1HUCA

The refined 2.15 angstroms x-ray crystal structure of human liver cathepsin b: the structural basis for its specificity
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
47
structure length
47
Chain Sequence
LPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN B
publication title The refined 2.15 A X-ray crystal structure of human liver cathepsin B: the structural basis for its specificity.
pubmed rcsb
source organism Homo sapiens
molecule tags Thiol protease
total genus 12
structure length 47
sequence length 47
chains with identical sequence C
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1993-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1hucA01
5AW0B 1GU4A 3HE4B 3HTKA 4XE5B 4C7NA 3B8EB 1MV8A 3M0AA 1KQLA 5APXA 5APUA 3V5BA 3TYYA 2YNYA 2QM8A 5AVYB 1T2KD 1GD2E 1JUNA 1HUCA 3M91A 4GT1A 4JYCA 1FOSE 3V4WA 1OXZA 2C9LY 1T2KC 5AVXB 3VMYA 5AW2B 1OWAA 3SWFA 3O8ZA 2BASA 4AYCA 3KDPB 1DH3A 4I6MC 4I2LC 4GKGA 5APWA 2WT7A 2WPQA 5AVVB 3MD0A 2YO3A 2Z5IA 5AW6B 3A7OA 2WPRA 4JYBA 5AVSB 1G2CB 3A3YB 1NAFA 3NMDA 3NFQA 5AW7B 2H7HA 2Q5UA 3M0DA 4B86A 5AVZB 3L36A 2R5DA 3TNUB 1HJBA 1H89A 2JJLA 3OAKA 3M06A 5AW8B 3MGNA 5AVWB 3A2AA 2Z5HA 2IPPA 5AW5B 5APYA 2VRSA 3M9BA 1CI6B 4KHXA 4C46A 5AVRB 1IO4A 2P67A 2XZRA 1GK4A 3HE5B 3HE4A 1JNMA 5AW3B 2N9BA 5APSA 1YYCA 2XU6A 5AVUB 1A02F 2YO2A 3VN0A 3IR9A 3KQGA 2P7JA 4LC1A 3L37A 2XV5A 1GZLA 5AW4B 3VYIA 2Q3IA 2R5BA 3LIDA 5AVQB 2Q7CA 2W6AA 2WPSA 3VTPC 1HBWA 3NXSA 5APTA 2WWWA 2KP8A 3TK1A 3HE5A 1MUUA 3LIEA 5APVA 1SLQA 1SP4A 2E42A 2WTYA 4AQRD 5AVTB 1S9KD 3UIAA 1X8YA 1FAVA 1MFZA 1GTWA 3VMZA 3NTNA 3VMXA 4AUWA 2QM7A 4DZOA 1H88A 2WT7B 3L35A 3TNUA 4EOTA 3P32A 3P8MC 3A5TA 3V4QA 1FOSF 5APQA 3I5CA 1HWTC 3M9HA 5AW9B 5AW1B 4RESB 1CI6A 1GK6A 4C7NB 1S9KE 2R32A 1GU5A 3P7KA 1CZQA 1CSBA 3T97A 2P2UA 1J2JB 2ZXEB 2R3CA 1H8AA 1NWQA 4HYTB 5CMZA 4M3LA 2E43A 2C9NY 2W27A 1A02J 2ZFCA
chains in the Genus database with same CATH superfamily
2RKLA 1QL2A 1KZUB 3B8EB 2M8RA 1RH5B 1NVOA 1LJ2A 2KYVA 5AVXB 3SWFA 2ZXXA 2FYNC 2WT7A 1L4AC 1PP9E 2JP3A 2Z5IA 1NTZD 1LTBC 1SQQK 3PP5A 1KORA 5BVZA 1ZV8A 4DJGA 3OAKA 2WZ7A 2LR2A 1S5LX 2PFXA 1XTCC 2FFDB 1PV3A 4NPEA 3N4XA 3CCVP 3JCUE 5TISH 1QEXA 3RK2C 1LT9B 1FZEA 4R4MA 1HBWA 3VTPC 1AQ5A 4PD4H 5KLVK 5EFWB 1VL2A 2PAJA 2B89A 2QJYB 1VQ5P 1YITP 3AEAC 3T97B 1FZCA 1H88A 3R4YA 3L35A 2Y9ZA 1OW7A 2FXPA 1AA0A 1N73C 3M9HA 1VPCA 2R32A 3PLNA 2P2UA 1Q2NA 2V7QJ 4ZKUA 1NTKK 5CMZA 4C7RA 1NTMG 4IL6X 1N7SD 2FKWB 2QVAA 3GW6A 2QG4A 1FOSE 1LNQA 2E76D 2C9LY 1NU1G 3O8ZA 4H0LC 3CXHI 3BATA 2D2CD 2AEJA 1IK7A 3V2NA 3TGUE 5AVSB 3L72E 1BDDA 2V4HA 2N1TA 3L36A 1M7LA 1P84D 2MJZA 3AE3C 1ZMEC 2HG5D 1PP9J 1SQQE 2NPSC 1Y9BA 3M9BA 3S9OA 3ABVC 2W8ZA 1E5WA 4LLHA 2GUSA 3CWBE 1AFOA 3L70G 2WVRA 2YO2A 1N7SB 1H0TB 4LC1A 3L37A 3RK3D 1JMMA 4BWNA 1BCCE 3GHGC 2E76B 1MUUA 1SLQA 2Y0CA 1PFIA 5E79H 4UB8E 2G8YA 2Y0DA 5KKZB 1LTJC 2HPCA 1LTSC 1GL2B 5KLVE 5CCHA 1RF0C 1PP9D 2E5TA 4OGQC 3P32A 3ZDMA 3A5TA 1FOSF 1FDMA 1FS0E 2NZ2A 4GODA 3FXEA 1BGYE 2KXPB 1LTAC 1K8AQ 1MFTA 4EDFA 1EZVI 2B9BA 1SQBJ 2H43A 4DCKA 2ZFCA 5AW0B 1RE4C 2IBZE 1NTKE 1L0LG 1OMIA 2JWDA 2QJPC 3S4RA 1EC5A 2AXTE 5AW2B 2XKMA 1U7JA 1QVGO 3BCCJ 3MUDA 3CCJP 4A7PA 2YMYA 1YI2P 5DJTB 2E75B 3R2PA 1KV4A 3M0DA 3H1LE 2H8PD 4IL6H 1VQKP 1SQBD 3H1KG 2C0XA 3C9IA 2O01N 2VRSA 3TGUJ 2PP6A 3L72J 1GK4A 2POHA 2O01J 5TISE 3IR9A 4PD4E 3I56P 3BCCD 2R5BA 4UB6H 1LWUC 1N8RQ 2BCCG 1PPJD 1JY3N 3VP8A 3F5HA 3Q5SA 2OTLP 3P8CE 4L75A 3VMZA 1ZR2A 3NTNA 1S2EA 1VQ7P 5B66H 1MZ9A 4BRYA 2KZJA 1DD4A 1WT6A 1BCCJ 2JO1A 3TGUD 4YTPC 2WITA 3L72D 1LTGC 1R5LA 1VF5D 1ZOYC 4QMAA 5K5GB 3IF4A 3P7KA 5KJ7C 5KLVJ 4Y99C 2E43A 2FXOA 2OGUA 3JSVC 1ZR4A 2OYHA 3WUVA 4PV1D 1DIPA 2AEFA 4U7JA 3HD7C 2K9JA 3B71A 1OXZA 1KB9H 1BCCD 4HJGH 1Q82Q 2BASA 1DH3A 4N78D 4GKGA 1JY2O 1NKNA 1T3UA 1NTKJ 3H1JE 3A7OA 2KNCB 2A45I 3VOPA 1U57A 5KLVD 4D6TJ 3L73G 3KXDA 4K35A 1EZVG 1JMBA 1SQVG 1VQNP 3L75G 1PZQA 1OVVA 2WSEH 2XZRA 1YYCA 4IFMA 4PV1B 2YIUC 1IJDB 3F89A 2Q9IA 2WPVB 1KYOH 2Q3IA 1NTKD 4WY4B 4EYYQ 1NKZB 3Q5RA 3TK1A 4D6TD 1FJKA 1S9KD 1S5LE 1G2CA 1Z56A 3BRTB 2WT7B 1FE6A 2FFDC 1BE3E 1M57D 2P1JA 5KTBA 2KLVA 3OA7A 1X79B 4C7NB 2P10A 2ZAEB 3PHLA 2QEXP 2QJYC 2W27A 1VQPP 3L71G 2FYUG 4YXWH 3U59A 3HUSB 1KQLA 3CD6P 5BU8B 2W6BA 3II6A 1GD2E 1L4AA 4PD4D 3V4WA 1KQSO 1SQPG 1T2KC 1N86A 1N7LA 1M1JB 5KAFE 2M3EA 4IOIH 3P8CD 4IL6E 1FZCB 1W2EA 1OIPA 2E74C 1RQUA 1YQ4C 3V2QA 3RL0D 1IC2A 3AE4C 1NTMK 1S3JA 3A2AA 4KHXA 5CHXA 1BSNA 1AQTA 1JY2N 1YTZI 1NU1K 3AE8C 2W6JH 2J58A 2MKVA 4I7ZC 2KSJA 3OW2O 1ZLLA 2IFMA 5M1BA 3WU2H 2A45G 4R4LA 3EFGA 2IYOA 3Q3DA 2JKVA 1P84I 1SS1A 1WMKA 3HD7D 1KILB 4ASVA 3TDKA 5CCHD 3USSA 3KPEA 1SFCC 2N1TB 1CI6A 1GK6A 1OW8A 1K9MQ 3IN6A 1YIJP 2I1JA 1BE3J 1JTHA 5B5EE 1GL2C 1RF1C 1YHQP 1KFMA 3CC4P 1KB9E 1JUNA 2M3BA 4NPFX 4JYCA 2JEEA 2RMZA 3CCQP 4U3FG 1SQXJ 1Q81Q 2ZT9C 1DD3A 2NPSA 3MTUE 2HPCB 3ITKA 4O9BA 2OYOA 1BE3D 1JO5A 1EDIA 1FZFA 1L0LK 2IPPA 1MKMA 3B5NB 1URQC 1HVVA 3HE4A 5APSA 2AXTH 1NTME 3AEFC 3GHGA 1KYOE 5AVUB 3AECC 3VYIA 1L0NJ 1SQXD 3CC7P 1G1IA 1LTJA 1NU1E 1SP4A 3A0BE 5GTIE 2ZVNB 2Y0EA 1MFZA 4IFDK 4GOEA 4ASWA 3P8MC 2M5AB 3V4QA 1EDLA 1VQ9P 3I5CA 1HWTC 2WSFH 1CZQA 1RE4A 1HH0A 3CC2P 1L0ND 3L70E 2E74D 4JBZA 4Z1MH 2QJKB 3D6ZA 1S4XA 4JPZB 1YBKA 1IFMA 3AE9C 3CX5H 1VQ4P 2IYPA 2A06G 2KUBA 3VMYA 3H1IJ 3MD0A 2YO3A 2CPBA 3U1CA 4JYBA 3RL0g 3NMDA 1KMIZ 1R8EA 4BRYB 5CJ4A 2HODA 3CCEP 3D70A 3U1AA 1HJBA 5AVWB 1LP1A 3M9QA 4H44D 4RO0A 4C46A 1QGKB 2P67A 3HE5B 1U7MA 3G6EP 1LWUA 1PP9G 1L0LE 2FBWC 3H1ID 3VN0A 2OYHB 4H13D 1IFDA 2WSEJ 1K04A 3WU2E 1CW5A 1KB9D 3LIEA 1NTMJ 1NGMB 5DJUB 1YJWP 1SQVK 1X8YA 3CI9A 1X22A 2FY8A 3S1KA 1JEKA 3KZIH 1EQ7A 5KJ7A 1NU1J 3CCRP 3H1KE 4PJ0E 4WY4C 4H44B 3JC22 2R3CA 2C0WA 4HYTB 4M3LA 3WMM0 2D2CB 2RN0A 3HD7A 4GIFA 1S5LH 1NTMD 1QL1A 3CXHE 1KYOD 1SQBG 5APXA 1KN7A 4DOJA 1JB0J 2M0BA 4GT1A 1OW6A 3L70J 1KQGB 1L4AD 1OWAA 1NU1D 2RH0A 3AE6C 4XA4A 1J1EB 1NH4A 2HFED 2WPRA 1G2CB 3K5BA 3BCCG 3E1IA 3CPWO 3RK3B 1YQ3C 3HUSC 3OJAB 3MGNA 1PPJG 2Z5HA 5APYA 2OYIC 4OH8B 4RKUJ 4OVNF 4HH2A 4PD4I 1M1JC 5CBNA 2L5GB 3L70D 2XNDH 3RK2D 5KAFH 1AVOA 3KQGA 2P7JA 2XV5A 3RBXA 4HKZH 3EWKA 3E1RA 2FYNB 3BRVB 1FJPA 2QE7H 2FFDA 1L4AB 3MHVA 1L0LJ 3E7KA 3H25A 2BEZF 1XTGB 3VMXA 4AUWA 1KC8Q 1HF9A 3L73E 4EOTA 1SQVE 4I1LA 3L75E 1SQQJ 2IZ1A 2JDIH 1BCCG 3T97A 3H1HE 3L74E 2HR3A 2YXQB 3CWBJ 2DW3A 2E5YA 4N3YB 3HTKA 3RK2B 3CX5E 4GOFA 2KS1A 1L0LD 3W67A 1W2BO 2WSCJ 1KILC 3AE2C 4H0LD 4AYCA 3BASA 1J1DC 1SQQD 3A3YB 4L73A 3CWBD 2R5DA 1BGYJ 1NTKG 5B5EH 1Y47A 2NPSD 3CMAP 2K1AA 3GLMA 5CCGC 4D6TG 1CI6B 5AVRB 1IO4A 4WWIA 1OVRA 2FYUE 1JTHB 1PGOA 3LIDA 1ZRTE 2W6AA 1VF5B 4N6JA 3MP7B 1SVFA 1OZHA 1BGYD 3KHUA 2K88A 3KZIE 1GTWA 4YXDC 1LT1A 3B5NC 3H1LJ 4OGQD 1SFCA 1T6AA 3TNUA 3G4SP 1JCDA 3O6QB 2KLUA 2IBZD 1USDA 1NO4A 1KD1Q 1GL2A 1RF1A 3QWOC 4GDOA 3WUTA 2BEQD 2WSFJ 3A0BH 1SQVJ 1Y8AA 3QH9A 5GTIH 3HE4B 3L75J 4XE5B 2H89C 2GM4A 3H1HJ 2QM8A 3L74J 2LXBA 4WB4A 3H1LD 1LGHB 2Q3EA 1LT9C 2B88A 1LTJB 3CLQA 2CK3H 1NAFA 3PTZA 2I8DA 1HJ0A 4CPGA 5C39A 1URQA 2K9YA 1SQVD 2QJKC 1OX3A 3V2RA 2B87A 3FGAD 3L75D 3IFMA 3H1HD 3L74D 2XU6A 5KLIB 2QJPB 1A02F 1EDKA 2K37A 5AW4B 3CX5D 2Q7CA 1W5CE 2I1KA 5GTHH 3NXSA 5APTA 4LGDE 1IZNB 4U3FE 2KSEA 3UIAA 1IK9A 3H1JJ 2KI7B 2L91A 1YJNP 1HTLC 1UIXA 1LTTC 1JM0A 1VQOP 2ITAA 2JWAA 1KFNA 4Y28J 2HODB 1M90Q 5KJ7D 4K3AA 1NWQA 1N2DC 3CMEP 1LP1B 2GUVA 2KB7P 1N73A 1KB9I 1A02J 1R5SA 2Y9YA 3H1JD 2OTJP 3RL0B 1N7SC 4W7ZA 2YKQA 1JCCA 1ZP0C 1FZBA 3LW5H 1K73Q 2JR8A 1T8ZA 2E76C 1NAYA 2WPQA 4PJ0H 5AVVB 4JQ0D 1NTZG 2XNXA 2H7HA 2D2CC 3NFQA 5AW7B 5KKZC 3EFFK 1SQXG 2J5UA 1VQMP 3CXHH 1KYOI 5TJHA 2R3SA 2PRRA 1J1EC 5H2FH 3HD7B 3CCMP 2ZYDA 2QIWA 1G1JA 2A06E 3C1LA 2IZ0A 3RK3C 5CBOA 1QLED 2E42A 2WTYA 1L0NG 1S1CX 2J59M 1FAVA 2QA4P 3RK3E 4WY4A 3Q5PA 2IX7C 3BVHA 2E75C 3IAOA 3G3ZA 3CCLP 3WUUA 4U3FJ 2K3RA 5AW9B 4RESB 4EIJA 1RF0A 2YIUB 2C9NY 3SSUA 1GU4A 3SWYA 4C7NA 1MV8A 3V5BA 1T2KD 1AV1A 3KDPB 5APWA 4U3FD 3HUSA 3H1IG 4JF7A 1RE3C 3C8VA 2OYIA 1H89A 1M1JA 3GMAA 1EDJA 2LXCB 3FXDA 1NYHA 1KTMA 1JNMA 3W68A 5AW3B 1YTZT 1ZXGA 1SQBE 3A0HE 5GTHE 1OFCX 1GZLA 1Q86Q 3HTKB 2WPSA 2KS1B 4RJTA 2IDBA 1GMJA 4AQRD 5AVTB 1VQLP 3Q2YA 2KZIA 4W7YA 1FZAA 4WVZA 2E74B 3BCCE 5KAIE 1SFCD 1PPJE 1CSBA 4MN4C 1VF5C 2OARA 3V2PA 2K9JB 3H32A 4I7ZB 3SWKA 1KILA 1GL2D 3RGUA 4PV1C 1JY3O 4OWFA 3M91A 2A06D 2IBZI 4I2LC 3H6PA 2ZT9D 1QVFO 5CCGA 4B86A 1SFCB 4H13B 3TNUB 2JJLA 3M06A 2BCCE 3EQ2A 1E79H 3SFEC 4N78E 1URQD 1UIIA 2ZYGA 3B4SA 1GW3A 2A45H 2N9BA 3AEGC 5H2FE 1RF1B 2E75D 1LTIC 2GA1A 2O1KA 2YMKA 1RY3A 5AVQB 1IFPA 3AE7C 3B5NA 2WWWA 2YKPA 5APVA 1ZW0A 2FYUK 1JY3P 4KJMA 2ZT9B 3PRJA 4EI2A 4DZOA 1SQPK 1VQ6P 2KIKA 3TGUG 3VP9A 5KLIC 3L72G 1FZCC 4DT0A 4D6TE 1S9KE 1URQB 1X9VA 1TU3F 2QSIA 4BXLA 2B87B 3CX5I 1SQQG 2UWJE 3AEEC 2M5AA 4ZNCA 1LT9A 3VMAA 2WSSH 3CWBG 3M0AA 2G3AA 1EZVE 1X0TA 3TYYA 2SPZA 4WBAA 4NPDA 2WMMA 3V6IA 2HLOA 3LW5J 1GDTA 1WRGA 1PIXA 3H1KJ 5KLVG 5AVZB 5AW8B 3RL0C 3I55P 1IFNA 1BGYG 2N1TC 5CJ0A 4W80A 1KILE 1JOCA 1N73B 2BCCJ 2IBZG 1NTZK 1NJIQ 1Q90D 2AEMA 4YPCA 2KP8A 3HE5A 3H1KD 1SQXK 3PH0A 2ZJSE 3L71E 1M56D 3HRNA 1FDIA 1EXIA 2V7QH 3H1LG 4WY4D 3CXHD 1SQPE 1PGJA 2XDJA 5CCHC 1P84H 3N7NA 2BCCD 2ZXEB 2WQYC 4H0LB 2CPSA 1M1KQ 1N7SA 4KT0J 1H0TA 1VDFA 1L0NK 1HGVA 3GF7A 2YNYA 1HUCA 2NPSB 2Q6QA 3TSIA 4TLFA 3H1HG 1DEEG 3L74G 1Q7YQ 1T3JA 3L73J 2W83C 2OTKE 3KYQA 2NRGA 2KOGA 2YKOA 1VQ8P 2Q5UA 4L76A 3D6YA 2KK7A 3FWNA 3GHGB 1RQVA 4ZMDA 5E79E 3MUDC 1USEA 5AW5B 3M0DC 2IFNA 5BU5A 4XFJA 3PJSK 1IFIA 4OGQB 1JY2P 5L8RJ 1HGZA 3AEBC 3FWLA 3AE5C 3L73D 2O3JA 1EZVD 3JCUH 1AVYA 1IFJA 1NTZE 1M8OB 1FDOA 2QM7A 2N9YB 1SQXE 3G9RA 3H1JG 3GF3A 1YJ9P 1KQFB 2Q1KA 1FZGA 2OYIB 3A0HH 3L71J 1H8AA 1RHZB 2FYUJ 2OQQA 1D7MA 1AJYA 3CCUP 4HB1A 1NHLA 1SQPJ 1KILD 4TT3H 1DEBA 5APUA 5AVYB 2OYHC 2N1TD 3L4FA 1L2PA 2ZVOB 5KAIH 1L0NE 3CL3D 2P58A 1RE3A 4I6MC 2H88C 1FU1A 2HYNA 2O1JA 2PGDA 5AW6B 4UB6E 3G71P 3L71D 3AEDC 1LWUB 2FYUD 1BE3G 2FYZA 1S72P 1PGPA 2AXCA 1BDCA 5CCGD 1OVUA 2O01H 4L74A 1ZRTD 3TF5A 5B66E 1PGQA 4IFFA 1SQPD 4ZKPA 4H44C 3CCSP 3AE1C 3H32B 1PL5A 2YXRB 1BSHA 1GW4A 3D71A 4H13C 1J1DB 4Y99B 3B5ND 1SQBK 1K05A 1EXJA 2KNCA 2WSCH 3H1IE 3Q1MA 2FXMA 1FC2C 4UB8H 3FX0A 2W90A 1P84E 1NOHA 1FBMA 5APQA 3MZWB 3SFDC 5AW1B 1NTZJ 2R44A 1GU5A 2LKMA 2Z4EA 1ZN5A 1J2JB 3RBZA 2QRXA 1QX8A 2ZYAA 3GG2A 3MIWA 1DX7A 3O6QA
chains in the Genus database with same CATH topology
4N3YB 3HTKA 3RK2B 1QL2A 3U59A 1KZUB 3B8EB 2M8RA 3HUSB 1KQLA 1JY3O 5BU8B 2W6BA 3II6A 1GD2E 1KILC 1L4AA 3M91A 3V4WA 2KYVA 1T2KC 5AVXB 1N86A 3SWFA 4AYCA 1N7LA 1M1JB 4I2LC 3H6PA 3BASA 1J1DC 2WT7A 1L4AC 2Z5IA 3P8CD 3A3YB 1LTBC 5CCGA 1FZCB 1SQQK 1W2EA 4B86A 1SFCB 3PP5A 5BVZA 2R5DA 3V2QA 3RL0D 1IC2A 3TNUB 1ZV8A 2JJLA 3OAKA 3M06A 2NPSD 3EQ2A 1NTMK 3A2AA 4N78E 2WZ7A 5CCGC 1URQD 4KHXA 1CI6B 5CHXA 5AVRB 1IO4A 1GW3A 2A45H 1XTCC 2FFDB 2N9BA 1RF1B 1LTIC 1JY2N 1YTZI 1NU1K 2O1KA 1RY3A 1JTHB 2J58A 3N4XA 2KSJA 3LIDA 3RK2C 1LT9B 5AVQB 1FZEA 2W6AA 1HBWA 3VTPC 4N6JA 1ZLLA 3B5NA 1AQ5A 2WWWA 2IFMA 2YKPA 5APVA 5KLVK 2FYUK 1SVFA 1JY3P 2A45G 2PAJA 3EFGA 1GTWA 1FZCA 3B5NC 4DZOA 1SFCA 1H88A 1SQPK 3L35A 3TNUA 3VP9A 3HD7D 1KILB 1JCDA 5CCHD 1N73C 1FZCC 3KPEA 3M9HA 1NO4A 1SFCC 2N1TB 1CI6A 1GK6A 1VPCA 1S9KE 2R32A 1URQB 1X9VA 2P2UA 4ZKUA 1GL2A 1RF1A 1NTKK 5CMZA 2I1JA 4C7RA 1JTHA 3HE4B 1LT9A 4XE5B 1GL2C 1N7SD 1RF1C 2FKWB 3M0AA 1KFMA 2GM4A 3TYYA 2QM8A 4WBAA 1JUNA 4WB4A 2M3BA 4JYCA 1FOSE 1LGHB 2JEEA 2C9LY 1LT9C 3O8ZA 1LTJB 2HLOA 3CLQA 3BATA 3V2NA 5AVSB 1GDTA 1NAFA 1WRGA 2NPSA 3MTUE 2HPCB 2N1TA 5AVZB 4O9BA 3L36A 1URQA 1JO5A 5AW8B 3V2RA 1M7LA 3RL0C 2MJZA 1FZFA 1L0LK 2HG5D 2IPPA 1IFNA 2NPSC 2N1TC 3M9BA 3B5NB 1URQC 3IFMA 1HVVA 3HE4A 5CJ0A 4W80A 5APSA 1E5WA 4LLHA 2GUSA 1AFOA 2XU6A 3GHGA 5AVUB 1A02F 2YO2A 1JOCA 1N7SB 1N73B 4LC1A 3L37A 5AW4B 3VYIA 3RK3D 1NTZK 1JMMA 2Q7CA 2I1KA 3NXSA 5APTA 1G1IA 3GHGC 1LTJA 2KP8A 4LGDE 3HE5A 1MUUA 1SLQA 1SP4A 1PFIA 1SQXK 3UIAA 1IK9A 1MFZA 1HTLC 1LTJC 2HPCA 1LTSC 1GL2B 4IFDK 5CCHA 1LTTC 1RF0C 3HRNA 3P32A 3P8MC 1KFNA 3A5TA 3V4QA 1FOSF 1FDMA 3I5CA 4WY4D 1HWTC 2WSFH 2HODB 5KJ7D 2XDJA 5CCHC 1CZQA 1RE4A 3N7NA 1HH0A 1LTAC 2ZXEB 2CPSA 1NWQA 1N2DC 2GUVA 2KB7P 1N7SA 1N73A 2H43A 1A02J 2ZFCA 5AW0B 1VDFA 1L0NK 1RE4C 1HGVA 3RL0B 1IFMA 1N7SC 2YNYA 4W7ZA 2YKQA 1HUCA 1JCCA 2NPSB 1FZBA 3LW5H 3TSIA 3VMYA 5AW2B 1T8ZA 2XKMA 2WPQA 1T3JA 5AVVB 3MD0A 3MUDA 2YO3A 2XNXA 2YMYA 2CPBA 3U1CA 3KYQA 4JYBA 2KOGA 2YKOA 3R2PA 3NMDA 3NFQA 5AW7B 2H7HA 2Q5UA 3M0DA 5CJ4A 2HODA 2H8PD 3GHGB 3U1AA 1HJBA 5AVWB 2C0XA 3C9IA 3M9QA 5AW5B 3M0DC 2VRSA 4C46A 2IFNA 5BU5A 2PP6A 2P67A 3HE5B 1GK4A 2POHA 1IFIA 1LWUA 1J1EC 1JY2P 3VN0A 3IR9A 1HGZA 2OYHB 3HD7B 1IFDA 2R5BA 1G1JA 1CW5A 1LWUC 3RK3C 3LIEA 2E42A 1IFJA 1JY3N 3VP8A 2WTYA 1SQVK 3P8CE 1X8YA 2J59M 3CI9A 1FAVA 3VMZA 1ZR2A 3NTNA 1MZ9A 2QM7A 4WY4A 1EQ7A 1WT6A 2IX7C 5KJ7A 3BVHA 2WITA 3G3ZA 1LTGC 1FZGA 5AW9B 4RESB 2OYIB 4EIJA 3P7KA 4WY4C 1RF0A 2R3CA 5KJ7C 1H8AA 2C0WA 4HYTB 4Y99C 4M3LA 2E43A 3WMM0 1ZR4A 2OYHA 2C9NY 3HD7A 1NHLA 4GIFA 1GU4A 3SWYA 1QL1A 4C7NA 1KILD 1MV8A 1DEBA 5APXA 5APUA 3V5BA 4DOJA 1T2KD 5AVYB 2OYHC 2N1TD 3L4FA 3HD7C 4GT1A 3CL3D 1OXZA 1OWAA 1L4AD 2BASA 3KDPB 1RE3A 4I6MC 1DH3A 4N78D 4GKGA 1FU1A 4XA4A 1JY2O 1NKNA 5APWA 2HYNA 1J1EB 1T3UA 2O1JA 1NH4A 3HUSA 2HFED 5AW6B 3A7OA 2WPRA 4JF7A 1G2CB 2A45I 3VOPA 1RE3C 3E1IA 2OYIA 1LWUB 2FYZA 3RK3B 1H89A 5CCGD 3HUSC 3OJAB 1M1JA 2O01H 3MGNA 2Z5HA 4IFFA 5APYA 2OYIC 4OH8B 4ZKPA 2WSEH 2XZRA 4HH2A 1JNMA 5AW3B 1M1JC 1YYCA 3H32B 4IFMA 1YTZT 2L5GB 1IJDB 3RK2D 3KQGA 2P7JA 2Q9IA 1GW4A 1GZLA 2XV5A 2Q3IA 3HTKB 4WY4B 2WPSA 1NKZB 3TK1A 3BRVB 1J1DB 1FJPA 4Y99B 2FFDA 1L4AB 4AQRD 1FJKA 3B5ND 1SQBK 5AVTB 1S9KD 1G2CA 1Z56A 2WSCH 4W7YA 1FZAA 2FXMA 1XTGB 3VMXA 4AUWA 3BRTB 2WT7B 2FFDC 2P1JA 4EOTA 1SFCD 5KTBA 4I1LA 1NOHA 1FBMA 5APQA 2KLVA 3OA7A 1X79B 5AW1B 4C7NB 1GU5A 2LKMA 3T97A 1CSBA 2Z4EA 2OARA 1ZN5A 1J2JB 3V2PA 3H32A 1KILA 3MIWA 2W27A 1GL2D 1DX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AW0 B;  1GU4 A;  3HE4 B;  3HTK A;  4XE5 B;  4C7N A;  3B8E B;  1MV8 A;  3M0A A;  1KQL A;  5APX A;  5APU A;  3V5B A;  3TYY A;  2YNY A;  2QM8 A;  5AVY B;  1T2K D;  1GD2 E;  1JUN A;  1HUC A;  3M91 A;  4GT1 A;  4JYC A;  1FOS E;  3V4W A;  1OXZ A;  2C9L Y;  1T2K C;  5AVX B;  3VMY A;  5AW2 B;  1OWA A;  3SWF A;  3O8Z A;  2BAS A;  4AYC A;  3KDP B;  1DH3 A;  4I6M C;  4I2L C;  4GKG A;  5APW A;  2WT7 A;  2WPQ A;  5AVV B;  3MD0 A;  2YO3 A;  2Z5I A;  5AW6 B;  3A7O A;  2WPR A;  4JYB A;  5AVS B;  1G2C B;  3A3Y B;  1NAF A;  3NMD A;  3NFQ A;  5AW7 B;  2H7H A;  2Q5U A;  3M0D A;  4B86 A;  5AVZ B;  3L36 A;  2R5D A;  3TNU B;  1HJB A;  1H89 A;  2JJL A;  3OAK A;  3M06 A;  5AW8 B;  3MGN A;  5AVW B;  3A2A A;  2Z5H A;  2IPP A;  5AW5 B;  5APY A;  2VRS A;  3M9B A;  1CI6 B;  4KHX A;  4C46 A;  5AVR B;  1IO4 A;  2P67 A;  2XZR A;  1GK4 A;  3HE5 B;  3HE4 A;  1JNM A;  5AW3 B;  2N9B A;  5APS A;  1YYC A;  2XU6 A;  5AVU B;  1A02 F;  2YO2 A;  3VN0 A;  3IR9 A;  3KQG A;  2P7J A;  4LC1 A;  3L37 A;  2XV5 A;  1GZL A;  5AW4 B;  3VYI A;  2Q3I A;  2R5B A;  3LID A;  5AVQ B;  2Q7C A;  2W6A A;  2WPS A;  3VTP C;  1HBW A;  3NXS A;  5APT A;  2WWW A;  2KP8 A;  3TK1 A;  3HE5 A;  1MUU A;  3LIE A;  5APV A;  1SLQ A;  1SP4 A;  2E42 A;  2WTY A;  4AQR D;  5AVT B;  1S9K D;  3UIA A;  1X8Y A;  1FAV A;  1MFZ A;  1GTW A;  3VMZ A;  3NTN A;  3VMX A;  4AUW A;  2QM7 A;  4DZO A;  1H88 A;  2WT7 B;  3L35 A;  3TNU A;  4EOT A;  3P32 A;  3P8M C;  3A5T A;  3V4Q A;  1FOS F;  5APQ A;  3I5C A;  1HWT C;  3M9H A;  5AW9 B;  5AW1 B;  4RES B;  1CI6 A;  1GK6 A;  4C7N B;  1S9K E;  2R32 A;  1GU5 A;  3P7K A;  1CZQ A;  1CSB A;  3T97 A;  2P2U A;  1J2J B;  2ZXE B;  2R3C A;  1H8A A;  1NWQ A;  4HYT B;  5CMZ A;  4M3L A;  2E43 A;  2C9N Y;  2W27 A;  1A02 J;  2ZFC A; 
#chains in the Genus database with same CATH topology
 2RKL A;  1QL2 A;  1KZU B;  3B8E B;  2M8R A;  1RH5 B;  1NVO A;  1LJ2 A;  2KYV A;  5AVX B;  3SWF A;  2ZXX A;  2FYN C;  2WT7 A;  1L4A C;  1PP9 E;  2JP3 A;  2Z5I A;  1NTZ D;  1LTB C;  1SQQ K;  3PP5 A;  1KOR A;  5BVZ A;  1ZV8 A;  4DJG A;  3OAK A;  2WZ7 A;  2LR2 A;  1S5L X;  2PFX A;  1XTC C;  2FFD B;  1PV3 A;  4NPE A;  3N4X A;  3CCV P;  3JCU E;  5TIS H;  1QEX A;  3RK2 C;  1LT9 B;  1FZE A;  4R4M A;  1HBW A;  3VTP C;  1AQ5 A;  4PD4 H;  5KLV K;  5EFW B;  1VL2 A;  2PAJ A;  2B89 A;  2QJY B;  1VQ5 P;  1YIT P;  3AEA C;  3T97 B;  1FZC A;  1H88 A;  3R4Y A;  3L35 A;  2Y9Z A;  1OW7 A;  2FXP A;  1AA0 A;  1N73 C;  3M9H A;  1VPC A;  2R32 A;  3PLN A;  2P2U A;  1Q2N A;  2V7Q J;  4ZKU A;  1NTK K;  5CMZ A;  4C7R A;  1NTM G;  4IL6 X;  1N7S D;  2FKW B;  2QVA A;  3GW6 A;  2QG4 A;  1FOS E;  1LNQ A;  2E76 D;  2C9L Y;  1NU1 G;  3O8Z A;  4H0L C;  3CXH I;  3BAT A;  2D2C D;  2AEJ A;  1IK7 A;  3V2N A;  3TGU E;  5AVS B;  3L72 E;  1BDD A;  2V4H A;  2N1T A;  3L36 A;  1M7L A;  1P84 D;  2MJZ A;  3AE3 C;  1ZME C;  2HG5 D;  1PP9 J;  1SQQ E;  2NPS C;  1Y9B A;  3M9B A;  3S9O A;  3ABV C;  2W8Z A;  1E5W A;  4LLH A;  2GUS A;  3CWB E;  1AFO A;  3L70 G;  2WVR A;  2YO2 A;  1N7S B;  1H0T B;  4LC1 A;  3L37 A;  3RK3 D;  1JMM A;  4BWN A;  1BCC E;  3GHG C;  2E76 B;  1MUU A;  1SLQ A;  2Y0C A;  1PFI A;  5E79 H;  4UB8 E;  2G8Y A;  2Y0D A;  5KKZ B;  1LTJ C;  2HPC A;  1LTS C;  1GL2 B;  5KLV E;  5CCH A;  1RF0 C;  1PP9 D;  2E5T A;  4OGQ C;  3P32 A;  3ZDM A;  3A5T A;  1FOS F;  1FDM A;  1FS0 E;  2NZ2 A;  4GOD A;  3FXE A;  1BGY E;  2KXP B;  1LTA C;  1K8A Q;  1MFT A;  4EDF A;  1EZV I;  2B9B A;  1SQB J;  2H43 A;  4DCK A;  2ZFC A;  5AW0 B;  1RE4 C;  2IBZ E;  1NTK E;  1L0L G;  1OMI A;  2JWD A;  2QJP C;  3S4R A;  1EC5 A;  2AXT E;  5AW2 B;  2XKM A;  1U7J A;  1QVG O;  3BCC J;  3MUD A;  3CCJ P;  4A7P A;  2YMY A;  1YI2 P;  5DJT B;  2E75 B;  3R2P A;  1KV4 A;  3M0D A;  3H1L E;  2H8P D;  4IL6 H;  1VQK P;  1SQB D;  3H1K G;  2C0X A;  3C9I A;  2O01 N;  2VRS A;  3TGU J;  2PP6 A;  3L72 J;  1GK4 A;  2POH A;  2O01 J;  5TIS E;  3IR9 A;  4PD4 E;  3I56 P;  3BCC D;  2R5B A;  4UB6 H;  1LWU C;  1N8R Q;  2BCC G;  1PPJ D;  1JY3 N;  3VP8 A;  3F5H A;  3Q5S A;  2OTL P;  3P8C E;  4L75 A;  3VMZ A;  1ZR2 A;  3NTN A;  1S2E A;  1VQ7 P;  5B66 H;  1MZ9 A;  4BRY A;  2KZJ A;  1DD4 A;  1WT6 A;  1BCC J;  2JO1 A;  3TGU D;  4YTP C;  2WIT A;  3L72 D;  1LTG C;  1R5L A;  1VF5 D;  1ZOY C;  4QMA A;  5K5G B;  3IF4 A;  3P7K A;  5KJ7 C;  5KLV J;  4Y99 C;  2E43 A;  2FXO A;  2OGU A;  3JSV C;  1ZR4 A;  2OYH A;  3WUV A;  4PV1 D;  1DIP A;  2AEF A;  4U7J A;  3HD7 C;  2K9J A;  3B71 A;  1OXZ A;  1KB9 H;  1BCC D;  4HJG H;  1Q82 Q;  2BAS A;  1DH3 A;  4N78 D;  4GKG A;  1JY2 O;  1NKN A;  1T3U A;  1NTK J;  3H1J E;  3A7O A;  2KNC B;  2A45 I;  3VOP A;  1U57 A;  5KLV D;  4D6T J;  3L73 G;  3KXD A;  4K35 A;  1EZV G;  1JMB A;  1SQV G;  1VQN P;  3L75 G;  1PZQ A;  1OVV A;  2WSE H;  2XZR A;  1YYC A;  4IFM A;  4PV1 B;  2YIU C;  1IJD B;  3F89 A;  2Q9I A;  2WPV B;  1KYO H;  2Q3I A;  1NTK D;  4WY4 B;  4EYY Q;  1NKZ B;  3Q5R A;  3TK1 A;  4D6T D;  1FJK A;  1S9K D;  1S5L E;  1G2C A;  1Z56 A;  3BRT B;  2WT7 B;  1FE6 A;  2FFD C;  1BE3 E;  1M57 D;  2P1J A;  5KTB A;  2KLV A;  3OA7 A;  1X79 B;  4C7N B;  2P10 A;  2ZAE B;  3PHL A;  2QEX P;  2QJY C;  2W27 A;  1VQP P;  3L71 G;  2FYU G;  4YXW H;  3U59 A;  3HUS B;  1KQL A;  3CD6 P;  5BU8 B;  2W6B A;  3II6 A;  1GD2 E;  1L4A A;  4PD4 D;  3V4W A;  1KQS O;  1SQP G;  1T2K C;  1N86 A;  1N7L A;  1M1J B;  5KAF E;  2M3E A;  4IOI H;  3P8C D;  4IL6 E;  1FZC B;  1W2E A;  1OIP A;  2E74 C;  1RQU A;  1YQ4 C;  3V2Q A;  3RL0 D;  1IC2 A;  3AE4 C;  1NTM K;  1S3J A;  3A2A A;  4KHX A;  5CHX A;  1BSN A;  1AQT A;  1JY2 N;  1YTZ I;  1NU1 K;  3AE8 C;  2W6J H;  2J58 A;  2MKV A;  4I7Z C;  2KSJ A;  3OW2 O;  1ZLL A;  2IFM A;  5M1B A;  3WU2 H;  2A45 G;  4R4L A;  3EFG A;  2IYO A;  3Q3D A;  2JKV A;  1P84 I;  1SS1 A;  1WMK A;  3HD7 D;  1KIL B;  4ASV A;  3TDK A;  5CCH D;  3USS A;  3KPE A;  1SFC C;  2N1T B;  1CI6 A;  1GK6 A;  1OW8 A;  1K9M Q;  3IN6 A;  1YIJ P;  2I1J A;  1BE3 J;  1JTH A;  5B5E E;  1GL2 C;  1RF1 C;  1YHQ P;  1KFM A;  3CC4 P;  1KB9 E;  1JUN A;  2M3B A;  4NPF X;  4JYC A;  2JEE A;  2RMZ A;  3CCQ P;  4U3F G;  1SQX J;  1Q81 Q;  2ZT9 C;  1DD3 A;  2NPS A;  3MTU E;  2HPC B;  3ITK A;  4O9B A;  2OYO A;  1BE3 D;  1JO5 A;  1EDI A;  1FZF A;  1L0L K;  2IPP A;  1MKM A;  3B5N B;  1URQ C;  1HVV A;  3HE4 A;  5APS A;  2AXT H;  1NTM E;  3AEF C;  3GHG A;  1KYO E;  5AVU B;  3AEC C;  3VYI A;  1L0N J;  1SQX D;  3CC7 P;  1G1I A;  1LTJ A;  1NU1 E;  1SP4 A;  3A0B E;  5GTI E;  2ZVN B;  2Y0E A;  1MFZ A;  4IFD K;  4GOE A;  4ASW A;  3P8M C;  2M5A B;  3V4Q A;  1EDL A;  1VQ9 P;  3I5C A;  1HWT C;  2WSF H;  1CZQ A;  1RE4 A;  1HH0 A;  3CC2 P;  1L0N D;  3L70 E;  2E74 D;  4JBZ A;  4Z1M H;  2QJK B;  3D6Z A;  1S4X A;  4JPZ B;  1YBK A;  1IFM A;  3AE9 C;  3CX5 H;  1VQ4 P;  2IYP A;  2A06 G;  2KUB A;  3VMY A;  3H1I J;  3MD0 A;  2YO3 A;  2CPB A;  3U1C A;  4JYB A;  3RL0 g;  3NMD A;  1KMI Z;  1R8E A;  4BRY B;  5CJ4 A;  2HOD A;  3CCE P;  3D70 A;  3U1A A;  1HJB A;  5AVW B;  1LP1 A;  3M9Q A;  4H44 D;  4RO0 A;  4C46 A;  1QGK B;  2P67 A;  3HE5 B;  1U7M A;  3G6E P;  1LWU A;  1PP9 G;  1L0L E;  2FBW C;  3H1I D;  3VN0 A;  2OYH B;  4H13 D;  1IFD A;  2WSE J;  1K04 A;  3WU2 E;  1CW5 A;  1KB9 D;  3LIE A;  1NTM J;  1NGM B;  5DJU B;  1YJW P;  1SQV K;  1X8Y A;  3CI9 A;  1X22 A;  2FY8 A;  3S1K A;  1JEK A;  3KZI H;  1EQ7 A;  5KJ7 A;  1NU1 J;  3CCR P;  3H1K E;  4PJ0 E;  4WY4 C;  4H44 B;  3JC2 2;  2R3C A;  2C0W A;  4HYT B;  4M3L A;  3WMM 0;  2D2C B;  2RN0 A;  3HD7 A;  4GIF A;  1S5L H;  1NTM D;  1QL1 A;  3CXH E;  1KYO D;  1SQB G;  5APX A;  1KN7 A;  4DOJ A;  1JB0 J;  2M0B A;  4GT1 A;  1OW6 A;  3L70 J;  1KQG B;  1L4A D;  1OWA A;  1NU1 D;  2RH0 A;  3AE6 C;  4XA4 A;  1J1E B;  1NH4 A;  2HFE D;  2WPR A;  1G2C B;  3K5B A;  3BCC G;  3E1I A;  3CPW O;  3RK3 B;  1YQ3 C;  3HUS C;  3OJA B;  3MGN A;  1PPJ G;  2Z5H A;  5APY A;  2OYI C;  4OH8 B;  4RKU J;  4OVN F;  4HH2 A;  4PD4 I;  1M1J C;  5CBN A;  2L5G B;  3L70 D;  2XND H;  3RK2 D;  5KAF H;  1AVO A;  3KQG A;  2P7J A;  2XV5 A;  3RBX A;  4HKZ H;  3EWK A;  3E1R A;  2FYN B;  3BRV B;  1FJP A;  2QE7 H;  2FFD A;  1L4A B;  3MHV A;  1L0L J;  3E7K A;  3H25 A;  2BEZ F;  1XTG B;  3VMX A;  4AUW A;  1KC8 Q;  1HF9 A;  3L73 E;  4EOT A;  1SQV E;  4I1L A;  3L75 E;  1SQQ J;  2IZ1 A;  2JDI H;  1BCC G;  3T97 A;  3H1H E;  3L74 E;  2HR3 A;  2YXQ B;  3CWB J;  2DW3 A;  2E5Y A;  4N3Y B;  3HTK A;  3RK2 B;  3CX5 E;  4GOF A;  2KS1 A;  1L0L D;  3W67 A;  1W2B O;  2WSC J;  1KIL C;  3AE2 C;  4H0L D;  4AYC A;  3BAS A;  1J1D C;  1SQQ D;  3A3Y B;  4L73 A;  3CWB D;  2R5D A;  1BGY J;  1NTK G;  5B5E H;  1Y47 A;  2NPS D;  3CMA P;  2K1A A;  3GLM A;  5CCG C;  4D6T G;  1CI6 B;  5AVR B;  1IO4 A;  4WWI A;  1OVR A;  2FYU E;  1JTH B;  1PGO A;  3LID A;  1ZRT E;  2W6A A;  1VF5 B;  4N6J A;  3MP7 B;  1SVF A;  1OZH A;  1BGY D;  3KHU A;  2K88 A;  3KZI E;  1GTW A;  4YXD C;  1LT1 A;  3B5N C;  3H1L J;  4OGQ D;  1SFC A;  1T6A A;  3TNU A;  3G4S P;  1JCD A;  3O6Q B;  2KLU A;  2IBZ D;  1USD A;  1NO4 A;  1KD1 Q;  1GL2 A;  1RF1 A;  3QWO C;  4GDO A;  3WUT A;  2BEQ D;  2WSF J;  3A0B H;  1SQV J;  1Y8A A;  3QH9 A;  5GTI H;  3HE4 B;  3L75 J;  4XE5 B;  2H89 C;  2GM4 A;  3H1H J;  2QM8 A;  3L74 J;  2LXB A;  4WB4 A;  3H1L D;  1LGH B;  2Q3E A;  1LT9 C;  2B88 A;  1LTJ B;  3CLQ A;  2CK3 H;  1NAF A;  3PTZ A;  2I8D A;  1HJ0 A;  4CPG A;  5C39 A;  1URQ A;  2K9Y A;  1SQV D;  2QJK C;  1OX3 A;  3V2R A;  2B87 A;  3FGA D;  3L75 D;  3IFM A;  3H1H D;  3L74 D;  2XU6 A;  5KLI B;  2QJP B;  1A02 F;  1EDK A;  2K37 A;  5AW4 B;  3CX5 D;  2Q7C A;  1W5C E;  2I1K A;  5GTH H;  3NXS A;  5APT A;  4LGD E;  1IZN B;  4U3F E;  2KSE A;  3UIA A;  1IK9 A;  3H1J J;  2KI7 B;  2L91 A;  1YJN P;  1HTL C;  1UIX A;  1LTT C;  1JM0 A;  1VQO P;  2ITA A;  2JWA A;  1KFN A;  4Y28 J;  2HOD B;  1M90 Q;  5KJ7 D;  4K3A A;  1NWQ A;  1N2D C;  3CME P;  1LP1 B;  2GUV A;  2KB7 P;  1N73 A;  1KB9 I;  1A02 J;  1R5S A;  2Y9Y A;  3H1J D;  2OTJ P;  3RL0 B;  1N7S C;  4W7Z A;  2YKQ A;  1JCC A;  1ZP0 C;  1FZB A;  3LW5 H;  1K73 Q;  2JR8 A;  1T8Z A;  2E76 C;  1NAY A;  2WPQ A;  4PJ0 H;  5AVV B;  4JQ0 D;  1NTZ G;  2XNX A;  2H7H A;  2D2C C;  3NFQ A;  5AW7 B;  5KKZ C;  3EFF K;  1SQX G;  2J5U A;  1VQM P;  3CXH H;  1KYO I;  5TJH A;  2R3S A;  2PRR A;  1J1E C;  5H2F H;  3HD7 B;  3CCM P;  2ZYD A;  2QIW A;  1G1J A;  2A06 E;  3C1L A;  2IZ0 A;  3RK3 C;  5CBO A;  1QLE D;  2E42 A;  2WTY A;  1L0N G;  1S1C X;  2J59 M;  1FAV A;  2QA4 P;  3RK3 E;  4WY4 A;  3Q5P A;  2IX7 C;  3BVH A;  2E75 C;  3IAO A;  3G3Z A;  3CCL P;  3WUU A;  4U3F J;  2K3R A;  5AW9 B;  4RES B;  4EIJ A;  1RF0 A;  2YIU B;  2C9N Y;  3SSU A;  1GU4 A;  3SWY A;  4C7N A;  1MV8 A;  3V5B A;  1T2K D;  1AV1 A;  3KDP B;  5APW A;  4U3F D;  3HUS A;  3H1I G;  4JF7 A;  1RE3 C;  3C8V A;  2OYI A;  1H89 A;  1M1J A;  3GMA A;  1EDJ A;  2LXC B;  3FXD A;  1NYH A;  1KTM A;  1JNM A;  3W68 A;  5AW3 B;  1YTZ T;  1ZXG A;  1SQB E;  3A0H E;  5GTH E;  1OFC X;  1GZL A;  1Q86 Q;  3HTK B;  2WPS A;  2KS1 B;  4RJT A;  2IDB A;  1GMJ A;  4AQR D;  5AVT B;  1VQL P;  3Q2Y A;  2KZI A;  4W7Y A;  1FZA A;  4WVZ A;  2E74 B;  3BCC E;  5KAI E;  1SFC D;  1PPJ E;  1CSB A;  4MN4 C;  1VF5 C;  2OAR A;  3V2P A;  2K9J B;  3H32 A;  4I7Z B;  3SWK A;  1KIL A;  1GL2 D;  3RGU A;  4PV1 C;  1JY3 O;  4OWF A;  3M91 A;  2A06 D;  2IBZ I;  4I2L C;  3H6P A;  2ZT9 D;  1QVF O;  5CCG A;  4B86 A;  1SFC B;  4H13 B;  3TNU B;  2JJL A;  3M06 A;  2BCC E;  3EQ2 A;  1E79 H;  3SFE C;  4N78 E;  1URQ D;  1UII A;  2ZYG A;  3B4S A;  1GW3 A;  2A45 H;  2N9B A;  3AEG C;  5H2F E;  1RF1 B;  2E75 D;  1LTI C;  2GA1 A;  2O1K A;  2YMK A;  1RY3 A;  5AVQ B;  1IFP A;  3AE7 C;  3B5N A;  2WWW A;  2YKP A;  5APV A;  1ZW0 A;  2FYU K;  1JY3 P;  4KJM A;  2ZT9 B;  3PRJ A;  4EI2 A;  4DZO A;  1SQP K;  1VQ6 P;  2KIK A;  3TGU G;  3VP9 A;  5KLI C;  3L72 G;  1FZC C;  4DT0 A;  4D6T E;  1S9K E;  1URQ B;  1X9V A;  1TU3 F;  2QSI A;  4BXL A;  2B87 B;  3CX5 I;  1SQQ G;  2UWJ E;  3AEE C;  2M5A A;  4ZNC A;  1LT9 A;  3VMA A;  2WSS H;  3CWB G;  3M0A A;  2G3A A;  1EZV E;  1X0T A;  3TYY A;  2SPZ A;  4WBA A;  4NPD A;  2WMM A;  3V6I A;  2HLO A;  3LW5 J;  1GDT A;  1WRG A;  1PIX A;  3H1K J;  5KLV G;  5AVZ B;  5AW8 B;  3RL0 C;  3I55 P;  1IFN A;  1BGY G;  2N1T C;  5CJ0 A;  4W80 A;  1KIL E;  1JOC A;  1N73 B;  2BCC J;  2IBZ G;  1NTZ K;  1NJI Q;  1Q90 D;  2AEM A;  4YPC A;  2KP8 A;  3HE5 A;  3H1K D;  1SQX K;  3PH0 A;  2ZJS E;  3L71 E;  1M56 D;  3HRN A;  1FDI A;  1EXI A;  2V7Q H;  3H1L G;  4WY4 D;  3CXH D;  1SQP E;  1PGJ A;  2XDJ A;  5CCH C;  1P84 H;  3N7N A;  2BCC D;  2ZXE B;  2WQY C;  4H0L B;  2CPS A;  1M1K Q;  1N7S A;  4KT0 J;  1H0T A;  1VDF A;  1L0N K;  1HGV A;  3GF7 A;  2YNY A;  1HUC A;  2NPS B;  2Q6Q A;  3TSI A;  4TLF A;  3H1H G;  1DEE G;  3L74 G;  1Q7Y Q;  1T3J A;  3L73 J;  2W83 C;  2OTK E;  3KYQ A;  2NRG A;  2KOG A;  2YKO A;  1VQ8 P;  2Q5U A;  4L76 A;  3D6Y A;  2KK7 A;  3FWN A;  3GHG B;  1RQV A;  4ZMD A;  5E79 E;  3MUD C;  1USE A;  5AW5 B;  3M0D C;  2IFN A;  5BU5 A;  4XFJ A;  3PJS K;  1IFI A;  4OGQ B;  1JY2 P;  5L8R J;  1HGZ A;  3AEB C;  3FWL A;  3AE5 C;  3L73 D;  2O3J A;  1EZV D;  3JCU H;  1AVY A;  1IFJ A;  1NTZ E;  1M8O B;  1FDO A;  2QM7 A;  2N9Y B;  1SQX E;  3G9R A;  3H1J G;  3GF3 A;  1YJ9 P;  1KQF B;  2Q1K A;  1FZG A;  2OYI B;  3A0H H;  3L71 J;  1H8A A;  1RHZ B;  2FYU J;  2OQQ A;  1D7M A;  1AJY A;  3CCU P;  4HB1 A;  1NHL A;  1SQP J;  1KIL D;  4TT3 H;  1DEB A;  5APU A;  5AVY B;  2OYH C;  2N1T D;  3L4F A;  1L2P A;  2ZVO B;  5KAI H;  1L0N E;  3CL3 D;  2P58 A;  1RE3 A;  4I6M C;  2H88 C;  1FU1 A;  2HYN A;  2O1J A;  2PGD A;  5AW6 B;  4UB6 E;  3G71 P;  3L71 D;  3AED C;  1LWU B;  2FYU D;  1BE3 G;  2FYZ A;  1S72 P;  1PGP A;  2AXC A;  1BDC A;  5CCG D;  1OVU A;  2O01 H;  4L74 A;  1ZRT D;  3TF5 A;  5B66 E;  1PGQ A;  4IFF A;  1SQP D;  4ZKP A;  4H44 C;  3CCS P;  3AE1 C;  3H32 B;  1PL5 A;  2YXR B;  1BSH A;  1GW4 A;  3D71 A;  4H13 C;  1J1D B;  4Y99 B;  3B5N D;  1SQB K;  1K05 A;  1EXJ A;  2KNC A;  2WSC H;  3H1I E;  3Q1M A;  2FXM A;  1FC2 C;  4UB8 H;  3FX0 A;  2W90 A;  1P84 E;  1NOH A;  1FBM A;  5APQ A;  3MZW B;  3SFD C;  5AW1 B;  1NTZ J;  2R44 A;  1GU5 A;  2LKM A;  2Z4E A;  1ZN5 A;  1J2J B;  3RBZ A;  2QRX A;  1QX8 A;  2ZYA A;  3GG2 A;  3MIW A;  1DX7 A;  3O6Q A; 
#chains in the Genus database with same CATH homology
 4N3Y B;  3HTK A;  3RK2 B;  1QL2 A;  3U59 A;  1KZU B;  3B8E B;  2M8R A;  3HUS B;  1KQL A;  1JY3 O;  5BU8 B;  2W6B A;  3II6 A;  1GD2 E;  1KIL C;  1L4A A;  3M91 A;  3V4W A;  2KYV A;  1T2K C;  5AVX B;  1N86 A;  3SWF A;  4AYC A;  1N7L A;  1M1J B;  4I2L C;  3H6P A;  3BAS A;  1J1D C;  2WT7 A;  1L4A C;  2Z5I A;  3P8C D;  3A3Y B;  1LTB C;  5CCG A;  1FZC B;  1SQQ K;  1W2E A;  4B86 A;  1SFC B;  3PP5 A;  5BVZ A;  2R5D A;  3V2Q A;  3RL0 D;  1IC2 A;  3TNU B;  1ZV8 A;  2JJL A;  3OAK A;  3M06 A;  2NPS D;  3EQ2 A;  1NTM K;  3A2A A;  4N78 E;  2WZ7 A;  5CCG C;  1URQ D;  4KHX A;  1CI6 B;  5CHX A;  5AVR B;  1IO4 A;  1GW3 A;  2A45 H;  1XTC C;  2FFD B;  2N9B A;  1RF1 B;  1LTI C;  1JY2 N;  1YTZ I;  1NU1 K;  2O1K A;  1RY3 A;  1JTH B;  2J58 A;  3N4X A;  2KSJ A;  3LID A;  3RK2 C;  1LT9 B;  5AVQ B;  1FZE A;  2W6A A;  1HBW A;  3VTP C;  4N6J A;  1ZLL A;  3B5N A;  1AQ5 A;  2WWW A;  2IFM A;  2YKP A;  5APV A;  5KLV K;  2FYU K;  1SVF A;  1JY3 P;  2A45 G;  2PAJ A;  3EFG A;  1GTW A;  1FZC A;  3B5N C;  4DZO A;  1SFC A;  1H88 A;  1SQP K;  3L35 A;  3TNU A;  3VP9 A;  3HD7 D;  1KIL B;  1JCD A;  5CCH D;  1N73 C;  1FZC C;  3KPE A;  3M9H A;  1NO4 A;  1SFC C;  2N1T B;  1CI6 A;  1GK6 A;  1VPC A;  1S9K E;  2R32 A;  1URQ B;  1X9V A;  2P2U A;  4ZKU A;  1GL2 A;  1RF1 A;  1NTK K;  5CMZ A;  2I1J A;  4C7R A;  1JTH A;  3HE4 B;  1LT9 A;  4XE5 B;  1GL2 C;  1N7S D;  1RF1 C;  2FKW B;  3M0A A;  1KFM A;  2GM4 A;  3TYY A;  2QM8 A;  4WBA A;  1JUN A;  4WB4 A;  2M3B A;  4JYC A;  1FOS E;  1LGH B;  2JEE A;  2C9L Y;  1LT9 C;  3O8Z A;  1LTJ B;  2HLO A;  3CLQ A;  3BAT A;  3V2N A;  5AVS B;  1GDT A;  1NAF A;  1WRG A;  2NPS A;  3MTU E;  2HPC B;  2N1T A;  5AVZ B;  4O9B A;  3L36 A;  1URQ A;  1JO5 A;  5AW8 B;  3V2R A;  1M7L A;  3RL0 C;  2MJZ A;  1FZF A;  1L0L K;  2HG5 D;  2IPP A;  1IFN A;  2NPS C;  2N1T C;  3M9B A;  3B5N B;  1URQ C;  3IFM A;  1HVV A;  3HE4 A;  5CJ0 A;  4W80 A;  5APS A;  1E5W A;  4LLH A;  2GUS A;  1AFO A;  2XU6 A;  3GHG A;  5AVU B;  1A02 F;  2YO2 A;  1JOC A;  1N7S B;  1N73 B;  4LC1 A;  3L37 A;  5AW4 B;  3VYI A;  3RK3 D;  1NTZ K;  1JMM A;  2Q7C A;  2I1K A;  3NXS A;  5APT A;  1G1I A;  3GHG C;  1LTJ A;  2KP8 A;  4LGD E;  3HE5 A;  1MUU A;  1SLQ A;  1SP4 A;  1PFI A;  1SQX K;  3UIA A;  1IK9 A;  1MFZ A;  1HTL C;  1LTJ C;  2HPC A;  1LTS C;  1GL2 B;  4IFD K;  5CCH A;  1LTT C;  1RF0 C;  3HRN A;  3P32 A;  3P8M C;  1KFN A;  3A5T A;  3V4Q A;  1FOS F;  1FDM A;  3I5C A;  4WY4 D;  1HWT C;  2WSF H;  2HOD B;  5KJ7 D;  2XDJ A;  5CCH C;  1CZQ A;  1RE4 A;  3N7N A;  1HH0 A;  1LTA C;  2ZXE B;  2CPS A;  1NWQ A;  1N2D C;  2GUV A;  2KB7 P;  1N7S A;  1N73 A;  2H43 A;  1A02 J;  2ZFC A;  5AW0 B;  1VDF A;  1L0N K;  1RE4 C;  1HGV A;  3RL0 B;  1IFM A;  1N7S C;  2YNY A;  4W7Z A;  2YKQ A;  1HUC A;  1JCC A;  2NPS B;  1FZB A;  3LW5 H;  3TSI A;  3VMY A;  5AW2 B;  1T8Z A;  2XKM A;  2WPQ A;  1T3J A;  5AVV B;  3MD0 A;  3MUD A;  2YO3 A;  2XNX A;  2YMY A;  2CPB A;  3U1C A;  3KYQ A;  4JYB A;  2KOG A;  2YKO A;  3R2P A;  3NMD A;  3NFQ A;  5AW7 B;  2H7H A;  2Q5U A;  3M0D A;  5CJ4 A;  2HOD A;  2H8P D;  3GHG B;  3U1A A;  1HJB A;  5AVW B;  2C0X A;  3C9I A;  3M9Q A;  5AW5 B;  3M0D C;  2VRS A;  4C46 A;  2IFN A;  5BU5 A;  2PP6 A;  2P67 A;  3HE5 B;  1GK4 A;  2POH A;  1IFI A;  1LWU A;  1J1E C;  1JY2 P;  3VN0 A;  3IR9 A;  1HGZ A;  2OYH B;  3HD7 B;  1IFD A;  2R5B A;  1G1J A;  1CW5 A;  1LWU C;  3RK3 C;  3LIE A;  2E42 A;  1IFJ A;  1JY3 N;  3VP8 A;  2WTY A;  1SQV K;  3P8C E;  1X8Y A;  2J59 M;  3CI9 A;  1FAV A;  3VMZ A;  1ZR2 A;  3NTN A;  1MZ9 A;  2QM7 A;  4WY4 A;  1EQ7 A;  1WT6 A;  2IX7 C;  5KJ7 A;  3BVH A;  2WIT A;  3G3Z A;  1LTG C;  1FZG A;  5AW9 B;  4RES B;  2OYI B;  4EIJ A;  3P7K A;  4WY4 C;  1RF0 A;  2R3C A;  5KJ7 C;  1H8A A;  2C0W A;  4HYT B;  4Y99 C;  4M3L A;  2E43 A;  3WMM 0;  1ZR4 A;  2OYH A;  2C9N Y;  3HD7 A;  1NHL A;  4GIF A;  1GU4 A;  3SWY A;  1QL1 A;  4C7N A;  1KIL D;  1MV8 A;  1DEB A;  5APX A;  5APU A;  3V5B A;  4DOJ A;  1T2K D;  5AVY B;  2OYH C;  2N1T D;  3L4F A;  3HD7 C;  4GT1 A;  3CL3 D;  1OXZ A;  1OWA A;  1L4A D;  2BAS A;  3KDP B;  1RE3 A;  4I6M C;  1DH3 A;  4N78 D;  4GKG A;  1FU1 A;  4XA4 A;  1JY2 O;  1NKN A;  5APW A;  2HYN A;  1J1E B;  1T3U A;  2O1J A;  1NH4 A;  3HUS A;  2HFE D;  5AW6 B;  3A7O A;  2WPR A;  4JF7 A;  1G2C B;  2A45 I;  3VOP A;  1RE3 C;  3E1I A;  2OYI A;  1LWU B;  2FYZ A;  3RK3 B;  1H89 A;  5CCG D;  3HUS C;  3OJA B;  1M1J A;  2O01 H;  3MGN A;  2Z5H A;  4IFF A;  5APY A;  2OYI C;  4OH8 B;  4ZKP A;  2WSE H;  2XZR A;  4HH2 A;  1JNM A;  5AW3 B;  1M1J C;  1YYC A;  3H32 B;  4IFM A;  1YTZ T;  2L5G B;  1IJD B;  3RK2 D;  3KQG A;  2P7J A;  2Q9I A;  1GW4 A;  1GZL A;  2XV5 A;  2Q3I A;  3HTK B;  4WY4 B;  2WPS A;  1NKZ B;  3TK1 A;  3BRV B;  1J1D B;  1FJP A;  4Y99 B;  2FFD A;  1L4A B;  4AQR D;  1FJK A;  3B5N D;  1SQB K;  5AVT B;  1S9K D;  1G2C A;  1Z56 A;  2WSC H;  4W7Y A;  1FZA A;  2FXM A;  1XTG B;  3VMX A;  4AUW A;  3BRT B;  2WT7 B;  2FFD C;  2P1J A;  4EOT A;  1SFC D;  5KTB A;  4I1L A;  1NOH A;  1FBM A;  5APQ A;  2KLV A;  3OA7 A;  1X79 B;  5AW1 B;  4C7N B;  1GU5 A;  2LKM A;  3T97 A;  1CSB A;  2Z4E A;  2OAR A;  1ZN5 A;  1J2J B;  3V2P A;  3H32 A;  1KIL A;  3MIW A;  2W27 A;  1GL2 D;  1DX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...