1HUCA

The refined 2.15 angstroms x-ray crystal structure of human liver cathepsin b: the structural basis for its specificity
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
47
structure length
47
Chain Sequence
LPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN B
publication title The refined 2.15 A X-ray crystal structure of human liver cathepsin B: the structural basis for its specificity.
pubmed rcsb
source organism Homo sapiens
molecule tags Thiol protease
total genus 12
structure length 47
sequence length 47
chains with identical sequence C
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1993-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1hucA01
2Q7CA 3LIEA 3OAKA 5CMZA 4C46A 2WWWA 1NWQA 4C7NB 1J2JB 4RESB 1FOSE 2Q5UA 2R32A 3L37A 1JNMA 1X8YA 4XE5B 2N9BA 3P7KA 1SLQA 3VMXA 1GTWA 2IPPA 2ZXEB 5APVA 4I2LC 1CI6A 3V4QA 3A2AA 3VN0A 2XV5A 5APSA 3TNUA 1OXZA 1HBWA 3A3YB 1GZLA 5APTA 4AYCA 1CI6B 2WPSA 3KDPB 3VTPC 1H89A 1T2KD 5APXA 2H7HA 2R5DA 1MFZA 3KQGA 4GKGA 1A02J 3TNUB 1MV8A 5AW3B 1S9KE 4LC1A 3T97A 1KQLA 5AVQB 1GU4A 3NFQA 1GU5A 2WPRA 3A5TA 3P8MC 1GK6A 1GK4A 5APUA 3HE4A 3M9BA 2C9LY 1T2KC 1A02F 1SP4A 5AVRB 2WT7A 2R5BA 3M91A 3NXSA 5APYA 5AW5B 3HE4B 3B8EB 1CZQA 5APQA 2YO2A 3M06A 1CSBA 2VRSA 4I6MC 5AVXB 1H88A 2YNYA 3SWFA 1H8AA 4AQRD 2Z5HA 3HE5A 3MGNA 5AW2B 4AUWA 1HJBA 2XU6A 3M0AA 3I5CA 5AVZB 3TK1A 3NMDA 2JJLA 5AW1B 3HE5B 3V4WA 3L35A 3NTNA 5AW9B 2WTYA 2ZFCA 5AW7B 5AVSB 1JUNA 4JYCA 5AW6B 1HUCA 2QM7A 5AW4B 2WPQA 3O8ZA 1G2CB 1YYCA 2WT7B 3P32A 4C7NA 5AW0B 3VYIA 5AVYB 1HWTC 3HTKA 3TYYA 3M0DA 3IR9A 3L36A 2E42A 4KHXA 5AVTB 3M9HA 3UIAA 1MUUA 1GD2E 5AW8B 1DH3A 3MD0A 2KP8A 1FAVA 4EOTA 4GT1A 5AVUB 2Z5IA 2W6AA 3LIDA 4HYTB 2P7JA 2R3CA 3V5BA 2QM8A 2YO3A 3A7OA 4M3LA 2W27A 5AVVB 3VMZA 2P2UA 2Q3IA 2C9NY 2P67A 1S9KD 4B86A 4JYBA 3VMYA 4DZOA 2E43A 1NAFA 1OWAA 2BASA 2XZRA 5AVWB 1FOSF 1IO4A 5APWA
chains in the Genus database with same CATH superfamily
1NTME 5M1BA 4C46A 3H6PA 1EC5A 1VQ9P 4RESB 1IFMA 3L37A 2ZYAA 1ZV8A 4DJGA 3H1JD 5KAIE 1N7SA 5KLVK 1S5LE 3VTPC 5TISE 4PJ0E 1KYOI 5APXA 3U59A 3KQGA 3TSIA 5KLVD 2KI7B 4UB8E 3AE1C 1X79B 2JWAA 3PHLA 1KFMA 1LTSC 2BCCD 3FXEA 1L0LK 4H13D 1RF1C 1VQ5P 1N7SB 3CX5D 2R44A 4L75A 2IBZG 2M3EA 1M1JA 1TU3F 2K9JA 3GMAA 2ZT9B 1GL2C 3NMDA 1L0LD 3L35A 1G2CA 4H0LB 3MUDC 2Q3EA 1PGJA 2N1TA 2ZVOB 2H43A 1PPJG 3E1RA 1HWTC 2LXBA 2HODA 3L75G 1FAVA 4ASWA 2H88C 3H1HE 2E74D 2C9NY 1N8RQ 5C39A 2KNCA 2ITAA 1Q7YQ 3CX5I 1LTTC 3II6A 3WUTA 2OYOA 1SQVK 3AEFC 2D2CD 3VMXA 1BSNA 1WMKA 1URQC 3V4QA 3VP9A 5BVZA 2QJKB 2FYUJ 2WPSA 4JF7A 2E76C 1EZVE 2KNCB 2M8RA 1SQVD 3B71A 3KZIH 1YTZT 2KUBA 1R5SA 4BWNA 3HE4A 1BE3G 3M9BA 1NKZB 1LTJC 2CK3H 3TF5A 2KB7P 2YO2A 3FWNA 1RE3A 3E7KA 1H88A 5AVXB 1SQBE 1KTMA 3MGNA 1E5WA 3IF4A 3V4WA 4HH2A 1KV4A 1WRGA 1JMMA 2I1JA 1KN7A 3D6ZA 4TLFA 1AQ5A 3HTKA 2C0XA 5B5EE 2QJPC 5KAIH 1VL2A 1IK7A 1NTMJ 2FY8A 5AVTB 3Q1MA 1S5LH 3Q3DA 4WY4B 1NTZG 1L0NE 2W6AA 1SQQE 5TISH 3HUSA 4PJ0H 2B88A 2W27A 4EI2A 4JYBA 4UB8H 3CLQA 3L70E 2IBZI 3CMEP 3G71P 1Z56A 2ZAEB 1OIPA 3BRVB 3BCCE 1S72P 1K73Q 1SVFA 3EFFK 1SFCC 1YHQP 3T97B 1PGPA 2W8ZA 2OTKE 3CPWO 2OYIC 1CZQA 2O1KA 3M06A 5KAFE 2HR3A 3M0AA 3I5CA 1BCCD 1UIIA 3RBXA 4BRYB 4GDOA 1J1EC 1U7MA 2WPVB 2WSFH 1LNQA 5AW4B 3H1HJ 2GUSA 2WMMA 1HJ0A 2V7QJ 3VP8A 2KXPB 1OVUA 1DH3A 2IDBA 3MD0A 2DW3A 3H32B 1ZRTE 2BEQD 3A7OA 2HLOA 1N7SC 1VQ8P 5BU5A 4O9BA 1K9MQ 1FOSF 3AE5C 2ZXXA 2ZT9C 3H1ID 1YQ4C 3P7KA 3MUDA 4TT3H 1G1JA 1R5LA 3TGUG 1GMJA 1RF0A 2J58A 2ZVNB 1NTKK 3HD7D 4U3FE 3RL0B 2FYNC 1SQQG 1SQBJ 3S1KA 1M1JC 3P8MC 3BVHA 1GDTA 1N73A 3P8CD 4PV1B 1KB9H 1SQXK 3D71A 5B5EH 1M90Q 1NTKD 3I55P 2BCCE 1Q86Q 1T3UA 2QIWA 2NPSD 3CCQP 3B5ND 2AXTE 1SQXD 3Q5RA 3BCCG 2A45G 2QG4A 5AW6B 3L73D 1L0NJ 2KSEA 1L0LE 1SQQJ 1PP9D 3OA7A 3QH9A 3U1AA 4IFDK 3WUVA 3H1KD 3QWOC 3IN6A 3L70J 2O3JA 5KLIC 5CCGD 2KYVA 3A0HE 1RQVA 3VMZA 2A45H 1LT1A 1OWAA 2RH0A 3H1LD 4NPEA 1JTHB 4IFFA 4EYYQ 5CHXA 1KD1Q 2R32A 3V2NA 4UB6H 2N9BA 2H8PD 1GTWA 2YIUC 1PFIA 1OFCX 1PZQA 5KAFH 2IFNA 1VF5C 1GZLA 4H44B 3CCRP 2NZ2A 1RE3C 1ZW0A 5AVQB 1LWUB 1GU5A 2P10A 1P84D 3PJSK 1SQVE 4OGQB 2R5BA 4D6TD 1GL2D 1H0TA 1KILA 4ASVA 2W6BA 1CSBA 1FZFA 2M3BA 4I7ZC 4RJTA 2WITA 1VDFA 3AE2C 3VOPA 1KB9I 4U3FG 2WPQA 1OMIA 3HUSC 4MN4C 2K37A 2KK7A 3IR9A 1J1DB 1YTZI 4H13B 3WUUA 2Z5IA 3LIDA 3U1CA 4M3LA 4WVZA 1BDDA 3BASA 5KKZC 4GODA 3CXHI 2A06E 1KYOD 3FWLA 5AVWB 3RL0g 3H1JJ 3CC7P 1LP1A 4U3FJ 1NWQA 1QLED 1JY3P 1LTBC 2E76D 3IAOA 3SWKA 1XTGB 1VQMP 3AE7C 2IFMA 2MKVA 2A45I 5KLVJ 1X22A 3A3YB 1CI6B 1NU1K 2AXTH 2M5AB 2BCCJ 4GKGA 4RKUJ 3TNUB 1AV1A 2W6JH 5AW3B 2Y9ZA 3EFGA 4PD4H 1PGQA 1KQLA 1BGYD 2Y9YA 2HPCB 1LP1B 4KJMA 1K04A 3M91A 1NU1D 4DT0A 2WSEH 5B66E 2IYPA 1L0LJ 4GOFA 3CMAP 1EDKA 2WSEJ 2FFDB 1YJ9P 1KFNA 1NVOA 2XKMA 4HKZH 4JYCA 1HUCA 5CJ4A 1S5LX 1IZNB 1USDA 1KZUB 4C7NA 3CCLP 5AVYB 2E42A 2YMKA 4PV1C 4EOTA 5AVUB 4XA4A 2QM8A 3USSA 2AXCA 2P67A 1DD3A 3FGAD 3L72E 3RK2D 1IO4A 1RF0C 4N78D 1CW5A 2KLVA 2WWWA 1DD4A 4C7NB 3RBZA 1DEBA 1OW6A 2FYUG 1W2BO 2J5UA 1Y47A 2QA4P 1SQVJ 1N73C 2IZ1A 1SFCD 2XV5A 1JCDA 1ZLLA 1VQ7P 2G3AA 1MFZA 1W2EA 2FBWC 1JEKA 2OTLP 2C9LY 2A06G 1T2KC 2Y0DA 2HYNA 4L76A 3GW6A 1H8AA 2KS1B 4PD4I 2MJZA 1FE6A 3NTNA 2WTYA 1S4XA 3O8ZA 1SQXE 1NTMG 5EFWB 5KJ7A 1Y8AA 3OJAB 3L73E 2IBZD 1GW3A 1N7SD 4WY4A 1JY2N 3M9HA 1FZCB 2P1JA 4OGQC 1OVRA 3V5BA 5AVVB 1ZOYC 1N2DC 4DZOA 1SQPE 1PPJD 1QGKB 1UIXA 3F5HA 2JWDA 3MTUE 5APWA 1L4AA 3LIEA 2QSIA 3TDKA 3H1LE 3L75D 3MP7B 1JNMA 1X8YA 3W67A 5CJ0A 1JY3N 2E75C 2K88A 2OARA 4C7RA 3Q2YA 2IX7C 1RQUA 2Q6QA 3VN0A 2YKQA 3V6IA 1LT9B 1FJPA 1KILC 4BXLA 1S9KE 3T97A 3AEGC 3L74E 2PFXA 4YTPC 1L4AB 4N3YB 2N1TD 3L72G 1RH5B 1QEXA 3CCSP 5APQA 1BCCJ 2VRSA 4D6TE 3SWFA 1YIJP 1S3JA 2LKMA 5H2FE 4BRYA 2XU6A 3H1HG 3S9OA 5AW1B 2JR8A 2ZFCA 1OZHA 1BE3D 3GHGB 1JUNA 3CWBE 3GF3A 1DEEG 1IFJA 2QM7A 1FZGA 1VQ4P 3L72J 2E5YA 3M0DA 4K35A 3N4XA 3RK3D 2B87B 3H32A 4KHXA 3MHVA 4JQ0D 3AE6C 4U7JA 1FZBA 2V7QH 4K3AA 5CBOA 3CC4P 1EZVG 1NTZK 3H1IJ 2NPSB 4KT0J 3B5NB 1IFDA 4XFJA 1PL5A 1VF5D 2B9BA 1D7MA 1MZ9A 1YQ3C 1NTZD 1VQOP 1SQBG 4DCKA 5E79E 1VQNP 2FXPA 1NAYA 2H7HA 2R5DA 4A7PA 4CPGA 3L4FA 5CCHA 1IFIA 1R8EA 1GU4A 2WPRA 1N86A 1SQPG 3ZDMA 4H0LC 1FDMA 1LGHB 1QL1A 1SQXJ 4HB1A 3H1JE 1NU1E 3L73J 1L0NG 4I1LA 1GW4A 3HE5B 1HVVA 1NH4A 4LLHA 5KLVE 3H1KJ 3L70G 1X9VA 4Y99B 1RF1B 3L74G 1NHLA 1Y9BA 4L73A 2R3SA 1SQPJ 1FZAA 3G6EP 3L71D 4WWIA 3CX5E 1GL2B 1QL2A 3H1LJ 4NPFX 2WSSH 3M9QA 2C0WA 1JTHA 2QJKC 4OVNF 3LW5J 3CC2P 2OTJP 2GUVA 2Q7CA 3CWBG 1NYHA 3JCUE 3L74J 4N78E 1LTAC 2Y0EA 4ZNCA 1ZR2A 2H89C 2JEEA 5H2FH 3A2AA 1OXZA 3AE3C 1KQFB 3V2RA 1LWUA 1SS1A 2SPZA 4W7ZA 4D6TJ 1SQQK 2ZJSE 1KB9D 2JP3A 1RY3A 4IL6E 1EZVI 3CWBJ 1WT6A 3TGUD 3CCMP 4I6MC 2YNYA 5KJ7C 1M56D 1G1IA 2E76B 1SQQD 5AVZB 3TK1A 1EDLA 1KMIZ 1RHZB 3C8VA 4WY4C 4R4LA 1HF9A 1LT9C 3CXHD 5GTIE 5BU8B 2POHA 1L4AC 5E79H 1MUUA 2IBZE 3H1JG 3BCCD 1YJWP 1NAFA 1JY2P 2K3RA 2QJPB 5KLVG 1J2JB 2AEJA 3O6QB 1ZR4A 3GHGC 2BCCG 1EXJA 2GA1A 1Q90D 2OQQA 1CI6A 3L75E 4OWFA 1BGYJ 2M5AA 2O01N 3TNUA 4ZMDA 1HBWA 4YPCA 1FZEA 3KDPB 1T2KD 2HFED 2WVRA 3WU2E 2HPCA 1NU1J 2PAJA 1URQD 3VMAA 1QX8A 3SFEC 1L0LG 2AEFA 3RK2B 3NXSA 5APYA 3W68A 3D6YA 3B5NC 3CX5H 2WZ7A 1U57A 1JOCA 2FFDA 4GIFA 1ZRTD 2E74B 3M0DC 2HG5D 4EDFA 1SFCB 3FXDA 3EQ2A 4YXWH 1LJ2A 4YXDC 2LXCB 3CD6P 3G3ZA 2OYIB 4OGQD 4IOIH 5AW0B 3Q5PA 3JCUH 3KHUA 3A0HH 1QVGO 2D2CB 3Q5SA 2OYHA 1VPCA 5AW8B 2KP8A 2PGDA 3RK3E 2P7JA 1J1EB 2Q3IA 4U3FD 3AEEC 1BCCE 1ZN5A 3VMYA 1L2PA 3RL0C 2E75D 1SQVG 1E79H 2G8YA 5CCHC 2Q5UA 1KILD 2XNDH 4IL6H 4XE5B 1AVYA 2KLUA 4WB4A 2KOGA 2BEZF 1FC2C 2Q1KA 2OYHB 4Y99C 1W5CE 3JSVC 1M7LA 3I56P 1NTZE 4AYCA 1H89A 3IFMA 1N7LA 2KIKA 4PD4D 3E1IA 2FYZA 2WQYC 2KSJA 5GTIH 1AJYA 1DX7A 5AVRB 1YJNP 3H1IE 2KZIA 2KS1A 1HH0A 2YXRB 2JKVA 5AW2B 3AECC 4AUWA 2FXMA 2FYNB 1S1CX 2XDJA 1KQSO 2JDIH 1M1JB 2K9JB 4DOJA 1ZXGA 1LTIC 5AW7B 2N9YB 2O1JA 4IFMA 5KTBA 4JBZA 2OGUA 1G2CB 3P8CE 1YI2P 1ZP0C 1LTGC 2N1TB 1FZCA 1NTKE 2YKOA 1FDIA 2IZ0A 2ZYDA 1U7JA 1FS0E 1Q81Q 2HODB 3L71E 1RE4A 4HYTB 2CPBA 1VQPP 3WU2H 2QEXP 5DJTB 3L75J 4H44C 3C9IA 3OAKA 1LWUC 1PP9E 2E5TA 1EQ7A 3OW2O 5KLIB 2V4HA 3GF7A 1LT9A 2ZT9D 3H1KE 2GM4A 2FYUK 1JM0A 1NGMB 5APSA 3RK3B 4H0LD 2Q9IA 4NPDA 2QRXA 1KC8Q 1JCCA 3H25A 1BCCG 3A5TA 3N7NA 1GK4A 2FYUD 5B66H 5APUA 2K9YA 1DIPA 2NRGA 2YIUB 1X0TA 2IYOA 3HE4B 2PRRA 2KZJA 2RKLA 1KB9E 1VF5B 1BE3J 3KPEA 1HJBA 1PGOA 3TGUE 5L8RJ 1J1DC 3MIWA 3GHGA 4H13C 3HD7A 1NKNA 2A06D 5K5GB 1EDIA 1HGVA 4EIJA 1P84E 1IFNA 3V2QA 1FDOA 3P32A 2B87A 2XNXA 3S4RA 3TYYA 1NTMK 1OVVA 3L36A 4I7ZB 3CXHE 3AE8C 3H1IG 3HTKB 3AEDC 3RK2C 2W83C 5GTHE 3FX0A 2NPSA 4Z1MH 3B5NA 3HD7B 3AE4C 2E43A 1NTMD 3CL3D 3HUSB 3KXDA 1NO4A 1AVOA 4W7YA 2BASA 3B4SA 1NTZJ 2JO1A 3CCEP 2E74C 1JB0J 3AEAC 3F89A 1IK9A 3CCJP 2IPPA 1FJKA 5CCGA 1JO5A 2FKWB 1NTKG 4UB6E 1ZMEC 3HRNA 5KKZB 3RGUA 2D2CC 1A02J 1FBMA 4ZKPA 2B89A 3L71G 1JY2O 3GLMA 4LC1A 2QJYB 1T3JA 2QE7H 2FFDC 1MKMA 1SQXG 1KYOE 5KJ7D 3PLNA 3A0BE 3R4YA 3L73G 2K1AA 1VQ6P 1PP9G 1YBKA 4WY4D 1VQKP 3AEBC 1QVFO 2I1KA 1K05A 1EDJA 4AQRD 2WSFJ 3HE5A 2L5GB 1IJDB 3H1KG 3MZWB 1NTKJ 1Q2NA 3L72D 1JY3O 2OYHC 5AVSB 1RF1A 1BGYE 1OW7A 5DJUB 3L71J 1L4AD 5TJHA 1YYCA 2ZYGA 2RN0A 3H1LG 1GL2A 1NOHA 2YKPA 1M8OB 2M0BA 1PV3A 3H1HD 1PP9J 2UWJE 3R2PA 2R3CA 1BSHA 3KYQA 2P2UA 1FU1A 1HTLC 4B86A 1T8ZA 3CCVP 1NJIQ 2FXOA 3AE9C 2O01H 5CMZA 2Y0CA 1HGZA 1YITP 3LW5H 5APVA 4D6TG 1T6AA 2P58A 1KILE 2O01J 2J59M 3PRJA 1EZVD 5APTA 1SQBK 2N1TC 3SWYA 1AFOA 2I8DA 4RO0A 3NFQA 3TGUJ 1OX3A 1AA0A 1GK6A 1P84H 4PD4E 2PP6A 1URQA 2QVAA 1SQBD 5AW5B 1SQPK 1N73B 3B8EB 3CXHH 4ZKUA 1IC2A 4HJGH 3EWKA 5GTHH 1S2EA 1FZCC 1USEA 3SFDC 1L0NK 1LTJA 1SQPD 5AW9B 2YXQB 1KORA 3RK3C 2Z4EA 1RE4C 1URQB 4W80A 3VYIA 1Q82Q 3BCCJ 3ITKA 1L0ND 3UIAA 4GT1A 3RL0D 1IFPA 3BATA 2WSCH 4IL6X 5CCHD 3PTZA 1S9KD 3L70D 1LTJB 4PV1D 2RMZA 3L74D 3PP5A 1KYOH 2CPSA 2LR2A 3O6QA 3A0BH 2WSCJ 1BGYG 1M57D 2AEMA 3PH0A 1FOSE 4LGDE 4GOEA 1EXIA 1SLQA 4JPZB 1AQTA 2ZXEB 4I2LC 1NU1G 5CBNA 4OH8B 1MFTA 3SSUA 1VQLP 2L91A 1MV8A 3CWBD 1PPJE 1XTCC 2YMYA 1A02F 1K8AQ 1SP4A 3HD7C 2WT7A 1KQGB 2E75B 1JMBA 1M1KQ 2FYUE 4N6JA 1H0TB 1KILB 3V2PA 2Z5HA 3GG2A 1SFCA 3K5BA 2JJLA 4QMAA 1P84I 3WMM0 3C1LA 3KZIE 2OYIA 1PIXA 2NPSC 3ABVC 3BRTB 3CCUP 1OW8A 2WT7B 2QJYC 3G9RA 3CI9A 3JC22 4H44D 4WBAA 1GD2E 3D70A 2W90A 2YO3A 4L74A 5CCGC 3G4SP 1BDCA 4R4MA 1BE3E 2XZRA 4Y28J
chains in the Genus database with same CATH topology
4IFFA 3OAKA 1LWUC 4C46A 5CHXA 3H6PA 1EQ7A 4RESB 1IFMA 2R32A 3L37A 3V2NA 2N9BA 2H8PD 1ZV8A 1GTWA 1MZ9A 5KLVK 1N7SA 1PFIA 1LT9A 2GM4A 2FYUK 5APSA 3RK3B 2IFNA 1GZLA 3VTPC 5APXA 2H7HA 3U59A 2R5DA 2Q9IA 3KQGA 1RE3C 5CCHA 3L4FA 3TSIA 1JCCA 1IFIA 5AVQB 1LWUB 1GU4A 1GU5A 2WPRA 3A5TA 1N86A 3N7NA 1X79B 1GK4A 5APUA 1KFMA 1LTSC 1FDMA 1LGHB 1L0LK 1QL1A 2R5BA 1GL2D 1KILA 3HE4B 2W6BA 1RF1C 1N7SB 1CSBA 1FZFA 2M3BA 3KPEA 1HJBA 4I1LA 1M1JA 2WITA 1VDFA 1J1DC 1GL2C 3MIWA 3NMDA 3GHGA 1GW4A 3HE5B 3HD7A 3L35A 1HVVA 1NH4A 1NKNA 4LLHA 1G2CA 3VOPA 1HGVA 2WPQA 4EIJA 1X9VA 3HUSC 4Y99B 1IFNA 2N1TA 3V2QA 2H43A 1RF1B 1NHLA 3P32A 2XNXA 1HWTC 1FZAA 3TYYA 1NTMK 3IR9A 3L36A 2HODA 1J1DB 3HTKB 1GL2B 1YTZI 1FAVA 3RK2C 1QL2A 2Z5IA 3LIDA 2NPSA 3U1CA 4M3LA 2C9NY 3BASA 3B5NA 3HD7B 3M9QA 2C0WA 1JTHA 2E43A 3CL3D 3HUSB 1NO4A 4W7YA 2BASA 5AVWB 1LTTC 2GUVA 3II6A 2Q7CA 1NWQA 1JY3P 1LTBC 1SQVK 4N78E 1LTAC 3VMXA 1IK9A 2IPPA 1XTGB 1FJKA 1ZR2A 2IFMA 2A45I 2JEEA 5CCGA 1JO5A 2FKWB 1URQC 3V4QA 3A2AA 3VP9A 1OXZA 5BVZA 3HRNA 3A3YB 1CI6B 2WPSA 3V2RA 1NU1K 4JF7A 1LWUA 4GKGA 1A02J 1FBMA 3TNUB 4ZKPA 1JY2O 5AW3B 2M8RA 3EFGA 4W7ZA 4LC1A 1YTZT 1KQLA 1T3JA 2FFDC 2HPCB 5KJ7D 1SQQK 3HE4A 3M9BA 1NKZB 3M91A 1LTJC 1RY3A 2WSEH 1WT6A 2KB7P 2YO2A 4WY4D 1RE3A 4I6MC 1H88A 5AVXB 2YNYA 2I1KA 5KJ7C 4AQRD 1G1IA 3HE5A 3MGNA 2L5GB 1E5WA 1IJDB 5AVZB 3TK1A 2FFDB 3V4WA 4HH2A 4WY4C 1JY3O 1KFNA 1WRGA 2OYHC 1JMMA 2XKMA 5AVSB 1RF1A 2I1JA 4JYCA 1HUCA 5CJ4A 1L4AD 1LT9C 1YYCA 1KZUB 4C7NA 1AQ5A 5AVYB 5BU8B 3HTKA 2C0XA 1GL2A 1NOHA 2POHA 2YKPA 2E42A 1L4AC 5AVTB 1MUUA 4EOTA 5AVUB 4WY4B 3R2PA 4XA4A 2W6AA 2R3CA 3HUSA 2QM8A 3KYQA 2W27A 2P2UA 1FU1A 1HTLC 2P67A 4B86A 4JYBA 1T8ZA 1NAFA 3RK2D 1IO4A 1JY2P 3CLQA 1RF0C 4N78D 1CW5A 2O01H 2KLVA 5CMZA 2WWWA 4C7NB 1J2JB 1Z56A 1HGZA 1DEBA 1ZR4A 3GHGC 3LW5H 5APVA 1CI6A 3BRVB 1N73C 2J59M 1SFCD 2XV5A 3TNUA 1HBWA 1JCDA 1FZEA 1SQBK 1ZLLA 3KDPB 5APTA 2N1TC 1T2KD 2HFED 1MFZA 3SWYA 1W2EA 2HPCA 1AFOA 2PAJA 1URQD 1SVFA 3NFQA 1SFCC 1GK6A 2PP6A 2C9LY 1URQA 1T2KC 3RK2B 3NXSA 5APYA 2HYNA 1SQPK 5AW5B 1N73B 2OYIC 3B8EB 1CZQA 4ZKUA 2O1KA 3B5NC 3M06A 1IC2A 2WZ7A 1JOCA 1H8AA 2FFDA 4GIFA 3M0AA 3I5CA 1FZCC 2MJZA 3M0DC 2HG5D 1SFCB 1L0NK 1LTJA 3EQ2A 3NTNA 5AW9B 2WTYA 1J1EC 2WSFH 3RK3C 5AW4B 3O8ZA 2Z4EA 1RE4C 3G3ZA 5KJ7A 2GUSA 2OYIB 1URQB 3OJAB 4W80A 5AW0B 3VYIA 3VP8A 1GW3A 1N7SD 4WY4A 1JY2N 3M9HA 3UIAA 2OYHA 1FZCB 1VPCA 2P1JA 5AW8B 1DH3A 3MD0A 2KP8A 4GT1A 3RL0D 3BATA 3H32B 2P7JA 3V5BA 1J1EB 3A7OA 5AVVB 2HLOA 2WSCH 2Q3IA 5CCHD 1N7SC 1S9KD 1LTJB 1N2DC 1ZN5A 3VMYA 4DZOA 5BU5A 4O9BA 1FOSF 3MTUE 3PP5A 2CPSA 5APWA 3RL0C 1L4AA 3LIEA 5CCHC 1FOSE 2Q5UA 1KILD 4LGDE 1JNMA 1X8YA 4XE5B 3P7KA 4WB4A 2KOGA 3MUDA 1SLQA 1G1JA 5CJ0A 2ZXEB 4I2LC 1JY3N 2OYHB 2OARA 4Y99C 4C7RA 2IX7C 4OH8B 3VN0A 2YKQA 1M7LA 1LT9B 1RF0A 4AYCA 1FJPA 1KILC 1H89A 3IFMA 2J58A 1N7LA 1NTKK 3HD7D 1MV8A 3RL0B 1S9KE 3E1IA 2FYZA 3T97A 2KSJA 1M1JC 1L4AB 3P8MC 4N3YB 3BVHA 1GDTA 2N1TD 1N73A 1XTCC 3P8CD 2YMYA 1A02F 1DX7A 1SP4A 3HD7C 5AVRB 2WT7A 1SQXK 5APQA 2VRSA 4N6JA 1HH0A 1KILB 3V2PA 3SWFA 1T3UA 2Z5HA 2LKMA 5AW2B 4AUWA 2FXMA 1SFCA 2XU6A 2NPSD 2XDJA 2JJLA 5AW1B 3B5ND 1M1JB 4DOJA 1LTIC 2ZFCA 3WMM0 5AW7B 2O1JA 3GHGB 4IFMA 2OYIA 1JUNA 2A45G 5KTBA 5AW6B 1IFJA 2QM7A 1FZGA 2NPSC 1G2CB 3BRTB 3OA7A 3P8CE 2WT7B 1LTGC 3U1AA 2N1TB 1FZCA 4IFDK 3M0DA 2YKOA 3N4XA 3RK3D 3CI9A 3H32A 4KHXA 5CCGD 4WBAA 1GD2E 2KYVA 2HODB 1FZBA 1RE4A 4HYTB 2YO3A 3VMZA 2A45H 2CPBA 1NTZK 2NPSB 5CCGC 1OWAA 2XZRA 3B5NB 1IFDA 1JTHB 3C9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7C A;  3LIE A;  3OAK A;  5CMZ A;  4C46 A;  2WWW A;  1NWQ A;  4C7N B;  1J2J B;  4RES B;  1FOS E;  2Q5U A;  2R32 A;  3L37 A;  1JNM A;  1X8Y A;  4XE5 B;  2N9B A;  3P7K A;  1SLQ A;  3VMX A;  1GTW A;  2IPP A;  2ZXE B;  5APV A;  4I2L C;  1CI6 A;  3V4Q A;  3A2A A;  3VN0 A;  2XV5 A;  5APS A;  3TNU A;  1OXZ A;  1HBW A;  3A3Y B;  1GZL A;  5APT A;  4AYC A;  1CI6 B;  2WPS A;  3KDP B;  3VTP C;  1H89 A;  1T2K D;  5APX A;  2H7H A;  2R5D A;  1MFZ A;  3KQG A;  4GKG A;  1A02 J;  3TNU B;  1MV8 A;  5AW3 B;  1S9K E;  4LC1 A;  3T97 A;  1KQL A;  5AVQ B;  1GU4 A;  3NFQ A;  1GU5 A;  2WPR A;  3A5T A;  3P8M C;  1GK6 A;  1GK4 A;  5APU A;  3HE4 A;  3M9B A;  2C9L Y;  1T2K C;  1A02 F;  1SP4 A;  5AVR B;  2WT7 A;  2R5B A;  3M91 A;  3NXS A;  5APY A;  5AW5 B;  3HE4 B;  3B8E B;  1CZQ A;  5APQ A;  2YO2 A;  3M06 A;  1CSB A;  2VRS A;  4I6M C;  5AVX B;  1H88 A;  2YNY A;  3SWF A;  1H8A A;  4AQR D;  2Z5H A;  3HE5 A;  3MGN A;  5AW2 B;  4AUW A;  1HJB A;  2XU6 A;  3M0A A;  3I5C A;  5AVZ B;  3TK1 A;  3NMD A;  2JJL A;  5AW1 B;  3HE5 B;  3V4W A;  3L35 A;  3NTN A;  5AW9 B;  2WTY A;  2ZFC A;  5AW7 B;  5AVS B;  1JUN A;  4JYC A;  5AW6 B;  1HUC A;  2QM7 A;  5AW4 B;  2WPQ A;  3O8Z A;  1G2C B;  1YYC A;  2WT7 B;  3P32 A;  4C7N A;  5AW0 B;  3VYI A;  5AVY B;  1HWT C;  3HTK A;  3TYY A;  3M0D A;  3IR9 A;  3L36 A;  2E42 A;  4KHX A;  5AVT B;  3M9H A;  3UIA A;  1MUU A;  1GD2 E;  5AW8 B;  1DH3 A;  3MD0 A;  2KP8 A;  1FAV A;  4EOT A;  4GT1 A;  5AVU B;  2Z5I A;  2W6A A;  3LID A;  4HYT B;  2P7J A;  2R3C A;  3V5B A;  2QM8 A;  2YO3 A;  3A7O A;  4M3L A;  2W27 A;  5AVV B;  3VMZ A;  2P2U A;  2Q3I A;  2C9N Y;  2P67 A;  1S9K D;  4B86 A;  4JYB A;  3VMY A;  4DZO A;  2E43 A;  1NAF A;  1OWA A;  2BAS A;  2XZR A;  5AVW B;  1FOS F;  1IO4 A;  5APW A; 
#chains in the Genus database with same CATH topology
 1NTM E;  5M1B A;  4C46 A;  3H6P A;  1EC5 A;  1VQ9 P;  4RES B;  1IFM A;  3L37 A;  2ZYA A;  1ZV8 A;  4DJG A;  3H1J D;  5KAI E;  1N7S A;  5KLV K;  1S5L E;  3VTP C;  5TIS E;  4PJ0 E;  1KYO I;  5APX A;  3U59 A;  3KQG A;  3TSI A;  5KLV D;  2KI7 B;  4UB8 E;  3AE1 C;  1X79 B;  2JWA A;  3PHL A;  1KFM A;  1LTS C;  2BCC D;  3FXE A;  1L0L K;  4H13 D;  1RF1 C;  1VQ5 P;  1N7S B;  3CX5 D;  2R44 A;  4L75 A;  2IBZ G;  2M3E A;  1M1J A;  1TU3 F;  2K9J A;  3GMA A;  2ZT9 B;  1GL2 C;  3NMD A;  1L0L D;  3L35 A;  1G2C A;  4H0L B;  3MUD C;  2Q3E A;  1PGJ A;  2N1T A;  2ZVO B;  2H43 A;  1PPJ G;  3E1R A;  1HWT C;  2LXB A;  2HOD A;  3L75 G;  1FAV A;  4ASW A;  2H88 C;  3H1H E;  2E74 D;  2C9N Y;  1N8R Q;  5C39 A;  2KNC A;  2ITA A;  1Q7Y Q;  3CX5 I;  1LTT C;  3II6 A;  3WUT A;  2OYO A;  1SQV K;  3AEF C;  2D2C D;  3VMX A;  1BSN A;  1WMK A;  1URQ C;  3V4Q A;  3VP9 A;  5BVZ A;  2QJK B;  2FYU J;  2WPS A;  4JF7 A;  2E76 C;  1EZV E;  2KNC B;  2M8R A;  1SQV D;  3B71 A;  3KZI H;  1YTZ T;  2KUB A;  1R5S A;  4BWN A;  3HE4 A;  1BE3 G;  3M9B A;  1NKZ B;  1LTJ C;  2CK3 H;  3TF5 A;  2KB7 P;  2YO2 A;  3FWN A;  1RE3 A;  3E7K A;  1H88 A;  5AVX B;  1SQB E;  1KTM A;  3MGN A;  1E5W A;  3IF4 A;  3V4W A;  4HH2 A;  1KV4 A;  1WRG A;  1JMM A;  2I1J A;  1KN7 A;  3D6Z A;  4TLF A;  1AQ5 A;  3HTK A;  2C0X A;  5B5E E;  2QJP C;  5KAI H;  1VL2 A;  1IK7 A;  1NTM J;  2FY8 A;  5AVT B;  3Q1M A;  1S5L H;  3Q3D A;  4WY4 B;  1NTZ G;  1L0N E;  2W6A A;  1SQQ E;  5TIS H;  3HUS A;  4PJ0 H;  2B88 A;  2W27 A;  4EI2 A;  4JYB A;  4UB8 H;  3CLQ A;  3L70 E;  2IBZ I;  3CME P;  3G71 P;  1Z56 A;  2ZAE B;  1OIP A;  3BRV B;  3BCC E;  1S72 P;  1K73 Q;  1SVF A;  3EFF K;  1SFC C;  1YHQ P;  3T97 B;  1PGP A;  2W8Z A;  2OTK E;  3CPW O;  2OYI C;  1CZQ A;  2O1K A;  3M06 A;  5KAF E;  2HR3 A;  3M0A A;  3I5C A;  1BCC D;  1UII A;  3RBX A;  4BRY B;  4GDO A;  1J1E C;  1U7M A;  2WPV B;  2WSF H;  1LNQ A;  5AW4 B;  3H1H J;  2GUS A;  2WMM A;  1HJ0 A;  2V7Q J;  3VP8 A;  2KXP B;  1OVU A;  1DH3 A;  2IDB A;  3MD0 A;  2DW3 A;  3H32 B;  1ZRT E;  2BEQ D;  3A7O A;  2HLO A;  1N7S C;  1VQ8 P;  5BU5 A;  4O9B A;  1K9M Q;  1FOS F;  3AE5 C;  2ZXX A;  2ZT9 C;  3H1I D;  1YQ4 C;  3P7K A;  3MUD A;  4TT3 H;  1G1J A;  1R5L A;  3TGU G;  1GMJ A;  1RF0 A;  2J58 A;  2ZVN B;  1NTK K;  3HD7 D;  4U3F E;  3RL0 B;  2FYN C;  1SQQ G;  1SQB J;  3S1K A;  1M1J C;  3P8M C;  3BVH A;  1GDT A;  1N73 A;  3P8C D;  4PV1 B;  1KB9 H;  1SQX K;  3D71 A;  5B5E H;  1M90 Q;  1NTK D;  3I55 P;  2BCC E;  1Q86 Q;  1T3U A;  2QIW A;  2NPS D;  3CCQ P;  3B5N D;  2AXT E;  1SQX D;  3Q5R A;  3BCC G;  2A45 G;  2QG4 A;  5AW6 B;  3L73 D;  1L0N J;  2KSE A;  1L0L E;  1SQQ J;  1PP9 D;  3OA7 A;  3QH9 A;  3U1A A;  4IFD K;  3WUV A;  3H1K D;  3QWO C;  3IN6 A;  3L70 J;  2O3J A;  5KLI C;  5CCG D;  2KYV A;  3A0H E;  1RQV A;  3VMZ A;  2A45 H;  1LT1 A;  1OWA A;  2RH0 A;  3H1L D;  4NPE A;  1JTH B;  4IFF A;  4EYY Q;  5CHX A;  1KD1 Q;  2R32 A;  3V2N A;  4UB6 H;  2N9B A;  2H8P D;  1GTW A;  2YIU C;  1PFI A;  1OFC X;  1PZQ A;  5KAF H;  2IFN A;  1VF5 C;  1GZL A;  4H44 B;  3CCR P;  2NZ2 A;  1RE3 C;  1ZW0 A;  5AVQ B;  1LWU B;  1GU5 A;  2P10 A;  1P84 D;  3PJS K;  1SQV E;  4OGQ B;  2R5B A;  4D6T D;  1GL2 D;  1H0T A;  1KIL A;  4ASV A;  2W6B A;  1CSB A;  1FZF A;  2M3B A;  4I7Z C;  4RJT A;  2WIT A;  1VDF A;  3AE2 C;  3VOP A;  1KB9 I;  4U3F G;  2WPQ A;  1OMI A;  3HUS C;  4MN4 C;  2K37 A;  2KK7 A;  3IR9 A;  1J1D B;  1YTZ I;  4H13 B;  3WUU A;  2Z5I A;  3LID A;  3U1C A;  4M3L A;  4WVZ A;  1BDD A;  3BAS A;  5KKZ C;  4GOD A;  3CXH I;  2A06 E;  1KYO D;  3FWL A;  5AVW B;  3RL0 g;  3H1J J;  3CC7 P;  1LP1 A;  4U3F J;  1NWQ A;  1QLE D;  1JY3 P;  1LTB C;  2E76 D;  3IAO A;  3SWK A;  1XTG B;  1VQM P;  3AE7 C;  2IFM A;  2MKV A;  2A45 I;  5KLV J;  1X22 A;  3A3Y B;  1CI6 B;  1NU1 K;  2AXT H;  2M5A B;  2BCC J;  4GKG A;  4RKU J;  3TNU B;  1AV1 A;  2W6J H;  5AW3 B;  2Y9Z A;  3EFG A;  4PD4 H;  1PGQ A;  1KQL A;  1BGY D;  2Y9Y A;  2HPC B;  1LP1 B;  4KJM A;  1K04 A;  3M91 A;  1NU1 D;  4DT0 A;  2WSE H;  5B66 E;  2IYP A;  1L0L J;  4GOF A;  3CMA P;  1EDK A;  2WSE J;  2FFD B;  1YJ9 P;  1KFN A;  1NVO A;  2XKM A;  4HKZ H;  4JYC A;  1HUC A;  5CJ4 A;  1S5L X;  1IZN B;  1USD A;  1KZU B;  4C7N A;  3CCL P;  5AVY B;  2E42 A;  2YMK A;  4PV1 C;  4EOT A;  5AVU B;  4XA4 A;  2QM8 A;  3USS A;  2AXC A;  2P67 A;  1DD3 A;  3FGA D;  3L72 E;  3RK2 D;  1IO4 A;  1RF0 C;  4N78 D;  1CW5 A;  2KLV A;  2WWW A;  1DD4 A;  4C7N B;  3RBZ A;  1DEB A;  1OW6 A;  2FYU G;  1W2B O;  2J5U A;  1Y47 A;  2QA4 P;  1SQV J;  1N73 C;  2IZ1 A;  1SFC D;  2XV5 A;  1JCD A;  1ZLL A;  1VQ7 P;  2G3A A;  1MFZ A;  1W2E A;  2FBW C;  1JEK A;  2OTL P;  2C9L Y;  2A06 G;  1T2K C;  2Y0D A;  2HYN A;  4L76 A;  3GW6 A;  1H8A A;  2KS1 B;  4PD4 I;  2MJZ A;  1FE6 A;  3NTN A;  2WTY A;  1S4X A;  3O8Z A;  1SQX E;  1NTM G;  5EFW B;  5KJ7 A;  1Y8A A;  3OJA B;  3L73 E;  2IBZ D;  1GW3 A;  1N7S D;  4WY4 A;  1JY2 N;  3M9H A;  1FZC B;  2P1J A;  4OGQ C;  1OVR A;  3V5B A;  5AVV B;  1ZOY C;  1N2D C;  4DZO A;  1SQP E;  1PPJ D;  1QGK B;  1UIX A;  3F5H A;  2JWD A;  3MTU E;  5APW A;  1L4A A;  3LIE A;  2QSI A;  3TDK A;  3H1L E;  3L75 D;  3MP7 B;  1JNM A;  1X8Y A;  3W67 A;  5CJ0 A;  1JY3 N;  2E75 C;  2K88 A;  2OAR A;  4C7R A;  3Q2Y A;  2IX7 C;  1RQU A;  2Q6Q A;  3VN0 A;  2YKQ A;  3V6I A;  1LT9 B;  1FJP A;  1KIL C;  4BXL A;  1S9K E;  3T97 A;  3AEG C;  3L74 E;  2PFX A;  4YTP C;  1L4A B;  4N3Y B;  2N1T D;  3L72 G;  1RH5 B;  1QEX A;  3CCS P;  5APQ A;  1BCC J;  2VRS A;  4D6T E;  3SWF A;  1YIJ P;  1S3J A;  2LKM A;  5H2F E;  4BRY A;  2XU6 A;  3H1H G;  3S9O A;  5AW1 B;  2JR8 A;  2ZFC A;  1OZH A;  1BE3 D;  3GHG B;  1JUN A;  3CWB E;  3GF3 A;  1DEE G;  1IFJ A;  2QM7 A;  1FZG A;  1VQ4 P;  3L72 J;  2E5Y A;  3M0D A;  4K35 A;  3N4X A;  3RK3 D;  2B87 B;  3H32 A;  4KHX A;  3MHV A;  4JQ0 D;  3AE6 C;  4U7J A;  1FZB A;  2V7Q H;  4K3A A;  5CBO A;  3CC4 P;  1EZV G;  1NTZ K;  3H1I J;  2NPS B;  4KT0 J;  3B5N B;  1IFD A;  4XFJ A;  1PL5 A;  1VF5 D;  2B9B A;  1D7M A;  1MZ9 A;  1YQ3 C;  1NTZ D;  1VQO P;  1SQB G;  4DCK A;  5E79 E;  1VQN P;  2FXP A;  1NAY A;  2H7H A;  2R5D A;  4A7P A;  4CPG A;  3L4F A;  5CCH A;  1IFI A;  1R8E A;  1GU4 A;  2WPR A;  1N86 A;  1SQP G;  3ZDM A;  4H0L C;  1FDM A;  1LGH B;  1QL1 A;  1SQX J;  4HB1 A;  3H1J E;  1NU1 E;  3L73 J;  1L0N G;  4I1L A;  1GW4 A;  3HE5 B;  1HVV A;  1NH4 A;  4LLH A;  5KLV E;  3H1K J;  3L70 G;  1X9V A;  4Y99 B;  1RF1 B;  3L74 G;  1NHL A;  1Y9B A;  4L73 A;  2R3S A;  1SQP J;  1FZA A;  3G6E P;  3L71 D;  4WWI A;  3CX5 E;  1GL2 B;  1QL2 A;  3H1L J;  4NPF X;  2WSS H;  3M9Q A;  2C0W A;  1JTH A;  2QJK C;  4OVN F;  3LW5 J;  3CC2 P;  2OTJ P;  2GUV A;  2Q7C A;  3CWB G;  1NYH A;  3JCU E;  3L74 J;  4N78 E;  1LTA C;  2Y0E A;  4ZNC A;  1ZR2 A;  2H89 C;  2JEE A;  5H2F H;  3A2A A;  1OXZ A;  3AE3 C;  1KQF B;  3V2R A;  1LWU A;  1SS1 A;  2SPZ A;  4W7Z A;  4D6T J;  1SQQ K;  2ZJS E;  1KB9 D;  2JP3 A;  1RY3 A;  4IL6 E;  1EZV I;  3CWB J;  1WT6 A;  3TGU D;  3CCM P;  4I6M C;  2YNY A;  5KJ7 C;  1M56 D;  1G1I A;  2E76 B;  1SQQ D;  5AVZ B;  3TK1 A;  1EDL A;  1KMI Z;  1RHZ B;  3C8V A;  4WY4 C;  4R4L A;  1HF9 A;  1LT9 C;  3CXH D;  5GTI E;  5BU8 B;  2POH A;  1L4A C;  5E79 H;  1MUU A;  2IBZ E;  3H1J G;  3BCC D;  1YJW P;  1NAF A;  1JY2 P;  2K3R A;  2QJP B;  5KLV G;  1J2J B;  2AEJ A;  3O6Q B;  1ZR4 A;  3GHG C;  2BCC G;  1EXJ A;  2GA1 A;  1Q90 D;  2OQQ A;  1CI6 A;  3L75 E;  4OWF A;  1BGY J;  2M5A A;  2O01 N;  3TNU A;  4ZMD A;  1HBW A;  4YPC A;  1FZE A;  3KDP B;  1T2K D;  2HFE D;  2WVR A;  3WU2 E;  2HPC A;  1NU1 J;  2PAJ A;  1URQ D;  3VMA A;  1QX8 A;  3SFE C;  1L0L G;  2AEF A;  3RK2 B;  3NXS A;  5APY A;  3W68 A;  3D6Y A;  3B5N C;  3CX5 H;  2WZ7 A;  1U57 A;  1JOC A;  2FFD A;  4GIF A;  1ZRT D;  2E74 B;  3M0D C;  2HG5 D;  4EDF A;  1SFC B;  3FXD A;  3EQ2 A;  4YXW H;  1LJ2 A;  4YXD C;  2LXC B;  3CD6 P;  3G3Z A;  2OYI B;  4OGQ D;  4IOI H;  5AW0 B;  3Q5P A;  3JCU H;  3KHU A;  3A0H H;  1QVG O;  2D2C B;  3Q5S A;  2OYH A;  1VPC A;  5AW8 B;  2KP8 A;  2PGD A;  3RK3 E;  2P7J A;  1J1E B;  2Q3I A;  4U3F D;  3AEE C;  1BCC E;  1ZN5 A;  3VMY A;  1L2P A;  3RL0 C;  2E75 D;  1SQV G;  1E79 H;  2G8Y A;  5CCH C;  2Q5U A;  1KIL D;  2XND H;  4IL6 H;  4XE5 B;  1AVY A;  2KLU A;  4WB4 A;  2KOG A;  2BEZ F;  1FC2 C;  2Q1K A;  2OYH B;  4Y99 C;  1W5C E;  3JSV C;  1M7L A;  3I56 P;  1NTZ E;  4AYC A;  1H89 A;  3IFM A;  1N7L A;  2KIK A;  4PD4 D;  3E1I A;  2FYZ A;  2WQY C;  2KSJ A;  5GTI H;  1AJY A;  1DX7 A;  5AVR B;  1YJN P;  3H1I E;  2KZI A;  2KS1 A;  1HH0 A;  2YXR B;  2JKV A;  5AW2 B;  3AEC C;  4AUW A;  2FXM A;  2FYN B;  1S1C X;  2XDJ A;  1KQS O;  2JDI H;  1M1J B;  2K9J B;  4DOJ A;  1ZXG A;  1LTI C;  5AW7 B;  2N9Y B;  2O1J A;  4IFM A;  5KTB A;  4JBZ A;  2OGU A;  1G2C B;  3P8C E;  1YI2 P;  1ZP0 C;  1LTG C;  2N1T B;  1FZC A;  1NTK E;  2YKO A;  1FDI A;  2IZ0 A;  2ZYD A;  1U7J A;  1FS0 E;  1Q81 Q;  2HOD B;  3L71 E;  1RE4 A;  4HYT B;  2CPB A;  1VQP P;  3WU2 H;  2QEX P;  5DJT B;  3L75 J;  4H44 C;  3C9I A;  3OAK A;  1LWU C;  1PP9 E;  2E5T A;  1EQ7 A;  3OW2 O;  5KLI B;  2V4H A;  3GF7 A;  1LT9 A;  2ZT9 D;  3H1K E;  2GM4 A;  2FYU K;  1JM0 A;  1NGM B;  5APS A;  3RK3 B;  4H0L D;  2Q9I A;  4NPD A;  2QRX A;  1KC8 Q;  1JCC A;  3H25 A;  1BCC G;  3A5T A;  3N7N A;  1GK4 A;  2FYU D;  5B66 H;  5APU A;  2K9Y A;  1DIP A;  2NRG A;  2YIU B;  1X0T A;  2IYO A;  3HE4 B;  2PRR A;  2KZJ A;  2RKL A;  1KB9 E;  1VF5 B;  1BE3 J;  3KPE A;  1HJB A;  1PGO A;  3TGU E;  5L8R J;  1J1D C;  3MIW A;  3GHG A;  4H13 C;  3HD7 A;  1NKN A;  2A06 D;  5K5G B;  1EDI A;  1HGV A;  4EIJ A;  1P84 E;  1IFN A;  3V2Q A;  1FDO A;  3P32 A;  2B87 A;  2XNX A;  3S4R A;  3TYY A;  1NTM K;  1OVV A;  3L36 A;  4I7Z B;  3CXH E;  3AE8 C;  3H1I G;  3HTK B;  3AED C;  3RK2 C;  2W83 C;  5GTH E;  3FX0 A;  2NPS A;  4Z1M H;  3B5N A;  3HD7 B;  3AE4 C;  2E43 A;  1NTM D;  3CL3 D;  3HUS B;  3KXD A;  1NO4 A;  1AVO A;  4W7Y A;  2BAS A;  3B4S A;  1NTZ J;  2JO1 A;  3CCE P;  2E74 C;  1JB0 J;  3AEA C;  3F89 A;  1IK9 A;  3CCJ P;  2IPP A;  1FJK A;  5CCG A;  1JO5 A;  2FKW B;  1NTK G;  4UB6 E;  1ZME C;  3HRN A;  5KKZ B;  3RGU A;  2D2C C;  1A02 J;  1FBM A;  4ZKP A;  2B89 A;  3L71 G;  1JY2 O;  3GLM A;  4LC1 A;  2QJY B;  1T3J A;  2QE7 H;  2FFD C;  1MKM A;  1SQX G;  1KYO E;  5KJ7 D;  3PLN A;  3A0B E;  3R4Y A;  3L73 G;  2K1A A;  1VQ6 P;  1PP9 G;  1YBK A;  4WY4 D;  1VQK P;  3AEB C;  1QVF O;  2I1K A;  1K05 A;  1EDJ A;  4AQR D;  2WSF J;  3HE5 A;  2L5G B;  1IJD B;  3H1K G;  3MZW B;  1NTK J;  1Q2N A;  3L72 D;  1JY3 O;  2OYH C;  5AVS B;  1RF1 A;  1BGY E;  1OW7 A;  5DJU B;  3L71 J;  1L4A D;  5TJH A;  1YYC A;  2ZYG A;  2RN0 A;  3H1L G;  1GL2 A;  1NOH A;  2YKP A;  1M8O B;  2M0B A;  1PV3 A;  3H1H D;  1PP9 J;  2UWJ E;  3R2P A;  2R3C A;  1BSH A;  3KYQ A;  2P2U A;  1FU1 A;  1HTL C;  4B86 A;  1T8Z A;  3CCV P;  1NJI Q;  2FXO A;  3AE9 C;  2O01 H;  5CMZ A;  2Y0C A;  1HGZ A;  1YIT P;  3LW5 H;  5APV A;  4D6T G;  1T6A A;  2P58 A;  1KIL E;  2O01 J;  2J59 M;  3PRJ A;  1EZV D;  5APT A;  1SQB K;  2N1T C;  3SWY A;  1AFO A;  2I8D A;  4RO0 A;  3NFQ A;  3TGU J;  1OX3 A;  1AA0 A;  1GK6 A;  1P84 H;  4PD4 E;  2PP6 A;  1URQ A;  2QVA A;  1SQB D;  5AW5 B;  1SQP K;  1N73 B;  3B8E B;  3CXH H;  4ZKU A;  1IC2 A;  4HJG H;  3EWK A;  5GTH H;  1S2E A;  1FZC C;  1USE A;  3SFD C;  1L0N K;  1LTJ A;  1SQP D;  5AW9 B;  2YXQ B;  1KOR A;  3RK3 C;  2Z4E A;  1RE4 C;  1URQ B;  4W80 A;  3VYI A;  1Q82 Q;  3BCC J;  3ITK A;  1L0N D;  3UIA A;  4GT1 A;  3RL0 D;  1IFP A;  3BAT A;  2WSC H;  4IL6 X;  5CCH D;  3PTZ A;  1S9K D;  3L70 D;  1LTJ B;  4PV1 D;  2RMZ A;  3L74 D;  3PP5 A;  1KYO H;  2CPS A;  2LR2 A;  3O6Q A;  3A0B H;  2WSC J;  1BGY G;  1M57 D;  2AEM A;  3PH0 A;  1FOS E;  4LGD E;  4GOE A;  1EXI A;  1SLQ A;  4JPZ B;  1AQT A;  2ZXE B;  4I2L C;  1NU1 G;  5CBN A;  4OH8 B;  1MFT A;  3SSU A;  1VQL P;  2L91 A;  1MV8 A;  3CWB D;  1PPJ E;  1XTC C;  2YMY A;  1A02 F;  1K8A Q;  1SP4 A;  3HD7 C;  2WT7 A;  1KQG B;  2E75 B;  1JMB A;  1M1K Q;  2FYU E;  4N6J A;  1H0T B;  1KIL B;  3V2P A;  2Z5H A;  3GG2 A;  1SFC A;  3K5B A;  2JJL A;  4QMA A;  1P84 I;  3WMM 0;  3C1L A;  3KZI E;  2OYI A;  1PIX A;  2NPS C;  3ABV C;  3BRT B;  3CCU P;  1OW8 A;  2WT7 B;  2QJY C;  3G9R A;  3CI9 A;  3JC2 2;  4H44 D;  4WBA A;  1GD2 E;  3D70 A;  2W90 A;  2YO3 A;  4L74 A;  5CCG C;  3G4S P;  1BDC A;  4R4M A;  1BE3 E;  2XZR A;  4Y28 J; 
#chains in the Genus database with same CATH homology
 4IFF A;  3OAK A;  1LWU C;  4C46 A;  5CHX A;  3H6P A;  1EQ7 A;  4RES B;  1IFM A;  2R32 A;  3L37 A;  3V2N A;  2N9B A;  2H8P D;  1ZV8 A;  1GTW A;  1MZ9 A;  5KLV K;  1N7S A;  1PFI A;  1LT9 A;  2GM4 A;  2FYU K;  5APS A;  3RK3 B;  2IFN A;  1GZL A;  3VTP C;  5APX A;  2H7H A;  3U59 A;  2R5D A;  2Q9I A;  3KQG A;  1RE3 C;  5CCH A;  3L4F A;  3TSI A;  1JCC A;  1IFI A;  5AVQ B;  1LWU B;  1GU4 A;  1GU5 A;  2WPR A;  3A5T A;  1N86 A;  3N7N A;  1X79 B;  1GK4 A;  5APU A;  1KFM A;  1LTS C;  1FDM A;  1LGH B;  1L0L K;  1QL1 A;  2R5B A;  1GL2 D;  1KIL A;  3HE4 B;  2W6B A;  1RF1 C;  1N7S B;  1CSB A;  1FZF A;  2M3B A;  3KPE A;  1HJB A;  4I1L A;  1M1J A;  2WIT A;  1VDF A;  1J1D C;  1GL2 C;  3MIW A;  3NMD A;  3GHG A;  1GW4 A;  3HE5 B;  3HD7 A;  3L35 A;  1HVV A;  1NH4 A;  1NKN A;  4LLH A;  1G2C A;  3VOP A;  1HGV A;  2WPQ A;  4EIJ A;  1X9V A;  3HUS C;  4Y99 B;  1IFN A;  2N1T A;  3V2Q A;  2H43 A;  1RF1 B;  1NHL A;  3P32 A;  2XNX A;  1HWT C;  1FZA A;  3TYY A;  1NTM K;  3IR9 A;  3L36 A;  2HOD A;  1J1D B;  3HTK B;  1GL2 B;  1YTZ I;  1FAV A;  3RK2 C;  1QL2 A;  2Z5I A;  3LID A;  2NPS A;  3U1C A;  4M3L A;  2C9N Y;  3BAS A;  3B5N A;  3HD7 B;  3M9Q A;  2C0W A;  1JTH A;  2E43 A;  3CL3 D;  3HUS B;  1NO4 A;  4W7Y A;  2BAS A;  5AVW B;  1LTT C;  2GUV A;  3II6 A;  2Q7C A;  1NWQ A;  1JY3 P;  1LTB C;  1SQV K;  4N78 E;  1LTA C;  3VMX A;  1IK9 A;  2IPP A;  1XTG B;  1FJK A;  1ZR2 A;  2IFM A;  2A45 I;  2JEE A;  5CCG A;  1JO5 A;  2FKW B;  1URQ C;  3V4Q A;  3A2A A;  3VP9 A;  1OXZ A;  5BVZ A;  3HRN A;  3A3Y B;  1CI6 B;  2WPS A;  3V2R A;  1NU1 K;  4JF7 A;  1LWU A;  4GKG A;  1A02 J;  1FBM A;  3TNU B;  4ZKP A;  1JY2 O;  5AW3 B;  2M8R A;  3EFG A;  4W7Z A;  4LC1 A;  1YTZ T;  1KQL A;  1T3J A;  2FFD C;  2HPC B;  5KJ7 D;  1SQQ K;  3HE4 A;  3M9B A;  1NKZ B;  3M91 A;  1LTJ C;  1RY3 A;  2WSE H;  1WT6 A;  2KB7 P;  2YO2 A;  4WY4 D;  1RE3 A;  4I6M C;  1H88 A;  5AVX B;  2YNY A;  2I1K A;  5KJ7 C;  4AQR D;  1G1I A;  3HE5 A;  3MGN A;  2L5G B;  1E5W A;  1IJD B;  5AVZ B;  3TK1 A;  2FFD B;  3V4W A;  4HH2 A;  4WY4 C;  1JY3 O;  1KFN A;  1WRG A;  2OYH C;  1JMM A;  2XKM A;  5AVS B;  1RF1 A;  2I1J A;  4JYC A;  1HUC A;  5CJ4 A;  1L4A D;  1LT9 C;  1YYC A;  1KZU B;  4C7N A;  1AQ5 A;  5AVY B;  5BU8 B;  3HTK A;  2C0X A;  1GL2 A;  1NOH A;  2POH A;  2YKP A;  2E42 A;  1L4A C;  5AVT B;  1MUU A;  4EOT A;  5AVU B;  4WY4 B;  3R2P A;  4XA4 A;  2W6A A;  2R3C A;  3HUS A;  2QM8 A;  3KYQ A;  2W27 A;  2P2U A;  1FU1 A;  1HTL C;  2P67 A;  4B86 A;  4JYB A;  1T8Z A;  1NAF A;  3RK2 D;  1IO4 A;  1JY2 P;  3CLQ A;  1RF0 C;  4N78 D;  1CW5 A;  2O01 H;  2KLV A;  5CMZ A;  2WWW A;  4C7N B;  1J2J B;  1Z56 A;  1HGZ A;  1DEB A;  1ZR4 A;  3GHG C;  3LW5 H;  5APV A;  1CI6 A;  3BRV B;  1N73 C;  2J59 M;  1SFC D;  2XV5 A;  3TNU A;  1HBW A;  1JCD A;  1FZE A;  1SQB K;  1ZLL A;  3KDP B;  5APT A;  2N1T C;  1T2K D;  2HFE D;  1MFZ A;  3SWY A;  1W2E A;  2HPC A;  1AFO A;  2PAJ A;  1URQ D;  1SVF A;  3NFQ A;  1SFC C;  1GK6 A;  2PP6 A;  2C9L Y;  1URQ A;  1T2K C;  3RK2 B;  3NXS A;  5APY A;  2HYN A;  1SQP K;  5AW5 B;  1N73 B;  2OYI C;  3B8E B;  1CZQ A;  4ZKU A;  2O1K A;  3B5N C;  3M06 A;  1IC2 A;  2WZ7 A;  1JOC A;  1H8A A;  2FFD A;  4GIF A;  3M0A A;  3I5C A;  1FZC C;  2MJZ A;  3M0D C;  2HG5 D;  1SFC B;  1L0N K;  1LTJ A;  3EQ2 A;  3NTN A;  5AW9 B;  2WTY A;  1J1E C;  2WSF H;  3RK3 C;  5AW4 B;  3O8Z A;  2Z4E A;  1RE4 C;  3G3Z A;  5KJ7 A;  2GUS A;  2OYI B;  1URQ B;  3OJA B;  4W80 A;  5AW0 B;  3VYI A;  3VP8 A;  1GW3 A;  1N7S D;  4WY4 A;  1JY2 N;  3M9H A;  3UIA A;  2OYH A;  1FZC B;  1VPC A;  2P1J A;  5AW8 B;  1DH3 A;  3MD0 A;  2KP8 A;  4GT1 A;  3RL0 D;  3BAT A;  3H32 B;  2P7J A;  3V5B A;  1J1E B;  3A7O A;  5AVV B;  2HLO A;  2WSC H;  2Q3I A;  5CCH D;  1N7S C;  1S9K D;  1LTJ B;  1N2D C;  1ZN5 A;  3VMY A;  4DZO A;  5BU5 A;  4O9B A;  1FOS F;  3MTU E;  3PP5 A;  2CPS A;  5APW A;  3RL0 C;  1L4A A;  3LIE A;  5CCH C;  1FOS E;  2Q5U A;  1KIL D;  4LGD E;  1JNM A;  1X8Y A;  4XE5 B;  3P7K A;  4WB4 A;  2KOG A;  3MUD A;  1SLQ A;  1G1J A;  5CJ0 A;  2ZXE B;  4I2L C;  1JY3 N;  2OYH B;  2OAR A;  4Y99 C;  4C7R A;  2IX7 C;  4OH8 B;  3VN0 A;  2YKQ A;  1M7L A;  1LT9 B;  1RF0 A;  4AYC A;  1FJP A;  1KIL C;  1H89 A;  3IFM A;  2J58 A;  1N7L A;  1NTK K;  3HD7 D;  1MV8 A;  3RL0 B;  1S9K E;  3E1I A;  2FYZ A;  3T97 A;  2KSJ A;  1M1J C;  1L4A B;  3P8M C;  4N3Y B;  3BVH A;  1GDT A;  2N1T D;  1N73 A;  1XTC C;  3P8C D;  2YMY A;  1A02 F;  1DX7 A;  1SP4 A;  3HD7 C;  5AVR B;  2WT7 A;  1SQX K;  5APQ A;  2VRS A;  4N6J A;  1HH0 A;  1KIL B;  3V2P A;  3SWF A;  1T3U A;  2Z5H A;  2LKM A;  5AW2 B;  4AUW A;  2FXM A;  1SFC A;  2XU6 A;  2NPS D;  2XDJ A;  2JJL A;  5AW1 B;  3B5N D;  1M1J B;  4DOJ A;  1LTI C;  2ZFC A;  3WMM 0;  5AW7 B;  2O1J A;  3GHG B;  4IFM A;  2OYI A;  1JUN A;  2A45 G;  5KTB A;  5AW6 B;  1IFJ A;  2QM7 A;  1FZG A;  2NPS C;  1G2C B;  3BRT B;  3OA7 A;  3P8C E;  2WT7 B;  1LTG C;  3U1A A;  2N1T B;  1FZC A;  4IFD K;  3M0D A;  2YKO A;  3N4X A;  3RK3 D;  3CI9 A;  3H32 A;  4KHX A;  5CCG D;  4WBA A;  1GD2 E;  2KYV A;  2HOD B;  1FZB A;  1RE4 A;  4HYT B;  2YO3 A;  3VMZ A;  2A45 H;  2CPB A;  1NTZ K;  2NPS B;  5CCG C;  1OWA A;  2XZR A;  3B5N B;  1IFD A;  1JTH B;  3C9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...