1HUCA

The refined 2.15 angstroms x-ray crystal structure of human liver cathepsin b: the structural basis for its specificity
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
47
structure length
47
Chain Sequence
LPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The refined 2.15 A X-ray crystal structure of human liver cathepsin B: the structural basis for its specificity.
pubmed rcsb
source organism Homo sapiens
molecule tags Thiol protease
molecule keywords CATHEPSIN B
total genus 12
structure length 47
sequence length 47
chains with identical sequence C
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1993-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1hucA01
1FOSE 3L36A 4XE5B 1SLQA 2Q5UA 1S9KD 2P67A 1HUCA 1J2JB 5APSA 4C7NA 1GD2E 2C9LY 2E43A 3B8EB 4M3LA 1OXZA 3MD0A 3HE4B 4LC1A 1NWQA 3TNUB 2WT7B 5AW0B 5AVWB 4C46A 2N9BA 1GK4A 2R32A 3VYIA 4EOTA 4I2LC 2WTYA 3KQGA 1SP4A 1G2CB 1GU5A 1T2KD 3NXSA 1GK6A 2W6AA 5AW7B 1A02J 5AVRB 5AW4B 1MUUA 1GZLA 5AW2B 3LIEA 1X8YA 3M06A 2VRSA 5AVSB 3A3YB 3VMXA 4C7NB 3HE5B 2W27A 2P2UA 4HYTB 1FOSF 5AW3B 2WPQA 4AUWA 1A02F 3M9HA 3VTPC 2R3CA 1DH3A 3L35A 5AW6B 3SWFA 5AVXB 1JUNA 2E42A 1MV8A 3NMDA 3OAKA 3HE5A 3TYYA 3HTKA 1H88A 2Q7CA 5AVUB 5AW9B 5APXA 3V5BA 3V4QA 3VMYA 4B86A 3T97A 4GT1A 3IR9A 3TK1A 5CMZA 5AW8B 2YO3A 2YNYA 3MGNA 5AVVB 4JYCA 5APVA 3M0DA 1FAVA 1NAFA 3O8ZA 4DZOA 2JJLA 5AVYB 2XU6A 3VMZA 2P7JA 4RESB 3M0AA 5AW5B 3I5CA 5APUA 5AVZB 3P7KA 1H8AA 2WPRA 3P32A 2BASA 4JYBA 3TNUA 1HBWA 4I6MC 1HJBA 1T2KC 5AVTB 1IO4A 5APQA 1GU4A 2ZXEB 1CI6A 5APYA 2R5BA 3V4WA 2QM8A 1CZQA 5AW1B 1CSBA 2C9NY 2IPPA 2WPSA 3NTNA 1KQLA 4AYCA 3A5TA 1OWAA 1YYCA 1HWTC 3VN0A 3NFQA 3M9BA 3L37A 2Z5HA 3A7OA 3M91A 5APWA 3HE4A 2XV5A 3P8MC 2Z5IA 3KDPB 2QM7A 3LIDA 2H7HA 2WWWA 1JNMA 2KP8A 4GKGA 1H89A 4KHXA 4AQRD 2YO2A 2ZFCA 2WT7A 2XZRA 2Q3IA 2R5DA 5APTA 3A2AA 5AVQB 3UIAA 1GTWA 1S9KE 1MFZA 1CI6B
chains in the Genus database with same CATH superfamily
2YMKA 1KC8Q 1BGYE 2QRXA 2QG4A 3JSVC 3CCLP 1S9KD 1KFMA 3CX5I 1L0LJ 3G4SP 1J2JB 1NO4A 3L74J 1Z56A 2FYUE 1OXZA 1W2EA 4M3LA 1JM0A 1EQ7A 3L75E 3MD0A 5KLIC 3L75J 5M1BA 3CCSP 3TNUB 2WT7B 1Q90D 4JPZB 1SFCC 2YXQB 1GL2B 3L75G 4EOTA 1OFCX 3RK2C 1KYOE 1SQPG 3PRJA 2M5AA 4WY4B 2AEFA 3PH0A 1AJYA 1NHLA 1T2KD 3EWKA 1T3JA 1NTKG 5AW7B 4ZKPA 2WMMA 1L4AC 1PP9J 1BGYD 2E74C 2HR3A 2YKPA 4IL6E 5TISH 3VP8A 5CBNA 3AE2C 5AVRB 1VQ8P 4HB1A 1MUUA 1SQBG 1GZLA 1X8YA 3D70A 3H1LJ 1W5CE 1M56D 1NAYA 3AE6C 2HPCA 1OVUA 4N3YB 1URQB 1IC2A 2Q1KA 3A3YB 2W27A 3HE5B 4HYTB 2R44A 4OGQC 4C7NB 3G9RA 3D6ZA 3CMEP 2ZT9D 1SQVG 2WPQA 2FXPA 2M3EA 2J5UA 1YI2P 1IFDA 2IBZE 1KFNA 3A0HH 1URQD 3B5NB 5AW6B 1KILA 2FBWC 5AVXB 1LWUC 3W68A 3NMDA 1XTCC 1OVVA 3HE5A 3MUDA 4JF7A 4WB4A 3TYYA 2Q7CA 2E76D 1JOCA 1BE3E 4RKUJ 3V5BA 2E5TA 4U3FE 1SQQE 3VMYA 3GG2A 2QJPB 2OTKE 3H1ID 1M1JB 3D6YA 4GT1A 1ZN5A 1L0LK 2C0WA 3HUSC 1MZ9A 1H0TA 2YNYA 5AVVB 1YHQP 2H88C 2WPVB 2R3SA 4OH8B 4IFFA 5APVA 3VMAA 2B87A 2OYIB 1CW5A 3FX0A 5GTIH 2OTJP 1N73B 4IL6H 3CD6P 1W2BO 1YQ3C 2V7QH 1M1JA 5AVYB 3RBZA 3CWBE 3MHVA 2FXOA 3CX5E 3ITKA 2KSEA 1N7SC 2IZ0A 3F5HA 3L73D 2E75C 2AXTH 4IFDK 4DCKA 1SQQD 2I1JA 4DT0A 2O1JA 2WPRA 3P32A 3TDKA 1ZRTD 1QX8A 4H44C 5CJ4A 3AEDC 1JCCA 4JYBA 4N78D 3RK3C 2WZ7A 4I6MC 2AXCA 2PAJA 1HJBA 4DOJA 3V2PA 1HH0A 1FJPA 1NU1D 1QL2A 4I7ZB 3KYQA 3CWBJ 1UIXA 1KB9I 1QL1A 1LP1B 1NH4A 3CLQA 2E76B 1AVOA 1YBKA 2PP6A 2ZXEB 3IN6A 2FYNB 4L75A 1L0LD 1USDA 2QM8A 5CCGD 2V7QJ 4D6TD 1CSBA 1AA0A 2HFED 2NZ2A 1VF5C 3M0DC 1KYOI 2JO1A 1LT9B 3L70G 1PIXA 1KQLA 1PGPA 2Y0EA 1KORA 2YIUB 3GF7A 3HUSA 1S1CX 2MJZA 3E1IA 2Q6QA 1HGVA 2IFNA 2XNXA 3VN0A 2GM4A 3M9BA 4UB8E 1IFJA 2IBZI 2AEJA 1DX7A 2FFDA 1SQPJ 1SQXD 3S4RA 3CPWO 5CCHD 1Q2NA 3CCRP 3Q3DA 1KTMA 5BU5A 2Z5IA 1JY2O 2YXRB 3R2PA 3L75D 2H7HA 3HD7C 5KJ7C 5KKZC 4UB6E 1SQXJ 1SQPD 3GMAA 1RF0C 4H13C 4KHXA 2WSFH 2FYUK 2YO2A 3CWBD 3GHGB 4IOIH 1RQVA 1R8EA 1JMBA 3JC22 2WT7A 1NTKD 2K3RA 1ZOYC 4GOFA 5APTA 4WY4C 1HTLC 1BGYG 2I1KA 3IF4A 1R5SA 3H1LG 1GTWA 3TGUG 5H2FE 1SQBD 1KILD 1CI6B 4H0LD 4QMAA 5K5GB 2ZYAA 2ZYDA 4HKZH 4JBZA 5CCHA 4XE5B 1PP9E 3B5ND 4U7JA 3A0BE 2UWJE 2P67A 3BCCE 3AEBC 5CJ0A 1NTKJ 3S1KA 3VOPA 4BXLA 3L71D 1HJ0A 3V2QA 4C7NA 2H89C 4R4MA 1GD2E 1NU1E 2JDIH 2LR2A 3H1KJ 4BWNA 1SQVD 1L0NE 3PHLA 3AE1C 2JWDA 1L0NJ 1SQVK 3HE4B 2A45H 2WSEH 3C1LA 4MN4C 3W67A 1N73A 1EZVE 5AW0B 5KAFE 1JCDA 3H1HJ 2OYIA 1NTKE 1L0NG 3PJSK 1FZCA 1EXIA 4W7ZA 2P58A 1YJWP 2FYUJ 1SP4A 1G2CB 3F89A 4I1LA 1P84H 5B66E 1GU5A 1SQBK 2A06E 1EDKA 1GDTA 2G8YA 3RGUA 1NKNA 3H1IG 3I56P 1OIPA 4PV1C 1OW8A 1LGHB 2FXMA 1VPCA 1IJDB 3SWYA 4ZMDA 5AW4B 4UB6H 2QJPC 2NPSC 3RL0C 3II6A 3LIEA 5AW2B 4EI2A 5KJ7A 3M06A 1E5WA 3QH9A 2Z4EA 2K37A 1D7MA 2PRRA 3JCUH 3MZWB 3N4XA 4C7RA 2C9NY 2N1TC 1OW6A 1S4XA 2P2UA 2BEQD 1YQ4C 2K9JA 3N7NA 2FFDC 2I8DA 1KILB 1SQXK 2YMYA 2KS1B 3H1KD 3L73G 4OVNF 4W7YA 3VTPC 4CPGA 5GTHE 1VQ7P 1LTAC 1Y9BA 1BDDA 1SQQG 3C9IA 3H6PA 1J1DC 1ZR4A 3KHUA 3L73E 3AECC 1H88A 5B5EE 3AE8C 5AW9B 4HJGH 1YIJP 1SQBE 1FDMA 1R5LA 2BCCG 3HTKB 1EDJA 3E1RA 4XFJA 1KB9E 1G2CA 2QJKC 2JWAA 2M3BA 2QJYC 1BCCJ 1HGZA 5AW8B 2YO3A 1J1EB 2KIKA 2WVRA 2ZJSE 1K73Q 1SQVE 2JEEA 4I7ZC 1S5LH 1FAVA 1PL5A 3I55P 4IL6X 1L0LG 1Q86Q 4LGDE 3CC4P 1PGQA 1T3UA 1USEA 2IYPA 2M8RA 4D6TG 1EDLA 1BSHA 2XU6A 4PD4E 2OYHC 1NOHA 3VMZA 1N8RQ 1M1KQ 1ZMEC 4RJTA 4RESB 3CCMP 1G1IA 3O6QB 3BRTB 1YTZT 3HD7A 5APUA 1LTGC 3P7KA 2K9JB 2B9BA 1X9VA 1H8AA 1GW3A 3V2RA 1M57D 3FXDA 2BASA 1NTMJ 1SQXG 1UIIA 2E74B 3G3ZA 1FU1A 3L70J 2W6BA 5GTHH 2Y9ZA 1LT1A 1RE3C 1GW4A 1IO4A 2POHA 3G6EP 2IFMA 5APQA 1GU4A 1P84D 1PPJD 3AE3C 4NPFX 1VQ5P 3LW5H 3G71P 1GL2C 4EDFA 1RF1B 3CWBG 3AE5C 4GOEA 1LTTC 4A7PA 2D2CD 2R5BA 1PV3A 2V4HA 1CZQA 3OJAB 2BCCE 1E79H 3PP5A 2A45G 5AW1B 3H1LD 1BCCE 3NTNA 2ZVNB 1JTHB 1IK7A 1RY3A 3CXHE 3L71E 4U3FJ 3TF5A 2O1KA 1PZQA 2KS1A 3A5TA 4OGQD 3H1JJ 1OWAA 1PP9D 1FBMA 2IZ1A 2ZT9C 3MP7B 4Y99B 1RF1A 1LTJA 3NFQA 1KILE 1U57A 2AEMA 2W8ZA 3L71G 3WUUA 1K05A 1YJ9P 2A06D 2FYUD 4WVZA 3A7OA 3TGUJ 4OGQB 3CCUP 3VP9A 3B5NA 3H1JE 3P8MC 1RH5B 2IBZG 3CMAP 3KDPB 1Q7YQ 5E79E 3LIDA 3CXHI 1L0ND 1WRGA 2L5GB 1JNMA 1ZLLA 1ZW0A 3WU2E 1BDCA 3L71J 2N1TA 4O9BA 5AVQB 1GMJA 3OA7A 3CCJP 2ITAA 3USSA 3Q2YA 2E75B 3TSIA 1URQA 1MFZA 3V6IA 1FDOA 1OVRA 1G1JA 1IFMA 1JY3P 2B87B 3HUSB 1OZHA 1SLQA 2KXPB 2Q5UA 4W80A 1S5LX 1H0TB 1JTHA 4GODA 3RL0B 1WMKA 2C9LY 4H0LB 3B4SA 1LNQA 3B8EB 3BATA 4ASWA 2KZIA 4ZNCA 1AQTA 3L70E 3WMM0 3H1KG 1MFTA 3H1HE 4LC1A 3MUDC 4PJ0H 1NWQA 1FZCC 4C46A 5AVWB 1MKMA 4H44D 4UB8H 1LWUA 1GK4A 2KNCB 3VYIA 1KN7A 3H1IE 4I2LC 3H1KE 2N9YB 2BEZF 2XKMA 3KQGA 3A0HE 1KV4A 2L91A 3NXSA 1GK6A 2W6AA 2OYHA 4H44B 5DJUB 2BCCD 4EIJA 5B5EH 1M8OB 1IK9A 2OTLP 4PD4D 3TGUD 2FY8A 4KT0J 1T8ZA 2CPBA 1SFCD 3P8CE 5KLIB 2QJKB 1DD3A 4OWFA 1FZGA 1FE6A 4TT3H 2E76C 3SSUA 3H1HD 2XNDH 3GHGA 5AVSB 3WUVA 3BASA 5KLVE 2JKVA 4DJGA 1LTJB 5AW3B 3OW2O 1Q82Q 1OX3A 1FOSF 1FZFA 5L8RJ 4AUWA 1BCCD 2WSEJ 3AE9C 3EQ2A 3M9HA 3TGUE 1QVGO 1DH3A 3L35A 2WSCJ 2LXBA 1RHZB 2G3AA 3CX5H 5EFWB 3OAKA 1JB0J 1IZNB 1N7SB 2RN0A 1DEBA 3CXHH 3U59A 5CCHC 1KD1Q 3HTKA 3KZIH 4TLFA 2AXTE 1SS1A 2Y0CA 5AVUB 1LJ2A 1PPJE 3HRNA 4EYYQ 2C0XA 4PD4I 2D2CB 3HD7D 5KLVK 1KYOD 2OYOA 1SVFA 2YKOA 5KTBA 1EXJA 1N7SD 2BCCJ 3Q5PA 2JR8A 4WWIA 1PPJG 1URQC 1RF0A 3MGNA 1VQKP 2GUSA 1TU3F 4JYCA 3AEAC 3M0DA 3CCEP 1JY3N 1K04A 1KB9D 1NAFA 3CXHD 2Q3EA 3GHGC 1FC2C 3O8ZA 4DZOA 3RK3D 2JJLA 1ZRTE 3CC2P 1PFIA 1QEXA 3CC7P 1JO5A 1S72P 2P7JA 1WT6A 1JY2P 1VDFA 2IX7C 2QVAA 1N86A 3M0AA 3L74D 5AW5B 1FZBA 2CK3H 3I5CA 1BE3G 5DJTB 5AVZB 3D71A 1PP9G 4YTPC 1LTSC 3RBXA 4YPCA 1NVOA 2QA4P 2ZXXA 5CCGC 1YITP 2A06G 2FYUG 4GDOA 3RK2D 4Z1MH 1U7MA 3BCCJ 1K9MQ 1NTKK 4R4LA 1VQOP 2J58A 1VL2A 1NKZB 1YTZI 2IBZD 5AVTB 1T2KC 1Q81Q 2OARA 1LT9A 1VQ4P 3PLNA 1ZR2A 2O01H 1L4AD 1FDIA 1PGJA 1L0NK 1SQVJ 2E74D 1LTBC 2H8PD 3EFGA 3R4YA 3U1CA 4PD4H 1P84I 1CI6A 1ZP0C 1P84E 2K9YA 2O3JA 5KKZB 1KQSO 2KI7B 2M5AB 4WY4A 3RL0D 2J59M 1L2PA 1SQBJ 2HODA 2WPSA 1NTMD 1X79B 3CX5D 4PV1B 3ZDMA 4AYCA 2ZVOB 2A45I 2N1TD 1IFPA 4Y28J 5CHXA 5BU8B 1AV1A 1SQXE 1RE3A 3GW6A 1DIPA 1SQQJ 3AEGC 1SQPE 2KZJA 2WITA 3AEFC 3H1JG 3KPEA 4NPDA 1QLED 1RE4A 3CCVP 3L37A 4N78E 3Q5RA 3RL0g 2Z5HA 2HPCB 1M1JC 2WSCH 2XV5A 1KQFB 2QJYB 1KILC 1NJIQ 3BVHA 2K88A 3H32A 2O01J 4WBAA 2OYIC 2P10A 3B5NC 2WWWA 1VQ6P 1H89A 4LLHA 2KOGA 3P8CD 2RH0A 1AFOA 1N73C 4K3AA 1VF5B 1VQMP 2ZFCA 1OMIA 2KK7A 1U7JA 2XZRA 3RK3E 2ZAEB 1S2EA 3L72D 1S9KE 1VQNP 1EC5A 1KB9H 2GA1A 3Q1MA 2HG5D 1FOSE 3KXDA 1JY2N 3L36A 1NTZJ 2B89A 2GUVA 1JMMA 2FYZA 1HUCA 3H1HG 3BRVB 2E75D 5APSA 3V2NA 1N2DC 2CPSA 2E43A 1DEEG 4PV1D 1JEKA 4WY4D 1BCCG 1FZEA 1NYHA 2QE7H 1KZUB 1NU1J 2N1TB 3O6QA 4IFMA 3FWNA 1BSNA 1EZVI 2N9BA 1QVFO 2IDBA 2LKMA 1X22A 2R32A 1RF1C 1KQGB 3SFDC 3T97B 2WTYA 1NTZE 2W83C 1EZVD 1DD4A 1RE4C 2RKLA 3JCUE 4GIFA 1Y8AA 1A02J 4K35A 3RK3B 1BGYJ 1NTZG 2Y9YA 3H25A 5GTIE 2LXCB 3BCCG 3QWOC 4BRYB 4NPEA 2YIUC 5KLVG 4U3FG 2D2CC 3CCQP 2RMZA 1OW7A 2ZT9B 4Y99C 1VF5D 3MTUE 1YJNP 1FJKA 2VRSA 1BE3J 3VMXA 1LTIC 4YXDC 4JQ0D 5C39A 2FYNC 2PFXA 5TISE 1N7LA 1VQ9P 2DW3A 1SFCB 1QGKB 1A02F 3RK2B 4HH2A 2QIWA 1K8AQ 2R3CA 1HVVA 1LT9C 3L74G 4D6TE 1BE3D 3U1AA 1Y47A 1KMIZ 1LP1A 1MV8A 2NPSD 4H13B 3WUTA 2E42A 1JUNA 1L4AB 4L74A 5CCGA 2KUBA 4PJ0E 5APXA 5KLVJ 3V4QA 5KJ7D 3SFEC 2NPSB 3C8VA 4H13D 4B86A 3H1LE 3L72E 1FZAA 3T97A 3Q5SA 3IR9A 3TK1A 2PGDA 5CMZA 5CBOA 2Y0DA 3AE4C 2K1AA 3A0BH 2YKQA 3HD7B 2OQQA 2KLUA 4L76A 3IAOA 4H0LC 4KJMA 4XA4A 4ZKUA 1NGMB 3MIWA 1LWUB 2KNCA 1KYOH 1NTMG 1ZV8A 2W90A 3KZIE 2NRGA 5BVZA 3GF3A 3H1IJ 5KAFH 2H43A 1SFCA 1N7SA 2MKVA 3H1JD 1NTME 2HLOA 1XTGB 1JY3O 1IFIA 2WSSH 3TNUA 4YXWH 1SQQK 2HYNA 1HBWA 3FXEA 1J1EC 3L74E 1S5LE 2KSJA 1EDIA 1GL2A 2KYVA 1M7LA 1L0LE 1SQPK 2B88A 4BRYA 1RQUA 1IFNA 5KAIH 2NPSA 5H2FH 2OYHB 2WSFJ 3E7KA 1PGOA 4ASVA 3PTZA 2FKWB 3AE7C 2P1JA 4RO0A 1ZXGA 3AEEC 5APYA 3V4WA 3M9QA 3EFFK 3L72G 2ZYGA 2IPPA 3FGAD 4N6JA 3S9OA 2WQYC 3WU2H 2JP3A 2M0BA 3SWFA 2SPZA 3IFMA 3K5BA 1J1DB 3L72J 2HODB 1VQPP 5E79H 1YYCA 1HWTC 3ABVC 1GL2D 3CI9A 3B71A 1NTMK 2Q9IA 1L4AA 1M90Q 3L73J 3M91A 5APWA 1LTJC 1S3JA 3SWKA 1AQ5A 3HE4A 1HF9A 4D6TJ 2FFDB 1VQLP 2E5YA 2KB7P 1T6AA 1NU1G 2QM7A 2KLVA 2OGUA 3CL3D 2O01N 1X0TA 2KP8A 2XDJA 4GKGA 2QSIA 1FZCB 3H32B 1NU1K 3FWLA 1EZVG 3GLMA 5TJHA 4AQRD 2QEXP 2IYOA 2Q3IA 2R5DA 3A2AA 3LW5J 3UIAA 1NTZD 1AVYA 3L4FA 5B66H 3BCCD 2W6JH 1FS0E 3L70D 5KLVD 4U3FD 4L73A 5KAIE 1NTZK
chains in the Genus database with same CATH topology
1S9KD 1KFMA 1J2JB 1NO4A 1Z56A 4M3LA 1OXZA 1W2EA 3MD0A 1EQ7A 3TNUB 2WT7B 1SFCC 1GL2B 4EOTA 3RK2C 4WY4B 1NHLA 1T2KD 1T3JA 5AW7B 4ZKPA 1L4AC 2YKPA 3VP8A 5AVRB 1MUUA 1GZLA 1X8YA 2HPCA 4N3YB 1URQB 1IC2A 3A3YB 3HE5B 2W27A 4C7NB 4HYTB 2WPQA 1IFDA 1KFNA 3B5NB 1URQD 5AW6B 3SWFA 1KILA 5AVXB 1LWUC 3NMDA 1XTCC 3HE5A 3MUDA 4JF7A 4WB4A 3TYYA 2Q7CA 3VP9A 1JOCA 3V5BA 3VMYA 1M1JB 4GT1A 1ZN5A 1L0LK 2C0WA 3HUSC 1MZ9A 2YNYA 5AVVB 2OYIB 4OH8B 5APVA 1CW5A 4IFFA 1N73B 1M1JA 5AVYB 1N7SC 2I1JA 2O1JA 2WPRA 3P32A 5CJ4A 1JCCA 4JYBA 4N78D 3RK3C 2WZ7A 4I6MC 1HJBA 2PAJA 4DOJA 3V2PA 1HH0A 1FJPA 1QL2A 3KYQA 1QL1A 1NH4A 3CLQA 2PP6A 2ZXEB 2QM8A 5CCGD 1CSBA 2HFED 3M0DC 1LT9B 1KQLA 3HUSA 2MJZA 3E1IA 2XNXA 1HGVA 2IFNA 3VN0A 2GM4A 3M9BA 1DX7A 1IFJA 2FFDA 5CCHD 5BU5A 2Z5IA 1JY2O 3R2PA 2H7HA 3HD7C 5KJ7C 1RF0C 4KHXA 2WSFH 2FYUK 2YO2A 3GHGB 2WT7A 5APTA 4WY4C 1HTLC 2I1KA 1GTWA 1KILD 1CI6B 5CCHA 4XE5B 3B5ND 3VOPA 2P67A 5CJ0A 3V2QA 4C7NA 1GD2E 3HE4B 1SQVK 1N73A 2A45H 2WSEH 5AW0B 1JCDA 2OYIA 1FZCA 4W7ZA 1SP4A 1G2CB 1GU5A 4I1LA 1SQBK 1GDTA 1NKNA 3SWYA 1LGHB 2FXMA 1VPCA 1IJDB 5AW4B 2NPSC 3RL0C 3II6A 3LIEA 5AW2B 5KJ7A 3M06A 1E5WA 2Z4EA 4C7RA 2C9NY 3N4XA 2N1TC 2P2UA 3N7NA 2FFDC 1KILB 1SQXK 2YMYA 4W7YA 3VTPC 1LTAC 3C9IA 1ZR4A 3H6PA 1J1DC 1H88A 5AW9B 1FDMA 3HTKB 1G2CA 2M3BA 1HGZA 5AW8B 2YO3A 1J1EB 2JEEA 1FAVA 4LGDE 1T3UA 2M8RA 2XU6A 2OYHC 1NOHA 3VMZA 4RESB 1G1IA 3BRTB 1YTZT 3HD7A 5APUA 1LTGC 3P7KA 1H8AA 1X9VA 1GW3A 3V2RA 2BASA 3G3ZA 1FU1A 2W6BA 1RE3C 1GW4A 1IO4A 2POHA 2IFMA 5APQA 1GU4A 3LW5H 1GL2C 1RF1B 1LTTC 2R5BA 3OJAB 1CZQA 3PP5A 2A45G 5AW1B 3NTNA 1AQ5A 1JTHB 1RY3A 2O1KA 3A5TA 1RF1A 1OWAA 1FBMA 4Y99B 1LTJA 3NFQA 3A7OA 3B5NA 3P8MC 3KDPB 3LIDA 1WRGA 2L5GB 1JNMA 1ZLLA 2N1TA 4O9BA 5AVQB 3OA7A 3TSIA 1URQA 1MFZA 1G1JA 1IFMA 1JY3P 3HUSB 1SLQA 4W80A 2Q5UA 1JTHA 3RL0B 2C9LY 3BATA 3B8EB 3WMM0 4LC1A 1NWQA 1FZCC 4C46A 5AVWB 1LWUA 1GK4A 3VYIA 4I2LC 3KQGA 2XKMA 3NXSA 1GK6A 2W6AA 2OYHA 4EIJA 1IK9A 1T8ZA 2CPBA 1SFCD 3P8CE 1FZGA 4IFDK 5AVSB 3GHGA 3BASA 1FOSF 1LTJB 5AW3B 1FZFA 4AUWA 3EQ2A 3M9HA 1DH3A 3L35A 3OAKA 1N7SB 5CCHC 1DEBA 3U59A 3HTKA 5AVUB 3HRNA 2C0XA 5KLVK 3HD7D 5KTBA 1SVFA 2YKOA 1N7SD 1URQC 1RF0A 3MGNA 2GUSA 4JYCA 3M0DA 1JY3N 1NAFA 3GHGC 3O8ZA 4DZOA 3RK3D 2JJLA 1PFIA 1JO5A 2P7JA 1WT6A 1JY2P 1VDFA 2IX7C 1N86A 3M0AA 5AW5B 1FZBA 3I5CA 5AVZB 1LTSC 5CCGC 3RK2D 1NTKK 2J58A 1T2KC 1NKZB 1YTZI 5AVTB 2OARA 1LT9A 1ZR2A 2O01H 1L4AD 1L0NK 2H8PD 1LTBC 3EFGA 3U1CA 1CI6A 4WY4A 3RL0D 2J59M 2WPSA 2HODA 1X79B 4AYCA 5BU8B 2A45I 2N1TD 5CHXA 1RE3A 2WITA 3KPEA 1RE4A 3L37A 4N78E 2Z5HA 2HPCB 1M1JC 2WSCH 2XV5A 1KILC 3BVHA 3H32A 4WBAA 2OYIC 3B5NC 2WWWA 1H89A 4LLHA 2KOGA 3P8CD 1AFOA 1N73C 2ZFCA 2XZRA 1S9KE 2HG5D 1FOSE 1JY2N 3L36A 2GUVA 1JMMA 2FYZA 1HUCA 3BRVB 5APSA 3V2NA 1N2DC 2CPSA 2E43A 4WY4D 1FZEA 4IFMA 1KZUB 2N1TB 2N9BA 2LKMA 2R32A 1RF1C 2WTYA 1RE4C 4GIFA 1A02J 3RK3B 4Y99C 3MTUE 1FJKA 2VRSA 3VMXA 1LTIC 1N7LA 1SFCB 1A02F 3RK2B 4HH2A 2R3CA 1HVVA 1LT9C 3U1AA 1JUNA 2E42A 1MV8A 2NPSD 1L4AB 5CCGA 5APXA 3V4QA 5KJ7D 2NPSB 4B86A 3T97A 1FZAA 3IR9A 3TK1A 5CMZA 2YKQA 3HD7B 4XA4A 4ZKUA 3MIWA 1LWUB 1ZV8A 5BVZA 2H43A 1SFCA 1N7SA 2HLOA 1XTGB 1JY3O 1IFIA 3TNUA 1HBWA 1SQQK 2HYNA 1J1EC 2KYVA 2KSJA 1GL2A 1M7LA 1SQPK 1IFNA 2NPSA 2OYHB 2FKWB 5APYA 2P1JA 3V4WA 3M9QA 2IPPA 4N6JA 3IFMA 1J1DB 2HODB 1YYCA 1HWTC 1GL2D 3CI9A 1NTMK 2Q9IA 1L4AA 3M91A 5APWA 1LTJC 3HE4A 2FFDB 2KB7P 2QM7A 2KLVA 3CL3D 2KP8A 2XDJA 4GKGA 1FZCB 3H32B 1NU1K 4AQRD 2Q3IA 2R5DA 3A2AA 3UIAA 3L4FA 1NTZK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOS E;  3L36 A;  4XE5 B;  1SLQ A;  2Q5U A;  1S9K D;  2P67 A;  1HUC A;  1J2J B;  5APS A;  4C7N A;  1GD2 E;  2C9L Y;  2E43 A;  3B8E B;  4M3L A;  1OXZ A;  3MD0 A;  3HE4 B;  4LC1 A;  1NWQ A;  3TNU B;  2WT7 B;  5AW0 B;  5AVW B;  4C46 A;  2N9B A;  1GK4 A;  2R32 A;  3VYI A;  4EOT A;  4I2L C;  2WTY A;  3KQG A;  1SP4 A;  1G2C B;  1GU5 A;  1T2K D;  3NXS A;  1GK6 A;  2W6A A;  5AW7 B;  1A02 J;  5AVR B;  5AW4 B;  1MUU A;  1GZL A;  5AW2 B;  3LIE A;  1X8Y A;  3M06 A;  2VRS A;  5AVS B;  3A3Y B;  3VMX A;  4C7N B;  3HE5 B;  2W27 A;  2P2U A;  4HYT B;  1FOS F;  5AW3 B;  2WPQ A;  4AUW A;  1A02 F;  3M9H A;  3VTP C;  2R3C A;  1DH3 A;  3L35 A;  5AW6 B;  3SWF A;  5AVX B;  1JUN A;  2E42 A;  1MV8 A;  3NMD A;  3OAK A;  3HE5 A;  3TYY A;  3HTK A;  1H88 A;  2Q7C A;  5AVU B;  5AW9 B;  5APX A;  3V5B A;  3V4Q A;  3VMY A;  4B86 A;  3T97 A;  4GT1 A;  3IR9 A;  3TK1 A;  5CMZ A;  5AW8 B;  2YO3 A;  2YNY A;  3MGN A;  5AVV B;  4JYC A;  5APV A;  3M0D A;  1FAV A;  1NAF A;  3O8Z A;  4DZO A;  2JJL A;  5AVY B;  2XU6 A;  3VMZ A;  2P7J A;  4RES B;  3M0A A;  5AW5 B;  3I5C A;  5APU A;  5AVZ B;  3P7K A;  1H8A A;  2WPR A;  3P32 A;  2BAS A;  4JYB A;  3TNU A;  1HBW A;  4I6M C;  1HJB A;  1T2K C;  5AVT B;  1IO4 A;  5APQ A;  1GU4 A;  2ZXE B;  1CI6 A;  5APY A;  2R5B A;  3V4W A;  2QM8 A;  1CZQ A;  5AW1 B;  1CSB A;  2C9N Y;  2IPP A;  2WPS A;  3NTN A;  1KQL A;  4AYC A;  3A5T A;  1OWA A;  1YYC A;  1HWT C;  3VN0 A;  3NFQ A;  3M9B A;  3L37 A;  2Z5H A;  3A7O A;  3M91 A;  5APW A;  3HE4 A;  2XV5 A;  3P8M C;  2Z5I A;  3KDP B;  2QM7 A;  3LID A;  2H7H A;  2WWW A;  1JNM A;  2KP8 A;  4GKG A;  1H89 A;  4KHX A;  4AQR D;  2YO2 A;  2ZFC A;  2WT7 A;  2XZR A;  2Q3I A;  2R5D A;  5APT A;  3A2A A;  5AVQ B;  3UIA A;  1GTW A;  1S9K E;  1MFZ A;  1CI6 B; 
#chains in the Genus database with same CATH topology
 2YMK A;  1KC8 Q;  1BGY E;  2QRX A;  2QG4 A;  3JSV C;  3CCL P;  1S9K D;  1KFM A;  3CX5 I;  1L0L J;  3G4S P;  1J2J B;  1NO4 A;  3L74 J;  1Z56 A;  2FYU E;  1OXZ A;  1W2E A;  4M3L A;  1JM0 A;  1EQ7 A;  3L75 E;  3MD0 A;  5KLI C;  3L75 J;  5M1B A;  3CCS P;  3TNU B;  2WT7 B;  1Q90 D;  4JPZ B;  1SFC C;  2YXQ B;  1GL2 B;  3L75 G;  4EOT A;  1OFC X;  3RK2 C;  1KYO E;  1SQP G;  3PRJ A;  2M5A A;  4WY4 B;  2AEF A;  3PH0 A;  1AJY A;  1NHL A;  1T2K D;  3EWK A;  1T3J A;  1NTK G;  5AW7 B;  4ZKP A;  2WMM A;  1L4A C;  1PP9 J;  1BGY D;  2E74 C;  2HR3 A;  2YKP A;  4IL6 E;  5TIS H;  3VP8 A;  5CBN A;  3AE2 C;  5AVR B;  1VQ8 P;  4HB1 A;  1MUU A;  1SQB G;  1GZL A;  1X8Y A;  3D70 A;  3H1L J;  1W5C E;  1M56 D;  1NAY A;  3AE6 C;  2HPC A;  1OVU A;  4N3Y B;  1URQ B;  1IC2 A;  2Q1K A;  3A3Y B;  2W27 A;  3HE5 B;  4HYT B;  2R44 A;  4OGQ C;  4C7N B;  3G9R A;  3D6Z A;  3CME P;  2ZT9 D;  1SQV G;  2WPQ A;  2FXP A;  2M3E A;  2J5U A;  1YI2 P;  1IFD A;  2IBZ E;  1KFN A;  3A0H H;  1URQ D;  3B5N B;  5AW6 B;  1KIL A;  2FBW C;  5AVX B;  1LWU C;  3W68 A;  3NMD A;  1XTC C;  1OVV A;  3HE5 A;  3MUD A;  4JF7 A;  4WB4 A;  3TYY A;  2Q7C A;  2E76 D;  1JOC A;  1BE3 E;  4RKU J;  3V5B A;  2E5T A;  4U3F E;  1SQQ E;  3VMY A;  3GG2 A;  2QJP B;  2OTK E;  3H1I D;  1M1J B;  3D6Y A;  4GT1 A;  1ZN5 A;  1L0L K;  2C0W A;  3HUS C;  1MZ9 A;  1H0T A;  2YNY A;  5AVV B;  1YHQ P;  2H88 C;  2WPV B;  2R3S A;  4OH8 B;  4IFF A;  5APV A;  3VMA A;  2B87 A;  2OYI B;  1CW5 A;  3FX0 A;  5GTI H;  2OTJ P;  1N73 B;  4IL6 H;  3CD6 P;  1W2B O;  1YQ3 C;  2V7Q H;  1M1J A;  5AVY B;  3RBZ A;  3CWB E;  3MHV A;  2FXO A;  3CX5 E;  3ITK A;  2KSE A;  1N7S C;  2IZ0 A;  3F5H A;  3L73 D;  2E75 C;  2AXT H;  4IFD K;  4DCK A;  1SQQ D;  2I1J A;  4DT0 A;  2O1J A;  2WPR A;  3P32 A;  3TDK A;  1ZRT D;  1QX8 A;  4H44 C;  5CJ4 A;  3AED C;  1JCC A;  4JYB A;  4N78 D;  3RK3 C;  2WZ7 A;  4I6M C;  2AXC A;  2PAJ A;  1HJB A;  4DOJ A;  3V2P A;  1HH0 A;  1FJP A;  1NU1 D;  1QL2 A;  4I7Z B;  3KYQ A;  3CWB J;  1UIX A;  1KB9 I;  1QL1 A;  1LP1 B;  1NH4 A;  3CLQ A;  2E76 B;  1AVO A;  1YBK A;  2PP6 A;  2ZXE B;  3IN6 A;  2FYN B;  4L75 A;  1L0L D;  1USD A;  2QM8 A;  5CCG D;  2V7Q J;  4D6T D;  1CSB A;  1AA0 A;  2HFE D;  2NZ2 A;  1VF5 C;  3M0D C;  1KYO I;  2JO1 A;  1LT9 B;  3L70 G;  1PIX A;  1KQL A;  1PGP A;  2Y0E A;  1KOR A;  2YIU B;  3GF7 A;  3HUS A;  1S1C X;  2MJZ A;  3E1I A;  2Q6Q A;  1HGV A;  2IFN A;  2XNX A;  3VN0 A;  2GM4 A;  3M9B A;  4UB8 E;  1IFJ A;  2IBZ I;  2AEJ A;  1DX7 A;  2FFD A;  1SQP J;  1SQX D;  3S4R A;  3CPW O;  5CCH D;  1Q2N A;  3CCR P;  3Q3D A;  1KTM A;  5BU5 A;  2Z5I A;  1JY2 O;  2YXR B;  3R2P A;  3L75 D;  2H7H A;  3HD7 C;  5KJ7 C;  5KKZ C;  4UB6 E;  1SQX J;  1SQP D;  3GMA A;  1RF0 C;  4H13 C;  4KHX A;  2WSF H;  2FYU K;  2YO2 A;  3CWB D;  3GHG B;  4IOI H;  1RQV A;  1R8E A;  1JMB A;  3JC2 2;  2WT7 A;  1NTK D;  2K3R A;  1ZOY C;  4GOF A;  5APT A;  4WY4 C;  1HTL C;  1BGY G;  2I1K A;  3IF4 A;  1R5S A;  3H1L G;  1GTW A;  3TGU G;  5H2F E;  1SQB D;  1KIL D;  1CI6 B;  4H0L D;  4QMA A;  5K5G B;  2ZYA A;  2ZYD A;  4HKZ H;  4JBZ A;  5CCH A;  4XE5 B;  1PP9 E;  3B5N D;  4U7J A;  3A0B E;  2UWJ E;  2P67 A;  3BCC E;  3AEB C;  5CJ0 A;  1NTK J;  3S1K A;  3VOP A;  4BXL A;  3L71 D;  1HJ0 A;  3V2Q A;  4C7N A;  2H89 C;  4R4M A;  1GD2 E;  1NU1 E;  2JDI H;  2LR2 A;  3H1K J;  4BWN A;  1SQV D;  1L0N E;  3PHL A;  3AE1 C;  2JWD A;  1L0N J;  1SQV K;  3HE4 B;  2A45 H;  2WSE H;  3C1L A;  4MN4 C;  3W67 A;  1N73 A;  1EZV E;  5AW0 B;  5KAF E;  1JCD A;  3H1H J;  2OYI A;  1NTK E;  1L0N G;  3PJS K;  1FZC A;  1EXI A;  4W7Z A;  2P58 A;  1YJW P;  2FYU J;  1SP4 A;  1G2C B;  3F89 A;  4I1L A;  1P84 H;  5B66 E;  1GU5 A;  1SQB K;  2A06 E;  1EDK A;  1GDT A;  2G8Y A;  3RGU A;  1NKN A;  3H1I G;  3I56 P;  1OIP A;  4PV1 C;  1OW8 A;  1LGH B;  2FXM A;  1VPC A;  1IJD B;  3SWY A;  4ZMD A;  5AW4 B;  4UB6 H;  2QJP C;  2NPS C;  3RL0 C;  3II6 A;  3LIE A;  5AW2 B;  4EI2 A;  5KJ7 A;  3M06 A;  1E5W A;  3QH9 A;  2Z4E A;  2K37 A;  1D7M A;  2PRR A;  3JCU H;  3MZW B;  3N4X A;  4C7R A;  2C9N Y;  2N1T C;  1OW6 A;  1S4X A;  2P2U A;  2BEQ D;  1YQ4 C;  2K9J A;  3N7N A;  2FFD C;  2I8D A;  1KIL B;  1SQX K;  2YMY A;  2KS1 B;  3H1K D;  3L73 G;  4OVN F;  4W7Y A;  3VTP C;  4CPG A;  5GTH E;  1VQ7 P;  1LTA C;  1Y9B A;  1BDD A;  1SQQ G;  3C9I A;  3H6P A;  1J1D C;  1ZR4 A;  3KHU A;  3L73 E;  3AEC C;  1H88 A;  5B5E E;  3AE8 C;  5AW9 B;  4HJG H;  1YIJ P;  1SQB E;  1FDM A;  1R5L A;  2BCC G;  3HTK B;  1EDJ A;  3E1R A;  4XFJ A;  1KB9 E;  1G2C A;  2QJK C;  2JWA A;  2M3B A;  2QJY C;  1BCC J;  1HGZ A;  5AW8 B;  2YO3 A;  1J1E B;  2KIK A;  2WVR A;  2ZJS E;  1K73 Q;  1SQV E;  2JEE A;  4I7Z C;  1S5L H;  1FAV A;  1PL5 A;  3I55 P;  4IL6 X;  1L0L G;  1Q86 Q;  4LGD E;  3CC4 P;  1PGQ A;  1T3U A;  1USE A;  2IYP A;  2M8R A;  4D6T G;  1EDL A;  1BSH A;  2XU6 A;  4PD4 E;  2OYH C;  1NOH A;  3VMZ A;  1N8R Q;  1M1K Q;  1ZME C;  4RJT A;  4RES B;  3CCM P;  1G1I A;  3O6Q B;  3BRT B;  1YTZ T;  3HD7 A;  5APU A;  1LTG C;  3P7K A;  2K9J B;  2B9B A;  1X9V A;  1H8A A;  1GW3 A;  3V2R A;  1M57 D;  3FXD A;  2BAS A;  1NTM J;  1SQX G;  1UII A;  2E74 B;  3G3Z A;  1FU1 A;  3L70 J;  2W6B A;  5GTH H;  2Y9Z A;  1LT1 A;  1RE3 C;  1GW4 A;  1IO4 A;  2POH A;  3G6E P;  2IFM A;  5APQ A;  1GU4 A;  1P84 D;  1PPJ D;  3AE3 C;  4NPF X;  1VQ5 P;  3LW5 H;  3G71 P;  1GL2 C;  4EDF A;  1RF1 B;  3CWB G;  3AE5 C;  4GOE A;  1LTT C;  4A7P A;  2D2C D;  2R5B A;  1PV3 A;  2V4H A;  1CZQ A;  3OJA B;  2BCC E;  1E79 H;  3PP5 A;  2A45 G;  5AW1 B;  3H1L D;  1BCC E;  3NTN A;  2ZVN B;  1JTH B;  1IK7 A;  1RY3 A;  3CXH E;  3L71 E;  4U3F J;  3TF5 A;  2O1K A;  1PZQ A;  2KS1 A;  3A5T A;  4OGQ D;  3H1J J;  1OWA A;  1PP9 D;  1FBM A;  2IZ1 A;  2ZT9 C;  3MP7 B;  4Y99 B;  1RF1 A;  1LTJ A;  3NFQ A;  1KIL E;  1U57 A;  2AEM A;  2W8Z A;  3L71 G;  3WUU A;  1K05 A;  1YJ9 P;  2A06 D;  2FYU D;  4WVZ A;  3A7O A;  3TGU J;  4OGQ B;  3CCU P;  3VP9 A;  3B5N A;  3H1J E;  3P8M C;  1RH5 B;  2IBZ G;  3CMA P;  3KDP B;  1Q7Y Q;  5E79 E;  3LID A;  3CXH I;  1L0N D;  1WRG A;  2L5G B;  1JNM A;  1ZLL A;  1ZW0 A;  3WU2 E;  1BDC A;  3L71 J;  2N1T A;  4O9B A;  5AVQ B;  1GMJ A;  3OA7 A;  3CCJ P;  2ITA A;  3USS A;  3Q2Y A;  2E75 B;  3TSI A;  1URQ A;  1MFZ A;  3V6I A;  1FDO A;  1OVR A;  1G1J A;  1IFM A;  1JY3 P;  2B87 B;  3HUS B;  1OZH A;  1SLQ A;  2KXP B;  2Q5U A;  4W80 A;  1S5L X;  1H0T B;  1JTH A;  4GOD A;  3RL0 B;  1WMK A;  2C9L Y;  4H0L B;  3B4S A;  1LNQ A;  3B8E B;  3BAT A;  4ASW A;  2KZI A;  4ZNC A;  1AQT A;  3L70 E;  3WMM 0;  3H1K G;  1MFT A;  3H1H E;  4LC1 A;  3MUD C;  4PJ0 H;  1NWQ A;  1FZC C;  4C46 A;  5AVW B;  1MKM A;  4H44 D;  4UB8 H;  1LWU A;  1GK4 A;  2KNC B;  3VYI A;  1KN7 A;  3H1I E;  4I2L C;  3H1K E;  2N9Y B;  2BEZ F;  2XKM A;  3KQG A;  3A0H E;  1KV4 A;  2L91 A;  3NXS A;  1GK6 A;  2W6A A;  2OYH A;  4H44 B;  5DJU B;  2BCC D;  4EIJ A;  5B5E H;  1M8O B;  1IK9 A;  2OTL P;  4PD4 D;  3TGU D;  2FY8 A;  4KT0 J;  1T8Z A;  2CPB A;  1SFC D;  3P8C E;  5KLI B;  2QJK B;  1DD3 A;  4OWF A;  1FZG A;  1FE6 A;  4TT3 H;  2E76 C;  3SSU A;  3H1H D;  2XND H;  3GHG A;  5AVS B;  3WUV A;  3BAS A;  5KLV E;  2JKV A;  4DJG A;  1LTJ B;  5AW3 B;  3OW2 O;  1Q82 Q;  1OX3 A;  1FOS F;  1FZF A;  5L8R J;  4AUW A;  1BCC D;  2WSE J;  3AE9 C;  3EQ2 A;  3M9H A;  3TGU E;  1QVG O;  1DH3 A;  3L35 A;  2WSC J;  2LXB A;  1RHZ B;  2G3A A;  3CX5 H;  5EFW B;  3OAK A;  1JB0 J;  1IZN B;  1N7S B;  2RN0 A;  1DEB A;  3CXH H;  3U59 A;  5CCH C;  1KD1 Q;  3HTK A;  3KZI H;  4TLF A;  2AXT E;  1SS1 A;  2Y0C A;  5AVU B;  1LJ2 A;  1PPJ E;  3HRN A;  4EYY Q;  2C0X A;  4PD4 I;  2D2C B;  3HD7 D;  5KLV K;  1KYO D;  2OYO A;  1SVF A;  2YKO A;  5KTB A;  1EXJ A;  1N7S D;  2BCC J;  3Q5P A;  2JR8 A;  4WWI A;  1PPJ G;  1URQ C;  1RF0 A;  3MGN A;  1VQK P;  2GUS A;  1TU3 F;  4JYC A;  3AEA C;  3M0D A;  3CCE P;  1JY3 N;  1K04 A;  1KB9 D;  1NAF A;  3CXH D;  2Q3E A;  3GHG C;  1FC2 C;  3O8Z A;  4DZO A;  3RK3 D;  2JJL A;  1ZRT E;  3CC2 P;  1PFI A;  1QEX A;  3CC7 P;  1JO5 A;  1S72 P;  2P7J A;  1WT6 A;  1JY2 P;  1VDF A;  2IX7 C;  2QVA A;  1N86 A;  3M0A A;  3L74 D;  5AW5 B;  1FZB A;  2CK3 H;  3I5C A;  1BE3 G;  5DJT B;  5AVZ B;  3D71 A;  1PP9 G;  4YTP C;  1LTS C;  3RBX A;  4YPC A;  1NVO A;  2QA4 P;  2ZXX A;  5CCG C;  1YIT P;  2A06 G;  2FYU G;  4GDO A;  3RK2 D;  4Z1M H;  1U7M A;  3BCC J;  1K9M Q;  1NTK K;  4R4L A;  1VQO P;  2J58 A;  1VL2 A;  1NKZ B;  1YTZ I;  2IBZ D;  5AVT B;  1T2K C;  1Q81 Q;  2OAR A;  1LT9 A;  1VQ4 P;  3PLN A;  1ZR2 A;  2O01 H;  1L4A D;  1FDI A;  1PGJ A;  1L0N K;  1SQV J;  2E74 D;  1LTB C;  2H8P D;  3EFG A;  3R4Y A;  3U1C A;  4PD4 H;  1P84 I;  1CI6 A;  1ZP0 C;  1P84 E;  2K9Y A;  2O3J A;  5KKZ B;  1KQS O;  2KI7 B;  2M5A B;  4WY4 A;  3RL0 D;  2J59 M;  1L2P A;  1SQB J;  2HOD A;  2WPS A;  1NTM D;  1X79 B;  3CX5 D;  4PV1 B;  3ZDM A;  4AYC A;  2ZVO B;  2A45 I;  2N1T D;  1IFP A;  4Y28 J;  5CHX A;  5BU8 B;  1AV1 A;  1SQX E;  1RE3 A;  3GW6 A;  1DIP A;  1SQQ J;  3AEG C;  1SQP E;  2KZJ A;  2WIT A;  3AEF C;  3H1J G;  3KPE A;  4NPD A;  1QLE D;  1RE4 A;  3CCV P;  3L37 A;  4N78 E;  3Q5R A;  3RL0 g;  2Z5H A;  2HPC B;  1M1J C;  2WSC H;  2XV5 A;  1KQF B;  2QJY B;  1KIL C;  1NJI Q;  3BVH A;  2K88 A;  3H32 A;  2O01 J;  4WBA A;  2OYI C;  2P10 A;  3B5N C;  2WWW A;  1VQ6 P;  1H89 A;  4LLH A;  2KOG A;  3P8C D;  2RH0 A;  1AFO A;  1N73 C;  4K3A A;  1VF5 B;  1VQM P;  2ZFC A;  1OMI A;  2KK7 A;  1U7J A;  2XZR A;  3RK3 E;  2ZAE B;  1S2E A;  3L72 D;  1S9K E;  1VQN P;  1EC5 A;  1KB9 H;  2GA1 A;  3Q1M A;  2HG5 D;  1FOS E;  3KXD A;  1JY2 N;  3L36 A;  1NTZ J;  2B89 A;  2GUV A;  1JMM A;  2FYZ A;  1HUC A;  3H1H G;  3BRV B;  2E75 D;  5APS A;  3V2N A;  1N2D C;  2CPS A;  2E43 A;  1DEE G;  4PV1 D;  1JEK A;  4WY4 D;  1BCC G;  1FZE A;  1NYH A;  2QE7 H;  1KZU B;  1NU1 J;  2N1T B;  3O6Q A;  4IFM A;  3FWN A;  1BSN A;  1EZV I;  2N9B A;  1QVF O;  2IDB A;  2LKM A;  1X22 A;  2R32 A;  1RF1 C;  1KQG B;  3SFD C;  3T97 B;  2WTY A;  1NTZ E;  2W83 C;  1EZV D;  1DD4 A;  1RE4 C;  2RKL A;  3JCU E;  4GIF A;  1Y8A A;  1A02 J;  4K35 A;  3RK3 B;  1BGY J;  1NTZ G;  2Y9Y A;  3H25 A;  5GTI E;  2LXC B;  3BCC G;  3QWO C;  4BRY B;  4NPE A;  2YIU C;  5KLV G;  4U3F G;  2D2C C;  3CCQ P;  2RMZ A;  1OW7 A;  2ZT9 B;  4Y99 C;  1VF5 D;  3MTU E;  1YJN P;  1FJK A;  2VRS A;  1BE3 J;  3VMX A;  1LTI C;  4YXD C;  4JQ0 D;  5C39 A;  2FYN C;  2PFX A;  5TIS E;  1N7L A;  1VQ9 P;  2DW3 A;  1SFC B;  1QGK B;  1A02 F;  3RK2 B;  4HH2 A;  2QIW A;  1K8A Q;  2R3C A;  1HVV A;  1LT9 C;  3L74 G;  4D6T E;  1BE3 D;  3U1A A;  1Y47 A;  1KMI Z;  1LP1 A;  1MV8 A;  2NPS D;  4H13 B;  3WUT A;  2E42 A;  1JUN A;  1L4A B;  4L74 A;  5CCG A;  2KUB A;  4PJ0 E;  5APX A;  5KLV J;  3V4Q A;  5KJ7 D;  3SFE C;  2NPS B;  3C8V A;  4H13 D;  4B86 A;  3H1L E;  3L72 E;  1FZA A;  3T97 A;  3Q5S A;  3IR9 A;  3TK1 A;  2PGD A;  5CMZ A;  5CBO A;  2Y0D A;  3AE4 C;  2K1A A;  3A0B H;  2YKQ A;  3HD7 B;  2OQQ A;  2KLU A;  4L76 A;  3IAO A;  4H0L C;  4KJM A;  4XA4 A;  4ZKU A;  1NGM B;  3MIW A;  1LWU B;  2KNC A;  1KYO H;  1NTM G;  1ZV8 A;  2W90 A;  3KZI E;  2NRG A;  5BVZ A;  3GF3 A;  3H1I J;  5KAF H;  2H43 A;  1SFC A;  1N7S A;  2MKV A;  3H1J D;  1NTM E;  2HLO A;  1XTG B;  1JY3 O;  1IFI A;  2WSS H;  3TNU A;  4YXW H;  1SQQ K;  2HYN A;  1HBW A;  3FXE A;  1J1E C;  3L74 E;  1S5L E;  2KSJ A;  1EDI A;  1GL2 A;  2KYV A;  1M7L A;  1L0L E;  1SQP K;  2B88 A;  4BRY A;  1RQU A;  1IFN A;  5KAI H;  2NPS A;  5H2F H;  2OYH B;  2WSF J;  3E7K A;  1PGO A;  4ASV A;  3PTZ A;  2FKW B;  3AE7 C;  2P1J A;  4RO0 A;  1ZXG A;  3AEE C;  5APY A;  3V4W A;  3M9Q A;  3EFF K;  3L72 G;  2ZYG A;  2IPP A;  3FGA D;  4N6J A;  3S9O A;  2WQY C;  3WU2 H;  2JP3 A;  2M0B A;  3SWF A;  2SPZ A;  3IFM A;  3K5B A;  1J1D B;  3L72 J;  2HOD B;  1VQP P;  5E79 H;  1YYC A;  1HWT C;  3ABV C;  1GL2 D;  3CI9 A;  3B71 A;  1NTM K;  2Q9I A;  1L4A A;  1M90 Q;  3L73 J;  3M91 A;  5APW A;  1LTJ C;  1S3J A;  3SWK A;  1AQ5 A;  3HE4 A;  1HF9 A;  4D6T J;  2FFD B;  1VQL P;  2E5Y A;  2KB7 P;  1T6A A;  1NU1 G;  2QM7 A;  2KLV A;  2OGU A;  3CL3 D;  2O01 N;  1X0T A;  2KP8 A;  2XDJ A;  4GKG A;  2QSI A;  1FZC B;  3H32 B;  1NU1 K;  3FWL A;  1EZV G;  3GLM A;  5TJH A;  4AQR D;  2QEX P;  2IYO A;  2Q3I A;  2R5D A;  3A2A A;  3LW5 J;  3UIA A;  1NTZ D;  1AVY A;  3L4F A;  5B66 H;  3BCC D;  2W6J H;  1FS0 E;  3L70 D;  5KLV D;  4U3F D;  4L73 A;  5KAI E;  1NTZ K; 
#chains in the Genus database with same CATH homology
 1S9K D;  1KFM A;  1J2J B;  1NO4 A;  1Z56 A;  4M3L A;  1OXZ A;  1W2E A;  3MD0 A;  1EQ7 A;  3TNU B;  2WT7 B;  1SFC C;  1GL2 B;  4EOT A;  3RK2 C;  4WY4 B;  1NHL A;  1T2K D;  1T3J A;  5AW7 B;  4ZKP A;  1L4A C;  2YKP A;  3VP8 A;  5AVR B;  1MUU A;  1GZL A;  1X8Y A;  2HPC A;  4N3Y B;  1URQ B;  1IC2 A;  3A3Y B;  3HE5 B;  2W27 A;  4C7N B;  4HYT B;  2WPQ A;  1IFD A;  1KFN A;  3B5N B;  1URQ D;  5AW6 B;  3SWF A;  1KIL A;  5AVX B;  1LWU C;  3NMD A;  1XTC C;  3HE5 A;  3MUD A;  4JF7 A;  4WB4 A;  3TYY A;  2Q7C A;  3VP9 A;  1JOC A;  3V5B A;  3VMY A;  1M1J B;  4GT1 A;  1ZN5 A;  1L0L K;  2C0W A;  3HUS C;  1MZ9 A;  2YNY A;  5AVV B;  2OYI B;  4OH8 B;  5APV A;  1CW5 A;  4IFF A;  1N73 B;  1M1J A;  5AVY B;  1N7S C;  2I1J A;  2O1J A;  2WPR A;  3P32 A;  5CJ4 A;  1JCC A;  4JYB A;  4N78 D;  3RK3 C;  2WZ7 A;  4I6M C;  1HJB A;  2PAJ A;  4DOJ A;  3V2P A;  1HH0 A;  1FJP A;  1QL2 A;  3KYQ A;  1QL1 A;  1NH4 A;  3CLQ A;  2PP6 A;  2ZXE B;  2QM8 A;  5CCG D;  1CSB A;  2HFE D;  3M0D C;  1LT9 B;  1KQL A;  3HUS A;  2MJZ A;  3E1I A;  2XNX A;  1HGV A;  2IFN A;  3VN0 A;  2GM4 A;  3M9B A;  1DX7 A;  1IFJ A;  2FFD A;  5CCH D;  5BU5 A;  2Z5I A;  1JY2 O;  3R2P A;  2H7H A;  3HD7 C;  5KJ7 C;  1RF0 C;  4KHX A;  2WSF H;  2FYU K;  2YO2 A;  3GHG B;  2WT7 A;  5APT A;  4WY4 C;  1HTL C;  2I1K A;  1GTW A;  1KIL D;  1CI6 B;  5CCH A;  4XE5 B;  3B5N D;  3VOP A;  2P67 A;  5CJ0 A;  3V2Q A;  4C7N A;  1GD2 E;  3HE4 B;  1SQV K;  1N73 A;  2A45 H;  2WSE H;  5AW0 B;  1JCD A;  2OYI A;  1FZC A;  4W7Z A;  1SP4 A;  1G2C B;  1GU5 A;  4I1L A;  1SQB K;  1GDT A;  1NKN A;  3SWY A;  1LGH B;  2FXM A;  1VPC A;  1IJD B;  5AW4 B;  2NPS C;  3RL0 C;  3II6 A;  3LIE A;  5AW2 B;  5KJ7 A;  3M06 A;  1E5W A;  2Z4E A;  4C7R A;  2C9N Y;  3N4X A;  2N1T C;  2P2U A;  3N7N A;  2FFD C;  1KIL B;  1SQX K;  2YMY A;  4W7Y A;  3VTP C;  1LTA C;  3C9I A;  1ZR4 A;  3H6P A;  1J1D C;  1H88 A;  5AW9 B;  1FDM A;  3HTK B;  1G2C A;  2M3B A;  1HGZ A;  5AW8 B;  2YO3 A;  1J1E B;  2JEE A;  1FAV A;  4LGD E;  1T3U A;  2M8R A;  2XU6 A;  2OYH C;  1NOH A;  3VMZ A;  4RES B;  1G1I A;  3BRT B;  1YTZ T;  3HD7 A;  5APU A;  1LTG C;  3P7K A;  1H8A A;  1X9V A;  1GW3 A;  3V2R A;  2BAS A;  3G3Z A;  1FU1 A;  2W6B A;  1RE3 C;  1GW4 A;  1IO4 A;  2POH A;  2IFM A;  5APQ A;  1GU4 A;  3LW5 H;  1GL2 C;  1RF1 B;  1LTT C;  2R5B A;  3OJA B;  1CZQ A;  3PP5 A;  2A45 G;  5AW1 B;  3NTN A;  1AQ5 A;  1JTH B;  1RY3 A;  2O1K A;  3A5T A;  1RF1 A;  1OWA A;  1FBM A;  4Y99 B;  1LTJ A;  3NFQ A;  3A7O A;  3B5N A;  3P8M C;  3KDP B;  3LID A;  1WRG A;  2L5G B;  1JNM A;  1ZLL A;  2N1T A;  4O9B A;  5AVQ B;  3OA7 A;  3TSI A;  1URQ A;  1MFZ A;  1G1J A;  1IFM A;  1JY3 P;  3HUS B;  1SLQ A;  4W80 A;  2Q5U A;  1JTH A;  3RL0 B;  2C9L Y;  3BAT A;  3B8E B;  3WMM 0;  4LC1 A;  1NWQ A;  1FZC C;  4C46 A;  5AVW B;  1LWU A;  1GK4 A;  3VYI A;  4I2L C;  3KQG A;  2XKM A;  3NXS A;  1GK6 A;  2W6A A;  2OYH A;  4EIJ A;  1IK9 A;  1T8Z A;  2CPB A;  1SFC D;  3P8C E;  1FZG A;  4IFD K;  5AVS B;  3GHG A;  3BAS A;  1FOS F;  1LTJ B;  5AW3 B;  1FZF A;  4AUW A;  3EQ2 A;  3M9H A;  1DH3 A;  3L35 A;  3OAK A;  1N7S B;  5CCH C;  1DEB A;  3U59 A;  3HTK A;  5AVU B;  3HRN A;  2C0X A;  5KLV K;  3HD7 D;  5KTB A;  1SVF A;  2YKO A;  1N7S D;  1URQ C;  1RF0 A;  3MGN A;  2GUS A;  4JYC A;  3M0D A;  1JY3 N;  1NAF A;  3GHG C;  3O8Z A;  4DZO A;  3RK3 D;  2JJL A;  1PFI A;  1JO5 A;  2P7J A;  1WT6 A;  1JY2 P;  1VDF A;  2IX7 C;  1N86 A;  3M0A A;  5AW5 B;  1FZB A;  3I5C A;  5AVZ B;  1LTS C;  5CCG C;  3RK2 D;  1NTK K;  2J58 A;  1T2K C;  1NKZ B;  1YTZ I;  5AVT B;  2OAR A;  1LT9 A;  1ZR2 A;  2O01 H;  1L4A D;  1L0N K;  2H8P D;  1LTB C;  3EFG A;  3U1C A;  1CI6 A;  4WY4 A;  3RL0 D;  2J59 M;  2WPS A;  2HOD A;  1X79 B;  4AYC A;  5BU8 B;  2A45 I;  2N1T D;  5CHX A;  1RE3 A;  2WIT A;  3KPE A;  1RE4 A;  3L37 A;  4N78 E;  2Z5H A;  2HPC B;  1M1J C;  2WSC H;  2XV5 A;  1KIL C;  3BVH A;  3H32 A;  4WBA A;  2OYI C;  3B5N C;  2WWW A;  1H89 A;  4LLH A;  2KOG A;  3P8C D;  1AFO A;  1N73 C;  2ZFC A;  2XZR A;  1S9K E;  2HG5 D;  1FOS E;  1JY2 N;  3L36 A;  2GUV A;  1JMM A;  2FYZ A;  1HUC A;  3BRV B;  5APS A;  3V2N A;  1N2D C;  2CPS A;  2E43 A;  4WY4 D;  1FZE A;  4IFM A;  1KZU B;  2N1T B;  2N9B A;  2LKM A;  2R32 A;  1RF1 C;  2WTY A;  1RE4 C;  4GIF A;  1A02 J;  3RK3 B;  4Y99 C;  3MTU E;  1FJK A;  2VRS A;  3VMX A;  1LTI C;  1N7L A;  1SFC B;  1A02 F;  3RK2 B;  4HH2 A;  2R3C A;  1HVV A;  1LT9 C;  3U1A A;  1JUN A;  2E42 A;  1MV8 A;  2NPS D;  1L4A B;  5CCG A;  5APX A;  3V4Q A;  5KJ7 D;  2NPS B;  4B86 A;  3T97 A;  1FZA A;  3IR9 A;  3TK1 A;  5CMZ A;  2YKQ A;  3HD7 B;  4XA4 A;  4ZKU A;  3MIW A;  1LWU B;  1ZV8 A;  5BVZ A;  2H43 A;  1SFC A;  1N7S A;  2HLO A;  1XTG B;  1JY3 O;  1IFI A;  3TNU A;  1HBW A;  1SQQ K;  2HYN A;  1J1E C;  2KYV A;  2KSJ A;  1GL2 A;  1M7L A;  1SQP K;  1IFN A;  2NPS A;  2OYH B;  2FKW B;  5APY A;  2P1J A;  3V4W A;  3M9Q A;  2IPP A;  4N6J A;  3IFM A;  1J1D B;  2HOD B;  1YYC A;  1HWT C;  1GL2 D;  3CI9 A;  1NTM K;  2Q9I A;  1L4A A;  3M91 A;  5APW A;  1LTJ C;  3HE4 A;  2FFD B;  2KB7 P;  2QM7 A;  2KLV A;  3CL3 D;  2KP8 A;  2XDJ A;  4GKG A;  1FZC B;  3H32 B;  1NU1 K;  4AQR D;  2Q3I A;  2R5D A;  3A2A A;  3UIA A;  3L4F A;  1NTZ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...