFO 1GZLA 1WMKA 2XU6A 2E5YA 2YMYA 4OGQB 4PD4H 4W7ZA 2O01N 1N2DC 5AVYB 1LP1B 2IZ1A 1KB9H 1SQPD 1UIXA 2OGUA 2YNYA 3MUDA 4TT3H 4U3FG 5DJTB 2C9LY 3CI9A 3HD7B 1R5SA 3U59A 3H1LD 1ZMEC 1RH5B 2E74B 3PRJA 1XTGB 5KLIB 3RGUA 2OTJP 2Y0EA 3PP5A 4AQRD 4D6TJ 3KXDA 1HF9A 1J1DB 3GF3A 5APYA 3EFFK 4JF7A 1Y47A 5TISE 1FDIA 2KK7A 3H6PA 1UIIA 1M1JC 2YIUC 1QL2A 2N9BA 1IFIA 2C9NY 1AA0A 4HH2A 1HWTC 2R44A 1L0NG 2P10A 3L71D 1AJYA 1FE6A 2WSCH 3M9QA 1FZCB 3L73G 3LW5H 4GT1A 2FBWC 2A45I 4YXDC 2IYPA 5B5EE 1VQKP 1M1KQ 1LJ2A 1S4XA 3G3ZA 4R4LA 3S4RA 1VQ5P 1YTZI 2VRSA 3TF5A 1X22A 4CPGA 3CC2P 1H0TB 4EI2A 2ZVNB 3VMZA 2V7QJ 1NU1E 1GW3A 3CC7P 1T3UA 1GL2C 5E79H 3KHUA 2QJPC 2GM4A 1VQLP 2J59M 4I2LC 5GTHE 1N7SC 2N9YB 3IAOA 3PHLA 1N86A 1RE3A 5KAIE 5KAFE 4BRYB 1PFIA 3V2PA 4HJGH 2A45G 1LT9C 3HE4B 5AW1B 3I5CA 4MN4C 4UB6H 3T97A 3L71E 3JSVC 3D6ZA 4WY4D 1P84H 5AVSB 1FDOA 2BCCE 3H32A 1OW7A 1AQTA 3L70E 1VQ9P 1SS1A 1NYHA 1PGOA 2QSIA 4ZKPA 1M56D 2QRXA 2XZRA 4IL6E 3II6A 1XTCC 2E74C 1HVVA 1SQXJ 2XNDH 2A06G 1EQ7A 1BGYJ 1FZBA 1PP9D 4M3LA 1GK6A 3Q5SA 4EDFA 4H44C 1OFCX 1NU1D 4U3FJ 1Z56A 3WMM0 1ZW0A 3RK2D 2W90A 5AVRB 1SQBG 3A0BH 3L75E 1LTAC 4GKGA 2FYNB 1NTKE 1NTZE 5AW8B 2DW3A 1EXJA 1HJ0A 2KYVA 3AEFC 2WVRA 3VP9A 5KLVJ 3F89A 2OYHC 3D70A 1SFCB 1CI6B 3BRTB 3CX5I 4L75A 3BVHA 4I6MC 5C39A 3Q5RA 1AQ5A 3H1JJ 1S5LX 4IFFA 4PD4I 3L72E 1ZV8A 2PRRA 1G2CA 1ZRTE 1FC2C 4N6JA 3VP8A 1ZR4A 1A02J 3AECC 2B89A 2KP8A 3V5BA 2I8DA 1L0NJ 1OWAA 2NPSB 2BCCG 3CWBD 3GHGC 4WB4A 1OVVA 2P2UA 2WQYC 2R5BA 2J5UA 2E75C 4EOTA 1Q7YQ 2KSJA 2YIUB 4ZKUA 1SQPE 1YHQP 1D7MA 2BEQD 1OZHA 4EIJA 1JOCA 2A06E 4NPEA 2D2CD 2B87B 1G1IA 2HODB 1NTKD 1NTZD 2N1TC 1YQ4C 2O3JA 3MTUE 1BCCD 2KNCB 1JTHA 4GOEA 1P84E 4PJ0E 3TNUB 4IL6X 5E79E 2G3AA 1VQMP 4YPCA 1JY3P 2AXCA 2ZXXA 3USSA 4IOIH 3IF4A 4B86A 1LT9A 4OH8B 4H13C 2WSFJ 3JCUH 2M5AA 4KHXA 1L4AC 5KAFH 5KLVG 4D6TE 1VF5C 3KQGA 1IFMA 3LIEA 3H1HJ 3P8CD 3EFGA 4LLHA 3CCLP 1RQUA 2H89C 1YIJP 2QJKC 3H32B 1MFTA 5AW0B 5H2FH 1HJBA 1FU1A 1FOSE 1N73A 3CWBE 1GMJA 3GMAA 1LTJC 1SVFA 2JKVA 3AE4C 2FYUE 2O1KA 2H43A 3A0BE 1NKZB 3BCCJ 4KT0J 4OGQD 4PD4D 1VF5D 5GTIE 1NWQA 1SFCC 3QH9A 1KV4A 4H13D 2A06D 1KILB 1LWUB 2Z5HA 1KQFB 3G6EP 2W6AA 2O1JA 1BGYG 1IFDA 2KLUA 2E43A 3PLNA 1BSHA 1BCCE 1LTSC 4HYTB 2NPSD 2JEEA 2ZT9C 2N1TD 4QMAA 1QGKB 1IK7A 2Q3IA 1G2CB 1SQVJ 2IYOA 2SPZA 3V6IA 5AW3B 5AVTB 1NVOA 3A3YB 2YKPA 5KJ7C 3H1IG 3S1KA 3Q3DA 2E75D 3RL0B 1KC8Q 1JY2N 1Q86Q 2QM8A 4U7JA 1GL2A 1VDFA 3L70D 1NTMG 4JPZB 4XFJA 4GIFA 2OYHB 3AE8C 1OMIA 3BCCD 1SFCA 2YKOA 1OIPA 3L71J 4N3YB 4PD4E 2BCCJ 2V7QH 3VYIA 3CD6P 2KZIA 5APTA 2FYUG 1VQNP 3L70J 1SQXK 3IR9A 2FFDB 2R3SA 1CSBA 2AEMA 2P67A 1ZLLA 1J2JB 1JM0A 1KQGB 3RL0g 1S1CX 2ZT9D 2CPBA 4AYCA 2NPSC 1YYCA 3EQ2A 3L75D 5BU8B 1USEA 1BGYE 1JY3O 1KORA 3HUSC 2Y0CA 2AXTE 5CCGA 1BCCG 1LGHB 2BEZF 5BVZA 5AW2B 1JO5A 4Y99B 2QJKB 1MV8A 1MKMA 1EDIA 2PP6A 2WPRA 3CX5D 5CCHC 3L75J 2QA4P 1M57D 1NTZJ 1NTKJ 4I7ZB 1CI6A 4IL6H 1T3JA 4OGQC 5AW9B 2YXQB 2Q7CA 3RBZA 2UWJE 5GTIH 1N73C 1LNQA 2WSSH 1BSNA 2KNCA 2R32A 3FX0A 4RKUJ 4Y28J 3SSUA 3Q2YA 1YITP 2MKVA 3UIAA 1AVYA 2Y9ZA 1X9VA 2Q1KA 3L72J 4WY4C 1YJ9P 2E42A 2KZJA 3P8CE 1L4AD 2WMMA 1RF1A 2B88A 3VTPC 2D2CB 1KZUB 1EZVE 1HGZA 3ITKA 5AW5B 1PGJA 2RH0A 2FFDA 3ABVC 1URQA 2WPVB 1BGYD 2XKMA 3MZWB 4OWFA 1DIPA 4ZNCA 1SQPJ 4L76A 3S9OA 3PH0A 2IBZE 1ZN5A 3H1IJ 4W7YA 3AEAC 4RO0A 3F5HA 4WWIA 3TNUA 2B9BA 3SWKA 5KTBA 4BWNA 1YJWP 1GU4A 1SQVG 3RK3C 2Y9YA 1LT9B 3HE5B 3G4SP 3TK1A 3WUTA 2WSEH 2P1JA 2I1JA 4C7RA 4C7NA 3NMDA 1NGMB 3VMAA 1U57A 4WVZA 4Z1MH 1J1EB 2IPPA 3VMXA 1JB0J 1Y9BA 2ZFCA 4LGDE 3H1HE 1Y8AA 1GK4A 3L70G 3LW5J 4GOFA 4PV1D 1VL2A 1NAFA 3AE1C 2WWWA 3EWKA 1L4AA 1MZ9A 1L2PA 1LP1A 2WZ7A 3CWBJ 2L91A 3L72G 3NFQA 2WT7B 1YJNP 2OYIC 1KN7A 2FYUJ
chains in the Genus database with same CATH topology
3WU2H 3A0HH 1S5LH 3KZIH 4IL6H 4PJ0H 5GTHH 5H2FH 5GTIH 2AXTH 4UB8H 5E79H 5TISH 4UB6H 3JCUH 5B5EH 5KAIH 5KAFH 5B66H 3A0BH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU2 H;  3A0H H;  1S5L H;  3KZI H;  4IL6 H;  4PJ0 H;  5GTH H;  5H2F H;  5GTI H;  2AXT H;  4UB8 H;  5E79 H;  5TIS H;  4UB6 H;  3JCU H;  5B5E H;  5KAI H;  5KAF H;  5B66 H;  3A0B H; 
#chains in the Genus database with same CATH topology
 2K3R A;  3C1L A;  2ZJS E;  3BCC E;  2OQQ A;  2Q6Q A;  1RHZ B;  5AVV B;  3I55 P;  3G71 P;  2AEF A;  4AUW A;  3P7K A;  1E5W A;  3AEB C;  4L73 A;  1SQB E;  2J58 A;  3L75 G;  1SQQ K;  1X0T A;  2KB7 P;  1K04 A;  4H44 D;  2O01 J;  1FOS F;  3HE4 A;  4H0L C;  3I56 P;  1BCC J;  1JCD A;  1SQQ D;  2FYN C;  4TLF A;  1EDL A;  4ZMD A;  3H1L G;  2BAS A;  1SQV E;  1N73 B;  3E7K A;  3AEG C;  3V4W A;  1OW8 A;  1S3J A;  2KIK A;  1PPJ E;  1U7M A;  3A7O A;  1WT6 A;  3N7N A;  3OJA B;  4WY4 A;  4XE5 B;  4Y99 C;  3B5N D;  1S5L E;  3SWF A;  2IZ0 A;  1JUN A;  4JYB A;  4DZO A;  1KQL A;  1Q90 D;  2PAJ A;  4UB6 E;  5GTH H;  1T2K C;  2HYN A;  3KPE A;  1JCC A;  1NO4 A;  4R4M A;  5KAI H;  1GD2 E;  2ZAE B;  4LC1 A;  1RE4 A;  4IFM A;  1OX3 A;  2N1T B;  3H1K G;  1GL2 D;  3TGU G;  2FY8 A;  3A0H H;  3MD0 A;  4WY4 B;  2G8Y A;  5L8R J;  2WPS A;  2WPQ A;  1QX8 A;  3B5N C;  5CCG D;  5APU A;  1FJK A;  3RBX A;  3CME P;  1KTM A;  4BRY A;  3FXD A;  1KD1 Q;  1VQ4 P;  3MIW A;  4A7P A;  2XDJ A;  2HPC B;  2E75 B;  1DX7 A;  1L0L K;  5KLI C;  1RF0 C;  1X79 B;  1L4A B;  3C9I A;  3TDK A;  4YXW H;  4H0L D;  1MFZ A;  1SLQ A;  2JR8 A;  1JEK A;  1E79 H;  2GA1 A;  1KFM A;  1NH4 A;  4KJM A;  3MP7 B;  2Z4E A;  1GDT A;  1QVG O;  3KZI H;  2PFX A;  3V2N A;  1EZV D;  1KYO D;  4HKZ H;  1JNM A;  1M1J A;  2M3E A;  3L74 G;  4I1L A;  3L36 A;  3W67 A;  1EXI A;  2Z5I A;  1RF1 C;  4ASV A;  3AE5 C;  3MHV A;  2QJY B;  1SQP K;  1KYO H;  1M7L A;  2KUB A;  2N1T A;  1S72 P;  1LTB C;  2K37 A;  3TYY A;  3OAK A;  5B66 H;  1NU1 G;  4RJT A;  3AED C;  3CXH H;  3H1I E;  1M8O B;  4PV1 B;  5CBN A;  1SQB D;  1YTZ T;  2Y0D A;  3RK3 D;  2WT7 A;  2OTL P;  1AFO A;  3MUD C;  1QEX A;  2NRG A;  3HD7 D;  3H1H D;  1NTM E;  4IFD K;  3M0D C;  1FS0 E;  1NHL A;  3M9B A;  4K3A A;  2YMK A;  2YKQ A;  1KIL A;  1LWU A;  1NAY A;  2H88 C;  3NXS A;  3P32 A;  3FXE A;  1RE3 C;  3MGN A;  2W6J H;  3TSI A;  1Q81 Q;  3B5N B;  2H7H A;  2KS1 A;  1CW5 A;  3M91 A;  3PTZ A;  2NZ2 A;  4EYY Q;  2JJL A;  1AV1 A;  1JY3 N;  2QJP B;  5KKZ B;  3RL0 C;  3WU2 E;  3LID A;  1HTL C;  3RK2 B;  4ASW A;  3L74 J;  1PIX A;  3TGU D;  3WUU A;  1HBW A;  3Q1M A;  4C46 A;  5AVU B;  3HUS B;  2QG4 A;  3V4Q A;  1VQ6 P;  2I1K A;  2M5A B;  2OTK E;  3CL3 D;  1SQB J;  1PV3 A;  1VPC A;  2Q9I A;  1KIL D;  1NTZ G;  1NTK G;  1L0N D;  1URQ C;  2E76 C;  2XV5 A;  3L71 G;  3O6Q B;  4L74 A;  4DJG A;  5KJ7 A;  2Q3E A;  3L73 D;  1H8A A;  2YO3 A;  3M0D A;  1IFJ A;  2FYZ A;  1CZQ A;  3BAS A;  3M06 A;  5DJU B;  2ZYG A;  5AVW B;  2KSE A;  2QE7 H;  2QJY C;  5AVX B;  1SQX G;  1FZG A;  5TJH A;  2P58 A;  2LXB A;  2YO2 A;  1KMI Z;  1ZOY C;  3HTK A;  1N7S A;  1DD4 A;  1EZV G;  2GUV A;  1LT1 A;  2IBZ I;  1BE3 J;  2KXP B;  3GHG B;  2L5G B;  3JC2 2;  4PV1 C;  5H2F E;  2JWD A;  1K8A Q;  1HH0 A;  3OA7 A;  1LTJ A;  4HB1 A;  2OYI A;  1DH3 A;  1VQP P;  1S5L H;  3JCU E;  2IFM A;  2RN0 A;  4N78 D;  1FDM A;  4DOJ A;  3B4S A;  3HTK B;  3IN6 A;  2CPS A;  1YI2 P;  1K9M Q;  3CX5 E;  5KJ7 D;  1QLE D;  3HE5 A;  5CJ4 A;  3OW2 O;  1FZF A;  1IFP A;  5B5E H;  3H1I D;  2IDB A;  3H1H G;  3O8Z A;  1U7J A;  1WRG A;  5EFW B;  1PP9 G;  1IZN B;  1S2E A;  3RK3 E;  1SQB K;  1J1D C;  1EZV I;  3BRV B;  1KYO I;  5AW6 B;  1URQ B;  1L0N K;  2E76 B;  1NTM D;  3CC4 P;  2WSE J;  1SFC D;  2A45 H;  5CHX A;  5B66 E;  3BCC G;  3H1J G;  2IFN A;  1GTW A;  1NJI Q;  2LKM A;  3FGA D;  1KB9 E;  2K1A A;  1SQV K;  4O9B A;  1JTH B;  4H13 B;  2FFD C;  3CCM P;  1J1E C;  1USD A;  1L0L D;  2K88 A;  4N78 E;  1FZC C;  3D6Y A;  3A5T A;  2IBZ D;  4JYC A;  4D6T G;  2HR3 A;  2WSF H;  4W80 A;  2OAR A;  3CCR P;  3SFE C;  2OYH A;  5CCH D;  1S9K E;  2Q5U A;  1JY2 O;  2HFE D;  3GW6 A;  4YTP C;  1W2B O;  2BCC D;  3CWB G;  1N7L A;  2KOG A;  2NPS A;  1GU5 A;  5CBO A;  1FZA A;  2PGD A;  1LTJ B;  2AXT H;  2K9J A;  3K5B A;  3G9R A;  2W27 A;  1SQX D;  3AE6 C;  1P84 I;  3GG2 A;  1A02 F;  5CCH A;  1NTM J;  2HLO A;  3CCU P;  1RQV A;  1FBM A;  1ZR2 A;  3V2Q A;  1K73 Q;  3CXH E;  1KB9 D;  1TU3 F;  3H1K J;  3H1L J;  3TGU J;  1PGP A;  1HUC A;  1L0L E;  4GOD A;  3D71 A;  3AEE C;  1AVO A;  3SFD C;  2R5D A;  4RES B;  5KLV D;  1KFN A;  3GF7 A;  3VN0 A;  2POH A;  1H89 A;  1BE3 D;  1N7S B;  3L74 E;  3M0A A;  2E5T A;  1RY3 A;  1GL2 B;  1IFN A;  2QM7 A;  3HRN A;  5APX A;  5AVZ B;  3KYQ A;  1FAV A;  1X8Y A;  1MUU A;  1SQQ E;  1ZRT D;  3E1R A;  3L73 J;  3L37 A;  3U1A A;  1DEB A;  1VQO P;  4H44 B;  3M9H A;  1PP9 J;  1SQV D;  1ZP0 C;  3HUS A;  4DCK A;  3CCQ P;  2ZYD A;  1T8Z A;  3L35 A;  1PPJ D;  1DD3 A;  1EC5 A;  1YQ3 C;  2ZYA A;  2FXP A;  3SWY A;  3P8M C;  2FXM A;  3U1C A;  1LTT C;  3CCS P;  4OVN F;  4DT0 A;  3CXH D;  5APS A;  3QWO C;  1HGV A;  2M3B A;  3W68 A;  3R2P A;  1RF1 B;  3CCE P;  1K05 A;  3E1I A;  1BDC A;  3H1J D;  1LTI C;  1IK9 A;  1IJD B;  2CK3 H;  3CLQ A;  1P84 D;  1LTG C;  2P7J A;  2HOD A;  3KDP B;  5K5G B;  1BE3 E;  1DEE G;  1FJP A;  3CCJ P;  4K35 A;  1L0L G;  5CMZ A;  3B5N A;  1BDD A;  1H0T A;  3A0H E;  1KB9 I;  2IBZ G;  2QVA A;  4I7Z C;  4D6T D;  2JDI H;  1R8E A;  1OVU A;  1KQS O;  4JBZ A;  3AE7 C;  1R5L A;  1N7S D;  3Q5P A;  2FYU K;  1SQQ G;  1W5C E;  1SP4 A;  2W8Z A;  1FZE A;  2HG5 D;  2FYU D;  5KLV K;  2D2C C;  2OYO A;  3AE9 C;  3HD7 C;  2WIT A;  3AE2 C;  2LR2 A;  3T97 B;  5TIS H;  3ZDM A;  4WBA A;  5KKZ C;  1OW6 A;  1SQP G;  1ZXG A;  2AEJ A;  1NU1 J;  2IX7 C;  2M0B A;  3C8V A;  2C0W A;  2K9Y A;  2WSC J;  3L4F A;  4U3F D;  1KYO E;  3BAT A;  4UB8 E;  5APQ A;  3RK3 B;  4NPF X;  2W83 C;  1NU1 K;  2GUS A;  3CPW O;  1G1J A;  2M8R A;  3B8E B;  1Q2N A;  2LXC B;  1NOH A;  1PGQ A;  3CXH I;  3IFM A;  3H1K D;  4XA4 A;  4NPD A;  1BE3 G;  1YBK A;  1EDJ A;  4GDO A;  1S9K D;  3KZI E;  1N8R Q;  1VF5 B;  2JO1 A;  3GHG A;  1VQ8 P;  1H88 A;  3AE3 C;  2MJZ A;  3FWN A;  3A2A A;  4BXL A;  2QEX P;  3FWL A;  2XNX A;  1GW4 A;  2OYI B;  3HD7 A;  5AW7 B;  3RK2 C;  2YXR B;  2ZT9 B;  3H25 A;  1SQX E;  4C7N B;  2K9J B;  1Q82 Q;  2KI7 B;  1PPJ G;  2KLV A;  2O01 H;  3VOP A;  3VMY A;  2R3C A;  1NKN A;  1OVR A;  5AW4 B;  5BU5 A;  3WU2 H;  2KS1 B;  1M1J B;  1JMM A;  1KIL C;  1LWU C;  1NTM K;  1URQ D;  2E74 D;  2E76 D;  1RF0 A;  4JQ0 D;  4U3F E;  3R4Y A;  1W2E A;  2FKW B;  4H0L B;  1IO4 A;  1PZQ A;  2JP3 A;  1PL5 A;  1T6A A;  5CJ0 A;  5KLV E;  5CCG C;  3CCV P;  1EDK A;  2JWA A;  5APW A;  1NTK K;  1JMB A;  1IC2 A;  1NTZ K;  2C0X A;  3H1K E;  3H1L E;  3PJS K;  3L74 D;  1QL1 A;  5APV A;  3RL0 D;  3TGU E;  2WTY A;  3B71 A;  1L0L J;  3N4X A;  3H1J E;  2RMZ A;  2ZVO B;  3O6Q A;  1VQ7 P;  3NTN A;  2H8P D;  1RE4 C;  1JY2 P;  2HPC A;  2QIW A;  5AVQ B;  3GLM A;  3CMA P;  1T2K D;  1KIL E;  1FZC A;  3V2R A;  1L0N E;  1M90 Q;  2V4H A;  2RKL A;  5M1B A;  2ZXE B;  2ITA A;  3L72 D;  1SQQ J;  3L73 E;  4PJ0 H;  4UB8 H;  2W6B A;  1PP9 E;  2FXO A;  1OXZ A;  3CX5 H;  2B87 A;  3WUV A;  1QVF O;  1GZL A;  1WMK A;  2XU6 A;  2E5Y A;  2YMY A;  4OGQ B;  4PD4 H;  4W7Z A;  2O01 N;  1N2D C;  5AVY B;  1LP1 B;  2IZ1 A;  1KB9 H;  1SQP D;  1UIX A;  2OGU A;  2YNY A;  3MUD A;  4TT3 H;  4U3F G;  5DJT B;  2C9L Y;  3CI9 A;  3HD7 B;  1R5S A;  3U59 A;  3H1L D;  1ZME C;  1RH5 B;  2E74 B;  3PRJ A;  1XTG B;  5KLI B;  3RGU A;  2OTJ P;  2Y0E A;  3PP5 A;  4AQR D;  4D6T J;  3KXD A;  1HF9 A;  1J1D B;  3GF3 A;  5APY A;  3EFF K;  4JF7 A;  1Y47 A;  5TIS E;  1FDI A;  2KK7 A;  3H6P A;  1UII A;  1M1J C;  2YIU C;  1QL2 A;  2N9B A;  1IFI A;  2C9N Y;  1AA0 A;  4HH2 A;  1HWT C;  2R44 A;  1L0N G;  2P10 A;  3L71 D;  1AJY A;  1FE6 A;  2WSC H;  3M9Q A;  1FZC B;  3L73 G;  3LW5 H;  4GT1 A;  2FBW C;  2A45 I;  4YXD C;  2IYP A;  5B5E E;  1VQK P;  1M1K Q;  1LJ2 A;  1S4X A;  3G3Z A;  4R4L A;  3S4R A;  1VQ5 P;  1YTZ I;  2VRS A;  3TF5 A;  1X22 A;  4CPG A;  3CC2 P;  1H0T B;  4EI2 A;  2ZVN B;  3VMZ A;  2V7Q J;  1NU1 E;  1GW3 A;  3CC7 P;  1T3U A;  1GL2 C;  5E79 H;  3KHU A;  2QJP C;  2GM4 A;  1VQL P;  2J59 M;  4I2L C;  5GTH E;  1N7S C;  2N9Y B;  3IAO A;  3PHL A;  1N86 A;  1RE3 A;  5KAI E;  5KAF E;  4BRY B;  1PFI A;  3V2P A;  4HJG H;  2A45 G;  1LT9 C;  3HE4 B;  5AW1 B;  3I5C A;  4MN4 C;  4UB6 H;  3T97 A;  3L71 E;  3JSV C;  3D6Z A;  4WY4 D;  1P84 H;  5AVS B;  1FDO A;  2BCC E;  3H32 A;  1OW7 A;  1AQT A;  3L70 E;  1VQ9 P;  1SS1 A;  1NYH A;  1PGO A;  2QSI A;  4ZKP A;  1M56 D;  2QRX A;  2XZR A;  4IL6 E;  3II6 A;  1XTC C;  2E74 C;  1HVV A;  1SQX J;  2XND H;  2A06 G;  1EQ7 A;  1BGY J;  1FZB A;  1PP9 D;  4M3L A;  1GK6 A;  3Q5S A;  4EDF A;  4H44 C;  1OFC X;  1NU1 D;  4U3F J;  1Z56 A;  3WMM 0;  1ZW0 A;  3RK2 D;  2W90 A;  5AVR B;  1SQB G;  3A0B H;  3L75 E;  1LTA C;  4GKG A;  2FYN B;  1NTK E;  1NTZ E;  5AW8 B;  2DW3 A;  1EXJ A;  1HJ0 A;  2KYV A;  3AEF C;  2WVR A;  3VP9 A;  5KLV J;  3F89 A;  2OYH C;  3D70 A;  1SFC B;  1CI6 B;  3BRT B;  3CX5 I;  4L75 A;  3BVH A;  4I6M C;  5C39 A;  3Q5R A;  1AQ5 A;  3H1J J;  1S5L X;  4IFF A;  4PD4 I;  3L72 E;  1ZV8 A;  2PRR A;  1G2C A;  1ZRT E;  1FC2 C;  4N6J A;  3VP8 A;  1ZR4 A;  1A02 J;  3AEC C;  2B89 A;  2KP8 A;  3V5B A;  2I8D A;  1L0N J;  1OWA A;  2NPS B;  2BCC G;  3CWB D;  3GHG C;  4WB4 A;  1OVV A;  2P2U A;  2WQY C;  2R5B A;  2J5U A;  2E75 C;  4EOT A;  1Q7Y Q;  2KSJ A;  2YIU B;  4ZKU A;  1SQP E;  1YHQ P;  1D7M A;  2BEQ D;  1OZH A;  4EIJ A;  1JOC A;  2A06 E;  4NPE A;  2D2C D;  2B87 B;  1G1I A;  2HOD B;  1NTK D;  1NTZ D;  2N1T C;  1YQ4 C;  2O3J A;  3MTU E;  1BCC D;  2KNC B;  1JTH A;  4GOE A;  1P84 E;  4PJ0 E;  3TNU B;  4IL6 X;  5E79 E;  2G3A A;  1VQM P;  4YPC A;  1JY3 P;  2AXC A;  2ZXX A;  3USS A;  4IOI H;  3IF4 A;  4B86 A;  1LT9 A;  4OH8 B;  4H13 C;  2WSF J;  3JCU H;  2M5A A;  4KHX A;  1L4A C;  5KAF H;  5KLV G;  4D6T E;  1VF5 C;  3KQG A;  1IFM A;  3LIE A;  3H1H J;  3P8C D;  3EFG A;  4LLH A;  3CCL P;  1RQU A;  2H89 C;  1YIJ P;  2QJK C;  3H32 B;  1MFT A;  5AW0 B;  5H2F H;  1HJB A;  1FU1 A;  1FOS E;  1N73 A;  3CWB E;  1GMJ A;  3GMA A;  1LTJ C;  1SVF A;  2JKV A;  3AE4 C;  2FYU E;  2O1K A;  2H43 A;  3A0B E;  1NKZ B;  3BCC J;  4KT0 J;  4OGQ D;  4PD4 D;  1VF5 D;  5GTI E;  1NWQ A;  1SFC C;  3QH9 A;  1KV4 A;  4H13 D;  2A06 D;  1KIL B;  1LWU B;  2Z5H A;  1KQF B;  3G6E P;  2W6A A;  2O1J A;  1BGY G;  1IFD A;  2KLU A;  2E43 A;  3PLN A;  1BSH A;  1BCC E;  1LTS C;  4HYT B;  2NPS D;  2JEE A;  2ZT9 C;  2N1T D;  4QMA A;  1QGK B;  1IK7 A;  2Q3I A;  1G2C B;  1SQV J;  2IYO A;  2SPZ A;  3V6I A;  5AW3 B;  5AVT B;  1NVO A;  3A3Y B;  2YKP A;  5KJ7 C;  3H1I G;  3S1K A;  3Q3D A;  2E75 D;  3RL0 B;  1KC8 Q;  1JY2 N;  1Q86 Q;  2QM8 A;  4U7J A;  1GL2 A;  1VDF A;  3L70 D;  1NTM G;  4JPZ B;  4XFJ A;  4GIF A;  2OYH B;  3AE8 C;  1OMI A;  3BCC D;  1SFC A;  2YKO A;  1OIP A;  3L71 J;  4N3Y B;  4PD4 E;  2BCC J;  2V7Q H;  3VYI A;  3CD6 P;  2KZI A;  5APT A;  2FYU G;  1VQN P;  3L70 J;  1SQX K;  3IR9 A;  2FFD B;  2R3S A;  1CSB A;  2AEM A;  2P67 A;  1ZLL A;  1J2J B;  1JM0 A;  1KQG B;  3RL0 g;  1S1C X;  2ZT9 D;  2CPB A;  4AYC A;  2NPS C;  1YYC A;  3EQ2 A;  3L75 D;  5BU8 B;  1USE A;  1BGY E;  1JY3 O;  1KOR A;  3HUS C;  2Y0C A;  2AXT E;  5CCG A;  1BCC G;  1LGH B;  2BEZ F;  5BVZ A;  5AW2 B;  1JO5 A;  4Y99 B;  2QJK B;  1MV8 A;  1MKM A;  1EDI A;  2PP6 A;  2WPR A;  3CX5 D;  5CCH C;  3L75 J;  2QA4 P;  1M57 D;  1NTZ J;  1NTK J;  4I7Z B;  1CI6 A;  4IL6 H;  1T3J A;  4OGQ C;  5AW9 B;  2YXQ B;  2Q7C A;  3RBZ A;  2UWJ E;  5GTI H;  1N73 C;  1LNQ A;  2WSS H;  1BSN A;  2KNC A;  2R32 A;  3FX0 A;  4RKU J;  4Y28 J;  3SSU A;  3Q2Y A;  1YIT P;  2MKV A;  3UIA A;  1AVY A;  2Y9Z A;  1X9V A;  2Q1K A;  3L72 J;  4WY4 C;  1YJ9 P;  2E42 A;  2KZJ A;  3P8C E;  1L4A D;  2WMM A;  1RF1 A;  2B88 A;  3VTP C;  2D2C B;  1KZU B;  1EZV E;  1HGZ A;  3ITK A;  5AW5 B;  1PGJ A;  2RH0 A;  2FFD A;  3ABV C;  1URQ A;  2WPV B;  1BGY D;  2XKM A;  3MZW B;  4OWF A;  1DIP A;  4ZNC A;  1SQP J;  4L76 A;  3S9O A;  3PH0 A;  2IBZ E;  1ZN5 A;  3H1I J;  4W7Y A;  3AEA C;  4RO0 A;  3F5H A;  4WWI A;  3TNU A;  2B9B A;  3SWK A;  5KTB A;  4BWN A;  1YJW P;  1GU4 A;  1SQV G;  3RK3 C;  2Y9Y A;  1LT9 B;  3HE5 B;  3G4S P;  3TK1 A;  3WUT A;  2WSE H;  2P1J A;  2I1J A;  4C7R A;  4C7N A;  3NMD A;  1NGM B;  3VMA A;  1U57 A;  4WVZ A;  4Z1M H;  1J1E B;  2IPP A;  3VMX A;  1JB0 J;  1Y9B A;  2ZFC A;  4LGD E;  3H1H E;  1Y8A A;  1GK4 A;  3L70 G;  3LW5 J;  4GOF A;  4PV1 D;  1VL2 A;  1NAF A;  3AE1 C;  2WWW A;  3EWK A;  1L4A A;  1MZ9 A;  1L2P A;  1LP1 A;  2WZ7 A;  3CWB J;  2L91 A;  3L72 G;  3NFQ A;  2WT7 B;  1YJN P;  2OYI C;  1KN7 A;  2FYU J; 
#chains in the Genus database with same CATH homology
 3WU2 H;  3A0H H;  1S5L H;  3KZI H;  4IL6 H;  4PJ0 H;  5GTH H;  5H2F H;  5GTI H;  2AXT H;  4UB8 H;  5E79 H;  5TIS H;  4UB6 H;  3JCU H;  5B5E H;  5KAI H;  5KAF H;  5B66 H;  3A0B H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...