1HUCA

The refined 2.15 angstroms x-ray crystal structure of human liver cathepsin b: the structural basis for its specificity
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
47
structure length
47
Chain Sequence
b'LPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN B
publication title The refined 2.15 A X-ray crystal structure of human liver cathepsin B: the structural basis for its specificity.
pubmed rcsb
source organism Homo sapiens
molecule tags Thiol protease
total genus 12
structure length 47
sequence length 47
chains with identical sequence C
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1993-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1hucA01
1GU4A 2E43A 3VN0A 4C7NB 1S9KE 4M3LA 1CI6B 3KQGA 3M9HA 5APTA 1NAFA 1MUUA 2R32A 3P7KA 4AYCA 4I2LC 1A02J 3M0AA 1A02F 2P2UA 4GT1A 5CMZA 2YO3A 2Z5IA 3MGNA 3TNUB 3VMYA 2QM8A 3L37A 1FAVA 5AW5B 2E42A 3T97A 3P32A 5AW2B 2R5BA 1S9KD 3NFQA 1T2KC 1CI6A 3P8MC 2WPRA 4AQRD 5AW4B 2Z5HA 3M06A 2YO2A 4EOTA 3OAKA 1GK4A 5AVYB 5APQA 2WTYA 5AVVB 2Q3IA 3A7OA 1X8YA 5APSA 3I5CA 3L35A 1HUCA 5AVTB 1IO4A 2Q5UA 1CSBA 1H8AA 5AVWB 1HJBA 2W6AA 1GU5A 2H7HA 4LC1A 2C9NY 1FOSF 1JNMA 3VMZA 2W27A 5AW7B 3HE4A 5AW8B 1FOSE 5AW0B 2WPSA 1CZQA 3V5BA 2YNYA 4HYTB 4JYCA 3TK1A 3HE5A 1SLQA 1GD2E 2WT7A 4I6MC 2XU6A 5AW6B 3SWFA 3L36A 2JJLA 3TYYA 1H88A 5AVUB 2P67A 5AW3B 3VYIA 2BASA 4RESB 3LIDA 3M0DA 3V4QA 3HE4B 3A3YB 1T2KD 1MV8A 3A2AA 3M91A 2QM7A 4C46A 3HE5B 2XZRA 2WT7B 5AW9B 1G2CB 2IPPA 2ZFCA 5APYA 5APXA 3HTKA 1GTWA 4B86A 3KDPB 1GK6A 5APWA 1H89A 4KHXA 1HWTC 4XE5B 1SP4A 4GKGA 2XV5A 1NWQA 3NXSA 5AVXB 2N9BA 3O8ZA 1OXZA 1KQLA 3NMDA 5AVZB 3V4WA 5APVA 1J2JB 2VRSA 2ZXEB 1DH3A 5AW1B 2R5DA 2R3CA 2WWWA 4C7NA 3M9BA 3IR9A 2P7JA 2Q7CA 5AVSB 1GZLA 5APUA 3UIAA 3A5TA 3VMXA 4DZOA 2KP8A 5AVQB 2WPQA 1HBWA 1YYCA 3TNUA 1OWAA 1JUNA 3LIEA 3B8EB 3NTNA 5AVRB 1MFZA 3MD0A 4JYBA 2C9LY 3VTPC 4AUWA
chains in the Genus database with same CATH superfamily
2E43A 3CMEP 2R32A 3P7KA 5CBOA 2W83C 3MGNA 2OYHC 2QSIA 3MTUE 1PP9J 4UB6H 3L74E 1BCCD 1EC5A 3CCSP 3GHGB 1NTKJ 1VQ7P 4OGQD 3ITKA 3A7OA 3U59A 2YMYA 1JY3P 1H8AA 1Q86Q 4IFDK 1KORA 3CCMP 2KNCA 2BEZF 1KYOH 2NZ2A 3GF3A 1VQLP 1JY3N 2BCCJ 1RHZB 4OVNF 1SLQA 4I6MC 4RJTA 1DEEG 1YJ9P 3EWKA 1JOCA 2G3AA 1JMMA 1LTJC 1JB0J 2N1TD 1M1JA 3AEGC 4H13C 3OW2O 1BGYJ 1URQC 2O01H 4B86A 2YIUC 5GTIH 3R4YA 2K9JA 2D2CD 2B88A 1NJIQ 1J2JB 2ZXEB 1SVFA 3H1LJ 1SQVJ 1GZLA 2KK7A 3H1ID 2HODB 4D6TE 2WPQA 1EDJA 3LIEA 3WUUA 5AVRB 1MFZA 2FY8A 1WMKA 4QMAA 4Y28J 1A02F 5KAIH 4H44C 2K88A 3OA7A 1Q81Q 1S5LH 3E7KA 3D71A 5AW4B 1FZAA 2W8ZA 3VMAA 3W68A 1YJNP 3Q3DA 1KILD 1L0LG 2OYIA 1X8YA 1BCCJ 3V6IA 1VF5D 1PGPA 2Q5UA 1NU1D 3CCUP 3O6QA 1L4AA 1JTHA 2H7HA 2FYZA 1S2EA 2FYUE 1SQXK 2N1TC 2B9BA 2LR2A 1KB9D 2JEEA 2KNCB 1YI2P 1MKMA 2PFXA 3OJAB 4R4LA 4N3YB 1M8OB 2SPZA 2D2CC 5B5EH 1T3JA 5E79H 2LXCB 3TF5A 4H0LD 3L70E 3B5ND 2POHA 4DOJA 3V2NA 1M1JB 2QIWA 1FZCC 2RMZA 4A7PA 3USSA 5KKZB 3JCUE 1EZVI 1HBWA 1YYCA 1OWAA 3AEBC 3E1IA 2BEQD 3VTPC 4JBZA 1KMIZ 2WSCJ 1VQOP 1NTZE 2L5GB 3RK2B 2P2UA 1JMBA 4EI2A 1LT9A 3CCRP 1PZQA 2ZVOB 1VQPP 2R44A 1SQQK 2AXTE 1S9KD 1KFMA 5KLVJ 1SQQG 3IF4A 1EXJA 2LKMA 3FGAD 3L75J 1DD3A 3H1HG 4WB4A 1N7SB 2E75B 3GG2A 1HF9A 2KS1A 1ZP0C 1NU1J 2OYIB 3P8CD 1SQBK 3O6QB 1X79B 1JTHB 3TDKA 4L74A 3L73G 2UWJE 1SQBG 3TYYA 2P67A 2WSSH 1YIJP 3A3YB 1RF1B 2JP3A 2FYUG 1ZLLA 2PGDA 5TISE 4PV1D 1VQ6P 1GL2A 1FU1A 1GK6A 2L91A 1OZHA 2O1JA 2Q1KA 1LTGC 2XV5A 1G2CA 3L71D 1UIIA 1ZOYC 4BXLA 1GMJA 3M9BA 2LXBA 1QVFO 4Z1MH 5CCGA 3EFGA 5L8RJ 1NTKK 2IYOA 3KQGA 1ZR4A 3H1KJ 1NKZB 3VP8A 2QM8A 1HVVA 3IAOA 1SQPE 1OVVA 3ZDMA 5B66H 3CC4P 3OAKA 1JY3O 3QH9A 5APQA 5AVVB 1LT9B 3HD7B 4HB1A 3CXHD 3PTZA 2NPSD 1BE3G 1XTCC 2V7QJ 4U3FG 1FOSF 2FFDA 1BDDA 1AQ5A 5BVZA 2WPSA 1K05A 3HUSC 1L0NG 3AEDC 3CLQA 3F89A 4PV1C 2P1JA 1N86A 2KS1B 3VYIA 1NHLA 3CI9A 3KZIE 3L72E 3BRVB 1RE3A 3PJSK 1SQVK 2IYPA 2XKMA 4ZKPA 2I1JA 2M5AB 4ASVA 1K9MQ 3H1LG 2NRGA 1AFOA 3D6ZA 4ASWA 1PV3A 1HGVA 4D6TD 1N73A 2PAJA 2JR8A 1KQLA 3NMDA 3MP7B 4TLFA 1DH3A 2WSCH 1GL2B 2B89A 2N1TA 3IR9A 3L71J 1P84I 1Q2NA 2WZ7A 1R5SA 3VMXA 3TGUG 2FYNB 2YKOA 2Y0EA 1FS0E 3AE4C 3VP9A 4Y99C 2A06D 4GT1A 1JY2O 1BCCG 2ZYDA 4O9BA 2IZ1A 1EZVG 3AE3C 2AEMA 3P8MC 2QJPC 2P10A 3M06A 1LTJB 5CCHC 2AXCA 4H13B 1SFCD 1URQB 3I5CA 3L35A 3RK3E 1FZCA 4R4MA 4YXDC 1KB9H 1JCCA 5KAFE 1VPCA 1KFNA 2E5YA 1OIPA 2KI7B 1KILA 2XNXA 2FFDB 3L70D 1OVRA 4IL6E 1HTLC 4GOFA 4EIJA 2XZRA 4OGQB 2O3JA 4UB8H 4W7YA 5APWA 1K04A 3CX5E 1YTZI 3H1IG 2AEJA 4LLHA 1RE4A 1LT1A 1BGYD 4D6TJ 1CW5A 3A0HH 5K5GB 1NTZD 1IJDB 5KLVK 1PGQA 4DZOA 4C7RA 3B5NA 3CXHI 2N1TB 1Q82Q 3QWOC 5GTHE 1VQKP 3H1JG 3P32A 4UB6E 1NU1K 3RBXA 1AVYA 2D2CB 1W2EA 2V7QH 1L0LE 2JO1A 2E74C 3CCLP 5APSA 2J58A 1KYOE 2RKLA 1GU5A 4LC1A 4HJGH 1G1IA 1BDCA 2MJZA 4GIFA 5AW0B 3E1RA 4XFJA 1FZCB 1Q7YQ 2I1KA 2KZIA 1NTMD 5AW6B 4NPDA 3RL0C 1IK7A 3CC2P 3LW5J 3A0BE 3Q5PA 5AW3B 2BASA 3M0DA 4H44D 3L70J 2QM7A 5DJUB 1QEXA 2ZVNB 1KILB 1EDLA 4PD4E 5APYA 3WU2E 2CPBA 5GTIE 3CMAP 1KTMA 2WSEH 1J1EC 4LGDE 1VF5B 1S5LX 1FZFA 4N6JA 2QJKB 2OARA 4NPEA 1IFJA 1BSNA 4HKZH 2KOGA 3H6PA 3GMAA 3HUSA 1M57D 2H88C 3CWBG 2KP8A 1LTBC 1NTZJ 3B8EB 3GW6A 3MD0A 4JYBA 3T97B 3M9HA 3V2PA 1J1DC 3AE1C 3K5BA 5CMZA 4H0LB 3B5NB 4ZMDA 1SQQE 1GK4A 3CXHH 1AA0A 5AVYB 1LGHB 2Q3IA 2HLOA 1IK9A 2M0BA 2KZJA 4YPCA 3H1HE 5KLVD 2RH0A 3KXDA 1LTSC 3C9IA 3L75D 1N7SA 3SFDC 1QL2A 3L73E 1SQBE 2JJLA 5B5EE 3LIDA 2YXQB 5E79E 1NTMJ 5KLIC 2NPSA 2W90A 1KQFB 5H2FH 4OH8B 2IPPA 5APXA 3HTKA 1VL2A 5DJTB 1RF1A 1SQXG 1E79H 3BCCD 1M1KQ 1RQUA 4I7ZC 2VRSA 1PPJE 3CCJP 1OW6A 3Q5SA 3CPWO 1TU3F 2I8DA 1JEKA 3TNUA 1JUNA 2C0XA 3MUDA 2QJYB 1PP9E 2C9LY 2J5UA 3RL0g 2CPSA 3HUSB 4ZKUA 3M0AA 1RY3A 1QVGO 1FAVA 4PV1B 1LP1B 3RK3D 4KJMA 1RF0C 2IFMA 3H32A 3H1KD 1HH0A 1JO5A 2WITA 1BE3E 2Y0CA 3GHGC 2W6AA 4U3FE 4GOEA 2Y9YA 3HD7A 2IBZD 2W27A 3CCQP 3G4SP 1NH4A 1L0NE 4N78E 3CL3D 1LWUA 1QL1A 1OMIA 3KYQA 1SFCA 1H88A 2RN0A 3G9RA 2Z4EA 1FC2C 3C8VA 3FWNA 5KJ7C 3JCUH 1AQTA 3H1LE 5CJ4A 1YBKA 5EFWB 2IZ0A 2NPSB 1NWQA 2QJPB 1NO4A 2M5AA 2OYHA 3HTKB 4BRYB 4C7NA 1S72P 2PP6A 2Q7CA 3BCCJ 2V4HA 5APUA 2AXTH 3TGUE 2QRXA 1GW4A 3RK3C 2A06G 3VN0A 1OVUA 5CHXA 1BCCE 1L0LD 4EYYQ 3TNUB 2QEXP 2E76D 1EZVE 5B66E 1PPJG 2HYNA 2KIKA 2WTYA 1LTAC 1PP9G 1NTKG 3L74D 1LTJA 1T8ZA 1M90Q 3H32B 1FBMA 3EQ2A 1URQA 4JQ0D 1KB9I 3BASA 4HYTB 4JYCA 4GDOA 2JDIH 4PD4D 2BCCG 5BU8B 1L2PA 1KD1Q 3A2AA 4DJGA 2B87A 3AE6C 3HRNA 1KV4A 1LWUB 2W6BA 2ZFCA 5CCHD 2FXOA 1SFCB 1NTZK 1U7MA 2QVAA 4WY4D 1YITP 1BGYG 1SP4A 1PIXA 3H1IE 5AVXB 3O8ZA 1L4AD 1OXZA 1USDA 3V4WA 2QE7H 2A45I 2WWWA 3B4SA 1M1JC 2E76C 1SQVG 2OYHB 5KKZC 4C7NB 1HGZA 1CI6B 1IFPA 1YHQP 3B71A 5APTA 2OYOA 3PHLA 2IBZI 3L4FA 2OGUA 4CPGA 3S1KA 1KZUB 4IOIH 1KILE 3H1JE 4IFMA 2E42A 2R5BA 1AV1A 4AQRD 1L0LJ 1ZMEC 2YXRB 4W80A 2C0WA 2YKPA 2MKVA 1N8RQ 1CSBA 1NTMK 1Y8AA 2C9NY 2IDBA 3AE8C 3L73D 1JNMA 3KZIH 3L74J 1OW7A 1NTMG 1PFIA 1FJPA 2OTJP 4DT0A 3PH0A 2KLUA 3SWYA 3HE5A 2FYUD 2E75C 3II6A 2HPCB 4WY4C 2OYIC 3KPEA 1JM0A 1L4AC 2YIUB 4UB8E 1AJYA 1RF0A 1J1DB 2FXMA 1S1CX 2E74D 1IFMA 3U1AA 2K37A 4GKGA 2ZYGA 1X9VA 4WVZA 4BWNA 2B87B 3U1CA 1SQPK 3AEAC 2O1KA 5AVSB 3CWBE 2HFED 5AVQB 4OWFA 3RL0D 3IFMA 1ZRTE 4H44B 2GA1A 1S9KE 2M3EA 1SS1A 1R8EA 1QGKB 2OTKE 1P84E 2YO3A 3VMYA 3L37A 2A45H 3BRTB 3GLMA 4L75A 4XA4A 3T97A 3NFQA 1T2KC 5KAFH 4U3FD 2ZT9D 5KLIB 1Y9BA 1IFIA 3R2PA 3H1HJ 5KLVG 1L0ND 4N78D 1FDIA 3L75G 1FZGA 1LT9C 1ZR2A 3VMZA 1Z56A 5AW8B 3HE4A 1PL5A 3L73J 2YNYA 4I7ZB 1USEA 1NU1G 4MN4C 2WT7A 2XU6A 3SWFA 5AVUB 1YQ3C 2FYUJ 3Q5RA 2OTLP 3HE5B 4PJ0H 3IN6A 2G8YA 1UIXA 1SQXE 3BCCG 1H89A 1FZEA 4ZNCA 3VOPA 3TGUD 2O01N 2N9BA 4HH2A 5GTHH 1U7JA 4JF7A 2GUSA 1EZVD 1KQSO 1GL2C 2ZT9C 4AUWA 1MFTA 1GU4A 1AVOA 2A45G 2FYNC 1IC2A 4L76A 5AW5B 2HR3A 3H1KG 3CXHE 2YO2A 2M8RA 5CCGC 1NKNA 1SQPD 1T3UA 1LP1A 1EDIA 1BE3J 1NGMB 4U3FJ 2IBZG 1HUCA 5KAIE 3ABVC 2YMKA 3A0BH 1IZNB 2FBWC 1S5LE 1LJ2A 1L0NJ 1T6AA 2WMMA 4WWIA 1FOSE 1NOHA 1DEBA 3G3ZA 4PD4H 3WU2H 2KUBA 4K35A 1GD2E 1LTTC 1S3JA 3L36A 2Q9IA 2R3SA 3V4QA 3RK3B 3HE4B 1M7LA 3C1LA 3TSIA 5H2FE 3N4XA 1H0TA 2H8PD 3M91A 4C46A 1NAYA 2FFDC 2WT7B 1FJKA 3AECC 2Q3EA 3KHUA 3H25A 2WQYC 3L72D 1ZW0A 1HWTC 1R5LA 2KSJA 1IFDA 3FXEA 3NXSA 1DD4A 4OGQC 2GM4A 3D6YA 3Q1MA 1VQ8P 5AW1B 3TGUJ 2R3CA 1IFNA 1KN7A 3WUTA 1RE3C 1L0LK 1Y47A 1JY2P 5CCHA 2A06E 3L71G 4BRYA 3NTNA 3H1JD 4WY4A 3PLNA 3M9QA 1RH5B 1JY2N 3I56P 1N73C 1S4XA 1EDKA 5KJ7D 2Z5IA 5M1BA 1VQNP 3RGUA 2YKQA 4EOTA 3GF7A 2WVRA 2Y9ZA 3L74G 2JWDA 1YJWP 3V2QA 3JC22 2H43A 1NTKE 4YTPC 4IFFA 1SQPJ 1IO4A 5C39A 3JSVC 3MHVA 2H89C 2JWAA 1KC8Q 1K73Q 1FE6A 3V5BA 3AE7C 3TK1A 3AEEC 1NYHA 1YTZT 2BCCE 2Y0DA 2E76B 4TT3H 2PRRA 2HG5D 2K9JB 2JKVA 3LW5H 5CBNA 3Q2YA 3H1IJ 1BGYE 4RO0A 1RQVA 1H0TB 3CWBD 1KILC 3L72J 3SSUA 1K8AQ 4KT0J 4U7JA 1ZRTD 3MIWA 4I1LA 5AVZB 5APVA 1VF5C 3CX5D 1FDMA 3BATA 2QJKC 2WSFJ 1W2BO 1P84D 4D6TG 3S9OA 2K1AA 4Y99B 1VQ5P 3BVHA 1SQVE 2ITAA 1QX8A 4M3LA 1X22A 3H1JJ 1A02J 1ZXGA 1RE4C 1D7MA 4WY4B 2WPVB 1CI6A 3AEFC 2GUVA 1L4AB 4H0LC 1WRGA 4W7ZA 1KQGB 3V2RA 3B5NC 3WUVA 1GDTA 1DX7A 2FYUK 1HJBA 2QG4A 3PP5A 1NTME 1N2DC 5AW7B 2XNDH 3I55P 1KYOD 1X0TA 2E5TA 3W67A 2IX7C 1Q90D 4EDFA 1OW8A 1SQXD 1N7LA 3CCVP 1VQMP 3N7NA 2FXPA 1MV8A 2HPCA 2IFNA 3RK2D 5AW9B 1MZ9A 1GTWA 3CC7P 2AEFA 3L70G 3KDPB 5TISH 3AE9C 1EQ7A 5BU5A 3CWBJ 3M0DC 4K3AA 1OX3A 1ZV8A 2P7JA 3G6EP 1N7SD 2E75D 4JPZB 2ZAEB 3AE2C 1NTZG 5CJ0A 1ZN5A 4AYCA 1HJ0A 1JCDA 1NVOA 2QJYC 4GODA 4WBAA 1L0NK 1PGOA 2E74B 4RKUJ 2WPRA 2XDJA 5KLVE 1SQQD 2KB7P 2QA4P 2Q6QA 2P58A 1GW3A 3L75E 3CCEP 3RL0B 3H1HD 1CZQA 1G1JA 3G71P 3RK2C 1FDOA 1NU1E 5TJHA 3MZWB 3AE5C 2KXPB 3CX5I 1XTGB 2KSEA 1J1EB 1W5CE 2WSEJ 1KB9E 1T2KD 1LTIC 2ZT9B 1SQXJ 1SQBD 3FXDA 1G2CB 4DCKA 3SWKA 5KTBA 3BCCE 2OQQA 2N9YB 2W6JH 3EFFK 4KHXA 2WSFH 1N7SC 3PRJA 4YXWH 2O01J 2KLVA 3HD7D 2K9YA 2R5DA 1E5WA 2NPSC 2DW3A 2J59M 2FKWB 4IL6X 3A5TA 3FWLA 2K3RA 1PPJD 2ZXXA 1RF1C 1WT6A 3GHGA 1MUUA 1NAFA 4I2LC 1PGJA 1M56D 3A0HE 1PP9D 2ZJSE 1SQPG 3H1KE 5AW2B 1NTKD 3RBZA 1YQ4C 2CK3H 1KYOI 2M3BA 2Z5HA 1VQ4P 3MUDC 2IBZE 3S4RA 5AVTB 5AVWB 3D70A 5KJ7A 2BCCD 1SQQJ 1LNQA 2KYVA 3CD6P 1GL2D 1BE3D 4PD4I 4RESB 4IL6H 3L72G 4NPFX 4PJ0E 3P8CE 1U57A 3HD7C 1DIPA 1N73B 5CCGD 3FX0A 1SQBJ 4XE5B 1BSHA 2HODA 2ZYAA 1EXIA 1LWUC 3CX5H 3SFEC 3H1LD 1SFCC 1SQVD 4H13D 1URQD 1P84H 1FZBA 1OFCX 3WMM0 3UIAA 4L73A 1QLED 3L71E 1VDFA 3F5HA 1VQ9P
chains in the Genus database with same CATH topology
2E43A 3VN0A 3VP9A 1JY2N 1N73C 2R32A 3P7KA 4Y99C 5KJ7D 4GT1A 1JY2O 5CHXA 2Z5IA 3MGNA 3TNUB 4O9BA 2OYHC 2HYNA 3P8MC 3MTUE 3M06A 2YKQA 4EOTA 1LTJB 3GHGB 5CCHC 2WTYA 1LTAC 3V2QA 3A7OA 3U59A 1SFCD 1URQB 2H43A 3I5CA 3L35A 1FZCA 4IFFA 2YMYA 1IO4A 1JY3P 1LTJA 1H8AA 4IFDK 1T8ZA 3H32B 1FBMA 3EQ2A 1JCCA 1URQA 1JY3N 1VPCA 3BASA 1KFNA 3V5BA 4HYTB 4JYCA 3TK1A 1SLQA 4I6MC 1KILA 1YTZT 2XNXA 2FFDB 1JOCA 5BU8B 2HG5D 1JMMA 1LTJC 1HTLC 2N1TD 3A2AA 1M1JA 4EIJA 3HRNA 2XZRA 3LW5H 1LWUB 2W6BA 1URQC 2O01H 2ZFCA 5CCHD 4W7YA 1SFCB 4B86A 1NTZK 4WY4D 5APWA 1SP4A 1YTZI 1KILC 5AVXB 3O8ZA 1L4AD 1OXZA 4LLHA 3MIWA 4I1LA 5AVZB 3V4WA 5APVA 1RE4A 1J2JB 2ZXEB 1CW5A 1FDMA 2A45I 3BATA 1SVFA 2WWWA 1GZLA 1M1JC 2HODB 1IJDB 5KLVK 4DZOA 2WPQA 4Y99B 3BVHA 3LIEA 4C7RA 5AVRB 1MFZA 3B5NA 2OYHB 4C7NB 1HGZA 2N1TB 4M3LA 1CI6B 5APTA 1A02J 1A02F 3L4FA 1RE4C 1KZUB 2E42A 3OA7A 4IFMA 3P32A 4WY4B 2R5BA 1CI6A 1NU1K 4AQRD 5AW4B 1FZAA 2GUVA 1W2EA 1L4AB 1WRGA 4W80A 1KILD 4W7ZA 3V2RA 2OYIA 3B5NC 1X8YA 2C0WA 5APSA 1GDTA 2YKPA 2J58A 1DX7A 2Q5UA 2FYUK 1CSBA 1L4AA 1NTMK 1JTHA 1HJBA 1GU5A 2H7HA 4LC1A 2FYZA 2C9NY 1G1IA 1JNMA 3PP5A 1SQXK 2MJZA 4GIFA 1N2DC 1PFIA 5AW7B 2N1TC 5AW0B 1FJPA 2JEEA 1FZCB 3SWYA 2I1KA 2IX7C 3HE5A 3OJAB 5AW6B 3II6A 3RL0C 2HPCB 4WY4C 2OYIC 3KPEA 4N3YB 5AW3B 2BASA 3M0DA 1N7LA 1L4AC 1T3JA 3N7NA 1MV8A 2HPCA 2QM7A 2IFNA 3RK2D 1RF0A 5AW9B 1KILB 1J1DB 1MZ9A 5APYA 2FXMA 2CPBA 1GTWA 2WSEH 1J1EC 3B5ND 2POHA 3KDPB 4LGDE 1IFMA 1FZFA 4DOJA 4N6JA 3U1AA 4GKGA 1X9VA 3V2NA 1M1JB 1EQ7A 3U1CA 1SQPK 5BU5A 2OARA 1FZCC 1IFJA 3M0DC 2O1KA 1ZV8A 2KOGA 2P7JA 5AVSB 3H6PA 3HUSA 2HFED 2KP8A 5AVQB 1HBWA 1LTBC 1YYCA 1OWAA 1N7SD 3E1IA 3B8EB 3RL0D 3MD0A 3IFMA 4JYBA 3VTPC 1S9KE 3M9HA 3V2PA 1J1DC 2L5GB 5CJ0A 1ZN5A 3RK2B 4AYCA 2P2UA 5CMZA 1JCDA 2YO3A 3VMYA 1LT9A 3L37A 2A45H 3BRTB 4WBAA 4XA4A 1L0NK 3B5NB 3T97A 1SQQK 1S9KD 3NFQA 1T2KC 1KFMA 2WPRA 2XDJA 1GK4A 1IFIA 3R2PA 5AVYB 1LGHB 2Q3IA 2LKMA 2HLOA 4N78D 2KB7P 1IK9A 4WB4A 1GW3A 1FZGA 1N7SB 1LT9C 1ZR2A 3VMZA 1Z56A 3RL0B 1LTSC 2OYIB 5AW8B 3HE4A 3C9IA 1CZQA 1G1JA 3RK2C 2YNYA 3P8CD 1SQBK 1N7SA 1X79B 1JTHB 2WT7A 2XU6A 3SWFA 1QL2A 2JJLA 3TYYA 5AVUB 2P67A 3LIDA 1XTGB 3A3YB 1J1EB 1T2KD 2NPSA 1RF1B 1LTIC 3HE5B 1ZLLA 1G2CB 4OH8B 2IPPA 5APXA 3HTKA 5KTBA 1GL2A 1FU1A 1GK6A 1RF1A 1FZEA 1H89A 2O1JA 4KHXA 1LTGC 2WSFH 1N7SC 2XV5A 3VOPA 1G2CA 2N9BA 2KLVA 3HD7D 2VRSA 2R5DA 1E5WA 3M9BA 4HH2A 2NPSC 2J59M 2FKWB 3A5TA 4JF7A 3TNUA 5CCGA 3EFGA 1JUNA 2GUSA 2C0XA 3MUDA 1NTKK 1GL2C 2C9LY 1RF1C 4AUWA 1GU4A 3KQGA 1WT6A 2CPSA 3HUSB 3GHGA 1MUUA 1NAFA 2A45G 4ZKUA 1ZR4A 4I2LC 1NKZB 3M0AA 1IC2A 1RY3A 3VP8A 2QM8A 1FAVA 1HVVA 5AW5B 5AW2B 3RK3D 2M3BA 2Z5HA 2YO2A 1RF0C 2IFMA 3H32A 3OAKA 1JY3O 2M8RA 5CCGC 5APQA 1NKNA 5AVVB 1LT9B 1T3UA 1HH0A 3HD7B 1JO5A 1HUCA 2WITA 5AVTB 5AVWB 3GHGC 2NPSD 1XTCC 2W6AA 5KJ7A 1FOSF 2FFDA 3HD7A 1AQ5A 2KYVA 2W27A 5BVZA 1FOSE 2WPSA 1NOHA 1NH4A 1DEBA 1GL2D 3HUSC 3G3ZA 4N78E 3CL3D 3CLQA 1GD2E 1LWUA 1QL1A 2P1JA 1LTTC 3KYQA 1N86A 3L36A 1SFCA 1H88A 2Q9IA 3VYIA 4RESB 3V4QA 3RK3B 3HE4B 2Z4EA 1NHLA 1M7LA 3TSIA 3CI9A 3N4XA 2H8PD 3BRVB 3M91A 3P8CE 5KJ7C 4C46A 1RE3A 1SQVK 2FFDC 2WT7B 1FJKA 3HD7C 2XKMA 4ZKPA 2I1JA 1N73B 5CCGD 5CJ4A 1AFOA 1HWTC 4XE5B 2HODA 2NPSB 1HGVA 1NWQA 2KSJA 1IFDA 3NXSA 1N73A 1LWUC 2GM4A 1NO4A 2PAJA 1SFCC 1KQLA 3NMDA 2OYHA 3HTKB 1DH3A 5AW1B 1URQD 2R3CA 2WSCH 1GL2B 1IFNA 4C7NA 2N1TA 2PP6A 3IR9A 1FZBA 2Q7CA 3WMM0 2WZ7A 5APUA 3UIAA 1RE3C 1L0LK 3VMXA 1JY2P 5CCHA 1GW4A 3RK3C 2YKOA 1VDFA 3NTNA 4WY4A 3M9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GU4 A;  2E43 A;  3VN0 A;  4C7N B;  1S9K E;  4M3L A;  1CI6 B;  3KQG A;  3M9H A;  5APT A;  1NAF A;  1MUU A;  2R32 A;  3P7K A;  4AYC A;  4I2L C;  1A02 J;  3M0A A;  1A02 F;  2P2U A;  4GT1 A;  5CMZ A;  2YO3 A;  2Z5I A;  3MGN A;  3TNU B;  3VMY A;  2QM8 A;  3L37 A;  1FAV A;  5AW5 B;  2E42 A;  3T97 A;  3P32 A;  5AW2 B;  2R5B A;  1S9K D;  3NFQ A;  1T2K C;  1CI6 A;  3P8M C;  2WPR A;  4AQR D;  5AW4 B;  2Z5H A;  3M06 A;  2YO2 A;  4EOT A;  3OAK A;  1GK4 A;  5AVY B;  5APQ A;  2WTY A;  5AVV B;  2Q3I A;  3A7O A;  1X8Y A;  5APS A;  3I5C A;  3L35 A;  1HUC A;  5AVT B;  1IO4 A;  2Q5U A;  1CSB A;  1H8A A;  5AVW B;  1HJB A;  2W6A A;  1GU5 A;  2H7H A;  4LC1 A;  2C9N Y;  1FOS F;  1JNM A;  3VMZ A;  2W27 A;  5AW7 B;  3HE4 A;  5AW8 B;  1FOS E;  5AW0 B;  2WPS A;  1CZQ A;  3V5B A;  2YNY A;  4HYT B;  4JYC A;  3TK1 A;  3HE5 A;  1SLQ A;  1GD2 E;  2WT7 A;  4I6M C;  2XU6 A;  5AW6 B;  3SWF A;  3L36 A;  2JJL A;  3TYY A;  1H88 A;  5AVU B;  2P67 A;  5AW3 B;  3VYI A;  2BAS A;  4RES B;  3LID A;  3M0D A;  3V4Q A;  3HE4 B;  3A3Y B;  1T2K D;  1MV8 A;  3A2A A;  3M91 A;  2QM7 A;  4C46 A;  3HE5 B;  2XZR A;  2WT7 B;  5AW9 B;  1G2C B;  2IPP A;  2ZFC A;  5APY A;  5APX A;  3HTK A;  1GTW A;  4B86 A;  3KDP B;  1GK6 A;  5APW A;  1H89 A;  4KHX A;  1HWT C;  4XE5 B;  1SP4 A;  4GKG A;  2XV5 A;  1NWQ A;  3NXS A;  5AVX B;  2N9B A;  3O8Z A;  1OXZ A;  1KQL A;  3NMD A;  5AVZ B;  3V4W A;  5APV A;  1J2J B;  2VRS A;  2ZXE B;  1DH3 A;  5AW1 B;  2R5D A;  2R3C A;  2WWW A;  4C7N A;  3M9B A;  3IR9 A;  2P7J A;  2Q7C A;  5AVS B;  1GZL A;  5APU A;  3UIA A;  3A5T A;  3VMX A;  4DZO A;  2KP8 A;  5AVQ B;  2WPQ A;  1HBW A;  1YYC A;  3TNU A;  1OWA A;  1JUN A;  3LIE A;  3B8E B;  3NTN A;  5AVR B;  1MFZ A;  3MD0 A;  4JYB A;  2C9L Y;  3VTP C;  4AUW A; 
#chains in the Genus database with same CATH topology
 2E43 A;  3CME P;  2R32 A;  3P7K A;  5CBO A;  2W83 C;  3MGN A;  2OYH C;  2QSI A;  3MTU E;  1PP9 J;  4UB6 H;  3L74 E;  1BCC D;  1EC5 A;  3CCS P;  3GHG B;  1NTK J;  1VQ7 P;  4OGQ D;  3ITK A;  3A7O A;  3U59 A;  2YMY A;  1JY3 P;  1H8A A;  1Q86 Q;  4IFD K;  1KOR A;  3CCM P;  2KNC A;  2BEZ F;  1KYO H;  2NZ2 A;  3GF3 A;  1VQL P;  1JY3 N;  2BCC J;  1RHZ B;  4OVN F;  1SLQ A;  4I6M C;  4RJT A;  1DEE G;  1YJ9 P;  3EWK A;  1JOC A;  2G3A A;  1JMM A;  1LTJ C;  1JB0 J;  2N1T D;  1M1J A;  3AEG C;  4H13 C;  3OW2 O;  1BGY J;  1URQ C;  2O01 H;  4B86 A;  2YIU C;  5GTI H;  3R4Y A;  2K9J A;  2D2C D;  2B88 A;  1NJI Q;  1J2J B;  2ZXE B;  1SVF A;  3H1L J;  1SQV J;  1GZL A;  2KK7 A;  3H1I D;  2HOD B;  4D6T E;  2WPQ A;  1EDJ A;  3LIE A;  3WUU A;  5AVR B;  1MFZ A;  2FY8 A;  1WMK A;  4QMA A;  4Y28 J;  1A02 F;  5KAI H;  4H44 C;  2K88 A;  3OA7 A;  1Q81 Q;  1S5L H;  3E7K A;  3D71 A;  5AW4 B;  1FZA A;  2W8Z A;  3VMA A;  3W68 A;  1YJN P;  3Q3D A;  1KIL D;  1L0L G;  2OYI A;  1X8Y A;  1BCC J;  3V6I A;  1VF5 D;  1PGP A;  2Q5U A;  1NU1 D;  3CCU P;  3O6Q A;  1L4A A;  1JTH A;  2H7H A;  2FYZ A;  1S2E A;  2FYU E;  1SQX K;  2N1T C;  2B9B A;  2LR2 A;  1KB9 D;  2JEE A;  2KNC B;  1YI2 P;  1MKM A;  2PFX A;  3OJA B;  4R4L A;  4N3Y B;  1M8O B;  2SPZ A;  2D2C C;  5B5E H;  1T3J A;  5E79 H;  2LXC B;  3TF5 A;  4H0L D;  3L70 E;  3B5N D;  2POH A;  4DOJ A;  3V2N A;  1M1J B;  2QIW A;  1FZC C;  2RMZ A;  4A7P A;  3USS A;  5KKZ B;  3JCU E;  1EZV I;  1HBW A;  1YYC A;  1OWA A;  3AEB C;  3E1I A;  2BEQ D;  3VTP C;  4JBZ A;  1KMI Z;  2WSC J;  1VQO P;  1NTZ E;  2L5G B;  3RK2 B;  2P2U A;  1JMB A;  4EI2 A;  1LT9 A;  3CCR P;  1PZQ A;  2ZVO B;  1VQP P;  2R44 A;  1SQQ K;  2AXT E;  1S9K D;  1KFM A;  5KLV J;  1SQQ G;  3IF4 A;  1EXJ A;  2LKM A;  3FGA D;  3L75 J;  1DD3 A;  3H1H G;  4WB4 A;  1N7S B;  2E75 B;  3GG2 A;  1HF9 A;  2KS1 A;  1ZP0 C;  1NU1 J;  2OYI B;  3P8C D;  1SQB K;  3O6Q B;  1X79 B;  1JTH B;  3TDK A;  4L74 A;  3L73 G;  2UWJ E;  1SQB G;  3TYY A;  2P67 A;  2WSS H;  1YIJ P;  3A3Y B;  1RF1 B;  2JP3 A;  2FYU G;  1ZLL A;  2PGD A;  5TIS E;  4PV1 D;  1VQ6 P;  1GL2 A;  1FU1 A;  1GK6 A;  2L91 A;  1OZH A;  2O1J A;  2Q1K A;  1LTG C;  2XV5 A;  1G2C A;  3L71 D;  1UII A;  1ZOY C;  4BXL A;  1GMJ A;  3M9B A;  2LXB A;  1QVF O;  4Z1M H;  5CCG A;  3EFG A;  5L8R J;  1NTK K;  2IYO A;  3KQG A;  1ZR4 A;  3H1K J;  1NKZ B;  3VP8 A;  2QM8 A;  1HVV A;  3IAO A;  1SQP E;  1OVV A;  3ZDM A;  5B66 H;  3CC4 P;  3OAK A;  1JY3 O;  3QH9 A;  5APQ A;  5AVV B;  1LT9 B;  3HD7 B;  4HB1 A;  3CXH D;  3PTZ A;  2NPS D;  1BE3 G;  1XTC C;  2V7Q J;  4U3F G;  1FOS F;  2FFD A;  1BDD A;  1AQ5 A;  5BVZ A;  2WPS A;  1K05 A;  3HUS C;  1L0N G;  3AED C;  3CLQ A;  3F89 A;  4PV1 C;  2P1J A;  1N86 A;  2KS1 B;  3VYI A;  1NHL A;  3CI9 A;  3KZI E;  3L72 E;  3BRV B;  1RE3 A;  3PJS K;  1SQV K;  2IYP A;  2XKM A;  4ZKP A;  2I1J A;  2M5A B;  4ASV A;  1K9M Q;  3H1L G;  2NRG A;  1AFO A;  3D6Z A;  4ASW A;  1PV3 A;  1HGV A;  4D6T D;  1N73 A;  2PAJ A;  2JR8 A;  1KQL A;  3NMD A;  3MP7 B;  4TLF A;  1DH3 A;  2WSC H;  1GL2 B;  2B89 A;  2N1T A;  3IR9 A;  3L71 J;  1P84 I;  1Q2N A;  2WZ7 A;  1R5S A;  3VMX A;  3TGU G;  2FYN B;  2YKO A;  2Y0E A;  1FS0 E;  3AE4 C;  3VP9 A;  4Y99 C;  2A06 D;  4GT1 A;  1JY2 O;  1BCC G;  2ZYD A;  4O9B A;  2IZ1 A;  1EZV G;  3AE3 C;  2AEM A;  3P8M C;  2QJP C;  2P10 A;  3M06 A;  1LTJ B;  5CCH C;  2AXC A;  4H13 B;  1SFC D;  1URQ B;  3I5C A;  3L35 A;  3RK3 E;  1FZC A;  4R4M A;  4YXD C;  1KB9 H;  1JCC A;  5KAF E;  1VPC A;  1KFN A;  2E5Y A;  1OIP A;  2KI7 B;  1KIL A;  2XNX A;  2FFD B;  3L70 D;  1OVR A;  4IL6 E;  1HTL C;  4GOF A;  4EIJ A;  2XZR A;  4OGQ B;  2O3J A;  4UB8 H;  4W7Y A;  5APW A;  1K04 A;  3CX5 E;  1YTZ I;  3H1I G;  2AEJ A;  4LLH A;  1RE4 A;  1LT1 A;  1BGY D;  4D6T J;  1CW5 A;  3A0H H;  5K5G B;  1NTZ D;  1IJD B;  5KLV K;  1PGQ A;  4DZO A;  4C7R A;  3B5N A;  3CXH I;  2N1T B;  1Q82 Q;  3QWO C;  5GTH E;  1VQK P;  3H1J G;  3P32 A;  4UB6 E;  1NU1 K;  3RBX A;  1AVY A;  2D2C B;  1W2E A;  2V7Q H;  1L0L E;  2JO1 A;  2E74 C;  3CCL P;  5APS A;  2J58 A;  1KYO E;  2RKL A;  1GU5 A;  4LC1 A;  4HJG H;  1G1I A;  1BDC A;  2MJZ A;  4GIF A;  5AW0 B;  3E1R A;  4XFJ A;  1FZC B;  1Q7Y Q;  2I1K A;  2KZI A;  1NTM D;  5AW6 B;  4NPD A;  3RL0 C;  1IK7 A;  3CC2 P;  3LW5 J;  3A0B E;  3Q5P A;  5AW3 B;  2BAS A;  3M0D A;  4H44 D;  3L70 J;  2QM7 A;  5DJU B;  1QEX A;  2ZVN B;  1KIL B;  1EDL A;  4PD4 E;  5APY A;  3WU2 E;  2CPB A;  5GTI E;  3CMA P;  1KTM A;  2WSE H;  1J1E C;  4LGD E;  1VF5 B;  1S5L X;  1FZF A;  4N6J A;  2QJK B;  2OAR A;  4NPE A;  1IFJ A;  1BSN A;  4HKZ H;  2KOG A;  3H6P A;  3GMA A;  3HUS A;  1M57 D;  2H88 C;  3CWB G;  2KP8 A;  1LTB C;  1NTZ J;  3B8E B;  3GW6 A;  3MD0 A;  4JYB A;  3T97 B;  3M9H A;  3V2P A;  1J1D C;  3AE1 C;  3K5B A;  5CMZ A;  4H0L B;  3B5N B;  4ZMD A;  1SQQ E;  1GK4 A;  3CXH H;  1AA0 A;  5AVY B;  1LGH B;  2Q3I A;  2HLO A;  1IK9 A;  2M0B A;  2KZJ A;  4YPC A;  3H1H E;  5KLV D;  2RH0 A;  3KXD A;  1LTS C;  3C9I A;  3L75 D;  1N7S A;  3SFD C;  1QL2 A;  3L73 E;  1SQB E;  2JJL A;  5B5E E;  3LID A;  2YXQ B;  5E79 E;  1NTM J;  5KLI C;  2NPS A;  2W90 A;  1KQF B;  5H2F H;  4OH8 B;  2IPP A;  5APX A;  3HTK A;  1VL2 A;  5DJT B;  1RF1 A;  1SQX G;  1E79 H;  3BCC D;  1M1K Q;  1RQU A;  4I7Z C;  2VRS A;  1PPJ E;  3CCJ P;  1OW6 A;  3Q5S A;  3CPW O;  1TU3 F;  2I8D A;  1JEK A;  3TNU A;  1JUN A;  2C0X A;  3MUD A;  2QJY B;  1PP9 E;  2C9L Y;  2J5U A;  3RL0 g;  2CPS A;  3HUS B;  4ZKU A;  3M0A A;  1RY3 A;  1QVG O;  1FAV A;  4PV1 B;  1LP1 B;  3RK3 D;  4KJM A;  1RF0 C;  2IFM A;  3H32 A;  3H1K D;  1HH0 A;  1JO5 A;  2WIT A;  1BE3 E;  2Y0C A;  3GHG C;  2W6A A;  4U3F E;  4GOE A;  2Y9Y A;  3HD7 A;  2IBZ D;  2W27 A;  3CCQ P;  3G4S P;  1NH4 A;  1L0N E;  4N78 E;  3CL3 D;  1LWU A;  1QL1 A;  1OMI A;  3KYQ A;  1SFC A;  1H88 A;  2RN0 A;  3G9R A;  2Z4E A;  1FC2 C;  3C8V A;  3FWN A;  5KJ7 C;  3JCU H;  1AQT A;  3H1L E;  5CJ4 A;  1YBK A;  5EFW B;  2IZ0 A;  2NPS B;  1NWQ A;  2QJP B;  1NO4 A;  2M5A A;  2OYH A;  3HTK B;  4BRY B;  4C7N A;  1S72 P;  2PP6 A;  2Q7C A;  3BCC J;  2V4H A;  5APU A;  2AXT H;  3TGU E;  2QRX A;  1GW4 A;  3RK3 C;  2A06 G;  3VN0 A;  1OVU A;  5CHX A;  1BCC E;  1L0L D;  4EYY Q;  3TNU B;  2QEX P;  2E76 D;  1EZV E;  5B66 E;  1PPJ G;  2HYN A;  2KIK A;  2WTY A;  1LTA C;  1PP9 G;  1NTK G;  3L74 D;  1LTJ A;  1T8Z A;  1M90 Q;  3H32 B;  1FBM A;  3EQ2 A;  1URQ A;  4JQ0 D;  1KB9 I;  3BAS A;  4HYT B;  4JYC A;  4GDO A;  2JDI H;  4PD4 D;  2BCC G;  5BU8 B;  1L2P A;  1KD1 Q;  3A2A A;  4DJG A;  2B87 A;  3AE6 C;  3HRN A;  1KV4 A;  1LWU B;  2W6B A;  2ZFC A;  5CCH D;  2FXO A;  1SFC B;  1NTZ K;  1U7M A;  2QVA A;  4WY4 D;  1YIT P;  1BGY G;  1SP4 A;  1PIX A;  3H1I E;  5AVX B;  3O8Z A;  1L4A D;  1OXZ A;  1USD A;  3V4W A;  2QE7 H;  2A45 I;  2WWW A;  3B4S A;  1M1J C;  2E76 C;  1SQV G;  2OYH B;  5KKZ C;  4C7N B;  1HGZ A;  1CI6 B;  1IFP A;  1YHQ P;  3B71 A;  5APT A;  2OYO A;  3PHL A;  2IBZ I;  3L4F A;  2OGU A;  4CPG A;  3S1K A;  1KZU B;  4IOI H;  1KIL E;  3H1J E;  4IFM A;  2E42 A;  2R5B A;  1AV1 A;  4AQR D;  1L0L J;  1ZME C;  2YXR B;  4W80 A;  2C0W A;  2YKP A;  2MKV A;  1N8R Q;  1CSB A;  1NTM K;  1Y8A A;  2C9N Y;  2IDB A;  3AE8 C;  3L73 D;  1JNM A;  3KZI H;  3L74 J;  1OW7 A;  1NTM G;  1PFI A;  1FJP A;  2OTJ P;  4DT0 A;  3PH0 A;  2KLU A;  3SWY A;  3HE5 A;  2FYU D;  2E75 C;  3II6 A;  2HPC B;  4WY4 C;  2OYI C;  3KPE A;  1JM0 A;  1L4A C;  2YIU B;  4UB8 E;  1AJY A;  1RF0 A;  1J1D B;  2FXM A;  1S1C X;  2E74 D;  1IFM A;  3U1A A;  2K37 A;  4GKG A;  2ZYG A;  1X9V A;  4WVZ A;  4BWN A;  2B87 B;  3U1C A;  1SQP K;  3AEA C;  2O1K A;  5AVS B;  3CWB E;  2HFE D;  5AVQ B;  4OWF A;  3RL0 D;  3IFM A;  1ZRT E;  4H44 B;  2GA1 A;  1S9K E;  2M3E A;  1SS1 A;  1R8E A;  1QGK B;  2OTK E;  1P84 E;  2YO3 A;  3VMY A;  3L37 A;  2A45 H;  3BRT B;  3GLM A;  4L75 A;  4XA4 A;  3T97 A;  3NFQ A;  1T2K C;  5KAF H;  4U3F D;  2ZT9 D;  5KLI B;  1Y9B A;  1IFI A;  3R2P A;  3H1H J;  5KLV G;  1L0N D;  4N78 D;  1FDI A;  3L75 G;  1FZG A;  1LT9 C;  1ZR2 A;  3VMZ A;  1Z56 A;  5AW8 B;  3HE4 A;  1PL5 A;  3L73 J;  2YNY A;  4I7Z B;  1USE A;  1NU1 G;  4MN4 C;  2WT7 A;  2XU6 A;  3SWF A;  5AVU B;  1YQ3 C;  2FYU J;  3Q5R A;  2OTL P;  3HE5 B;  4PJ0 H;  3IN6 A;  2G8Y A;  1UIX A;  1SQX E;  3BCC G;  1H89 A;  1FZE A;  4ZNC A;  3VOP A;  3TGU D;  2O01 N;  2N9B A;  4HH2 A;  5GTH H;  1U7J A;  4JF7 A;  2GUS A;  1EZV D;  1KQS O;  1GL2 C;  2ZT9 C;  4AUW A;  1MFT A;  1GU4 A;  1AVO A;  2A45 G;  2FYN C;  1IC2 A;  4L76 A;  5AW5 B;  2HR3 A;  3H1K G;  3CXH E;  2YO2 A;  2M8R A;  5CCG C;  1NKN A;  1SQP D;  1T3U A;  1LP1 A;  1EDI A;  1BE3 J;  1NGM B;  4U3F J;  2IBZ G;  1HUC A;  5KAI E;  3ABV C;  2YMK A;  3A0B H;  1IZN B;  2FBW C;  1S5L E;  1LJ2 A;  1L0N J;  1T6A A;  2WMM A;  4WWI A;  1FOS E;  1NOH A;  1DEB A;  3G3Z A;  4PD4 H;  3WU2 H;  2KUB A;  4K35 A;  1GD2 E;  1LTT C;  1S3J A;  3L36 A;  2Q9I A;  2R3S A;  3V4Q A;  3RK3 B;  3HE4 B;  1M7L A;  3C1L A;  3TSI A;  5H2F E;  3N4X A;  1H0T A;  2H8P D;  3M91 A;  4C46 A;  1NAY A;  2FFD C;  2WT7 B;  1FJK A;  3AEC C;  2Q3E A;  3KHU A;  3H25 A;  2WQY C;  3L72 D;  1ZW0 A;  1HWT C;  1R5L A;  2KSJ A;  1IFD A;  3FXE A;  3NXS A;  1DD4 A;  4OGQ C;  2GM4 A;  3D6Y A;  3Q1M A;  1VQ8 P;  5AW1 B;  3TGU J;  2R3C A;  1IFN A;  1KN7 A;  3WUT A;  1RE3 C;  1L0L K;  1Y47 A;  1JY2 P;  5CCH A;  2A06 E;  3L71 G;  4BRY A;  3NTN A;  3H1J D;  4WY4 A;  3PLN A;  3M9Q A;  1RH5 B;  1JY2 N;  3I56 P;  1N73 C;  1S4X A;  1EDK A;  5KJ7 D;  2Z5I A;  5M1B A;  1VQN P;  3RGU A;  2YKQ A;  4EOT A;  3GF7 A;  2WVR A;  2Y9Z A;  3L74 G;  2JWD A;  1YJW P;  3V2Q A;  3JC2 2;  2H43 A;  1NTK E;  4YTP C;  4IFF A;  1SQP J;  1IO4 A;  5C39 A;  3JSV C;  3MHV A;  2H89 C;  2JWA A;  1KC8 Q;  1K73 Q;  1FE6 A;  3V5B A;  3AE7 C;  3TK1 A;  3AEE C;  1NYH A;  1YTZ T;  2BCC E;  2Y0D A;  2E76 B;  4TT3 H;  2PRR A;  2HG5 D;  2K9J B;  2JKV A;  3LW5 H;  5CBN A;  3Q2Y A;  3H1I J;  1BGY E;  4RO0 A;  1RQV A;  1H0T B;  3CWB D;  1KIL C;  3L72 J;  3SSU A;  1K8A Q;  4KT0 J;  4U7J A;  1ZRT D;  3MIW A;  4I1L A;  5AVZ B;  5APV A;  1VF5 C;  3CX5 D;  1FDM A;  3BAT A;  2QJK C;  2WSF J;  1W2B O;  1P84 D;  4D6T G;  3S9O A;  2K1A A;  4Y99 B;  1VQ5 P;  3BVH A;  1SQV E;  2ITA A;  1QX8 A;  4M3L A;  1X22 A;  3H1J J;  1A02 J;  1ZXG A;  1RE4 C;  1D7M A;  4WY4 B;  2WPV B;  1CI6 A;  3AEF C;  2GUV A;  1L4A B;  4H0L C;  1WRG A;  4W7Z A;  1KQG B;  3V2R A;  3B5N C;  3WUV A;  1GDT A;  1DX7 A;  2FYU K;  1HJB A;  2QG4 A;  3PP5 A;  1NTM E;  1N2D C;  5AW7 B;  2XND H;  3I55 P;  1KYO D;  1X0T A;  2E5T A;  3W67 A;  2IX7 C;  1Q90 D;  4EDF A;  1OW8 A;  1SQX D;  1N7L A;  3CCV P;  1VQM P;  3N7N A;  2FXP A;  1MV8 A;  2HPC A;  2IFN A;  3RK2 D;  5AW9 B;  1MZ9 A;  1GTW A;  3CC7 P;  2AEF A;  3L70 G;  3KDP B;  5TIS H;  3AE9 C;  1EQ7 A;  5BU5 A;  3CWB J;  3M0D C;  4K3A A;  1OX3 A;  1ZV8 A;  2P7J A;  3G6E P;  1N7S D;  2E75 D;  4JPZ B;  2ZAE B;  3AE2 C;  1NTZ G;  5CJ0 A;  1ZN5 A;  4AYC A;  1HJ0 A;  1JCD A;  1NVO A;  2QJY C;  4GOD A;  4WBA A;  1L0N K;  1PGO A;  2E74 B;  4RKU J;  2WPR A;  2XDJ A;  5KLV E;  1SQQ D;  2KB7 P;  2QA4 P;  2Q6Q A;  2P58 A;  1GW3 A;  3L75 E;  3CCE P;  3RL0 B;  3H1H D;  1CZQ A;  1G1J A;  3G71 P;  3RK2 C;  1FDO A;  1NU1 E;  5TJH A;  3MZW B;  3AE5 C;  2KXP B;  3CX5 I;  1XTG B;  2KSE A;  1J1E B;  1W5C E;  2WSE J;  1KB9 E;  1T2K D;  1LTI C;  2ZT9 B;  1SQX J;  1SQB D;  3FXD A;  1G2C B;  4DCK A;  3SWK A;  5KTB A;  3BCC E;  2OQQ A;  2N9Y B;  2W6J H;  3EFF K;  4KHX A;  2WSF H;  1N7S C;  3PRJ A;  4YXW H;  2O01 J;  2KLV A;  3HD7 D;  2K9Y A;  2R5D A;  1E5W A;  2NPS C;  2DW3 A;  2J59 M;  2FKW B;  4IL6 X;  3A5T A;  3FWL A;  2K3R A;  1PPJ D;  2ZXX A;  1RF1 C;  1WT6 A;  3GHG A;  1MUU A;  1NAF A;  4I2L C;  1PGJ A;  1M56 D;  3A0H E;  1PP9 D;  2ZJS E;  1SQP G;  3H1K E;  5AW2 B;  1NTK D;  3RBZ A;  1YQ4 C;  2CK3 H;  1KYO I;  2M3B A;  2Z5H A;  1VQ4 P;  3MUD C;  2IBZ E;  3S4R A;  5AVT B;  5AVW B;  3D70 A;  5KJ7 A;  2BCC D;  1SQQ J;  1LNQ A;  2KYV A;  3CD6 P;  1GL2 D;  1BE3 D;  4PD4 I;  4RES B;  4IL6 H;  3L72 G;  4NPF X;  4PJ0 E;  3P8C E;  1U57 A;  3HD7 C;  1DIP A;  1N73 B;  5CCG D;  3FX0 A;  1SQB J;  4XE5 B;  1BSH A;  2HOD A;  2ZYA A;  1EXI A;  1LWU C;  3CX5 H;  3SFE C;  3H1L D;  1SFC C;  1SQV D;  4H13 D;  1URQ D;  1P84 H;  1FZB A;  1OFC X;  3WMM 0;  3UIA A;  4L73 A;  1QLE D;  3L71 E;  1VDF A;  3F5H A;  1VQ9 P; 
#chains in the Genus database with same CATH homology
 2E43 A;  3VN0 A;  3VP9 A;  1JY2 N;  1N73 C;  2R32 A;  3P7K A;  4Y99 C;  5KJ7 D;  4GT1 A;  1JY2 O;  5CHX A;  2Z5I A;  3MGN A;  3TNU B;  4O9B A;  2OYH C;  2HYN A;  3P8M C;  3MTU E;  3M06 A;  2YKQ A;  4EOT A;  1LTJ B;  3GHG B;  5CCH C;  2WTY A;  1LTA C;  3V2Q A;  3A7O A;  3U59 A;  1SFC D;  1URQ B;  2H43 A;  3I5C A;  3L35 A;  1FZC A;  4IFF A;  2YMY A;  1IO4 A;  1JY3 P;  1LTJ A;  1H8A A;  4IFD K;  1T8Z A;  3H32 B;  1FBM A;  3EQ2 A;  1JCC A;  1URQ A;  1JY3 N;  1VPC A;  3BAS A;  1KFN A;  3V5B A;  4HYT B;  4JYC A;  3TK1 A;  1SLQ A;  4I6M C;  1KIL A;  1YTZ T;  2XNX A;  2FFD B;  1JOC A;  5BU8 B;  2HG5 D;  1JMM A;  1LTJ C;  1HTL C;  2N1T D;  3A2A A;  1M1J A;  4EIJ A;  3HRN A;  2XZR A;  3LW5 H;  1LWU B;  2W6B A;  1URQ C;  2O01 H;  2ZFC A;  5CCH D;  4W7Y A;  1SFC B;  4B86 A;  1NTZ K;  4WY4 D;  5APW A;  1SP4 A;  1YTZ I;  1KIL C;  5AVX B;  3O8Z A;  1L4A D;  1OXZ A;  4LLH A;  3MIW A;  4I1L A;  5AVZ B;  3V4W A;  5APV A;  1RE4 A;  1J2J B;  2ZXE B;  1CW5 A;  1FDM A;  2A45 I;  3BAT A;  1SVF A;  2WWW A;  1GZL A;  1M1J C;  2HOD B;  1IJD B;  5KLV K;  4DZO A;  2WPQ A;  4Y99 B;  3BVH A;  3LIE A;  4C7R A;  5AVR B;  1MFZ A;  3B5N A;  2OYH B;  4C7N B;  1HGZ A;  2N1T B;  4M3L A;  1CI6 B;  5APT A;  1A02 J;  1A02 F;  3L4F A;  1RE4 C;  1KZU B;  2E42 A;  3OA7 A;  4IFM A;  3P32 A;  4WY4 B;  2R5B A;  1CI6 A;  1NU1 K;  4AQR D;  5AW4 B;  1FZA A;  2GUV A;  1W2E A;  1L4A B;  1WRG A;  4W80 A;  1KIL D;  4W7Z A;  3V2R A;  2OYI A;  3B5N C;  1X8Y A;  2C0W A;  5APS A;  1GDT A;  2YKP A;  2J58 A;  1DX7 A;  2Q5U A;  2FYU K;  1CSB A;  1L4A A;  1NTM K;  1JTH A;  1HJB A;  1GU5 A;  2H7H A;  4LC1 A;  2FYZ A;  2C9N Y;  1G1I A;  1JNM A;  3PP5 A;  1SQX K;  2MJZ A;  4GIF A;  1N2D C;  1PFI A;  5AW7 B;  2N1T C;  5AW0 B;  1FJP A;  2JEE A;  1FZC B;  3SWY A;  2I1K A;  2IX7 C;  3HE5 A;  3OJA B;  5AW6 B;  3II6 A;  3RL0 C;  2HPC B;  4WY4 C;  2OYI C;  3KPE A;  4N3Y B;  5AW3 B;  2BAS A;  3M0D A;  1N7L A;  1L4A C;  1T3J A;  3N7N A;  1MV8 A;  2HPC A;  2QM7 A;  2IFN A;  3RK2 D;  1RF0 A;  5AW9 B;  1KIL B;  1J1D B;  1MZ9 A;  5APY A;  2FXM A;  2CPB A;  1GTW A;  2WSE H;  1J1E C;  3B5N D;  2POH A;  3KDP B;  4LGD E;  1IFM A;  1FZF A;  4DOJ A;  4N6J A;  3U1A A;  4GKG A;  1X9V A;  3V2N A;  1M1J B;  1EQ7 A;  3U1C A;  1SQP K;  5BU5 A;  2OAR A;  1FZC C;  1IFJ A;  3M0D C;  2O1K A;  1ZV8 A;  2KOG A;  2P7J A;  5AVS B;  3H6P A;  3HUS A;  2HFE D;  2KP8 A;  5AVQ B;  1HBW A;  1LTB C;  1YYC A;  1OWA A;  1N7S D;  3E1I A;  3B8E B;  3RL0 D;  3MD0 A;  3IFM A;  4JYB A;  3VTP C;  1S9K E;  3M9H A;  3V2P A;  1J1D C;  2L5G B;  5CJ0 A;  1ZN5 A;  3RK2 B;  4AYC A;  2P2U A;  5CMZ A;  1JCD A;  2YO3 A;  3VMY A;  1LT9 A;  3L37 A;  2A45 H;  3BRT B;  4WBA A;  4XA4 A;  1L0N K;  3B5N B;  3T97 A;  1SQQ K;  1S9K D;  3NFQ A;  1T2K C;  1KFM A;  2WPR A;  2XDJ A;  1GK4 A;  1IFI A;  3R2P A;  5AVY B;  1LGH B;  2Q3I A;  2LKM A;  2HLO A;  4N78 D;  2KB7 P;  1IK9 A;  4WB4 A;  1GW3 A;  1FZG A;  1N7S B;  1LT9 C;  1ZR2 A;  3VMZ A;  1Z56 A;  3RL0 B;  1LTS C;  2OYI B;  5AW8 B;  3HE4 A;  3C9I A;  1CZQ A;  1G1J A;  3RK2 C;  2YNY A;  3P8C D;  1SQB K;  1N7S A;  1X79 B;  1JTH B;  2WT7 A;  2XU6 A;  3SWF A;  1QL2 A;  2JJL A;  3TYY A;  5AVU B;  2P67 A;  3LID A;  1XTG B;  3A3Y B;  1J1E B;  1T2K D;  2NPS A;  1RF1 B;  1LTI C;  3HE5 B;  1ZLL A;  1G2C B;  4OH8 B;  2IPP A;  5APX A;  3HTK A;  5KTB A;  1GL2 A;  1FU1 A;  1GK6 A;  1RF1 A;  1FZE A;  1H89 A;  2O1J A;  4KHX A;  1LTG C;  2WSF H;  1N7S C;  2XV5 A;  3VOP A;  1G2C A;  2N9B A;  2KLV A;  3HD7 D;  2VRS A;  2R5D A;  1E5W A;  3M9B A;  4HH2 A;  2NPS C;  2J59 M;  2FKW B;  3A5T A;  4JF7 A;  3TNU A;  5CCG A;  3EFG A;  1JUN A;  2GUS A;  2C0X A;  3MUD A;  1NTK K;  1GL2 C;  2C9L Y;  1RF1 C;  4AUW A;  1GU4 A;  3KQG A;  1WT6 A;  2CPS A;  3HUS B;  3GHG A;  1MUU A;  1NAF A;  2A45 G;  4ZKU A;  1ZR4 A;  4I2L C;  1NKZ B;  3M0A A;  1IC2 A;  1RY3 A;  3VP8 A;  2QM8 A;  1FAV A;  1HVV A;  5AW5 B;  5AW2 B;  3RK3 D;  2M3B A;  2Z5H A;  2YO2 A;  1RF0 C;  2IFM A;  3H32 A;  3OAK A;  1JY3 O;  2M8R A;  5CCG C;  5APQ A;  1NKN A;  5AVV B;  1LT9 B;  1T3U A;  1HH0 A;  3HD7 B;  1JO5 A;  1HUC A;  2WIT A;  5AVT B;  5AVW B;  3GHG C;  2NPS D;  1XTC C;  2W6A A;  5KJ7 A;  1FOS F;  2FFD A;  3HD7 A;  1AQ5 A;  2KYV A;  2W27 A;  5BVZ A;  1FOS E;  2WPS A;  1NOH A;  1NH4 A;  1DEB A;  1GL2 D;  3HUS C;  3G3Z A;  4N78 E;  3CL3 D;  3CLQ A;  1GD2 E;  1LWU A;  1QL1 A;  2P1J A;  1LTT C;  3KYQ A;  1N86 A;  3L36 A;  1SFC A;  1H88 A;  2Q9I A;  3VYI A;  4RES B;  3V4Q A;  3RK3 B;  3HE4 B;  2Z4E A;  1NHL A;  1M7L A;  3TSI A;  3CI9 A;  3N4X A;  2H8P D;  3BRV B;  3M91 A;  3P8C E;  5KJ7 C;  4C46 A;  1RE3 A;  1SQV K;  2FFD C;  2WT7 B;  1FJK A;  3HD7 C;  2XKM A;  4ZKP A;  2I1J A;  1N73 B;  5CCG D;  5CJ4 A;  1AFO A;  1HWT C;  4XE5 B;  2HOD A;  2NPS B;  1HGV A;  1NWQ A;  2KSJ A;  1IFD A;  3NXS A;  1N73 A;  1LWU C;  2GM4 A;  1NO4 A;  2PAJ A;  1SFC C;  1KQL A;  3NMD A;  2OYH A;  3HTK B;  1DH3 A;  5AW1 B;  1URQ D;  2R3C A;  2WSC H;  1GL2 B;  1IFN A;  4C7N A;  2N1T A;  2PP6 A;  3IR9 A;  1FZB A;  2Q7C A;  3WMM 0;  2WZ7 A;  5APU A;  3UIA A;  1RE3 C;  1L0L K;  3VMX A;  1JY2 P;  5CCH A;  1GW4 A;  3RK3 C;  2YKO A;  1VDF A;  3NTN A;  4WY4 A;  3M9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...