4UB6H

Native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 13
structure length 65
sequence length 65
chains with identical sequence h
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 4ub6H01
5B5EH 3JCUH 4UB6H 4UB8H 5E79H 2AXTH 5GTIH 3WU2H 1S5LH 3A0BH 5KAFH 3A0HH 5KAIH 5H2FH 4IL6H 4PJ0H 5GTHH 5B66H 5TISH 3KZIH
chains in the Genus database with same CATH superfamily
2K37A 2QA4P 2FYUD 4GODA 4NPFX 1EDIA 1OIPA 5KLVE 1LT1A 2HR3A 3U1AA 1K73Q 3CMAP 1KFNA 3L72G 3M06A 2MJZA 1M1KQ 1Q86Q 1EZVE 1SQQD 3V6IA 1OW7A 2FYUJ 3VTPC 2BEZF 2W6BA 1NWQA 2IYOA 1ZMEC 3WMM0 2R3SA 4C7RA 1SLQA 3B5NC 4W7YA 1L0NG 2WVRA 1BGYD 1SQQJ 2LKMA 3S9OA 5APVA 1QGKB 3RK3D 1S9KD 1GL2D 1CI6A 2WSFH 2LR2A 1IK9A 4N3YB 1SVFA 1Z56A 1RQUA 3G4SP 2KLUA 1BGYJ 1FOSE 1SQPD 3CPWO 4M3LA 1KN7A 5AVVB 3GF7A 1NOHA 2L5GB 3AE3C 2N1TC 2M8RA 1FS0E 3W67A 1PGQA 1FZCA 1RF1C 2KS1A 1SQPJ 5L8RJ 1JO5A 3LIDA 2WSSH 1BE3G 4R4MA 4OGQD 5KJ7A 1URQD 1DIPA 3JCUE 1W2EA 2HFED 3HUSB 3FGAD 3B71A 3O6QB 1HJ0A 1PGOA 2H88C 4KT0J 3HE4B 4IL6X 2ZVNB 1SQXK 1AA0A 3H32A 2QE7H 4AYCA 2D2CB 2B9BA 2WPRA 3C9IA 2ZFCA 5AVTB 1JM0A 2AXTE 2PP6A 2JO1A 1M8OB 2ZT9D 3TNUA 4AQRD 3FWLA 1CZQA 1SQQG 4WB4A 2YMKA 2KXPB 3CL3D 2GUVA 1N86A 5M1BA 1LWUB 2FYZA 2M0BA 2XZRA 3HUSC 1BGYG 1IK7A 5B66E 3L70D 1DEBA 3RK2D 1JMBA 3P8CE 2H8PD 1G1IA 3UIAA 1KILD 2P7JA 1DD3A 2D2CC 1BCCJ 2WPVB 3CXHI 3L70J 1GU4A 1IFPA 3GMAA 5AW3B 3U1CA 2YMYA 1KD1Q 1GW4A 4HYTB 4TLFA 4WVZA 4XA4A 4ASWA 1HJBA 4H13D 1JY2O 1DX7A 1MZ9A 1P84E 1YQ4C 3V2NA 5CCGC 2N1TA 1YTZI 1NTMD 1LP1B 3JCUH 4EI2A 1RF1A 2WITA 3KXDA 3G6EP 2NRGA 3CWBE 1DH3A 1NO4A 1GK4A 1T8ZA 1PP9D 1NTMJ 2XDJA 1RF0C 2YKPA 1S72P 1JMMA 1N8RQ 2IBZD 3KZIE 2WWWA 1Q2NA 5CBOA 2Q6QA 3TYYA 1QVGO 1G2CB 1PP9J 4K3AA 1SQXE 1OVRA 3HD7C 1AVYA 4LGDE 2R5BA 2IBZE 3I5CA 2W6JH 2PFXA 2QJKB 1NKNA 1BCCG 1R5SA 2I1JA 1USEA 3OJAB 3L70G 1X79B 3M91A 1EXJA 1JY3N 3L36A 5B66H 2OYHB 2C9NY 2Y0CA 4I6MC 1H8AA 2E75C 4N6JA 2NZ2A 3H1IE 3BRTB 3P7KA 3HUSA 4Y28J 3F89A 2IX7C 2Z5IA 3O6QA 3BCCD 2I1KA 3HE4A 3EWKA 1BDCA 2W27A 1S3JA 1OWAA 2SPZA 4U3FE 2N9BA 4ZNCA 3BCCE 2QJKC 5E79E 2E76B 2KZIA 3CCLP 1VQ7P 2M5AA 1NTMG 2A45I 4KJMA 1P84H 2IFNA 1LTBC 3B5ND 4RESB 2A06E 3CI9A 2OYHC 2P2UA 1VL2A 1ZRTD 3S1KA 1FDMA 2OARA 1HTLC 5CCGA 1PP9G 3RBXA 2GA1A 4YTPC 2O01J 2YO3A 1ZRTE 1OVUA 4D6TE 2VRSA 1DD4A 4GOEA 1RH5B 4ZMDA 2P10A 1MUUA 1Y9BA 2PRRA 1T3JA 3T97A 2E76C 2NPSA 2BCCD 1CI6B 1VQLP 1MFZA 2WSCJ 3WUTA 3AEEC 4CPGA 1VQNP 2FYUK 3HD7A 3O8ZA 2JDIH 2BCCE 3A5TA 2BCCJ 2Y0EA 1S2EA 1AFOA 1Y8AA 3FXDA 1VF5B 3H1KD 3FX0A 2R32A 3TSIA 2JWDA 3MUDC 1FZEA 3RBZA 3PJSK 2IYPA 1S5LE 5CCHC 4H0LD 2ITAA 3C1LA 3EFFK 1PZQA 4MN4C 2YIUB 1VPCA 3H1KJ 2QSIA 4BRYB 3RGUA 2KK7A 1FZFA 3S4RA 4TT3H 1AJYA 3H32B 2YXQB 3L72E 4L73A 1WRGA 1SQVD 2POHA 5AVRB 4YXDC 1NU1J 5E79H 1G2CA 1L0ND 5APYA 4PV1B 2FBWC 1R8EA 5DJUB 3L71D 1VQ9P 2K9JA 1SQPK 3CMEP 3EFGA 3CXHD 2O3JA 2FXOA 1SQVJ 1VF5C 3AEBC 3KPEA 1L0NE 3CC4P 3P32A 1Q81Q 1E79H 5KJ7C 2E42A 2P58A 2D2CD 1Q7YQ 3L71J 3M0AA 4HH2A 2AXCA 1JY3O 2OYHA 2YIUC 2E74B 2H7HA 1LTGC 3CCJP 4R4LA 2V7QH 4WY4B 1BE3D 1MV8A 1LT9A 5EFWB 1PV3A 1HBWA 3HTKA 3W68A 4PV1C 3H1LE 1LTAC 2QVAA 3OAKA 2KSJA 1KQFB 1BE3E 1BE3J 3GLMA 3GF3A 1A02J 3H1KG 1D7MA 3ABVC 4NPEA 2BASA 1X0TA 1HWTC 2E74C 2N1TB 2G3AA 1NU1G 2FYUE 1RF1B 3KQGA 1RE4C 1LTIC 1S5LH 1GW3A 1JOCA 4WY4C 3L75D 1LJ2A 3AEGC 4DT0A 1SQVG 3MUDA 1SQQE 1XTGB 1N2DC 1LTJA 5CCHA 4I7ZC 3G71P 2J5UA 3L71G 3L75J 4WBAA 3TGUG 1AQ5A 4YXWH 4K35A 3V4QA 2B87B 1RQVA 1BGYE 5AW4B 3N7NA 3H1JD 3AECC 2G8YA 1S9KE 1AV1A 3RK3E 3D6ZA 2ZYAA 3CCSP 1NH4A 3PTZA 1ZP0C 3JC22 1SFCA 4O9BA 1S5LX 2ZVOB 4JYCA 4AUWA 1SQPE 4IOIH 1VQ6P 3H1JJ 3AE4C 3F5HA 4JBZA 1KQLA 1W2BO 3CD6P 1T2KC 1ZR4A 5TJHA 2K1AA 4DCKA 4BRYA 5H2FE 1KB9I 1N7SA 2R44A 1BSHA 1QL2A 2XKMA 2E43A 3MP7B 1IFIA 3H1HG 5KLVG 4OWFA 3PP5A 4ZKPA 3JSVC 3MIWA 3BVHA 2LXBA 2ZXEB 2Q5UA 2M5AB 3TDKA 2V4HA 2RH0A 3L75G 3SWKA 3GG2A 3KDPB 1GMJA 4W80A 1PPJG 1IO4A 3M0DC 2E76D 4BXLA 1BCCD 1NAFA 2Q9IA 2Z4EA 1SP4A 1KYOI 1L4AB 1RE4A 3Q5PA 1S4XA 3CCUP 1K05A 4WY4A 1AQTA 2FFDC 1GK6A 4C7NA 3G9RA 2HODA 1BCCE 2XU6A 3H1JG 3I55P 3L70E 3T97B 4I1LA 2NPSB 4HKZH 1QLED 1KILE 2JEEA 1JUNA 2Z5HA 2YKOA 2A45G 3HD7B 2BEQD 1NYHA 2C0WA 4JPZB 1FZAA 2QG4A 1L4AC 1YJWP 1JB0J 5H2FH 2Q7CA 3CCQP 4PD4I 1NTME 1FJPA 1R5LA 2E75B 1YHQP 2NPSC 4H44B 1FU1A 3CCEP 3G3ZA 3LW5J 2WMMA 3SFDC 4GT1A 2DW3A 1PL5A 2QM8A 5KJ7D 1H89A 2B87A 1L0LG 1PP9E 1RE3C 3RL0B 2QM7A 1KQGB 1M57D 1GZLA 2K9JB 1EZVI 2QIWA 2QRXA 1FJKA 2OTLP 1OX3A 4U7JA 1URQB 3WUVA 5CJ4A 3BRVB 4PV1D 1LGHB 2KNCB 5AVUB 3CC2P 2ZAEB 1JTHA 1GL2C 4H44C 3M0DA 4ASVA 2OGUA 3MTUE 1NTKD 1LT9B 3A0HE 2XNXA 3PLNA 3HTKB 2HG5D 3IN6A 1OXZA 1SQVK 3RL0C 2FFDA 1IFNA 2E74D 1L0NK 3AE1C 1RHZB 1NTKJ 3L74D 3HE5A 2LXCB 5DJTB 3A0BE 4N78D 2R3CA 1ZV8A 1URQC 3B4SA 1FBMA 3A7OA 2AEJA 2J58A 5AVQB 4YPCA 3ITKA 2UWJE 3L74J 1JY2P 3WU2E 3CCVP 1OVVA 2HPCB 2CPBA 1LT9C 4RO0A 1L4AA 3QWOC 4XE5B 3MGNA 1YQ3C 2W8ZA 5AW5B 2KB7P 2WQYC 2IPPA 1LTJB 2N1TD 3VP8A 1SQBD 1SQXG 4NPDA 1CSBA 1VQ5P 1KMIZ 1M1JB 4DOJA 3V2RA 1KB9D 2CK3H 3L4FA 1ZOYC 4EYYQ 5CBNA 1IZNB 2W83C 3SFEC 1SQBJ 1RE3A 1S1CX 1JEKA 1L2PA 3Q3DA 2ZYDA 1NVOA 2OYOA 4QMAA 1SFCB 1L0LK 3D71A 1KV4A 2Q3IA 3H1IG 2OQQA 1CW5A 3SWFA 1SQQK 1NTZD 3M9HA 1NTKG 1T3UA 3CX5I 4DJGA 5K5GB 5APSA 4Z1MH 1NU1D 1LTJC 3A0HH 3H1KE 1W5CE 1N7SB 1K9MQ 1NTZJ 1GL2A 1YITP 3L74G 1M1JC 2I8DA 1FOSF 3HRNA 1KYOD 1NU1E 2L91A 3V2PA 3KHUA 1OFCX 2P67A 1EDLA 3C8VA 3A0BH 2Y9YA 1P84I 4PJ0E 1SFCC 1OW6A 3M9BA 1SQVE 3TGUD 1BDDA 3GHGA 3CCMP 3VMZA 2B89A 1U57A 3WU2H 1URQA 3L71E 3MZWB 1GD2E 2WSFJ 3KYQA 1QL1A 4GIFA 2H43A 4IL6E 3CCRP 3CXHE 2KNCA 2O01H 3TGUE 3TGUJ 3H6PA 5TISE 2WT7B 3NTNA 2OTJP 3SSUA 1SQBG 2HYNA 1FE6A 5AVXB 1N7SC 3L73D 4Y99B 4A7PA 4C46A 1YI2P 3E1IA 1YJ9P 5GTHE 4C7NB 2IBZI 2HODB 2WSCH 1EXIA 1VQPP 5CCGD 5AVWB 4PD4D 1J1DB 4I7ZB 3L73J 3NXSA 2WPSA 2GM4A 1KFMA 1L4AD 1X8YA 1EQ7A 1N7LA 3ZDMA 5KLVD 3H1HD 1NTZG 4JF7A 2KLVA 4PD4E 5AW9B 1ZXGA 1M56D 2GUSA 5CMZA 2QJPB 2NPSD 2YNYA 3R4YA 1EZVD 5CHXA 2Q1KA 3VMAA 1JY2N 2HPCA 3H1HE 4EDFA 1SS1A 5KLVJ 3H1HJ 4HJGH 1UIXA 2XNDH 5AW7B 1IFJA 1IC2A 4Y99C 3AE7C 3NFQA 2JJLA 1KILA 5APWA 3MHVA 3HD7D 1M7LA 4W7ZA 1PPJD 2K88A 1AVOA 1HVVA 4KHXA 1J1DC 3OW2O 1WMKA 1Y47A 3IAOA 3L75E 2KOGA 1VQOP 4PJ0H 3VP9A 1PPJE 1UIIA 1M1JA 4RJTA 3Q5SA 2FYNB 5B5EH 1KYOH 5C39A 1NAYA 3TF5A 1GTWA 2OYIB 1PGPA 2QJPC 2E75D 2KZJA 3AE2C 2MKVA 4H44D 4IL6H 3CXHH 1E5WA 2KI7B 4EOTA 3EQ2A 3H1JE 5TISH 1OZHA 3L73G 1BSNA 1NTMK 1JCCA 4H0LB 3RL0D 3IFMA 1HGZA 1JTHB 1EDJA 2W6AA 3H1LG 1JY3P 5KAFH 5GTHH 1MFTA 4HB1A 1J2JB 1FAVA 2FYNC 3BATA 2K3RA 2FFDB 2FKWB 4ZKUA 2E5YA 2OYIC 2FY8A 2CPSA 2AEFA 4LLHA 1N73B 5KAIE 3HE5B 2O01N 5AW1B 4PD4H 3M9QA 1EZVG 1L0LD 1MKMA 2FYUG 1TU3F 3P8MC 4RKUJ 1FDIA 3VOPA 2HLOA 1K04A 2YXRB 2KP8A 5AW6B 4H0LC 3PHLA 1H0TB 2K9YA 1M90Q 2YKQA 1L0LE 2M3BA 2WT7A 1L0LJ 2C9LY 4BWNA 3E7KA 3P8CD 2IZ0A 1Q82Q 5APTA 3V2QA 3I56P 1QVFO 5GTIE 1NTKK 2RN0A 3CX5D 1N73C 2JWAA 3L35A 5AW8B 5KKZB 3RL0g 3A2AA 3V4WA 4GKGA 3Q5RA 1Q90D 2PAJA 3B5NA 3AEFC 2WSEJ 3CX5E 4L75A 3VN0A 1SQPG 5CCHD 1H88A 1YTZT 1P84D 1ZR2A 3AEAC 3WUUA 3AE8C 4OVNF 1QX8A 2QEXP 3CWBD 1LWUC 3N4XA 2A45H 2OTKE 1YYCA 3E1RA 2ZYGA 1RY3A 1SFCD 3RK3B 5KKZC 4XFJA 1VF5D 1GL2B 1VQKP 2Y9ZA 1IFDA 1FZBA 3V5BA 1NGMB 1SQBK 3CWBJ 4UB8E 5APUA 2IDBA 3IR9A 1VDFA 5KAIH 1GDTA 2WTYA 3MD0A 3U59A 1ZN5A 1SQXD 4IFMA 1VQ8P 1FDOA 1YBKA 3BASA 3SWYA 2OYIA 1LNQA 2IFMA 1PFIA 1N7SD 4DZOA 2AXTH 4I2LC 1YIJP 3GHGB 1NHLA 5KTBA 2WZ7A 2ZJSE 3R2PA 4OGQB 1FZGA 1IJDB 1SQXJ 2M3EA 1YJNP 5AVSB 1NTZK 3RK3C 4GOFA 3D70A 5AW0B 3H1ID 3VMYA 5GTIH 1NU1K 1HF9A 3PRJA 4JQ0D 2E5TA 5AVYB 2O1JA 1KORA 2AEMA 2B88A 1NJIQ 4U3FD 3Q2YA 3QH9A 3H1IJ 1PIXA 2WSEH 3VMXA 2ZT9B 3CX5H 3A3YB 2P1JA 1N73A 1NTKE 5AVZB 2RKLA 2R5DA 1X9VA 3USSA 3GHGC 4WY4D 5CJ0A 1DEEG 4OGQC 4U3FJ 2ZXXA 1NKZB 2Q3EA 1HGVA 2A06D 3CWBG 4L76A 1FC2C 3BCCJ 3L74E 2YO2A 1H0TA 2J59M 5BU8B 3LIEA 4N78E 1J1EB 4EIJA 3RK2B 2Y0DA 5APXA 3Q1MA 1KILB 1KC8Q 1HH0A 2KYVA 2W90A 3AE9C 1LWUA 4D6TD 3LW5H 4UB6E 4UB8H 5KLIB 2O1KA 2FXMA 1K8AQ 2H89C 3FWNA 2ZT9C 2KUBA 1A02F 2IBZG 2C0XA 3AE5C 4L74A 1OMIA 2QJYB 4GDOA 5APQA 3KZIH 2KIKA 4WWIA 3K5BA 3VYIA 4D6TJ 4H13B 4B86A 1SQBE 2V7QJ 1T2KD 1RF0A 5KLVK 3AEDC 1HUCA 1J1EC 3RK2C 1KZUB 5BU5A 1KB9E 1X22A 3TK1A 3D6YA 1KILC 1LTSC 2JP3A 1IFMA 1JNMA 2FXPA 4IFDK 5KLIC 3H25A 1FZCB 5BVZA 4U3FG 2KS1B 3FXEA 1LP1A 2N9YB 1NTZE 2QJYC 4OH8B 3BCCG 4IFFA 3L72D 1U7JA 3NMDA 4H13C 3L37A 1EC5A 1VQMP 3B8EB 1LTTC 2JR8A 3CC7P 1OW8A 2A06G 1ZW0A 4LC1A 3GW6A 1USDA 3L72J 1QEXA 5B5EE 1KYOE 2PGDA 3CLQA 4JYBA 1XTCC 1GU5A 1JCDA 5AW2B 3AE6C 1U7MA 1FZCC 3TNUB 4D6TG 2XV5A 2JKVA 1L0NJ 1KQSO 4UB6H 2WPQA 3II6A 1G1JA 5KAFE 1KTMA 3H1LD 3IF4A 2IZ1A 3L73E 1ZLLA 3PH0A 2KSEA 2BCCG 1PGJA 1T6AA 3OA7A 3B5NB 1VQ4P 1EDKA 3H1LJ 1KB9H 1WT6A 2RMZA
chains in the Genus database with same CATH topology
5B5EH 3JCUH 4UB6H 4UB8H 5E79H 2AXTH 5GTIH 3WU2H 1S5LH 3A0BH 5KAFH 3A0HH 5KAIH 5H2FH 4IL6H 4PJ0H 5GTHH 5B66H 5TISH 3KZIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B5E H;  3JCU H;  4UB6 H;  4UB8 H;  5E79 H;  2AXT H;  5GTI H;  3WU2 H;  1S5L H;  3A0B H;  5KAF H;  3A0H H;  5KAI H;  5H2F H;  4IL6 H;  4PJ0 H;  5GTH H;  5B66 H;  5TIS H;  3KZI H; 
#chains in the Genus database with same CATH topology
 2K37 A;  2QA4 P;  2FYU D;  4GOD A;  4NPF X;  1EDI A;  1OIP A;  5KLV E;  1LT1 A;  2HR3 A;  3U1A A;  1K73 Q;  3CMA P;  1KFN A;  3L72 G;  3M06 A;  2MJZ A;  1M1K Q;  1Q86 Q;  1EZV E;  1SQQ D;  3V6I A;  1OW7 A;  2FYU J;  3VTP C;  2BEZ F;  2W6B A;  1NWQ A;  2IYO A;  1ZME C;  3WMM 0;  2R3S A;  4C7R A;  1SLQ A;  3B5N C;  4W7Y A;  1L0N G;  2WVR A;  1BGY D;  1SQQ J;  2LKM A;  3S9O A;  5APV A;  1QGK B;  3RK3 D;  1S9K D;  1GL2 D;  1CI6 A;  2WSF H;  2LR2 A;  1IK9 A;  4N3Y B;  1SVF A;  1Z56 A;  1RQU A;  3G4S P;  2KLU A;  1BGY J;  1FOS E;  1SQP D;  3CPW O;  4M3L A;  1KN7 A;  5AVV B;  3GF7 A;  1NOH A;  2L5G B;  3AE3 C;  2N1T C;  2M8R A;  1FS0 E;  3W67 A;  1PGQ A;  1FZC A;  1RF1 C;  2KS1 A;  1SQP J;  5L8R J;  1JO5 A;  3LID A;  2WSS H;  1BE3 G;  4R4M A;  4OGQ D;  5KJ7 A;  1URQ D;  1DIP A;  3JCU E;  1W2E A;  2HFE D;  3HUS B;  3FGA D;  3B71 A;  3O6Q B;  1HJ0 A;  1PGO A;  2H88 C;  4KT0 J;  3HE4 B;  4IL6 X;  2ZVN B;  1SQX K;  1AA0 A;  3H32 A;  2QE7 H;  4AYC A;  2D2C B;  2B9B A;  2WPR A;  3C9I A;  2ZFC A;  5AVT B;  1JM0 A;  2AXT E;  2PP6 A;  2JO1 A;  1M8O B;  2ZT9 D;  3TNU A;  4AQR D;  3FWL A;  1CZQ A;  1SQQ G;  4WB4 A;  2YMK A;  2KXP B;  3CL3 D;  2GUV A;  1N86 A;  5M1B A;  1LWU B;  2FYZ A;  2M0B A;  2XZR A;  3HUS C;  1BGY G;  1IK7 A;  5B66 E;  3L70 D;  1DEB A;  3RK2 D;  1JMB A;  3P8C E;  2H8P D;  1G1I A;  3UIA A;  1KIL D;  2P7J A;  1DD3 A;  2D2C C;  1BCC J;  2WPV B;  3CXH I;  3L70 J;  1GU4 A;  1IFP A;  3GMA A;  5AW3 B;  3U1C A;  2YMY A;  1KD1 Q;  1GW4 A;  4HYT B;  4TLF A;  4WVZ A;  4XA4 A;  4ASW A;  1HJB A;  4H13 D;  1JY2 O;  1DX7 A;  1MZ9 A;  1P84 E;  1YQ4 C;  3V2N A;  5CCG C;  2N1T A;  1YTZ I;  1NTM D;  1LP1 B;  3JCU H;  4EI2 A;  1RF1 A;  2WIT A;  3KXD A;  3G6E P;  2NRG A;  3CWB E;  1DH3 A;  1NO4 A;  1GK4 A;  1T8Z A;  1PP9 D;  1NTM J;  2XDJ A;  1RF0 C;  2YKP A;  1S72 P;  1JMM A;  1N8R Q;  2IBZ D;  3KZI E;  2WWW A;  1Q2N A;  5CBO A;  2Q6Q A;  3TYY A;  1QVG O;  1G2C B;  1PP9 J;  4K3A A;  1SQX E;  1OVR A;  3HD7 C;  1AVY A;  4LGD E;  2R5B A;  2IBZ E;  3I5C A;  2W6J H;  2PFX A;  2QJK B;  1NKN A;  1BCC G;  1R5S A;  2I1J A;  1USE A;  3OJA B;  3L70 G;  1X79 B;  3M91 A;  1EXJ A;  1JY3 N;  3L36 A;  5B66 H;  2OYH B;  2C9N Y;  2Y0C A;  4I6M C;  1H8A A;  2E75 C;  4N6J A;  2NZ2 A;  3H1I E;  3BRT B;  3P7K A;  3HUS A;  4Y28 J;  3F89 A;  2IX7 C;  2Z5I A;  3O6Q A;  3BCC D;  2I1K A;  3HE4 A;  3EWK A;  1BDC A;  2W27 A;  1S3J A;  1OWA A;  2SPZ A;  4U3F E;  2N9B A;  4ZNC A;  3BCC E;  2QJK C;  5E79 E;  2E76 B;  2KZI A;  3CCL P;  1VQ7 P;  2M5A A;  1NTM G;  2A45 I;  4KJM A;  1P84 H;  2IFN A;  1LTB C;  3B5N D;  4RES B;  2A06 E;  3CI9 A;  2OYH C;  2P2U A;  1VL2 A;  1ZRT D;  3S1K A;  1FDM A;  2OAR A;  1HTL C;  5CCG A;  1PP9 G;  3RBX A;  2GA1 A;  4YTP C;  2O01 J;  2YO3 A;  1ZRT E;  1OVU A;  4D6T E;  2VRS A;  1DD4 A;  4GOE A;  1RH5 B;  4ZMD A;  2P10 A;  1MUU A;  1Y9B A;  2PRR A;  1T3J A;  3T97 A;  2E76 C;  2NPS A;  2BCC D;  1CI6 B;  1VQL P;  1MFZ A;  2WSC J;  3WUT A;  3AEE C;  4CPG A;  1VQN P;  2FYU K;  3HD7 A;  3O8Z A;  2JDI H;  2BCC E;  3A5T A;  2BCC J;  2Y0E A;  1S2E A;  1AFO A;  1Y8A A;  3FXD A;  1VF5 B;  3H1K D;  3FX0 A;  2R32 A;  3TSI A;  2JWD A;  3MUD C;  1FZE A;  3RBZ A;  3PJS K;  2IYP A;  1S5L E;  5CCH C;  4H0L D;  2ITA A;  3C1L A;  3EFF K;  1PZQ A;  4MN4 C;  2YIU B;  1VPC A;  3H1K J;  2QSI A;  4BRY B;  3RGU A;  2KK7 A;  1FZF A;  3S4R A;  4TT3 H;  1AJY A;  3H32 B;  2YXQ B;  3L72 E;  4L73 A;  1WRG A;  1SQV D;  2POH A;  5AVR B;  4YXD C;  1NU1 J;  5E79 H;  1G2C A;  1L0N D;  5APY A;  4PV1 B;  2FBW C;  1R8E A;  5DJU B;  3L71 D;  1VQ9 P;  2K9J A;  1SQP K;  3CME P;  3EFG A;  3CXH D;  2O3J A;  2FXO A;  1SQV J;  1VF5 C;  3AEB C;  3KPE A;  1L0N E;  3CC4 P;  3P32 A;  1Q81 Q;  1E79 H;  5KJ7 C;  2E42 A;  2P58 A;  2D2C D;  1Q7Y Q;  3L71 J;  3M0A A;  4HH2 A;  2AXC A;  1JY3 O;  2OYH A;  2YIU C;  2E74 B;  2H7H A;  1LTG C;  3CCJ P;  4R4L A;  2V7Q H;  4WY4 B;  1BE3 D;  1MV8 A;  1LT9 A;  5EFW B;  1PV3 A;  1HBW A;  3HTK A;  3W68 A;  4PV1 C;  3H1L E;  1LTA C;  2QVA A;  3OAK A;  2KSJ A;  1KQF B;  1BE3 E;  1BE3 J;  3GLM A;  3GF3 A;  1A02 J;  3H1K G;  1D7M A;  3ABV C;  4NPE A;  2BAS A;  1X0T A;  1HWT C;  2E74 C;  2N1T B;  2G3A A;  1NU1 G;  2FYU E;  1RF1 B;  3KQG A;  1RE4 C;  1LTI C;  1S5L H;  1GW3 A;  1JOC A;  4WY4 C;  3L75 D;  1LJ2 A;  3AEG C;  4DT0 A;  1SQV G;  3MUD A;  1SQQ E;  1XTG B;  1N2D C;  1LTJ A;  5CCH A;  4I7Z C;  3G71 P;  2J5U A;  3L71 G;  3L75 J;  4WBA A;  3TGU G;  1AQ5 A;  4YXW H;  4K35 A;  3V4Q A;  2B87 B;  1RQV A;  1BGY E;  5AW4 B;  3N7N A;  3H1J D;  3AEC C;  2G8Y A;  1S9K E;  1AV1 A;  3RK3 E;  3D6Z A;  2ZYA A;  3CCS P;  1NH4 A;  3PTZ A;  1ZP0 C;  3JC2 2;  1SFC A;  4O9B A;  1S5L X;  2ZVO B;  4JYC A;  4AUW A;  1SQP E;  4IOI H;  1VQ6 P;  3H1J J;  3AE4 C;  3F5H A;  4JBZ A;  1KQL A;  1W2B O;  3CD6 P;  1T2K C;  1ZR4 A;  5TJH A;  2K1A A;  4DCK A;  4BRY A;  5H2F E;  1KB9 I;  1N7S A;  2R44 A;  1BSH A;  1QL2 A;  2XKM A;  2E43 A;  3MP7 B;  1IFI A;  3H1H G;  5KLV G;  4OWF A;  3PP5 A;  4ZKP A;  3JSV C;  3MIW A;  3BVH A;  2LXB A;  2ZXE B;  2Q5U A;  2M5A B;  3TDK A;  2V4H A;  2RH0 A;  3L75 G;  3SWK A;  3GG2 A;  3KDP B;  1GMJ A;  4W80 A;  1PPJ G;  1IO4 A;  3M0D C;  2E76 D;  4BXL A;  1BCC D;  1NAF A;  2Q9I A;  2Z4E A;  1SP4 A;  1KYO I;  1L4A B;  1RE4 A;  3Q5P A;  1S4X A;  3CCU P;  1K05 A;  4WY4 A;  1AQT A;  2FFD C;  1GK6 A;  4C7N A;  3G9R A;  2HOD A;  1BCC E;  2XU6 A;  3H1J G;  3I55 P;  3L70 E;  3T97 B;  4I1L A;  2NPS B;  4HKZ H;  1QLE D;  1KIL E;  2JEE A;  1JUN A;  2Z5H A;  2YKO A;  2A45 G;  3HD7 B;  2BEQ D;  1NYH A;  2C0W A;  4JPZ B;  1FZA A;  2QG4 A;  1L4A C;  1YJW P;  1JB0 J;  5H2F H;  2Q7C A;  3CCQ P;  4PD4 I;  1NTM E;  1FJP A;  1R5L A;  2E75 B;  1YHQ P;  2NPS C;  4H44 B;  1FU1 A;  3CCE P;  3G3Z A;  3LW5 J;  2WMM A;  3SFD C;  4GT1 A;  2DW3 A;  1PL5 A;  2QM8 A;  5KJ7 D;  1H89 A;  2B87 A;  1L0L G;  1PP9 E;  1RE3 C;  3RL0 B;  2QM7 A;  1KQG B;  1M57 D;  1GZL A;  2K9J B;  1EZV I;  2QIW A;  2QRX A;  1FJK A;  2OTL P;  1OX3 A;  4U7J A;  1URQ B;  3WUV A;  5CJ4 A;  3BRV B;  4PV1 D;  1LGH B;  2KNC B;  5AVU B;  3CC2 P;  2ZAE B;  1JTH A;  1GL2 C;  4H44 C;  3M0D A;  4ASV A;  2OGU A;  3MTU E;  1NTK D;  1LT9 B;  3A0H E;  2XNX A;  3PLN A;  3HTK B;  2HG5 D;  3IN6 A;  1OXZ A;  1SQV K;  3RL0 C;  2FFD A;  1IFN A;  2E74 D;  1L0N K;  3AE1 C;  1RHZ B;  1NTK J;  3L74 D;  3HE5 A;  2LXC B;  5DJT B;  3A0B E;  4N78 D;  2R3C A;  1ZV8 A;  1URQ C;  3B4S A;  1FBM A;  3A7O A;  2AEJ A;  2J58 A;  5AVQ B;  4YPC A;  3ITK A;  2UWJ E;  3L74 J;  1JY2 P;  3WU2 E;  3CCV P;  1OVV A;  2HPC B;  2CPB A;  1LT9 C;  4RO0 A;  1L4A A;  3QWO C;  4XE5 B;  3MGN A;  1YQ3 C;  2W8Z A;  5AW5 B;  2KB7 P;  2WQY C;  2IPP A;  1LTJ B;  2N1T D;  3VP8 A;  1SQB D;  1SQX G;  4NPD A;  1CSB A;  1VQ5 P;  1KMI Z;  1M1J B;  4DOJ A;  3V2R A;  1KB9 D;  2CK3 H;  3L4F A;  1ZOY C;  4EYY Q;  5CBN A;  1IZN B;  2W83 C;  3SFE C;  1SQB J;  1RE3 A;  1S1C X;  1JEK A;  1L2P A;  3Q3D A;  2ZYD A;  1NVO A;  2OYO A;  4QMA A;  1SFC B;  1L0L K;  3D71 A;  1KV4 A;  2Q3I A;  3H1I G;  2OQQ A;  1CW5 A;  3SWF A;  1SQQ K;  1NTZ D;  3M9H A;  1NTK G;  1T3U A;  3CX5 I;  4DJG A;  5K5G B;  5APS A;  4Z1M H;  1NU1 D;  1LTJ C;  3A0H H;  3H1K E;  1W5C E;  1N7S B;  1K9M Q;  1NTZ J;  1GL2 A;  1YIT P;  3L74 G;  1M1J C;  2I8D A;  1FOS F;  3HRN A;  1KYO D;  1NU1 E;  2L91 A;  3V2P A;  3KHU A;  1OFC X;  2P67 A;  1EDL A;  3C8V A;  3A0B H;  2Y9Y A;  1P84 I;  4PJ0 E;  1SFC C;  1OW6 A;  3M9B A;  1SQV E;  3TGU D;  1BDD A;  3GHG A;  3CCM P;  3VMZ A;  2B89 A;  1U57 A;  3WU2 H;  1URQ A;  3L71 E;  3MZW B;  1GD2 E;  2WSF J;  3KYQ A;  1QL1 A;  4GIF A;  2H43 A;  4IL6 E;  3CCR P;  3CXH E;  2KNC A;  2O01 H;  3TGU E;  3TGU J;  3H6P A;  5TIS E;  2WT7 B;  3NTN A;  2OTJ P;  3SSU A;  1SQB G;  2HYN A;  1FE6 A;  5AVX B;  1N7S C;  3L73 D;  4Y99 B;  4A7P A;  4C46 A;  1YI2 P;  3E1I A;  1YJ9 P;  5GTH E;  4C7N B;  2IBZ I;  2HOD B;  2WSC H;  1EXI A;  1VQP P;  5CCG D;  5AVW B;  4PD4 D;  1J1D B;  4I7Z B;  3L73 J;  3NXS A;  2WPS A;  2GM4 A;  1KFM A;  1L4A D;  1X8Y A;  1EQ7 A;  1N7L A;  3ZDM A;  5KLV D;  3H1H D;  1NTZ G;  4JF7 A;  2KLV A;  4PD4 E;  5AW9 B;  1ZXG A;  1M56 D;  2GUS A;  5CMZ A;  2QJP B;  2NPS D;  2YNY A;  3R4Y A;  1EZV D;  5CHX A;  2Q1K A;  3VMA A;  1JY2 N;  2HPC A;  3H1H E;  4EDF A;  1SS1 A;  5KLV J;  3H1H J;  4HJG H;  1UIX A;  2XND H;  5AW7 B;  1IFJ A;  1IC2 A;  4Y99 C;  3AE7 C;  3NFQ A;  2JJL A;  1KIL A;  5APW A;  3MHV A;  3HD7 D;  1M7L A;  4W7Z A;  1PPJ D;  2K88 A;  1AVO A;  1HVV A;  4KHX A;  1J1D C;  3OW2 O;  1WMK A;  1Y47 A;  3IAO A;  3L75 E;  2KOG A;  1VQO P;  4PJ0 H;  3VP9 A;  1PPJ E;  1UII A;  1M1J A;  4RJT A;  3Q5S A;  2FYN B;  5B5E H;  1KYO H;  5C39 A;  1NAY A;  3TF5 A;  1GTW A;  2OYI B;  1PGP A;  2QJP C;  2E75 D;  2KZJ A;  3AE2 C;  2MKV A;  4H44 D;  4IL6 H;  3CXH H;  1E5W A;  2KI7 B;  4EOT A;  3EQ2 A;  3H1J E;  5TIS H;  1OZH A;  3L73 G;  1BSN A;  1NTM K;  1JCC A;  4H0L B;  3RL0 D;  3IFM A;  1HGZ A;  1JTH B;  1EDJ A;  2W6A A;  3H1L G;  1JY3 P;  5KAF H;  5GTH H;  1MFT A;  4HB1 A;  1J2J B;  1FAV A;  2FYN C;  3BAT A;  2K3R A;  2FFD B;  2FKW B;  4ZKU A;  2E5Y A;  2OYI C;  2FY8 A;  2CPS A;  2AEF A;  4LLH A;  1N73 B;  5KAI E;  3HE5 B;  2O01 N;  5AW1 B;  4PD4 H;  3M9Q A;  1EZV G;  1L0L D;  1MKM A;  2FYU G;  1TU3 F;  3P8M C;  4RKU J;  1FDI A;  3VOP A;  2HLO A;  1K04 A;  2YXR B;  2KP8 A;  5AW6 B;  4H0L C;  3PHL A;  1H0T B;  2K9Y A;  1M90 Q;  2YKQ A;  1L0L E;  2M3B A;  2WT7 A;  1L0L J;  2C9L Y;  4BWN A;  3E7K A;  3P8C D;  2IZ0 A;  1Q82 Q;  5APT A;  3V2Q A;  3I56 P;  1QVF O;  5GTI E;  1NTK K;  2RN0 A;  3CX5 D;  1N73 C;  2JWA A;  3L35 A;  5AW8 B;  5KKZ B;  3RL0 g;  3A2A A;  3V4W A;  4GKG A;  3Q5R A;  1Q90 D;  2PAJ A;  3B5N A;  3AEF C;  2WSE J;  3CX5 E;  4L75 A;  3VN0 A;  1SQP G;  5CCH D;  1H88 A;  1YTZ T;  1P84 D;  1ZR2 A;  3AEA C;  3WUU A;  3AE8 C;  4OVN F;  1QX8 A;  2QEX P;  3CWB D;  1LWU C;  3N4X A;  2A45 H;  2OTK E;  1YYC A;  3E1R A;  2ZYG A;  1RY3 A;  1SFC D;  3RK3 B;  5KKZ C;  4XFJ A;  1VF5 D;  1GL2 B;  1VQK P;  2Y9Z A;  1IFD A;  1FZB A;  3V5B A;  1NGM B;  1SQB K;  3CWB J;  4UB8 E;  5APU A;  2IDB A;  3IR9 A;  1VDF A;  5KAI H;  1GDT A;  2WTY A;  3MD0 A;  3U59 A;  1ZN5 A;  1SQX D;  4IFM A;  1VQ8 P;  1FDO A;  1YBK A;  3BAS A;  3SWY A;  2OYI A;  1LNQ A;  2IFM A;  1PFI A;  1N7S D;  4DZO A;  2AXT H;  4I2L C;  1YIJ P;  3GHG B;  1NHL A;  5KTB A;  2WZ7 A;  2ZJS E;  3R2P A;  4OGQ B;  1FZG A;  1IJD B;  1SQX J;  2M3E A;  1YJN P;  5AVS B;  1NTZ K;  3RK3 C;  4GOF A;  3D70 A;  5AW0 B;  3H1I D;  3VMY A;  5GTI H;  1NU1 K;  1HF9 A;  3PRJ A;  4JQ0 D;  2E5T A;  5AVY B;  2O1J A;  1KOR A;  2AEM A;  2B88 A;  1NJI Q;  4U3F D;  3Q2Y A;  3QH9 A;  3H1I J;  1PIX A;  2WSE H;  3VMX A;  2ZT9 B;  3CX5 H;  3A3Y B;  2P1J A;  1N73 A;  1NTK E;  5AVZ B;  2RKL A;  2R5D A;  1X9V A;  3USS A;  3GHG C;  4WY4 D;  5CJ0 A;  1DEE G;  4OGQ C;  4U3F J;  2ZXX A;  1NKZ B;  2Q3E A;  1HGV A;  2A06 D;  3CWB G;  4L76 A;  1FC2 C;  3BCC J;  3L74 E;  2YO2 A;  1H0T A;  2J59 M;  5BU8 B;  3LIE A;  4N78 E;  1J1E B;  4EIJ A;  3RK2 B;  2Y0D A;  5APX A;  3Q1M A;  1KIL B;  1KC8 Q;  1HH0 A;  2KYV A;  2W90 A;  3AE9 C;  1LWU A;  4D6T D;  3LW5 H;  4UB6 E;  4UB8 H;  5KLI B;  2O1K A;  2FXM A;  1K8A Q;  2H89 C;  3FWN A;  2ZT9 C;  2KUB A;  1A02 F;  2IBZ G;  2C0X A;  3AE5 C;  4L74 A;  1OMI A;  2QJY B;  4GDO A;  5APQ A;  3KZI H;  2KIK A;  4WWI A;  3K5B A;  3VYI A;  4D6T J;  4H13 B;  4B86 A;  1SQB E;  2V7Q J;  1T2K D;  1RF0 A;  5KLV K;  3AED C;  1HUC A;  1J1E C;  3RK2 C;  1KZU B;  5BU5 A;  1KB9 E;  1X22 A;  3TK1 A;  3D6Y A;  1KIL C;  1LTS C;  2JP3 A;  1IFM A;  1JNM A;  2FXP A;  4IFD K;  5KLI C;  3H25 A;  1FZC B;  5BVZ A;  4U3F G;  2KS1 B;  3FXE A;  1LP1 A;  2N9Y B;  1NTZ E;  2QJY C;  4OH8 B;  3BCC G;  4IFF A;  3L72 D;  1U7J A;  3NMD A;  4H13 C;  3L37 A;  1EC5 A;  1VQM P;  3B8E B;  1LTT C;  2JR8 A;  3CC7 P;  1OW8 A;  2A06 G;  1ZW0 A;  4LC1 A;  3GW6 A;  1USD A;  3L72 J;  1QEX A;  5B5E E;  1KYO E;  2PGD A;  3CLQ A;  4JYB A;  1XTC C;  1GU5 A;  1JCD A;  5AW2 B;  3AE6 C;  1U7M A;  1FZC C;  3TNU B;  4D6T G;  2XV5 A;  2JKV A;  1L0N J;  1KQS O;  4UB6 H;  2WPQ A;  3II6 A;  1G1J A;  5KAF E;  1KTM A;  3H1L D;  3IF4 A;  2IZ1 A;  3L73 E;  1ZLL A;  3PH0 A;  2KSE A;  2BCC G;  1PGJ A;  1T6A A;  3OA7 A;  3B5N B;  1VQ4 P;  1EDK A;  3H1L J;  1KB9 H;  1WT6 A;  2RMZ A; 
#chains in the Genus database with same CATH homology
 5B5E H;  3JCU H;  4UB6 H;  4UB8 H;  5E79 H;  2AXT H;  5GTI H;  3WU2 H;  1S5L H;  3A0B H;  5KAF H;  3A0H H;  5KAI H;  5H2F H;  4IL6 H;  4PJ0 H;  5GTH H;  5B66 H;  5TIS H;  3KZI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...