4UB6H

Native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
b'ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 13
structure length 65
sequence length 65
chains with identical sequence h
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 4ub6H01
4UB8H 5E79H 4IL6H 5TISH 5B66H 3KZIH 3A0HH 5B5EH 1S5LH 5GTHH 5GTIH 5KAIH 3A0BH 4UB6H 3JCUH 5H2FH 4PJ0H 5KAFH 2AXTH 3WU2H
chains in the Genus database with same CATH superfamily
2RN0A 2IBZI 4KHXA 3L74J 1NU1D 3USSA 1EXJA 2L91A 2I1JA 1E5WA 4UB6H 1SQVK 1GU4A 2GUVA 1NVOA 1NKNA 4DT0A 3OW2O 1NTZE 4WY4A 1J2JB 2WSCH 1GDTA 2K9JA 4JBZA 3TF5A 1VQ7P 3H1LJ 1KILA 2QJYC 1VL2A 2JEEA 2XZRA 2JWDA 4WY4B 3H32A 2K9JB 1OWAA 4DOJA 2AEJA 1JMMA 2N1TA 1KILB 2AXTH 1RH5B 1RE4A 2IFMA 1RQUA 2AXCA 3H32B 4RKUJ 3TGUE 1FJKA 1SQQK 1VQPP 2O01H 1BE3J 2PAJA 2N1TB 4UB8E 5AW4B 1L4AA 1RHZB 2Q1KA 2QEXP 3CCLP 4AYCA 2KK7A 4PD4H 2R44A 5AVVB 3RL0C 3L72D 3L73G 2FYNC 3EFFK 3RBXA 1L4AB 1JOCA 3L71J 5CBOA 1H0TA 1NTZJ 1URQC 1FZCC 4K35A 1JY3O 4IFMA 1FE6A 1RF0A 1VQ4P 1IZNB 1NH4A 2JP3A 2E74C 2KXPB 4IFDK 4R4MA 2E75C 1CW5A 5APVA 3Q3DA 3C8VA 1YITP 1PP9J 2NPSD 2AEMA 5KTBA 2M3EA 3MUDC 2KZIA 2C0XA 1RE3A 3GG2A 3I56P 2WSEJ 1EQ7A 1BDDA 2JO1A 1FZFA 3L73E 5KLIC 2M5AA 3AE2C 4AQRD 2QJKB 3BVHA 3G9RA 1YBKA 1VQ9P 4H13C 2A06D 1VQMP 4I2LC 2WSFH 2P67A 3P32A 1QVGO 1MV8A 1FOSF 1R8EA 1HF9A 2DW3A 3B8EB 2O1KA 3BCCD 1X79B 1HH0A 3SWFA 1SQXG 1SVFA 2G3AA 4ZKPA 1GL2C 4I7ZB 1FJPA 1P84D 1HVVA 4L74A 1ZR2A 2W8ZA 1KB9D 1G1JA 4ZMDA 4NPEA 3HUSC 3W67A 1KFNA 1VQLP 2BCCE 3CCJP 4N3YB 1M1JB 1BDCA 1S5LE 4U3FE 1FS0E 4PV1D 1RQVA 1IFNA 4EDFA 2YNYA 5BU5A 2QVAA 1FZEA 5CCHA 1OXZA 3KQGA 3H1HD 3M0DA 2CK3H 3H1JG 3CWBD 2NPSA 1YJNP 3OA7A 1SQXE 2YKPA 4UB6E 3CX5D 1QLED 1OIPA 2H88C 1ZV8A 5CBNA 1PPJG 3B5NB 2ZT9D 1QVFO 2B9BA 2KSJA 1SQPJ 1ZN5A 2ZYGA 5CCGD 1ZRTE 2E74D 3L72J 4QMAA 2E75D 2QJPB 4YXWH 1NTMD 1IFIA 1YJWP 1SQXK 3PH0A 3RK2D 4GKGA 3H1IG 1XTGB 2BCCJ 3CCVP 3TNUA 3H1JE 3V2QA 1NWQA 1ZOYC 2V7QJ 2VRSA 1N7SD 5KAFE 3AE4C 2AXTE 3W68A 1H88A 3P7KA 4WB4A 1QL1A 1FZGA 4B86A 4W80A 3TNUB 1OVRA 1OW7A 1H8AA 3VYIA 3H1KD 1WMKA 1ZR4A 1N86A 2KLVA 2D2CC 3PJSK 3FX0A 4PD4E 2C9NY 5GTHH 1XTCC 1G2CA 1AQ5A 1IFMA 4M3LA 4HB1A 5AW7B 2K1AA 1L0NG 3AEGC 3H1IE 4N78E 5AW9B 4PV1B 1GL2D 1ZP0C 1K05A 2C0WA 1JCDA 2WSCJ 1G2CB 1J1EB 2Q3IA 5KLVD 3A7OA 1VDFA 3KDPB 2RH0A 3M06A 3BATA 1NJIQ 2H8PD 1BCCE 5L8RJ 2Y9YA 1VQNP 1EZVG 3B4SA 2HODA 5CHXA 5CCGA 2P2UA 3HD7A 5B5EH 2ZT9B 2IX7C 3PP5A 2Z4EA 1SQBJ 1VF5C 3H1LD 1JNMA 1L0NE 2O01J 4YPCA 1NKZB 2WPQA 4XFJA 2JDIH 3HD7B 1N7SA 2G8YA 3L70E 1JTHA 1L0LJ 1EDLA 1LTIC 3RK2B 3H1HJ 3P8CE 1S9KE 3CWBJ 3CC7P 1N7SB 1Q7YQ 1PIXA 2JWAA 1JTHB 4W7ZA 3CMAP 1EZVE 1N73A 1AV1A 3CXHI 4LGDE 1L0NK 1BE3D 3B71A 3IAOA 1FU1A 1LWUA 5DJUB 4GDOA 3NMDA 2LXBA 1M57D 3A5TA 2KSEA 3V4WA 1N73B 2H43A 3RK3E 1BCCJ 2Q7CA 3D71A 1GL2A 1AVOA 1Y8AA 1LWUB 1IC2A 1LGHB 1NTMJ 2B87A 1NTZD 3CMEP 3NFQA 3TDKA 5CJ4A 1VQ8P 2FYUG 3AEFC 2QIWA 3C9IA 2B87B 1RF1A 1BGYG 1NTKG 2WITA 4NPFX 2WSFJ 3RL0g 1LT9C 3CC4P 2B89A 2LXCB 3BRVB 3HE4B 1U57A 1DEEG 1RF1B 1P84I 3S4RA 2BEZF 3PLNA 1LJ2A 1SQVE 2BASA 3TGUD 1K73Q 3LW5H 2JJLA 3M9QA 3K5BA 3V2PA 4ZKUA 1FZBA 1K8AQ 3KHUA 3MP7B 5AVSB 5TISE 4Y99B 5TJHA 3VMAA 1J1DB 2IYOA 2P58A 5APYA 2FFDA 3A2AA 2XU6A 3L75J 3L71G 1HJ0A 1DEBA 3OAKA 2Q6QA 1FZAA 2ZYAA 5AW5B 3M0AA 5APQA 1BGYE 1NTKE 2QE7H 4R4LA 5KLVJ 3CXHH 2YIUC 2FFDB 3H6PA 1M1KQ 2QSIA 1PZQA 2PFXA 2M8RA 3CX5I 2QM7A 3GHGA 1M7LA 2YKQA 1A02J 1YIJP 4XA4A 1PP9G 1KN7A 4TT3H 3AE1C 2WQYC 1S72P 1NO4A 3GF7A 1SQQE 3V4QA 2FYUK 5GTHE 3GHGB 1Q86Q 1NTKK 2WZ7A 5APTA 3AE9C 2WPRA 1MUUA 5APXA 3IFMA 3IR9A 1JB0J 2OYIA 1SQVJ 3CCRP 1KILE 1SP4A 3JCUH 4A7PA 5KAFH 1UIIA 3CI9A 5AW0B 3S1KA 1NU1G 3G3ZA 3GLMA 4OWFA 2LR2A 4H0LD 4IL6X 2OYIB 3I55P 2MJZA 1EZVI 3L35A 1P84H 2IDBA 1SQPD 5B5EE 5AW2B 1DH3A 2O3JA 2BEQD 3MHVA 1HTLC 3HE5A 5AVRB 3M91A 1OW8A 2WMMA 1UIXA 2ITAA 1T8ZA 3V6IA 1VQ6P 1S3JA 2KZJA 1GW3A 2BCCD 2E76B 1QX8A 1X8YA 1YJ9P 3HE5B 2OYHC 3QWOC 1SQQJ 2K9YA 3RGUA 2SPZA 1NU1E 4U3FD 2J59M 1KYOI 5B66H 4GIFA 2OARA 1H0TB 2J58A 2QM8A 4OGQD 1YI2P 1KORA 3CX5H 2FBWC 4WBAA 4JYBA 3O8ZA 2Y0CA 1HWTC 4EYYQ 1LTJC 4H44C 2Y0EA 1SQXD 2YKOA 3TGUJ 5DJTB 1NU1K 1OVUA 2CPBA 3KXDA 1SFCC 3MD0A 1OFCX 2O01N 2XNDH 2UWJE 2ZVOB 2M5AB 2N9YB 1ZRTD 4C7NA 1QL2A 2W6AA 3UIAA 2YMKA 2P1JA 3Q1MA 5KKZB 1USDA 1FDIA 4GOFA 4D6TG 3H1JD 1Y47A 4H0LB 4C7NB 1DIPA 3RK3C 3U59A 5GTIH 1T3UA 4EOTA 1SQBD 4HH2A 2FXPA 3A3YB 2B88A 1YTZI 1AA0A 2FXOA 3G4SP 4OVNF 2QG4A 3MTUE 2ZXXA 4IL6H 1CZQA 3VTPC 1IFJA 1GK6A 2KP8A 1L0LD 2POHA 3NTNA 1DX7A 4PD4D 3L73J 2A06G 1KYOH 1TU3F 5AVZB 1R5LA 3CCEP 4JQ0D 3OJAB 4N78D 4D6TE 2IZ0A 2IBZD 3CXHE 3RL0D 4ASWA 3VP8A 3BCCG 3Q5PA 3A0HH 4OGQB 1SS1A 3LIDA 1URQD 1VQKP 3KZIE 2NPSB 2O1JA 3G6EP 5AVXB 1GD2E 4WWIA 1YQ4C 5AVWB 1BCCD 3F5HA 3N7NA 4L73A 2CPSA 5TISH 2IFNA 2P10A 3MIWA 2XDJA 3IF4A 3EWKA 1PGQA 2K3RA 2HYNA 1YTZT 3LW5J 2NZ2A 3JCUE 4H44D 4U3FJ 3L36A 1FC2C 1LTSC 3H1HG 3N4XA 4BRYA 3L70D 4Z1MH 3HRNA 5M1BA 3CWBG 1PPJE 1JY2N 3D6ZA 1JY3P 3P8CD 4H13D 3PHLA 1W5CE 1S9KD 3AE6C 2QJYB 1P84E 3AE3C 4WY4C 1SQXJ 1NAFA 2JKVA 2W83C 5AVYB 2RKLA 4CPGA 1KILC 1K04A 5EFWB 1FBMA 1FDMA 5APSA 3WU2H 2A45I 1M90Q 5APUA 3L75D 3D70A 2PP6A 1GMJA 3VMYA 3ZDMA 3GF3A 2N1TC 3CCMP 3A0BH 3AE7C 2WT7A 4KJMA 3R2PA 3SFDC 5B66E 1RE4C 1YYCA 1URQA 1FZCA 3CX5E 3E1RA 1T6AA 5AW8B 5E79H 3H1JJ 3RL0B 1KQLA 3AE5C 2FYNB 3CC2P 1AVYA 1L4AC 3G71P 1S5LX 2WT7B 2E5YA 4ZNCA 1T2KC 1FZCB 1URQB 3H1KG 4JPZB 3AEAC 3VP9A 1KD1Q 2OTLP 1SLQA 2GA1A 3VMZA 2HODB 4JYCA 3MUDA 4I6MC 2E74B 2E75B 3JSVC 2ZAEB 5AVUB 2MKVA 1SQVD 5KAIH 1NOHA 3II6A 2KUBA 1RF0C 3SWYA 3E7KA 3L74G 3H1IJ 2ZVNB 1K9MQ 4IFFA 1T3JA 1HBWA 5KLIB 2QJKC 3P8MC 3MGNA 1RE3C 4H13B 5GTIE 1QGKB 2A45H 2FXMA 3H1LG 2L5GB 4IL6E 2KI7B 4LC1A 1JCCA 2HPCA 3HUSA 3CCQP 2JR8A 3ABVC 1SQQD 1ZW0A 2Z5HA 1Q82Q 1KYOE 3L74E 5BVZA 1GL2B 1L0NJ 4I7ZC 2D2CD 3U1AA 4NPDA 4GODA 2C9LY 2H89C 3L70J 2HPCB 3HUSB 4O9BA 2YMYA 5K5GB 1IO4A 1M1JC 3A0HE 3NXSA 1BE3G 4IOIH 3CCUP 3FXDA 4DJGA 4Y28J 1KB9I 5KJ7C 2OTKE 2W6JH 3C1LA 3VOPA 4OH8B 1KFMA 1HJBA 1OMIA 3Q5SA 1A02F 3E1IA 2ZJSE 1USEA 2WPSA 2Q5UA 5CCHC 1NTZG 2V7QH 2FYUE 3B5NC 1FAVA 3M0DC 3L37A 4RO0A 1VF5D 2J5UA 2KOGA 2WSSH 3AEDC 1Q2NA 1EXIA 5AVTB 1OVVA 1BE3E 1KQFB 1GW4A 1VQOP 2QJPC 3KZIH 3F89A 2Q3EA 1IJDB 4C46A 4LLHA 4L75A 4GT1A 3FXEA 1IK7A 1PV3A 3TGUG 4DZOA 3L71E 3WU2E 2KLUA 2PRRA 3L73D 3SWKA 3AECC 1S2EA 1CI6A 2R3CA 4RJTA 3TYYA 3FGAD 3A0BE 4HKZH 2P7JA 2D2CB 5AW3B 1G1IA 5CMZA 1KTMA 3KPEA 1YQ3C 2HG5D 1HUCA 1U7MA 1CI6B 5E79E 1PP9E 2FYUJ 1EDKA 1JMBA 1PGOA 1BGYJ 1KQGB 1NTKJ 2V4HA 1GK4A 3VMXA 2IZ1A 1KB9H 1NTZK 3CL3D 3FWNA 3GW6A 4PV1C 3TSIA 3KYQA 3U1CA 1J1EC 1W2EA 1KMIZ 2W6BA 3CD6P 2A45G 2LKMA 5KAIE 2IYPA 2KS1A 3R4YA 3QH9A 5KJ7D 2ZT9C 1X22A 1VF5B 1LTBC 2KS1B 1IFDA 3AEEC 4YTPC 1D7MA 5BU8B 2KNCA 2I1KA 1HGZA 5CCGC 4HJGH 3HD7C 4D6TD 5CCHD 3CXHD 2E42A 2KB7P 1LT1A 3VN0A 1FOSE 3BRTB 3B5ND 1SQPG 3L4FA 3RK2C 5AW6B 4K3AA 1PL5A 4L76A 2QRXA 2KNCB 3L72G 4BXLA 1GZLA 1N7SC 2XNXA 3BASA 4YXDC 3H25A 2AEFA 1ZLLA 2R32A 2R3SA 1JY2O 2FYZA 2BCCG 2WPVB 1MFZA 1L2PA 1PGJA 4I1LA 1VQ5P 4U3FG 2YXRB 2R5DA 3JC22 4EI2A 1N73C 2XV5A 1NU1J 4W7YA 1MZ9A 1LWUC 2RMZA 2YXQB 1SQPE 1PPJD 4WVZA 1HGVA 1LT9A 3WUTA 4N6JA 1M8OB 1VPCA 1M1JA 3L72E 1N2DC 4TLFA 1AJYA 4C7RA 2W27A 1LT9B 5KJ7A 2QA4P 4GOEA 2KIKA 1Q90D 3D6YA 2Y9ZA 3H1ID 1GU5A 1SQPK 2GM4A 4PJ0E 1RF1C 1NYHA 4MN4C 2YO2A 3V5BA 1DD4A 5C39A 3B5NA 3FWLA 2GUSA 2YO3A 4Y99C 1J1DC 5H2FH 2Y0DA 1JY3N 1JEKA 1S1CX 1SQBG 1Q81Q 1NGMB 1JUNA 3IN6A 2YIUB 2A06E 1AFOA 3WUUA 2FFDC 1OZHA 2WTYA 1L0LG 1L0ND 3HD7D 5AW1B 2HR3A 3TK1A 1KZUB 3I5CA 3BCCE 4BWNA 3EFGA 2ZFCA 3LIEA 4ASVA 2IBZG 5AVQB 4U7JA 3GHGC 3M9BA 2KYVA 1RY3A 1SFCD 1NAYA 4AUWA 1E79H 1KB9E 5APWA 4BRYB 4D6TJ 1KC8Q 1EZVD 1SQBE 1N7LA 2HLOA 2M0BA 1BCCG 1OX3A 2E43A 1JM0A 3T97A 1QEXA 3V2RA 4JF7A 1NTMG 2ZYDA 1L0LE 4EIJA 4DCKA 2OYIC 2FKWB 2R5BA 3RK3D 3O6QA 3H1HE 3T97B 3CWBE 2IBZE 1SQBK 1MFTA 3PRJA 3ITKA 2WVRA 1EC5A 2OYHA 3L70G 1PGPA 1KYOD 3L74D 1LTAC 4RESB 3O6QB 1JY2P 2E5TA 3CLQA 2WSEH 3BCCJ 4HYTB 1L0LK 2ZXEB 2E76C 3EQ2A 1DD3A 2OYHB 3GMAA 4UB8H 2Q9IA 1H89A 2K37A 1NTME 2OYOA 1LTJA 1KQSO 1M56D 2K88A 2M3BA 3L75G 1EDJA 1U7JA 1YHQP 3WUVA 2FY8A 1WT6A 1LTJB 1EDIA 4H44B 1LTTC 1SFCA 5KLVG 4KT0J 2HFED 2OGUA 2FYUD 3M9HA 3MZWB 2Z5IA 1BGYD 1NTKD 1W2BO 1NTMK 3CCSP 3H1KE 2W90A 3S9OA 1MKMA 3PTZA 1SFCB 1X0TA 1CSBA 1BSHA 1NHLA 1IK9A 3WMM0 1ZXGA 1Z56A 3V2NA 5KKZC 3L75E 2OQQA 2PGDA 1AQTA 4H0LC 1R5SA 1SQVG 4WY4D 3RK3B 3L71D 5KLVE 2H7HA 1FDOA 3Q5RA 4XE5B 2I8DA 3HTKA 3SFEC 1KILD 3RBZA 1ZMEC 1WRGA 1Y9BA 2WWWA 5H2FE 3HE4A 5CJ0A 1OW6A 1KV4A 1LNQA 1S4XA 3HTKB 2N1TD 1GTWA 1LP1A 3H1LE 1PP9D 3AEBC 1LTGC 2OTJP 3CPWO 3Q2YA 2XKMA 5KLVK 1IFPA 3H1KJ 1JO5A 1X9VA 1N8RQ 1LP1B 1L4AD 2N9BA 4OGQC 1BSNA 1S5LH 4PD4I 3SSUA 2NRGA 1SQQG 1T2KD 2NPSC 2IPPA 1PFIA 4PJ0H 3AE8C 2E76D
chains in the Genus database with same CATH topology
4UB8H 5E79H 4IL6H 5TISH 5B66H 3KZIH 3A0HH 5B5EH 1S5LH 5GTHH 5GTIH 5KAIH 3A0BH 4UB6H 3JCUH 5H2FH 4PJ0H 5KAFH 2AXTH 3WU2H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB8 H;  5E79 H;  4IL6 H;  5TIS H;  5B66 H;  3KZI H;  3A0H H;  5B5E H;  1S5L H;  5GTH H;  5GTI H;  5KAI H;  3A0B H;  4UB6 H;  3JCU H;  5H2F H;  4PJ0 H;  5KAF H;  2AXT H;  3WU2 H; 
#chains in the Genus database with same CATH topology
 2RN0 A;  2IBZ I;  4KHX A;  3L74 J;  1NU1 D;  3USS A;  1EXJ A;  2L91 A;  2I1J A;  1E5W A;  4UB6 H;  1SQV K;  1GU4 A;  2GUV A;  1NVO A;  1NKN A;  4DT0 A;  3OW2 O;  1NTZ E;  4WY4 A;  1J2J B;  2WSC H;  1GDT A;  2K9J A;  4JBZ A;  3TF5 A;  1VQ7 P;  3H1L J;  1KIL A;  2QJY C;  1VL2 A;  2JEE A;  2XZR A;  2JWD A;  4WY4 B;  3H32 A;  2K9J B;  1OWA A;  4DOJ A;  2AEJ A;  1JMM A;  2N1T A;  1KIL B;  2AXT H;  1RH5 B;  1RE4 A;  2IFM A;  1RQU A;  2AXC A;  3H32 B;  4RKU J;  3TGU E;  1FJK A;  1SQQ K;  1VQP P;  2O01 H;  1BE3 J;  2PAJ A;  2N1T B;  4UB8 E;  5AW4 B;  1L4A A;  1RHZ B;  2Q1K A;  2QEX P;  3CCL P;  4AYC A;  2KK7 A;  4PD4 H;  2R44 A;  5AVV B;  3RL0 C;  3L72 D;  3L73 G;  2FYN C;  3EFF K;  3RBX A;  1L4A B;  1JOC A;  3L71 J;  5CBO A;  1H0T A;  1NTZ J;  1URQ C;  1FZC C;  4K35 A;  1JY3 O;  4IFM A;  1FE6 A;  1RF0 A;  1VQ4 P;  1IZN B;  1NH4 A;  2JP3 A;  2E74 C;  2KXP B;  4IFD K;  4R4M A;  2E75 C;  1CW5 A;  5APV A;  3Q3D A;  3C8V A;  1YIT P;  1PP9 J;  2NPS D;  2AEM A;  5KTB A;  2M3E A;  3MUD C;  2KZI A;  2C0X A;  1RE3 A;  3GG2 A;  3I56 P;  2WSE J;  1EQ7 A;  1BDD A;  2JO1 A;  1FZF A;  3L73 E;  5KLI C;  2M5A A;  3AE2 C;  4AQR D;  2QJK B;  3BVH A;  3G9R A;  1YBK A;  1VQ9 P;  4H13 C;  2A06 D;  1VQM P;  4I2L C;  2WSF H;  2P67 A;  3P32 A;  1QVG O;  1MV8 A;  1FOS F;  1R8E A;  1HF9 A;  2DW3 A;  3B8E B;  2O1K A;  3BCC D;  1X79 B;  1HH0 A;  3SWF A;  1SQX G;  1SVF A;  2G3A A;  4ZKP A;  1GL2 C;  4I7Z B;  1FJP A;  1P84 D;  1HVV A;  4L74 A;  1ZR2 A;  2W8Z A;  1KB9 D;  1G1J A;  4ZMD A;  4NPE A;  3HUS C;  3W67 A;  1KFN A;  1VQL P;  2BCC E;  3CCJ P;  4N3Y B;  1M1J B;  1BDC A;  1S5L E;  4U3F E;  1FS0 E;  4PV1 D;  1RQV A;  1IFN A;  4EDF A;  2YNY A;  5BU5 A;  2QVA A;  1FZE A;  5CCH A;  1OXZ A;  3KQG A;  3H1H D;  3M0D A;  2CK3 H;  3H1J G;  3CWB D;  2NPS A;  1YJN P;  3OA7 A;  1SQX E;  2YKP A;  4UB6 E;  3CX5 D;  1QLE D;  1OIP A;  2H88 C;  1ZV8 A;  5CBN A;  1PPJ G;  3B5N B;  2ZT9 D;  1QVF O;  2B9B A;  2KSJ A;  1SQP J;  1ZN5 A;  2ZYG A;  5CCG D;  1ZRT E;  2E74 D;  3L72 J;  4QMA A;  2E75 D;  2QJP B;  4YXW H;  1NTM D;  1IFI A;  1YJW P;  1SQX K;  3PH0 A;  3RK2 D;  4GKG A;  3H1I G;  1XTG B;  2BCC J;  3CCV P;  3TNU A;  3H1J E;  3V2Q A;  1NWQ A;  1ZOY C;  2V7Q J;  2VRS A;  1N7S D;  5KAF E;  3AE4 C;  2AXT E;  3W68 A;  1H88 A;  3P7K A;  4WB4 A;  1QL1 A;  1FZG A;  4B86 A;  4W80 A;  3TNU B;  1OVR A;  1OW7 A;  1H8A A;  3VYI A;  3H1K D;  1WMK A;  1ZR4 A;  1N86 A;  2KLV A;  2D2C C;  3PJS K;  3FX0 A;  4PD4 E;  2C9N Y;  5GTH H;  1XTC C;  1G2C A;  1AQ5 A;  1IFM A;  4M3L A;  4HB1 A;  5AW7 B;  2K1A A;  1L0N G;  3AEG C;  3H1I E;  4N78 E;  5AW9 B;  4PV1 B;  1GL2 D;  1ZP0 C;  1K05 A;  2C0W A;  1JCD A;  2WSC J;  1G2C B;  1J1E B;  2Q3I A;  5KLV D;  3A7O A;  1VDF A;  3KDP B;  2RH0 A;  3M06 A;  3BAT A;  1NJI Q;  2H8P D;  1BCC E;  5L8R J;  2Y9Y A;  1VQN P;  1EZV G;  3B4S A;  2HOD A;  5CHX A;  5CCG A;  2P2U A;  3HD7 A;  5B5E H;  2ZT9 B;  2IX7 C;  3PP5 A;  2Z4E A;  1SQB J;  1VF5 C;  3H1L D;  1JNM A;  1L0N E;  2O01 J;  4YPC A;  1NKZ B;  2WPQ A;  4XFJ A;  2JDI H;  3HD7 B;  1N7S A;  2G8Y A;  3L70 E;  1JTH A;  1L0L J;  1EDL A;  1LTI C;  3RK2 B;  3H1H J;  3P8C E;  1S9K E;  3CWB J;  3CC7 P;  1N7S B;  1Q7Y Q;  1PIX A;  2JWA A;  1JTH B;  4W7Z A;  3CMA P;  1EZV E;  1N73 A;  1AV1 A;  3CXH I;  4LGD E;  1L0N K;  1BE3 D;  3B71 A;  3IAO A;  1FU1 A;  1LWU A;  5DJU B;  4GDO A;  3NMD A;  2LXB A;  1M57 D;  3A5T A;  2KSE A;  3V4W A;  1N73 B;  2H43 A;  3RK3 E;  1BCC J;  2Q7C A;  3D71 A;  1GL2 A;  1AVO A;  1Y8A A;  1LWU B;  1IC2 A;  1LGH B;  1NTM J;  2B87 A;  1NTZ D;  3CME P;  3NFQ A;  3TDK A;  5CJ4 A;  1VQ8 P;  2FYU G;  3AEF C;  2QIW A;  3C9I A;  2B87 B;  1RF1 A;  1BGY G;  1NTK G;  2WIT A;  4NPF X;  2WSF J;  3RL0 g;  1LT9 C;  3CC4 P;  2B89 A;  2LXC B;  3BRV B;  3HE4 B;  1U57 A;  1DEE G;  1RF1 B;  1P84 I;  3S4R A;  2BEZ F;  3PLN A;  1LJ2 A;  1SQV E;  2BAS A;  3TGU D;  1K73 Q;  3LW5 H;  2JJL A;  3M9Q A;  3K5B A;  3V2P A;  4ZKU A;  1FZB A;  1K8A Q;  3KHU A;  3MP7 B;  5AVS B;  5TIS E;  4Y99 B;  5TJH A;  3VMA A;  1J1D B;  2IYO A;  2P58 A;  5APY A;  2FFD A;  3A2A A;  2XU6 A;  3L75 J;  3L71 G;  1HJ0 A;  1DEB A;  3OAK A;  2Q6Q A;  1FZA A;  2ZYA A;  5AW5 B;  3M0A A;  5APQ A;  1BGY E;  1NTK E;  2QE7 H;  4R4L A;  5KLV J;  3CXH H;  2YIU C;  2FFD B;  3H6P A;  1M1K Q;  2QSI A;  1PZQ A;  2PFX A;  2M8R A;  3CX5 I;  2QM7 A;  3GHG A;  1M7L A;  2YKQ A;  1A02 J;  1YIJ P;  4XA4 A;  1PP9 G;  1KN7 A;  4TT3 H;  3AE1 C;  2WQY C;  1S72 P;  1NO4 A;  3GF7 A;  1SQQ E;  3V4Q A;  2FYU K;  5GTH E;  3GHG B;  1Q86 Q;  1NTK K;  2WZ7 A;  5APT A;  3AE9 C;  2WPR A;  1MUU A;  5APX A;  3IFM A;  3IR9 A;  1JB0 J;  2OYI A;  1SQV J;  3CCR P;  1KIL E;  1SP4 A;  3JCU H;  4A7P A;  5KAF H;  1UII A;  3CI9 A;  5AW0 B;  3S1K A;  1NU1 G;  3G3Z A;  3GLM A;  4OWF A;  2LR2 A;  4H0L D;  4IL6 X;  2OYI B;  3I55 P;  2MJZ A;  1EZV I;  3L35 A;  1P84 H;  2IDB A;  1SQP D;  5B5E E;  5AW2 B;  1DH3 A;  2O3J A;  2BEQ D;  3MHV A;  1HTL C;  3HE5 A;  5AVR B;  3M91 A;  1OW8 A;  2WMM A;  1UIX A;  2ITA A;  1T8Z A;  3V6I A;  1VQ6 P;  1S3J A;  2KZJ A;  1GW3 A;  2BCC D;  2E76 B;  1QX8 A;  1X8Y A;  1YJ9 P;  3HE5 B;  2OYH C;  3QWO C;  1SQQ J;  2K9Y A;  3RGU A;  2SPZ A;  1NU1 E;  4U3F D;  2J59 M;  1KYO I;  5B66 H;  4GIF A;  2OAR A;  1H0T B;  2J58 A;  2QM8 A;  4OGQ D;  1YI2 P;  1KOR A;  3CX5 H;  2FBW C;  4WBA A;  4JYB A;  3O8Z A;  2Y0C A;  1HWT C;  4EYY Q;  1LTJ C;  4H44 C;  2Y0E A;  1SQX D;  2YKO A;  3TGU J;  5DJT B;  1NU1 K;  1OVU A;  2CPB A;  3KXD A;  1SFC C;  3MD0 A;  1OFC X;  2O01 N;  2XND H;  2UWJ E;  2ZVO B;  2M5A B;  2N9Y B;  1ZRT D;  4C7N A;  1QL2 A;  2W6A A;  3UIA A;  2YMK A;  2P1J A;  3Q1M A;  5KKZ B;  1USD A;  1FDI A;  4GOF A;  4D6T G;  3H1J D;  1Y47 A;  4H0L B;  4C7N B;  1DIP A;  3RK3 C;  3U59 A;  5GTI H;  1T3U A;  4EOT A;  1SQB D;  4HH2 A;  2FXP A;  3A3Y B;  2B88 A;  1YTZ I;  1AA0 A;  2FXO A;  3G4S P;  4OVN F;  2QG4 A;  3MTU E;  2ZXX A;  4IL6 H;  1CZQ A;  3VTP C;  1IFJ A;  1GK6 A;  2KP8 A;  1L0L D;  2POH A;  3NTN A;  1DX7 A;  4PD4 D;  3L73 J;  2A06 G;  1KYO H;  1TU3 F;  5AVZ B;  1R5L A;  3CCE P;  4JQ0 D;  3OJA B;  4N78 D;  4D6T E;  2IZ0 A;  2IBZ D;  3CXH E;  3RL0 D;  4ASW A;  3VP8 A;  3BCC G;  3Q5P A;  3A0H H;  4OGQ B;  1SS1 A;  3LID A;  1URQ D;  1VQK P;  3KZI E;  2NPS B;  2O1J A;  3G6E P;  5AVX B;  1GD2 E;  4WWI A;  1YQ4 C;  5AVW B;  1BCC D;  3F5H A;  3N7N A;  4L73 A;  2CPS A;  5TIS H;  2IFN A;  2P10 A;  3MIW A;  2XDJ A;  3IF4 A;  3EWK A;  1PGQ A;  2K3R A;  2HYN A;  1YTZ T;  3LW5 J;  2NZ2 A;  3JCU E;  4H44 D;  4U3F J;  3L36 A;  1FC2 C;  1LTS C;  3H1H G;  3N4X A;  4BRY A;  3L70 D;  4Z1M H;  3HRN A;  5M1B A;  3CWB G;  1PPJ E;  1JY2 N;  3D6Z A;  1JY3 P;  3P8C D;  4H13 D;  3PHL A;  1W5C E;  1S9K D;  3AE6 C;  2QJY B;  1P84 E;  3AE3 C;  4WY4 C;  1SQX J;  1NAF A;  2JKV A;  2W83 C;  5AVY B;  2RKL A;  4CPG A;  1KIL C;  1K04 A;  5EFW B;  1FBM A;  1FDM A;  5APS A;  3WU2 H;  2A45 I;  1M90 Q;  5APU A;  3L75 D;  3D70 A;  2PP6 A;  1GMJ A;  3VMY A;  3ZDM A;  3GF3 A;  2N1T C;  3CCM P;  3A0B H;  3AE7 C;  2WT7 A;  4KJM A;  3R2P A;  3SFD C;  5B66 E;  1RE4 C;  1YYC A;  1URQ A;  1FZC A;  3CX5 E;  3E1R A;  1T6A A;  5AW8 B;  5E79 H;  3H1J J;  3RL0 B;  1KQL A;  3AE5 C;  2FYN B;  3CC2 P;  1AVY A;  1L4A C;  3G71 P;  1S5L X;  2WT7 B;  2E5Y A;  4ZNC A;  1T2K C;  1FZC B;  1URQ B;  3H1K G;  4JPZ B;  3AEA C;  3VP9 A;  1KD1 Q;  2OTL P;  1SLQ A;  2GA1 A;  3VMZ A;  2HOD B;  4JYC A;  3MUD A;  4I6M C;  2E74 B;  2E75 B;  3JSV C;  2ZAE B;  5AVU B;  2MKV A;  1SQV D;  5KAI H;  1NOH A;  3II6 A;  2KUB A;  1RF0 C;  3SWY A;  3E7K A;  3L74 G;  3H1I J;  2ZVN B;  1K9M Q;  4IFF A;  1T3J A;  1HBW A;  5KLI B;  2QJK C;  3P8M C;  3MGN A;  1RE3 C;  4H13 B;  5GTI E;  1QGK B;  2A45 H;  2FXM A;  3H1L G;  2L5G B;  4IL6 E;  2KI7 B;  4LC1 A;  1JCC A;  2HPC A;  3HUS A;  3CCQ P;  2JR8 A;  3ABV C;  1SQQ D;  1ZW0 A;  2Z5H A;  1Q82 Q;  1KYO E;  3L74 E;  5BVZ A;  1GL2 B;  1L0N J;  4I7Z C;  2D2C D;  3U1A A;  4NPD A;  4GOD A;  2C9L Y;  2H89 C;  3L70 J;  2HPC B;  3HUS B;  4O9B A;  2YMY A;  5K5G B;  1IO4 A;  1M1J C;  3A0H E;  3NXS A;  1BE3 G;  4IOI H;  3CCU P;  3FXD A;  4DJG A;  4Y28 J;  1KB9 I;  5KJ7 C;  2OTK E;  2W6J H;  3C1L A;  3VOP A;  4OH8 B;  1KFM A;  1HJB A;  1OMI A;  3Q5S A;  1A02 F;  3E1I A;  2ZJS E;  1USE A;  2WPS A;  2Q5U A;  5CCH C;  1NTZ G;  2V7Q H;  2FYU E;  3B5N C;  1FAV A;  3M0D C;  3L37 A;  4RO0 A;  1VF5 D;  2J5U A;  2KOG A;  2WSS H;  3AED C;  1Q2N A;  1EXI A;  5AVT B;  1OVV A;  1BE3 E;  1KQF B;  1GW4 A;  1VQO P;  2QJP C;  3KZI H;  3F89 A;  2Q3E A;  1IJD B;  4C46 A;  4LLH A;  4L75 A;  4GT1 A;  3FXE A;  1IK7 A;  1PV3 A;  3TGU G;  4DZO A;  3L71 E;  3WU2 E;  2KLU A;  2PRR A;  3L73 D;  3SWK A;  3AEC C;  1S2E A;  1CI6 A;  2R3C A;  4RJT A;  3TYY A;  3FGA D;  3A0B E;  4HKZ H;  2P7J A;  2D2C B;  5AW3 B;  1G1I A;  5CMZ A;  1KTM A;  3KPE A;  1YQ3 C;  2HG5 D;  1HUC A;  1U7M A;  1CI6 B;  5E79 E;  1PP9 E;  2FYU J;  1EDK A;  1JMB A;  1PGO A;  1BGY J;  1KQG B;  1NTK J;  2V4H A;  1GK4 A;  3VMX A;  2IZ1 A;  1KB9 H;  1NTZ K;  3CL3 D;  3FWN A;  3GW6 A;  4PV1 C;  3TSI A;  3KYQ A;  3U1C A;  1J1E C;  1W2E A;  1KMI Z;  2W6B A;  3CD6 P;  2A45 G;  2LKM A;  5KAI E;  2IYP A;  2KS1 A;  3R4Y A;  3QH9 A;  5KJ7 D;  2ZT9 C;  1X22 A;  1VF5 B;  1LTB C;  2KS1 B;  1IFD A;  3AEE C;  4YTP C;  1D7M A;  5BU8 B;  2KNC A;  2I1K A;  1HGZ A;  5CCG C;  4HJG H;  3HD7 C;  4D6T D;  5CCH D;  3CXH D;  2E42 A;  2KB7 P;  1LT1 A;  3VN0 A;  1FOS E;  3BRT B;  3B5N D;  1SQP G;  3L4F A;  3RK2 C;  5AW6 B;  4K3A A;  1PL5 A;  4L76 A;  2QRX A;  2KNC B;  3L72 G;  4BXL A;  1GZL A;  1N7S C;  2XNX A;  3BAS A;  4YXD C;  3H25 A;  2AEF A;  1ZLL A;  2R32 A;  2R3S A;  1JY2 O;  2FYZ A;  2BCC G;  2WPV B;  1MFZ A;  1L2P A;  1PGJ A;  4I1L A;  1VQ5 P;  4U3F G;  2YXR B;  2R5D A;  3JC2 2;  4EI2 A;  1N73 C;  2XV5 A;  1NU1 J;  4W7Y A;  1MZ9 A;  1LWU C;  2RMZ A;  2YXQ B;  1SQP E;  1PPJ D;  4WVZ A;  1HGV A;  1LT9 A;  3WUT A;  4N6J A;  1M8O B;  1VPC A;  1M1J A;  3L72 E;  1N2D C;  4TLF A;  1AJY A;  4C7R A;  2W27 A;  1LT9 B;  5KJ7 A;  2QA4 P;  4GOE A;  2KIK A;  1Q90 D;  3D6Y A;  2Y9Z A;  3H1I D;  1GU5 A;  1SQP K;  2GM4 A;  4PJ0 E;  1RF1 C;  1NYH A;  4MN4 C;  2YO2 A;  3V5B A;  1DD4 A;  5C39 A;  3B5N A;  3FWL A;  2GUS A;  2YO3 A;  4Y99 C;  1J1D C;  5H2F H;  2Y0D A;  1JY3 N;  1JEK A;  1S1C X;  1SQB G;  1Q81 Q;  1NGM B;  1JUN A;  3IN6 A;  2YIU B;  2A06 E;  1AFO A;  3WUU A;  2FFD C;  1OZH A;  2WTY A;  1L0L G;  1L0N D;  3HD7 D;  5AW1 B;  2HR3 A;  3TK1 A;  1KZU B;  3I5C A;  3BCC E;  4BWN A;  3EFG A;  2ZFC A;  3LIE A;  4ASV A;  2IBZ G;  5AVQ B;  4U7J A;  3GHG C;  3M9B A;  2KYV A;  1RY3 A;  1SFC D;  1NAY A;  4AUW A;  1E79 H;  1KB9 E;  5APW A;  4BRY B;  4D6T J;  1KC8 Q;  1EZV D;  1SQB E;  1N7L A;  2HLO A;  2M0B A;  1BCC G;  1OX3 A;  2E43 A;  1JM0 A;  3T97 A;  1QEX A;  3V2R A;  4JF7 A;  1NTM G;  2ZYD A;  1L0L E;  4EIJ A;  4DCK A;  2OYI C;  2FKW B;  2R5B A;  3RK3 D;  3O6Q A;  3H1H E;  3T97 B;  3CWB E;  2IBZ E;  1SQB K;  1MFT A;  3PRJ A;  3ITK A;  2WVR A;  1EC5 A;  2OYH A;  3L70 G;  1PGP A;  1KYO D;  3L74 D;  1LTA C;  4RES B;  3O6Q B;  1JY2 P;  2E5T A;  3CLQ A;  2WSE H;  3BCC J;  4HYT B;  1L0L K;  2ZXE B;  2E76 C;  3EQ2 A;  1DD3 A;  2OYH B;  3GMA A;  4UB8 H;  2Q9I A;  1H89 A;  2K37 A;  1NTM E;  2OYO A;  1LTJ A;  1KQS O;  1M56 D;  2K88 A;  2M3B A;  3L75 G;  1EDJ A;  1U7J A;  1YHQ P;  3WUV A;  2FY8 A;  1WT6 A;  1LTJ B;  1EDI A;  4H44 B;  1LTT C;  1SFC A;  5KLV G;  4KT0 J;  2HFE D;  2OGU A;  2FYU D;  3M9H A;  3MZW B;  2Z5I A;  1BGY D;  1NTK D;  1W2B O;  1NTM K;  3CCS P;  3H1K E;  2W90 A;  3S9O A;  1MKM A;  3PTZ A;  1SFC B;  1X0T A;  1CSB A;  1BSH A;  1NHL A;  1IK9 A;  3WMM 0;  1ZXG A;  1Z56 A;  3V2N A;  5KKZ C;  3L75 E;  2OQQ A;  2PGD A;  1AQT A;  4H0L C;  1R5S A;  1SQV G;  4WY4 D;  3RK3 B;  3L71 D;  5KLV E;  2H7H A;  1FDO A;  3Q5R A;  4XE5 B;  2I8D A;  3HTK A;  3SFE C;  1KIL D;  3RBZ A;  1ZME C;  1WRG A;  1Y9B A;  2WWW A;  5H2F E;  3HE4 A;  5CJ0 A;  1OW6 A;  1KV4 A;  1LNQ A;  1S4X A;  3HTK B;  2N1T D;  1GTW A;  1LP1 A;  3H1L E;  1PP9 D;  3AEB C;  1LTG C;  2OTJ P;  3CPW O;  3Q2Y A;  2XKM A;  5KLV K;  1IFP A;  3H1K J;  1JO5 A;  1X9V A;  1N8R Q;  1LP1 B;  1L4A D;  2N9B A;  4OGQ C;  1BSN A;  1S5L H;  4PD4 I;  3SSU A;  2NRG A;  1SQQ G;  1T2K D;  2NPS C;  2IPP A;  1PFI A;  4PJ0 H;  3AE8 C;  2E76 D; 
#chains in the Genus database with same CATH homology
 4UB8 H;  5E79 H;  4IL6 H;  5TIS H;  5B66 H;  3KZI H;  3A0H H;  5B5E H;  1S5L H;  5GTH H;  5GTI H;  5KAI H;  3A0B H;  4UB6 H;  3JCU H;  5H2F H;  4PJ0 H;  5KAF H;  2AXT H;  3WU2 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...