1HUCA

The refined 2.15 angstroms x-ray crystal structure of human liver cathepsin b: the structural basis for its specificity
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
47
structure length
47
Chain Sequence
LPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The refined 2.15 A X-ray crystal structure of human liver cathepsin B: the structural basis for its specificity.
pubmed rcsb
source organism Homo sapiens
molecule tags Thiol protease
molecule keywords CATHEPSIN B
total genus 12
structure length 47
sequence length 47
chains with identical sequence C
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1993-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1hucA01
2C9NY 3IR9A 5AVZB 1H8AA 3TYYA 4XE5B 5AW3B 1CSBA 3HE5B 4JYCA 2QM8A 5APUA 3NMDA 2WT7A 4I2LC 1NAFA 3HE5A 3MD0A 3NTNA 5AVRB 3M0DA 3O8ZA 3T97A 3SWFA 1H88A 4EOTA 1MUUA 4M3LA 5AW4B 1HJBA 2QM7A 5AW5B 2Q5UA 5AVTB 2N9BA 5AW7B 5APWA 2W6AA 5AW2B 1GK6A 4AQRD 1OWAA 1KQLA 4GKGA 5AW0B 4LC1A 1HWTC 2C9LY 3HE4B 3HTKA 3P32A 3VMXA 2E43A 4AUWA 3KDPB 1FAVA 1MV8A 3NXSA 5AW9B 5AVXB 1J2JB 3TNUB 1SLQA 1GZLA 2WT7B 2YO2A 3A3YB 5APXA 1G2CB 1GU4A 3A7OA 4RESB 4C7NA 2E42A 3VYIA 4C7NB 4GT1A 1S9KD 3M91A 5AVQB 2WPSA 1DH3A 5AW1B 4KHXA 3NFQA 3OAKA 3L35A 3M9HA 2YO3A 3LIEA 2KP8A 2Z5HA 3LIDA 5APQA 2JJLA 3V4QA 1GTWA 1SP4A 2R3CA 3L36A 3L37A 3P8MC 1JNMA 1CZQA 5AVVB 4JYBA 3VMZA 5CMZA 2ZFCA 3M9BA 1S9KE 1JUNA 2BASA 5AW6B 1HUCA 3VN0A 1T2KC 3HE4A 1HBWA 2WPRA 2ZXEB 3UIAA 3MGNA 1A02F 4B86A 1A02J 3M06A 1H89A 1OXZA 5APVA 2P2UA 3TNUA 1GK4A 3M0AA 1NWQA 3A5TA 3V5BA 3VTPC 4HYTB 3V4WA 3B8EB 2W27A 4AYCA 4C46A 2Q3IA 2Z5IA 2R5DA 2YNYA 1X8YA 5AW8B 2WWWA 2WPQA 3VMYA 5AVWB 5AVYB 1FOSE 1T2KD 2Q7CA 2R32A 2XU6A 5AVUB 3TK1A 2R5BA 3I5CA 1IO4A 2VRSA 2IPPA 2P7JA 5APSA 2P67A 1YYCA 3A2AA 1GU5A 4DZOA 2H7HA 1CI6A 4I6MC 2XV5A 5APTA 2XZRA 3KQGA 5AVSB 1CI6B 1MFZA 3P7KA 2WTYA 1FOSF 1GD2E 5APYA
chains in the Genus database with same CATH superfamily
1P84I 1KZUB 1BCCG 1BGYE 2JWDA 2IZ1A 1JY3P 1NTZJ 3B5NA 4PD4E 5AVZB 4D6TJ 1K9MQ 1H8AA 4U7JA 2OTJP 2UWJE 1OMIA 2M8RA 1NH4A 1CSBA 1SQPG 4JYCA 2OQQA 2QM8A 1SQBG 1L0NK 3NMDA 1NAFA 1PPJG 1SQXE 4ASVA 4WY4A 3QWOC 1HF9A 2PP6A 3R4YA 1PGQA 1KYOD 2ZYAA 5B5EE 1OW6A 3TGUG 1G1IA 4OVNF 2OTKE 1M1JB 3E1RA 2QM7A 1EDIA 5CJ0A 3BATA 1AQ5A 1IK7A 1GW4A 2N9BA 5AW7B 5APWA 1MKMA 5AW2B 1S5LH 1BCCD 1GK6A 1OVRA 4CPGA 2WPVB 1BDDA 1L2PA 2XKMA 4GKGA 4LC1A 4XFJA 1LTAC 2KUBA 3H1LG 3G6EP 4H0LB 3PP5A 1FAVA 3H1KG 1MV8A 1PPJD 3NXSA 3TDKA 3CCSP 5AVXB 1RF1C 1NTZE 1YQ3C 1FJKA 4GDOA 2JP3A 1SQQJ 1SLQA 2Y0CA 1RE3C 1GZLA 2B87B 3F5HA 4U3FD 3RK3E 5CJ4A 5KTBA 3Q5SA 1VQNP 2FKWB 1S5LE 3CCVP 1JY2P 1SQQD 3PLNA 1GU4A 1MFTA 1BCCE 4C7NA 4Z1MH 3H1HG 4C7NB 4GT1A 3G9RA 4GIFA 1Z56A 4K3AA 1EXJA 3II6A 3M9QA 1S5LX 1KTMA 3IAOA 2C9LY 1PGJA 3V2RA 1LNQA 3GHGC 3B5NC 1VPCA 2ZAEB 1L0LK 2WPSA 4BRYB 1DH3A 4KHXA 1IFJA 4N78E 4XA4A 3OAKA 1N7SB 2YO3A 1BSNA 2Z5HA 3RL0D 1P84E 5K5GB 3GF7A 2G3AA 5APQA 5CCGC 2XDJA 1SQQE 3T97B 3V4QA 3WUTA 1PFIA 1URQD 1NAYA 2KSEA 1QX8A 2IFNA 4W7YA 2Y9ZA 4U3FE 3L37A 3G71P 3BRVB 3H1HD 3P8CD 2E74C 5AVVB 4JYBA 3VMZA 1NTZD 1URQA 1JCDA 1KB9H 1R5SA 2A06D 1Q82Q 3Q5PA 1M7LA 2I1KA 2A06G 2E75C 1T2KC 2QJPB 1Q81Q 3U59A 3L70D 1EC5A 1T3JA 1N7SC 2OYIA 2O3JA 5APVA 5KLIC 3SWYA 1GK4A 4HH2A 1RH5B 1SQXJ 3RBXA 3L71E 1M56D 2NPSD 3EFFK 1VQ6P 3IFMA 2QVAA 3WU2H 1OVUA 3RBZA 1N73A 2IDBA 2QIWA 4Y99C 1J1DB 2NPSA 3GLMA 4YXWH 4HJGH 2HYNA 3B71A 2PFXA 4L75A 1YI2P 2P10A 1Y47A 3B8EB 2WSSH 4AYCA 3D6YA 2LKMA 1H0TB 4Y99B 2WWWA 1N73C 1LTGC 2K9JB 3BCCE 1U7JA 3VMYA 5AVWB 1FOSE 1Y8AA 3ABVC 1VQ5P 1VQLP 2K9JA 3W67A 2W83C 1PP9D 2KIKA 2XU6A 3P8CE 4IFMA 4PD4H 1AFOA 2R44A 1GL2C 2HODB 1N7SA 1NTKE 3H1LE 2IPPA 3L75J 4GOEA 3Q3DA 1NTMK 2WSCH 3K5BA 1YIJP 2JWAA 3MUDA 3EWKA 1FC2C 1LWUC 2P67A 1KQFB 2BCCE 1KMIZ 1NTMD 4DZOA 1RE4C 5KJ7A 3L75E 1EXIA 4QMAA 1SQXK 2Q3EA 3RK3D 2H43A 1LTTC 2XV5A 1KILC 4L76A 3KQGA 1KD1Q 3PRJA 5AVSB 1CI6B 1HGZA 1MFZA 5AW0B 1FOSF 1UIXA 5APYA 2GUSA 3AEAC 1IFNA 3H1ID 1DD3A 2C9NY 3CMEP 3H1IG 1PPJE 4EIJA 2MJZA 4RJTA 4XE5B 2KZJA 2QJPC 2IYPA 5CBNA 1IC2A 3SSUA 1GL2B 4IL6E 2WT7A 3HE5A 1FZFA 1ZRTE 5AVRB 4D6TE 1SQVE 1GL2D 3M0DA 3HUSB 3SWFA 2D2CD 1H88A 1SQPJ 3CXHI 2G8YA 1MUUA 3H6PA 4NPEA 2HR3A 2ZT9C 2KK7A 1MZ9A 1NU1J 1DEEG 5AW5B 1X0TA 3H1KJ 5AVTB 1AVYA 3H1LJ 1URQB 3LW5J 2FYUJ 1KQLA 4PJ0H 3V6IA 3N7NA 3E7KA 2E5TA 2XNXA 1L0LJ 5DJTB 1FU1A 1WRGA 2BCCD 2M0BA 2YMYA 1SQPE 2ZYGA 1JB0J 2FYUG 2I8DA 3HE4B 3L72J 1YTZT 4GOFA 3RK3B 1K8AQ 2WZ7A 4DOJA 2Q9IA 1DD4A 2FYZA 3GHGA 2AXTH 1RY3A 4D6TD 1NTME 2SPZA 4Y28J 3A0HE 3CCLP 2CPBA 3FGAD 3TNUB 2HODA 3VP8A 1GL2A 2PRRA 2WQYC 3CX5I 3IF4A 2WT7B 5BU5A 1SQXD 2Z4EA 2N1TC 2OYHB 2FFDB 2J59M 3C1LA 1M1KQ 1ZW0A 2HFED 4RKUJ 4O9BA 1QVGO 1SQBJ 1VF5D 3H1IE 2ZT9D 4ZKPA 1LTJB 3QH9A 3VOPA 1EZVD 1LJ2A 2N9YB 3M0DC 1SS1A 4OGQC 1FZCB 1IFPA 2AEMA 5BU8B 1FDOA 2JKVA 2BCCJ 1SQBK 1X79B 3A0HH 3RL0g 1KQSO 2KI7B 2FYUD 1NKNA 2QJYC 3AEEC 3FXDA 5AVQB 3CCQP 1FJPA 3H1KD 4RO0A 2M3EA 2FYUK 3GHGB 2O1JA 1NU1G 5CCGD 3EQ2A 3L35A 3SFDC 2K88A 5GTIE 2Y0EA 3LIEA 2R3SA 3LIDA 1RF0C 3VP9A 1YJ9P 1QL2A 1SQQG 2JJLA 3R2PA 5KAIE 1VQMP 1SP4A 1WT6A 3MZWB 3Q2YA 3L36A 2E74D 1S72P 2RH0A 3L72D 4IFFA 4YPCA 3AEDC 2P58A 3P8MC 5B66H 1JEKA 1CZQA 1JTHB 3S4RA 1JNMA 1N8RQ 1JY3O 2FBWC 2K3RA 1HGVA 1P84H 1HTLC 1JTHA 1KILE 2E76D 1S9KE 2NRGA 1JUNA 2BASA 1NYHA 5AW6B 3CC7P 1SQPK 2KYVA 1CW5A 1BE3D 3HTKB 1VQPP 2CK3H 3TGUJ 1A02F 2E74B 1IFDA 1H89A 3TNUA 1LT9B 3AEFC 5KKZB 4WY4B 3D71A 3M0AA 3AE8C 1NWQA 2OYHA 1L4AC 1S2EA 1RF0A 1K05A 3L75D 3W68A 5KLVE 1KB9I 3TGUD 1NGMB 4PD4D 1FZCC 4PV1B 5TISE 3VTPC 1IZNB 1Q90D 5KLIB 2HPCA 1JMBA 4JPZB 2OARA 4NPDA 3RL0C 1LTJC 1HH0A 1LTBC 1NOHA 2HG5D 4C7RA 4C46A 2POHA 3CX5D 1BGYD 2Z5IA 3G3ZA 3CX5H 2FXPA 1VQ7P 1M1JC 2QE7H 2WSEJ 2YKOA 1YJNP 3KYQA 4W7ZA 3TF5A 4KJMA 3USSA 2E75D 1T2KD 1RHZB 5L8RJ 3HD7B 5AVUB 1XTCC 2B9BA 2R5BA 1PP9G 3ZDMA 2VRSA 1KC8Q 3HD7A 3BRTB 3L74J 3OJAB 5KLVD 3TGUE 1GDTA 3AE2C 3KPEA 3MIWA 1SFCD 1PGOA 4IL6H 4UB6H 2HLOA 2NPSC 3FXEA 3SWKA 1L4AD 1GU5A 4BWNA 4I7ZC 1USDA 1SQBE 2ZYDA 2K1AA 4WB4A 5APTA 1QL1A 4PV1D 3D6ZA 2QG4A 1EZVG 2IZ0A 3P7KA 1AQTA 4HB1A 4ASWA 1GD2E 1L4AA 3JC22 1RE3A 5E79H 1YHQP 3IN6A 3IR9A 4WY4D 3RK2C 1FE6A 3H1HJ 5B66E 1JCCA 1EZVE 1BSHA 1D7MA 2KS1B 3L73J 4JF7A 4WBAA 1W2BO 1FZBA 4I2LC 5CHXA 3CCUP 3MD0A 3AE4C 2QJKC 2L5GB 3WUVA 2E76B 1KYOI 4PJ0E 4M3LA 3H1KE 3CLQA 3L70J 2OYHC 1YTZI 3PTZA 1N73B 2FYUE 1J1DC 3JSVC 2Q5UA 2WITA 1NVOA 4H13B 3CXHH 4TT3H 2OYIC 2O01H 3E1IA 4AQRD 2M5AA 2BCCG 2KNCB 1N7LA 1Q2NA 2BEZF 3AE9C 4KT0J 2ITAA 3H1LD 1HWTC 2KNCA 1H0TA 5CCHD 1VDFA 3HTKA 3P32A 3WUUA 3A0BH 1SQVJ 3F89A 3CWBJ 3KDPB 4OWFA 4DJGA 1FZAA 4N78D 3CCMP 1S4XA 5AW9B 1J2JB 1QGKB 1VL2A 3TSIA 4D6TG 1SQXG 1YITP 1KILB 1FZEA 3CC2P 2RN0A 4WWIA 3H1JJ 3L71G 2E75B 2YO2A 3L74G 5APXA 1NTKK 2LXBA 3CCJP 1LTIC 1WMKA 4OGQD 4RESB 1GW3A 2E42A 1BE3J 1NKZB 1GMJA 1R8EA 3VYIA 1YJWP 2C0WA 2D2CC 1NTKG 2I1JA 2N1TB 1KYOE 2ZXXA 1L0LE 1NTKJ 2YIUC 3B4SA 2O01N 3FWLA 5CCGA 1ZR4A 1VQ9P 4BRYA 2JR8A 1X9VA 1PL5A 2P1JA 5M1BA 1KQGB 3GF3A 2KS1A 1LGHB 2M3BA 4U3FG 2QJYB 3FX0A 1EZVI 2W6JH 1BE3E 1SQQK 3RK2B 3Q5RA 4R4MA 3M9HA 1OVVA 3H32A 2KP8A 4LLHA 1KYOH 4UB8E 1URQC 2IBZG 3BCCJ 1NU1K 1PV3A 3HUSA 4JQ0D 2WVRA 1GTWA 1RE4A 5KJ7C 5TISH 3CWBD 3L73G 1EDKA 1JY2O 3CWBG 1J1EB 3CCEP 3L73D 2D2CB 3MTUE 1L0NJ 2YXQB 3HD7C 1EQ7A 2E76C 3WU2E 2M5AB 5CMZA 1ZR2A 3M9BA 2L91A 1HUCA 5BVZA 3HE4A 2FXMA 2WPRA 2ZXEB 3H25A 3UIAA 2FFDC 1JY2N 1M57D 3KHUA 3MGNA 1ZOYC 4IL6X 3CPWO 1A02J 1EDJA 3M06A 5KAFE 1OXZA 4R4LA 1FZGA 4N3YB 3PH0A 2J58A 4H44B 4ZKUA 4HKZH 1VQOP 2IYOA 1KV4A 2K37A 3L74D 1QEXA 3V5BA 2AEFA 2KXPB 1NTZG 1NTMG 1RF1B 2E43A 3L72G 1LTJA 2V4HA 1NHLA 2KB7P 2OTLP 3HUSC 2W27A 2JEEA 2QJKB 3CXHD 3ITKA 1BE3G 2R5DA 1X8YA 3C8VA 4GODA 1L0ND 5AW8B 5CBOA 2ZT9B 2WPQA 3HRNA 2O01J 2YKQA 3AEGC 1VF5B 1S1CX 5AVYB 3JCUE 1NU1D 2R32A 2Q7CA 4ZMDA 5KLVK 1KILA 1XTGB 3I5CA 2WSFJ 1UIIA 5KLVJ 2QA4P 1SQPD 4OH8B 1IO4A 5APSA 2A45H 2IFMA 1RQVA 2FFDA 1ZRTD 3RK3C 3L71D 1LT1A 5H2FE 1KILD 3CI9A 3JCUH 1G2CA 1ZP0C 2ZVNB 3FWNA 4LGDE 1OZHA 3WMM0 2AXTE 1CI6A 1OW7A 2IX7C 2NPSB 2QRXA 4IOIH 5TJHA 3Q1MA 1AJYA 2O1KA 4H13C 1FS0E 3L70E 1N2DC 3KXDA 4H0LD 1JMMA 4EDFA 2WTYA 5KJ7D 1LT9C 5KKZC 3CC4P 3CXHE 4H44D 1X22A 2QEXP 3VMAA 2OYOA 2FYNB 1IJDB 3AE7C 3L70G 3TYYA 5AW3B 3C9IA 3HE5B 3AE3C 3BVHA 3AECC 4K35A 5APUA 1OX3A 3V2NA 1FDIA 3NTNA 4JBZA 1LT9A 2V7QH 3O8ZA 3T97A 5E79E 1JOCA 2YKPA 3O6QB 4NPFX 2NZ2A 4EOTA 5KAFH 4DT0A 1T3UA 5AW4B 4EI2A 1HJBA 2C0XA 1PP9E 1Y9BA 2Y0DA 2LXCB 4W80A 2V7QJ 1VQ8P 3AE6C 2W6AA 1S3JA 1K04A 3RL0B 2RKLA 5B5EH 1OWAA 4WVZA 5CCHC 5GTHE 1KFMA 3EFGA 1SFCC 5C39A 1BCCJ 2KLUA 1FBMA 3B5ND 1JM0A 1SVFA 3BASA 3S9OA 3VMXA 4AUWA 2DW3A 1OFCX 1EDLA 3RK2D 2FXOA 2W90A 2OYIB 2AXCA 1W2EA 2N1TD 1SQBD 2B89A 2ZJSE 4UB8H 5CCHA 3BCCG 3CCRP 1USEA 2KZIA 1SFCB 5KLVG 1VF5C 1W5CE 2WSEH 2YMKA 1LP1A 2B88A 3MUDC 2LR2A 2PGDA 3A3YB 3O6QA 4OGQB 4DCKA 3L75G 3CMAP 1ZMEC 3D70A 1G2CB 3L72E 4L74A 3A7OA 1RF1A 2KSJA 2RMZA 3AE1C 2A06E 1VQKP 1AA0A 1PZQA 2WMMA 3M91A 5GTIH 1AVOA 2MKVA 1M8OB 1E5WA 2A45I 2PAJA 4A7PA 1Q7YQ 1K73Q 3GG2A 4ZNCA 4H0LC 5AW1B 2CPSA 1KN7A 2GUVA 1R5LA 3NFQA 1QVFO 2GA1A 2IBZD 2YIUB 2XNDH 3G4SP 1DEBA 1PIXA 3BCCD 1SQVK 3OA7A 2KLVA 4H13D 4YTPC 2KOGA 2Y9YA 1LWUB 3H1JE 3N4XA 1IFIA 3AEBC 5GTHH 1G1JA 2R3CA 1L0NE 4TLFA 4BXLA 1YQ4C 3KZIE 3CD6P 1DIPA 2H88C 2W8ZA 4IFDK 3A0BE 1L0LD 4N6JA 3LW5H 2K9YA 3SFEC 1J1EC 1FDMA 1BGYJ 1N86A 1RQUA 3AE5C 1NTKD 2ZFCA 1E79H 2H89C 3I56P 1VQ4P 4EYYQ 3RGUA 3V2PA 4L73A 3MHVA 3VN0A 2E5YA 2JDIH 1HBWA 2H8PD 1YBKA 2GM4A 1NU1E 1QLED 4MN4C 1ZV8A 3MP7B 1Q86Q 4H44C 2AEJA 4B86A 1BDCA 1OW8A 2W6BA 5KAIH 3OW2O 2P2UA 1KORA 3H1JD 4I1LA 1U7MA 1N7SD 4PV1C 1NJIQ 2B87A 2J5UA 2BEQD 3I55P 1LP1B 4U3FJ 1IK9A 1NTZK 2Q6QA 1KB9D 1M1JA 1ZN5A 2WSCJ 3L73E 4PD4I 3A5TA 1T8ZA 3H1HE 4YXDC 2WSFH 1DX7A 3KZIH 1IFMA 1SQVD 3H1IJ 2IBZE 4HYTB 3V4WA 1HJ0A 5H2FH 1TU3F 1U57A 1L4AB 1M90Q 2HPCB 3PHLA 2Q3IA 2YNYA 2QSIA 1JO5A 1ZLLA 2A45G 3CWBE 1FZCA 1P84D 2ZVOB 3L4FA 1L0NG 5EFWB 1NTMJ 2FYNC 2Q1KA 3CL3D 3H1JG 3HD7D 3L71J 4UB6E 2H7HA 1AV1A 1LTSC 3TK1A 1S9KD 1OIPA 1SFCA 2P7JA 1ZXGA 1KB9E 3H32B 2JO1A 3PJSK 3V2QA 1PP9J 1LWUA 1YYCA 3A2AA 1SQVG 2YXRB 3GMAA 3L74E 4I6MC 1NO4A 3GW6A 1PGPA 1HVVA 1KFNA 1L0LG 2OGUA 2XZRA 3CX5E 5DJUB 3S1KA 3U1CA 1JY3N 2IBZI 3U1AA 2N1TA 1T6AA 4WY4C 3B5NB 2FY8A 1BGYG 4I7ZB
chains in the Genus database with same CATH topology
1KZUB 1JY3P 5AVZB 3B5NA 1H8AA 2M8RA 1NH4A 1CSBA 4JYCA 2QM8A 3NMDA 1L0NK 1NAFA 4WY4A 2PP6A 1G1IA 1M1JB 2QM7A 5CJ0A 3BATA 1GW4A 2N9BA 5AW7B 5APWA 5AW2B 1GK6A 2XKMA 4GKGA 4LC1A 1LTAC 3PP5A 1FAVA 1MV8A 3NXSA 5AVXB 1FJKA 1SLQA 1RE3C 1GZLA 5KTBA 5CJ4A 2FKWB 1JY2P 1GU4A 4C7NA 4C7NB 4GT1A 4GIFA 1Z56A 3II6A 3M9QA 3V2RA 3GHGC 3B5NC 1VPCA 1L0LK 2WPSA 1DH3A 4KHXA 1IFJA 4N78E 4XA4A 3OAKA 1N7SB 2YO3A 2Z5HA 3RL0D 5CCGC 5APQA 2XDJA 3V4QA 1PFIA 1URQD 2IFNA 4W7YA 3L37A 3BRVB 3P8CD 5AVVB 4JYBA 3VMZA 1URQA 1JCDA 1M7LA 2I1KA 1T2KC 3U59A 1T3JA 1N7SC 2OYIA 5APVA 3SWYA 1GK4A 4HH2A 2NPSD 3IFMA 1N73A 4Y99C 1J1DB 2NPSA 2HYNA 3B8EB 4AYCA 2LKMA 2WWWA 1N73C 1LTGC 3VMYA 5AVWB 1FOSE 1AFOA 3P8CE 2XU6A 4IFMA 1GL2C 2HODB 1N7SA 2IPPA 1NTMK 2WSCH 3MUDA 1LWUC 2P67A 4DZOA 1RE4C 5KJ7A 1SQXK 3RK3D 2H43A 1LTTC 2XV5A 1KILC 3KQGA 5AVSB 1CI6B 1HGZA 1MFZA 1FOSF 2GUSA 1IFNA 2C9NY 4EIJA 2MJZA 4XE5B 1IC2A 1GL2B 2WT7A 3HE5A 5AVRB 1GL2D 3M0DA 3HUSB 3SWFA 1H88A 1MUUA 3H6PA 1MZ9A 5AW5B 5AVTB 1URQB 1KQLA 3N7NA 5AW0B 2XNXA 1FU1A 1WRGA 4Y99B 2YMYA 1FZFA 2C9LY 3RK3B 3HE4B 1YTZT 2Q9IA 2E43A 2WZ7A 4DOJA 2FYZA 3GHGA 1RY3A 2CPBA 3VP8A 3TNUB 2HODA 1GL2A 2WT7B 2Z4EA 5BU5A 2N1TC 2OYHB 2FFDB 2J59M 2HFED 4O9BA 4ZKPA 1LTJB 3VOPA 3M0DC 5BU8B 1SQBK 1X79B 1NKNA 5AVQB 1FJPA 3GHGB 2FYUK 2O1JA 5CCGD 3EQ2A 3L35A 3LIEA 3LIDA 1RF0C 3VP9A 1QL2A 2JJLA 3R2PA 1SP4A 1WT6A 3L36A 4IFFA 3P8MC 1JNMA 1CZQA 1JTHB 1JY3O 1HGVA 1HTLC 1JTHA 1S9KE 1JUNA 2BASA 5AW6B 1CW5A 1SQPK 2KYVA 3HTKB 1A02F 1IFDA 1H89A 3TNUA 1LT9B 4WY4B 3M0AA 1NWQA 2OYHA 1L4AC 1RF0A 1FZCC 3VTPC 2HPCA 2OARA 3RL0C 1LTJC 1HH0A 1LTBC 1NOHA 2HG5D 4C7RA 4C46A 2POHA 2Z5IA 3G3ZA 1M1JC 2YKOA 3KYQA 4W7ZA 1T2KD 3HD7B 5AVUB 1XTCC 2R5BA 2VRSA 3HD7A 3BRTB 3OJAB 1GDTA 3KPEA 3MIWA 1SFCD 2HLOA 2NPSC 1GU5A 1L4AD 4WB4A 5APTA 1QL1A 3P7KA 1GD2E 1L4AA 1RE3A 3IR9A 4WY4D 3RK2C 1JCCA 4JF7A 4WBAA 1FZBA 4I2LC 5CHXA 3MD0A 2L5GB 4M3LA 3CLQA 2OYHC 1YTZI 1N73B 1J1DC 2Q5UA 2WITA 2OYIC 2O01H 3E1IA 4AQRD 1N7LA 1HWTC 5CCHD 1VDFA 3HTKA 3P32A 3KDPB 1FZAA 4N78D 5AW9B 1J2JB 3TSIA 1KILB 1FZEA 2YO2A 5APXA 1NTKK 1LTIC 4RESB 1GW3A 2E42A 1NKZB 3VYIA 2C0WA 2I1JA 2N1TB 1S9KD 5CCGA 1ZR4A 1X9VA 2P1JA 2M3BA 1LGHB 3RK2B 1SQQK 3M9HA 3H32A 2KP8A 4LLHA 1URQC 1NU1K 3HUSA 1GTWA 1RE4A 5KJ7C 1JY2O 1J1EB 3MTUE 3HD7C 1EQ7A 5CMZA 1ZR2A 3M9BA 1HUCA 5BVZA 3HE4A 2FXMA 2WPRA 2ZXEB 2FFDC 3UIAA 1JY2N 3MGNA 1A02J 3M06A 1FZGA 1OXZA 4N3YB 2J58A 4ZKUA 3V5BA 1RF1B 1LTJA 1NHLA 2KB7P 3HUSC 2W27A 2JEEA 2R5DA 1X8YA 5AW8B 3HRNA 2WPQA 2YKQA 5AVYB 2Q7CA 2R32A 5KLVK 1KILA 1XTGB 3I5CA 1IO4A 4OH8B 5APSA 2A45H 2IFMA 2FFDA 3RK3C 1KILD 3CI9A 2H7HA 1G2CA 4LGDE 1RF1C 3WMM0 1CI6A 2IX7C 2NPSB 2O1KA 1N2DC 2WTYA 1JMMA 5KJ7D 1LT9C 1IJDB 3TYYA 5AW3B 3C9IA 3HE5B 3BVHA 5APUA 3V2NA 3NTNA 1LT9A 3O8ZA 3T97A 1JOCA 2YKPA 4EOTA 1T3UA 5AW4B 1HJBA 2C0XA 4W80A 2W6AA 3RL0B 1OWAA 5CCHC 1KFMA 3EFGA 1SFCC 3B5ND 1FBMA 3BASA 1SVFA 3VMXA 4AUWA 3RK2D 2OYIB 1W2EA 2N1TD 5CCHA 1SFCB 2WSEH 1AQ5A 3A3YB 1G2CB 3A7OA 1RF1A 2KSJA 3M91A 1FZCB 1E5WA 2A45I 2PAJA 5AW1B 2CPSA 2GUVA 3NFQA 1DEBA 3OA7A 1SQVK 2KLVA 2KOGA 1LWUB 3N4XA 1IFIA 1G1JA 2R3CA 4IFDK 4N6JA 3LW5H 1FDMA 1J1EC 1N86A 2ZFCA 3V2PA 3VN0A 1HBWA 2H8PD 2GM4A 1ZV8A 4B86A 2W6BA 2P2UA 4I1LA 1N7SD 1IK9A 1NTZK 1ZN5A 1M1JA 3A5TA 1T8ZA 2WSFH 1DX7A 1IFMA 4HYTB 3V4WA 2HPCB 1L4AB 2Q3IA 2YNYA 1JO5A 1ZLLA 2A45G 1FZCA 3L4FA 3CL3D 3HD7D 1LTSC 3TK1A 1SFCA 2P7JA 3H32B 3V2QA 1LWUA 1YYCA 3A2AA 4I6MC 1NO4A 1HVVA 1KFNA 2XZRA 3U1CA 1JY3N 3U1AA 2N1TA 4WY4C 3B5NB 5APYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C9N Y;  3IR9 A;  5AVZ B;  1H8A A;  3TYY A;  4XE5 B;  5AW3 B;  1CSB A;  3HE5 B;  4JYC A;  2QM8 A;  5APU A;  3NMD A;  2WT7 A;  4I2L C;  1NAF A;  3HE5 A;  3MD0 A;  3NTN A;  5AVR B;  3M0D A;  3O8Z A;  3T97 A;  3SWF A;  1H88 A;  4EOT A;  1MUU A;  4M3L A;  5AW4 B;  1HJB A;  2QM7 A;  5AW5 B;  2Q5U A;  5AVT B;  2N9B A;  5AW7 B;  5APW A;  2W6A A;  5AW2 B;  1GK6 A;  4AQR D;  1OWA A;  1KQL A;  4GKG A;  5AW0 B;  4LC1 A;  1HWT C;  2C9L Y;  3HE4 B;  3HTK A;  3P32 A;  3VMX A;  2E43 A;  4AUW A;  3KDP B;  1FAV A;  1MV8 A;  3NXS A;  5AW9 B;  5AVX B;  1J2J B;  3TNU B;  1SLQ A;  1GZL A;  2WT7 B;  2YO2 A;  3A3Y B;  5APX A;  1G2C B;  1GU4 A;  3A7O A;  4RES B;  4C7N A;  2E42 A;  3VYI A;  4C7N B;  4GT1 A;  1S9K D;  3M91 A;  5AVQ B;  2WPS A;  1DH3 A;  5AW1 B;  4KHX A;  3NFQ A;  3OAK A;  3L35 A;  3M9H A;  2YO3 A;  3LIE A;  2KP8 A;  2Z5H A;  3LID A;  5APQ A;  2JJL A;  3V4Q A;  1GTW A;  1SP4 A;  2R3C A;  3L36 A;  3L37 A;  3P8M C;  1JNM A;  1CZQ A;  5AVV B;  4JYB A;  3VMZ A;  5CMZ A;  2ZFC A;  3M9B A;  1S9K E;  1JUN A;  2BAS A;  5AW6 B;  1HUC A;  3VN0 A;  1T2K C;  3HE4 A;  1HBW A;  2WPR A;  2ZXE B;  3UIA A;  3MGN A;  1A02 F;  4B86 A;  1A02 J;  3M06 A;  1H89 A;  1OXZ A;  5APV A;  2P2U A;  3TNU A;  1GK4 A;  3M0A A;  1NWQ A;  3A5T A;  3V5B A;  3VTP C;  4HYT B;  3V4W A;  3B8E B;  2W27 A;  4AYC A;  4C46 A;  2Q3I A;  2Z5I A;  2R5D A;  2YNY A;  1X8Y A;  5AW8 B;  2WWW A;  2WPQ A;  3VMY A;  5AVW B;  5AVY B;  1FOS E;  1T2K D;  2Q7C A;  2R32 A;  2XU6 A;  5AVU B;  3TK1 A;  2R5B A;  3I5C A;  1IO4 A;  2VRS A;  2IPP A;  2P7J A;  5APS A;  2P67 A;  1YYC A;  3A2A A;  1GU5 A;  4DZO A;  2H7H A;  1CI6 A;  4I6M C;  2XV5 A;  5APT A;  2XZR A;  3KQG A;  5AVS B;  1CI6 B;  1MFZ A;  3P7K A;  2WTY A;  1FOS F;  1GD2 E;  5APY A; 
#chains in the Genus database with same CATH topology
 1P84 I;  1KZU B;  1BCC G;  1BGY E;  2JWD A;  2IZ1 A;  1JY3 P;  1NTZ J;  3B5N A;  4PD4 E;  5AVZ B;  4D6T J;  1K9M Q;  1H8A A;  4U7J A;  2OTJ P;  2UWJ E;  1OMI A;  2M8R A;  1NH4 A;  1CSB A;  1SQP G;  4JYC A;  2OQQ A;  2QM8 A;  1SQB G;  1L0N K;  3NMD A;  1NAF A;  1PPJ G;  1SQX E;  4ASV A;  4WY4 A;  3QWO C;  1HF9 A;  2PP6 A;  3R4Y A;  1PGQ A;  1KYO D;  2ZYA A;  5B5E E;  1OW6 A;  3TGU G;  1G1I A;  4OVN F;  2OTK E;  1M1J B;  3E1R A;  2QM7 A;  1EDI A;  5CJ0 A;  3BAT A;  1AQ5 A;  1IK7 A;  1GW4 A;  2N9B A;  5AW7 B;  5APW A;  1MKM A;  5AW2 B;  1S5L H;  1BCC D;  1GK6 A;  1OVR A;  4CPG A;  2WPV B;  1BDD A;  1L2P A;  2XKM A;  4GKG A;  4LC1 A;  4XFJ A;  1LTA C;  2KUB A;  3H1L G;  3G6E P;  4H0L B;  3PP5 A;  1FAV A;  3H1K G;  1MV8 A;  1PPJ D;  3NXS A;  3TDK A;  3CCS P;  5AVX B;  1RF1 C;  1NTZ E;  1YQ3 C;  1FJK A;  4GDO A;  2JP3 A;  1SQQ J;  1SLQ A;  2Y0C A;  1RE3 C;  1GZL A;  2B87 B;  3F5H A;  4U3F D;  3RK3 E;  5CJ4 A;  5KTB A;  3Q5S A;  1VQN P;  2FKW B;  1S5L E;  3CCV P;  1JY2 P;  1SQQ D;  3PLN A;  1GU4 A;  1MFT A;  1BCC E;  4C7N A;  4Z1M H;  3H1H G;  4C7N B;  4GT1 A;  3G9R A;  4GIF A;  1Z56 A;  4K3A A;  1EXJ A;  3II6 A;  3M9Q A;  1S5L X;  1KTM A;  3IAO A;  2C9L Y;  1PGJ A;  3V2R A;  1LNQ A;  3GHG C;  3B5N C;  1VPC A;  2ZAE B;  1L0L K;  2WPS A;  4BRY B;  1DH3 A;  4KHX A;  1IFJ A;  4N78 E;  4XA4 A;  3OAK A;  1N7S B;  2YO3 A;  1BSN A;  2Z5H A;  3RL0 D;  1P84 E;  5K5G B;  3GF7 A;  2G3A A;  5APQ A;  5CCG C;  2XDJ A;  1SQQ E;  3T97 B;  3V4Q A;  3WUT A;  1PFI A;  1URQ D;  1NAY A;  2KSE A;  1QX8 A;  2IFN A;  4W7Y A;  2Y9Z A;  4U3F E;  3L37 A;  3G71 P;  3BRV B;  3H1H D;  3P8C D;  2E74 C;  5AVV B;  4JYB A;  3VMZ A;  1NTZ D;  1URQ A;  1JCD A;  1KB9 H;  1R5S A;  2A06 D;  1Q82 Q;  3Q5P A;  1M7L A;  2I1K A;  2A06 G;  2E75 C;  1T2K C;  2QJP B;  1Q81 Q;  3U59 A;  3L70 D;  1EC5 A;  1T3J A;  1N7S C;  2OYI A;  2O3J A;  5APV A;  5KLI C;  3SWY A;  1GK4 A;  4HH2 A;  1RH5 B;  1SQX J;  3RBX A;  3L71 E;  1M56 D;  2NPS D;  3EFF K;  1VQ6 P;  3IFM A;  2QVA A;  3WU2 H;  1OVU A;  3RBZ A;  1N73 A;  2IDB A;  2QIW A;  4Y99 C;  1J1D B;  2NPS A;  3GLM A;  4YXW H;  4HJG H;  2HYN A;  3B71 A;  2PFX A;  4L75 A;  1YI2 P;  2P10 A;  1Y47 A;  3B8E B;  2WSS H;  4AYC A;  3D6Y A;  2LKM A;  1H0T B;  4Y99 B;  2WWW A;  1N73 C;  1LTG C;  2K9J B;  3BCC E;  1U7J A;  3VMY A;  5AVW B;  1FOS E;  1Y8A A;  3ABV C;  1VQ5 P;  1VQL P;  2K9J A;  3W67 A;  2W83 C;  1PP9 D;  2KIK A;  2XU6 A;  3P8C E;  4IFM A;  4PD4 H;  1AFO A;  2R44 A;  1GL2 C;  2HOD B;  1N7S A;  1NTK E;  3H1L E;  2IPP A;  3L75 J;  4GOE A;  3Q3D A;  1NTM K;  2WSC H;  3K5B A;  1YIJ P;  2JWA A;  3MUD A;  3EWK A;  1FC2 C;  1LWU C;  2P67 A;  1KQF B;  2BCC E;  1KMI Z;  1NTM D;  4DZO A;  1RE4 C;  5KJ7 A;  3L75 E;  1EXI A;  4QMA A;  1SQX K;  2Q3E A;  3RK3 D;  2H43 A;  1LTT C;  2XV5 A;  1KIL C;  4L76 A;  3KQG A;  1KD1 Q;  3PRJ A;  5AVS B;  1CI6 B;  1HGZ A;  1MFZ A;  5AW0 B;  1FOS F;  1UIX A;  5APY A;  2GUS A;  3AEA C;  1IFN A;  3H1I D;  1DD3 A;  2C9N Y;  3CME P;  3H1I G;  1PPJ E;  4EIJ A;  2MJZ A;  4RJT A;  4XE5 B;  2KZJ A;  2QJP C;  2IYP A;  5CBN A;  1IC2 A;  3SSU A;  1GL2 B;  4IL6 E;  2WT7 A;  3HE5 A;  1FZF A;  1ZRT E;  5AVR B;  4D6T E;  1SQV E;  1GL2 D;  3M0D A;  3HUS B;  3SWF A;  2D2C D;  1H88 A;  1SQP J;  3CXH I;  2G8Y A;  1MUU A;  3H6P A;  4NPE A;  2HR3 A;  2ZT9 C;  2KK7 A;  1MZ9 A;  1NU1 J;  1DEE G;  5AW5 B;  1X0T A;  3H1K J;  5AVT B;  1AVY A;  3H1L J;  1URQ B;  3LW5 J;  2FYU J;  1KQL A;  4PJ0 H;  3V6I A;  3N7N A;  3E7K A;  2E5T A;  2XNX A;  1L0L J;  5DJT B;  1FU1 A;  1WRG A;  2BCC D;  2M0B A;  2YMY A;  1SQP E;  2ZYG A;  1JB0 J;  2FYU G;  2I8D A;  3HE4 B;  3L72 J;  1YTZ T;  4GOF A;  3RK3 B;  1K8A Q;  2WZ7 A;  4DOJ A;  2Q9I A;  1DD4 A;  2FYZ A;  3GHG A;  2AXT H;  1RY3 A;  4D6T D;  1NTM E;  2SPZ A;  4Y28 J;  3A0H E;  3CCL P;  2CPB A;  3FGA D;  3TNU B;  2HOD A;  3VP8 A;  1GL2 A;  2PRR A;  2WQY C;  3CX5 I;  3IF4 A;  2WT7 B;  5BU5 A;  1SQX D;  2Z4E A;  2N1T C;  2OYH B;  2FFD B;  2J59 M;  3C1L A;  1M1K Q;  1ZW0 A;  2HFE D;  4RKU J;  4O9B A;  1QVG O;  1SQB J;  1VF5 D;  3H1I E;  2ZT9 D;  4ZKP A;  1LTJ B;  3QH9 A;  3VOP A;  1EZV D;  1LJ2 A;  2N9Y B;  3M0D C;  1SS1 A;  4OGQ C;  1FZC B;  1IFP A;  2AEM A;  5BU8 B;  1FDO A;  2JKV A;  2BCC J;  1SQB K;  1X79 B;  3A0H H;  3RL0 g;  1KQS O;  2KI7 B;  2FYU D;  1NKN A;  2QJY C;  3AEE C;  3FXD A;  5AVQ B;  3CCQ P;  1FJP A;  3H1K D;  4RO0 A;  2M3E A;  2FYU K;  3GHG B;  2O1J A;  1NU1 G;  5CCG D;  3EQ2 A;  3L35 A;  3SFD C;  2K88 A;  5GTI E;  2Y0E A;  3LIE A;  2R3S A;  3LID A;  1RF0 C;  3VP9 A;  1YJ9 P;  1QL2 A;  1SQQ G;  2JJL A;  3R2P A;  5KAI E;  1VQM P;  1SP4 A;  1WT6 A;  3MZW B;  3Q2Y A;  3L36 A;  2E74 D;  1S72 P;  2RH0 A;  3L72 D;  4IFF A;  4YPC A;  3AED C;  2P58 A;  3P8M C;  5B66 H;  1JEK A;  1CZQ A;  1JTH B;  3S4R A;  1JNM A;  1N8R Q;  1JY3 O;  2FBW C;  2K3R A;  1HGV A;  1P84 H;  1HTL C;  1JTH A;  1KIL E;  2E76 D;  1S9K E;  2NRG A;  1JUN A;  2BAS A;  1NYH A;  5AW6 B;  3CC7 P;  1SQP K;  2KYV A;  1CW5 A;  1BE3 D;  3HTK B;  1VQP P;  2CK3 H;  3TGU J;  1A02 F;  2E74 B;  1IFD A;  1H89 A;  3TNU A;  1LT9 B;  3AEF C;  5KKZ B;  4WY4 B;  3D71 A;  3M0A A;  3AE8 C;  1NWQ A;  2OYH A;  1L4A C;  1S2E A;  1RF0 A;  1K05 A;  3L75 D;  3W68 A;  5KLV E;  1KB9 I;  3TGU D;  1NGM B;  4PD4 D;  1FZC C;  4PV1 B;  5TIS E;  3VTP C;  1IZN B;  1Q90 D;  5KLI B;  2HPC A;  1JMB A;  4JPZ B;  2OAR A;  4NPD A;  3RL0 C;  1LTJ C;  1HH0 A;  1LTB C;  1NOH A;  2HG5 D;  4C7R A;  4C46 A;  2POH A;  3CX5 D;  1BGY D;  2Z5I A;  3G3Z A;  3CX5 H;  2FXP A;  1VQ7 P;  1M1J C;  2QE7 H;  2WSE J;  2YKO A;  1YJN P;  3KYQ A;  4W7Z A;  3TF5 A;  4KJM A;  3USS A;  2E75 D;  1T2K D;  1RHZ B;  5L8R J;  3HD7 B;  5AVU B;  1XTC C;  2B9B A;  2R5B A;  1PP9 G;  3ZDM A;  2VRS A;  1KC8 Q;  3HD7 A;  3BRT B;  3L74 J;  3OJA B;  5KLV D;  3TGU E;  1GDT A;  3AE2 C;  3KPE A;  3MIW A;  1SFC D;  1PGO A;  4IL6 H;  4UB6 H;  2HLO A;  2NPS C;  3FXE A;  3SWK A;  1L4A D;  1GU5 A;  4BWN A;  4I7Z C;  1USD A;  1SQB E;  2ZYD A;  2K1A A;  4WB4 A;  5APT A;  1QL1 A;  4PV1 D;  3D6Z A;  2QG4 A;  1EZV G;  2IZ0 A;  3P7K A;  1AQT A;  4HB1 A;  4ASW A;  1GD2 E;  1L4A A;  3JC2 2;  1RE3 A;  5E79 H;  1YHQ P;  3IN6 A;  3IR9 A;  4WY4 D;  3RK2 C;  1FE6 A;  3H1H J;  5B66 E;  1JCC A;  1EZV E;  1BSH A;  1D7M A;  2KS1 B;  3L73 J;  4JF7 A;  4WBA A;  1W2B O;  1FZB A;  4I2L C;  5CHX A;  3CCU P;  3MD0 A;  3AE4 C;  2QJK C;  2L5G B;  3WUV A;  2E76 B;  1KYO I;  4PJ0 E;  4M3L A;  3H1K E;  3CLQ A;  3L70 J;  2OYH C;  1YTZ I;  3PTZ A;  1N73 B;  2FYU E;  1J1D C;  3JSV C;  2Q5U A;  2WIT A;  1NVO A;  4H13 B;  3CXH H;  4TT3 H;  2OYI C;  2O01 H;  3E1I A;  4AQR D;  2M5A A;  2BCC G;  2KNC B;  1N7L A;  1Q2N A;  2BEZ F;  3AE9 C;  4KT0 J;  2ITA A;  3H1L D;  1HWT C;  2KNC A;  1H0T A;  5CCH D;  1VDF A;  3HTK A;  3P32 A;  3WUU A;  3A0B H;  1SQV J;  3F89 A;  3CWB J;  3KDP B;  4OWF A;  4DJG A;  1FZA A;  4N78 D;  3CCM P;  1S4X A;  5AW9 B;  1J2J B;  1QGK B;  1VL2 A;  3TSI A;  4D6T G;  1SQX G;  1YIT P;  1KIL B;  1FZE A;  3CC2 P;  2RN0 A;  4WWI A;  3H1J J;  3L71 G;  2E75 B;  2YO2 A;  3L74 G;  5APX A;  1NTK K;  2LXB A;  3CCJ P;  1LTI C;  1WMK A;  4OGQ D;  4RES B;  1GW3 A;  2E42 A;  1BE3 J;  1NKZ B;  1GMJ A;  1R8E A;  3VYI A;  1YJW P;  2C0W A;  2D2C C;  1NTK G;  2I1J A;  2N1T B;  1KYO E;  2ZXX A;  1L0L E;  1NTK J;  2YIU C;  3B4S A;  2O01 N;  3FWL A;  5CCG A;  1ZR4 A;  1VQ9 P;  4BRY A;  2JR8 A;  1X9V A;  1PL5 A;  2P1J A;  5M1B A;  1KQG B;  3GF3 A;  2KS1 A;  1LGH B;  2M3B A;  4U3F G;  2QJY B;  3FX0 A;  1EZV I;  2W6J H;  1BE3 E;  1SQQ K;  3RK2 B;  3Q5R A;  4R4M A;  3M9H A;  1OVV A;  3H32 A;  2KP8 A;  4LLH A;  1KYO H;  4UB8 E;  1URQ C;  2IBZ G;  3BCC J;  1NU1 K;  1PV3 A;  3HUS A;  4JQ0 D;  2WVR A;  1GTW A;  1RE4 A;  5KJ7 C;  5TIS H;  3CWB D;  3L73 G;  1EDK A;  1JY2 O;  3CWB G;  1J1E B;  3CCE P;  3L73 D;  2D2C B;  3MTU E;  1L0N J;  2YXQ B;  3HD7 C;  1EQ7 A;  2E76 C;  3WU2 E;  2M5A B;  5CMZ A;  1ZR2 A;  3M9B A;  2L91 A;  1HUC A;  5BVZ A;  3HE4 A;  2FXM A;  2WPR A;  2ZXE B;  3H25 A;  3UIA A;  2FFD C;  1JY2 N;  1M57 D;  3KHU A;  3MGN A;  1ZOY C;  4IL6 X;  3CPW O;  1A02 J;  1EDJ A;  3M06 A;  5KAF E;  1OXZ A;  4R4L A;  1FZG A;  4N3Y B;  3PH0 A;  2J58 A;  4H44 B;  4ZKU A;  4HKZ H;  1VQO P;  2IYO A;  1KV4 A;  2K37 A;  3L74 D;  1QEX A;  3V5B A;  2AEF A;  2KXP B;  1NTZ G;  1NTM G;  1RF1 B;  2E43 A;  3L72 G;  1LTJ A;  2V4H A;  1NHL A;  2KB7 P;  2OTL P;  3HUS C;  2W27 A;  2JEE A;  2QJK B;  3CXH D;  3ITK A;  1BE3 G;  2R5D A;  1X8Y A;  3C8V A;  4GOD A;  1L0N D;  5AW8 B;  5CBO A;  2ZT9 B;  2WPQ A;  3HRN A;  2O01 J;  2YKQ A;  3AEG C;  1VF5 B;  1S1C X;  5AVY B;  3JCU E;  1NU1 D;  2R32 A;  2Q7C A;  4ZMD A;  5KLV K;  1KIL A;  1XTG B;  3I5C A;  2WSF J;  1UII A;  5KLV J;  2QA4 P;  1SQP D;  4OH8 B;  1IO4 A;  5APS A;  2A45 H;  2IFM A;  1RQV A;  2FFD A;  1ZRT D;  3RK3 C;  3L71 D;  1LT1 A;  5H2F E;  1KIL D;  3CI9 A;  3JCU H;  1G2C A;  1ZP0 C;  2ZVN B;  3FWN A;  4LGD E;  1OZH A;  3WMM 0;  2AXT E;  1CI6 A;  1OW7 A;  2IX7 C;  2NPS B;  2QRX A;  4IOI H;  5TJH A;  3Q1M A;  1AJY A;  2O1K A;  4H13 C;  1FS0 E;  3L70 E;  1N2D C;  3KXD A;  4H0L D;  1JMM A;  4EDF A;  2WTY A;  5KJ7 D;  1LT9 C;  5KKZ C;  3CC4 P;  3CXH E;  4H44 D;  1X22 A;  2QEX P;  3VMA A;  2OYO A;  2FYN B;  1IJD B;  3AE7 C;  3L70 G;  3TYY A;  5AW3 B;  3C9I A;  3HE5 B;  3AE3 C;  3BVH A;  3AEC C;  4K35 A;  5APU A;  1OX3 A;  3V2N A;  1FDI A;  3NTN A;  4JBZ A;  1LT9 A;  2V7Q H;  3O8Z A;  3T97 A;  5E79 E;  1JOC A;  2YKP A;  3O6Q B;  4NPF X;  2NZ2 A;  4EOT A;  5KAF H;  4DT0 A;  1T3U A;  5AW4 B;  4EI2 A;  1HJB A;  2C0X A;  1PP9 E;  1Y9B A;  2Y0D A;  2LXC B;  4W80 A;  2V7Q J;  1VQ8 P;  3AE6 C;  2W6A A;  1S3J A;  1K04 A;  3RL0 B;  2RKL A;  5B5E H;  1OWA A;  4WVZ A;  5CCH C;  5GTH E;  1KFM A;  3EFG A;  1SFC C;  5C39 A;  1BCC J;  2KLU A;  1FBM A;  3B5N D;  1JM0 A;  1SVF A;  3BAS A;  3S9O A;  3VMX A;  4AUW A;  2DW3 A;  1OFC X;  1EDL A;  3RK2 D;  2FXO A;  2W90 A;  2OYI B;  2AXC A;  1W2E A;  2N1T D;  1SQB D;  2B89 A;  2ZJS E;  4UB8 H;  5CCH A;  3BCC G;  3CCR P;  1USE A;  2KZI A;  1SFC B;  5KLV G;  1VF5 C;  1W5C E;  2WSE H;  2YMK A;  1LP1 A;  2B88 A;  3MUD C;  2LR2 A;  2PGD A;  3A3Y B;  3O6Q A;  4OGQ B;  4DCK A;  3L75 G;  3CMA P;  1ZME C;  3D70 A;  1G2C B;  3L72 E;  4L74 A;  3A7O A;  1RF1 A;  2KSJ A;  2RMZ A;  3AE1 C;  2A06 E;  1VQK P;  1AA0 A;  1PZQ A;  2WMM A;  3M91 A;  5GTI H;  1AVO A;  2MKV A;  1M8O B;  1E5W A;  2A45 I;  2PAJ A;  4A7P A;  1Q7Y Q;  1K73 Q;  3GG2 A;  4ZNC A;  4H0L C;  5AW1 B;  2CPS A;  1KN7 A;  2GUV A;  1R5L A;  3NFQ A;  1QVF O;  2GA1 A;  2IBZ D;  2YIU B;  2XND H;  3G4S P;  1DEB A;  1PIX A;  3BCC D;  1SQV K;  3OA7 A;  2KLV A;  4H13 D;  4YTP C;  2KOG A;  2Y9Y A;  1LWU B;  3H1J E;  3N4X A;  1IFI A;  3AEB C;  5GTH H;  1G1J A;  2R3C A;  1L0N E;  4TLF A;  4BXL A;  1YQ4 C;  3KZI E;  3CD6 P;  1DIP A;  2H88 C;  2W8Z A;  4IFD K;  3A0B E;  1L0L D;  4N6J A;  3LW5 H;  2K9Y A;  3SFE C;  1J1E C;  1FDM A;  1BGY J;  1N86 A;  1RQU A;  3AE5 C;  1NTK D;  2ZFC A;  1E79 H;  2H89 C;  3I56 P;  1VQ4 P;  4EYY Q;  3RGU A;  3V2P A;  4L73 A;  3MHV A;  3VN0 A;  2E5Y A;  2JDI H;  1HBW A;  2H8P D;  1YBK A;  2GM4 A;  1NU1 E;  1QLE D;  4MN4 C;  1ZV8 A;  3MP7 B;  1Q86 Q;  4H44 C;  2AEJ A;  4B86 A;  1BDC A;  1OW8 A;  2W6B A;  5KAI H;  3OW2 O;  2P2U A;  1KOR A;  3H1J D;  4I1L A;  1U7M A;  1N7S D;  4PV1 C;  1NJI Q;  2B87 A;  2J5U A;  2BEQ D;  3I55 P;  1LP1 B;  4U3F J;  1IK9 A;  1NTZ K;  2Q6Q A;  1KB9 D;  1M1J A;  1ZN5 A;  2WSC J;  3L73 E;  4PD4 I;  3A5T A;  1T8Z A;  3H1H E;  4YXD C;  2WSF H;  1DX7 A;  3KZI H;  1IFM A;  1SQV D;  3H1I J;  2IBZ E;  4HYT B;  3V4W A;  1HJ0 A;  5H2F H;  1TU3 F;  1U57 A;  1L4A B;  1M90 Q;  2HPC B;  3PHL A;  2Q3I A;  2YNY A;  2QSI A;  1JO5 A;  1ZLL A;  2A45 G;  3CWB E;  1FZC A;  1P84 D;  2ZVO B;  3L4F A;  1L0N G;  5EFW B;  1NTM J;  2FYN C;  2Q1K A;  3CL3 D;  3H1J G;  3HD7 D;  3L71 J;  4UB6 E;  2H7H A;  1AV1 A;  1LTS C;  3TK1 A;  1S9K D;  1OIP A;  1SFC A;  2P7J A;  1ZXG A;  1KB9 E;  3H32 B;  2JO1 A;  3PJS K;  3V2Q A;  1PP9 J;  1LWU A;  1YYC A;  3A2A A;  1SQV G;  2YXR B;  3GMA A;  3L74 E;  4I6M C;  1NO4 A;  3GW6 A;  1PGP A;  1HVV A;  1KFN A;  1L0L G;  2OGU A;  2XZR A;  3CX5 E;  5DJU B;  3S1K A;  3U1C A;  1JY3 N;  2IBZ I;  3U1A A;  2N1T A;  1T6A A;  4WY4 C;  3B5N B;  2FY8 A;  1BGY G;  4I7Z B; 
#chains in the Genus database with same CATH homology
 1KZU B;  1JY3 P;  5AVZ B;  3B5N A;  1H8A A;  2M8R A;  1NH4 A;  1CSB A;  4JYC A;  2QM8 A;  3NMD A;  1L0N K;  1NAF A;  4WY4 A;  2PP6 A;  1G1I A;  1M1J B;  2QM7 A;  5CJ0 A;  3BAT A;  1GW4 A;  2N9B A;  5AW7 B;  5APW A;  5AW2 B;  1GK6 A;  2XKM A;  4GKG A;  4LC1 A;  1LTA C;  3PP5 A;  1FAV A;  1MV8 A;  3NXS A;  5AVX B;  1FJK A;  1SLQ A;  1RE3 C;  1GZL A;  5KTB A;  5CJ4 A;  2FKW B;  1JY2 P;  1GU4 A;  4C7N A;  4C7N B;  4GT1 A;  4GIF A;  1Z56 A;  3II6 A;  3M9Q A;  3V2R A;  3GHG C;  3B5N C;  1VPC A;  1L0L K;  2WPS A;  1DH3 A;  4KHX A;  1IFJ A;  4N78 E;  4XA4 A;  3OAK A;  1N7S B;  2YO3 A;  2Z5H A;  3RL0 D;  5CCG C;  5APQ A;  2XDJ A;  3V4Q A;  1PFI A;  1URQ D;  2IFN A;  4W7Y A;  3L37 A;  3BRV B;  3P8C D;  5AVV B;  4JYB A;  3VMZ A;  1URQ A;  1JCD A;  1M7L A;  2I1K A;  1T2K C;  3U59 A;  1T3J A;  1N7S C;  2OYI A;  5APV A;  3SWY A;  1GK4 A;  4HH2 A;  2NPS D;  3IFM A;  1N73 A;  4Y99 C;  1J1D B;  2NPS A;  2HYN A;  3B8E B;  4AYC A;  2LKM A;  2WWW A;  1N73 C;  1LTG C;  3VMY A;  5AVW B;  1FOS E;  1AFO A;  3P8C E;  2XU6 A;  4IFM A;  1GL2 C;  2HOD B;  1N7S A;  2IPP A;  1NTM K;  2WSC H;  3MUD A;  1LWU C;  2P67 A;  4DZO A;  1RE4 C;  5KJ7 A;  1SQX K;  3RK3 D;  2H43 A;  1LTT C;  2XV5 A;  1KIL C;  3KQG A;  5AVS B;  1CI6 B;  1HGZ A;  1MFZ A;  1FOS F;  2GUS A;  1IFN A;  2C9N Y;  4EIJ A;  2MJZ A;  4XE5 B;  1IC2 A;  1GL2 B;  2WT7 A;  3HE5 A;  5AVR B;  1GL2 D;  3M0D A;  3HUS B;  3SWF A;  1H88 A;  1MUU A;  3H6P A;  1MZ9 A;  5AW5 B;  5AVT B;  1URQ B;  1KQL A;  3N7N A;  5AW0 B;  2XNX A;  1FU1 A;  1WRG A;  4Y99 B;  2YMY A;  1FZF A;  2C9L Y;  3RK3 B;  3HE4 B;  1YTZ T;  2Q9I A;  2E43 A;  2WZ7 A;  4DOJ A;  2FYZ A;  3GHG A;  1RY3 A;  2CPB A;  3VP8 A;  3TNU B;  2HOD A;  1GL2 A;  2WT7 B;  2Z4E A;  5BU5 A;  2N1T C;  2OYH B;  2FFD B;  2J59 M;  2HFE D;  4O9B A;  4ZKP A;  1LTJ B;  3VOP A;  3M0D C;  5BU8 B;  1SQB K;  1X79 B;  1NKN A;  5AVQ B;  1FJP A;  3GHG B;  2FYU K;  2O1J A;  5CCG D;  3EQ2 A;  3L35 A;  3LIE A;  3LID A;  1RF0 C;  3VP9 A;  1QL2 A;  2JJL A;  3R2P A;  1SP4 A;  1WT6 A;  3L36 A;  4IFF A;  3P8M C;  1JNM A;  1CZQ A;  1JTH B;  1JY3 O;  1HGV A;  1HTL C;  1JTH A;  1S9K E;  1JUN A;  2BAS A;  5AW6 B;  1CW5 A;  1SQP K;  2KYV A;  3HTK B;  1A02 F;  1IFD A;  1H89 A;  3TNU A;  1LT9 B;  4WY4 B;  3M0A A;  1NWQ A;  2OYH A;  1L4A C;  1RF0 A;  1FZC C;  3VTP C;  2HPC A;  2OAR A;  3RL0 C;  1LTJ C;  1HH0 A;  1LTB C;  1NOH A;  2HG5 D;  4C7R A;  4C46 A;  2POH A;  2Z5I A;  3G3Z A;  1M1J C;  2YKO A;  3KYQ A;  4W7Z A;  1T2K D;  3HD7 B;  5AVU B;  1XTC C;  2R5B A;  2VRS A;  3HD7 A;  3BRT B;  3OJA B;  1GDT A;  3KPE A;  3MIW A;  1SFC D;  2HLO A;  2NPS C;  1GU5 A;  1L4A D;  4WB4 A;  5APT A;  1QL1 A;  3P7K A;  1GD2 E;  1L4A A;  1RE3 A;  3IR9 A;  4WY4 D;  3RK2 C;  1JCC A;  4JF7 A;  4WBA A;  1FZB A;  4I2L C;  5CHX A;  3MD0 A;  2L5G B;  4M3L A;  3CLQ A;  2OYH C;  1YTZ I;  1N73 B;  1J1D C;  2Q5U A;  2WIT A;  2OYI C;  2O01 H;  3E1I A;  4AQR D;  1N7L A;  1HWT C;  5CCH D;  1VDF A;  3HTK A;  3P32 A;  3KDP B;  1FZA A;  4N78 D;  5AW9 B;  1J2J B;  3TSI A;  1KIL B;  1FZE A;  2YO2 A;  5APX A;  1NTK K;  1LTI C;  4RES B;  1GW3 A;  2E42 A;  1NKZ B;  3VYI A;  2C0W A;  2I1J A;  2N1T B;  1S9K D;  5CCG A;  1ZR4 A;  1X9V A;  2P1J A;  2M3B A;  1LGH B;  3RK2 B;  1SQQ K;  3M9H A;  3H32 A;  2KP8 A;  4LLH A;  1URQ C;  1NU1 K;  3HUS A;  1GTW A;  1RE4 A;  5KJ7 C;  1JY2 O;  1J1E B;  3MTU E;  3HD7 C;  1EQ7 A;  5CMZ A;  1ZR2 A;  3M9B A;  1HUC A;  5BVZ A;  3HE4 A;  2FXM A;  2WPR A;  2ZXE B;  2FFD C;  3UIA A;  1JY2 N;  3MGN A;  1A02 J;  3M06 A;  1FZG A;  1OXZ A;  4N3Y B;  2J58 A;  4ZKU A;  3V5B A;  1RF1 B;  1LTJ A;  1NHL A;  2KB7 P;  3HUS C;  2W27 A;  2JEE A;  2R5D A;  1X8Y A;  5AW8 B;  3HRN A;  2WPQ A;  2YKQ A;  5AVY B;  2Q7C A;  2R32 A;  5KLV K;  1KIL A;  1XTG B;  3I5C A;  1IO4 A;  4OH8 B;  5APS A;  2A45 H;  2IFM A;  2FFD A;  3RK3 C;  1KIL D;  3CI9 A;  2H7H A;  1G2C A;  4LGD E;  1RF1 C;  3WMM 0;  1CI6 A;  2IX7 C;  2NPS B;  2O1K A;  1N2D C;  2WTY A;  1JMM A;  5KJ7 D;  1LT9 C;  1IJD B;  3TYY A;  5AW3 B;  3C9I A;  3HE5 B;  3BVH A;  5APU A;  3V2N A;  3NTN A;  1LT9 A;  3O8Z A;  3T97 A;  1JOC A;  2YKP A;  4EOT A;  1T3U A;  5AW4 B;  1HJB A;  2C0X A;  4W80 A;  2W6A A;  3RL0 B;  1OWA A;  5CCH C;  1KFM A;  3EFG A;  1SFC C;  3B5N D;  1FBM A;  3BAS A;  1SVF A;  3VMX A;  4AUW A;  3RK2 D;  2OYI B;  1W2E A;  2N1T D;  5CCH A;  1SFC B;  2WSE H;  1AQ5 A;  3A3Y B;  1G2C B;  3A7O A;  1RF1 A;  2KSJ A;  3M91 A;  1FZC B;  1E5W A;  2A45 I;  2PAJ A;  5AW1 B;  2CPS A;  2GUV A;  3NFQ A;  1DEB A;  3OA7 A;  1SQV K;  2KLV A;  2KOG A;  1LWU B;  3N4X A;  1IFI A;  1G1J A;  2R3C A;  4IFD K;  4N6J A;  3LW5 H;  1FDM A;  1J1E C;  1N86 A;  2ZFC A;  3V2P A;  3VN0 A;  1HBW A;  2H8P D;  2GM4 A;  1ZV8 A;  4B86 A;  2W6B A;  2P2U A;  4I1L A;  1N7S D;  1IK9 A;  1NTZ K;  1ZN5 A;  1M1J A;  3A5T A;  1T8Z A;  2WSF H;  1DX7 A;  1IFM A;  4HYT B;  3V4W A;  2HPC B;  1L4A B;  2Q3I A;  2YNY A;  1JO5 A;  1ZLL A;  2A45 G;  1FZC A;  3L4F A;  3CL3 D;  3HD7 D;  1LTS C;  3TK1 A;  1SFC A;  2P7J A;  3H32 B;  3V2Q A;  1LWU A;  1YYC A;  3A2A A;  4I6M C;  1NO4 A;  1HVV A;  1KFN A;  2XZR A;  3U1C A;  1JY3 N;  3U1A A;  2N1T A;  4WY4 C;  3B5N B;  5APY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...