2WSFH

Improved model of plant photosystem i
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
69
structure length
69
Chain Sequence
DLEDIANTTGQWDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSANAPQDVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination and improved model of plant photosystem I.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords AT3G54890
total genus 4
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03244 PSI_PsaH Photosystem I reaction centre subunit VI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wsfH01
3G3ZA 2O01H 1SQQK 2OARA 1NTZK 2LKMA 1L0LK 2WSEH 1NTMK 3LW5H 1SQPK 1NU1K 2WSCH 1SQBK 2WSFH 1NTKK 1SQXK 1L0NK 4IFDK 3M9QA 2J59M 1SQVK 5KLVK 2FYUK 3CLQA
chains in the Genus database with same CATH superfamily
2AEJA 5APQA 1RY3A 4N78D 3AEBC 1EZVG 2N1TC 2RKLA 2OYHC 1JY3O 5BVZA 1BGYG 1OWAA 4GOFA 3BCCJ 1FJKA 1GL2C 3L72G 1SQXJ 2LXCB 1VQ5P 1LTJA 3E1IA 3CPWO 1FZGA 1KB9E 1YTZT 5AW5B 3MUDC 1YJ9P 3L72D 4GT1A 4ASVA 1T2KC 1AQTA 4EYYQ 1KV4A 2KNCA 2QM7A 2HODB 2OYIC 3T97B 1N73C 3PHLA 4PD4I 2WSFJ 1T2KD 1X0TA 2B89A 3GLMA 4UB8H 3TK1A 1NU1D 2NPSB 3HUSA 3L35A 1NGMB 1HJBA 2KI7B 1KORA 1S5LE 4EDFA 2A45H 3G4SP 2H7HA 2KLVA 3EFGA 5AW6B 1OVRA 5APYA 3WU2H 3GHGA 1Q7YQ 1BGYJ 3P32A 5AVQB 4KJMA 5AW7B 4NPEA 5E79H 1KYOE 1RF0C 5AW4B 1JY2N 4Z1MH 3TF5A 2M0BA 1FC2C 1S9KE 1LT9B 1KZUB 4EI2A 3A5TA 1FZCA 1DH3A 1IK9A 2QJYB 1BSNA 1RF1A 2YXQB 3B4SA 1PFIA 1M57D 3B5NA 4LC1A 5KAFE 1QVFO 3O8ZA 1N7SB 2M5AA 3IAOA 3B71A 2WWWA 3PLNA 1OXZA 5AVVB 1IFJA 1KQLA 3CCUP 2H43A 1MFTA 2N1TA 2R5DA 1G2CB 1M1JA 1X79B 2QJYC 3GMAA 3HTKA 3H1ID 1K04A 3H1IE 3JCUH 1YQ4C 4ZMDA 5B5EE 5KLVJ 3CCEP 2XNXA 4L76A 2P1JA 3D70A 3RBXA 4GIFA 4H0LB 4GDOA 4HKZH 3I5CA 5CCGC 1JEKA 4PJ0H 3EFFK 2H89C 5APXA 3L71G 1N7SA 1S2EA 2DW3A 1SQVK 2N9BA 3USSA 2JP3A 2FYNB 3CC7P 1JMBA 3ZDMA 3CXHI 2V7QH 3L73D 3CXHH 3V4WA 2R3CA 4I7ZC 1WRGA 3LW5J 4JQ0D 4KHXA 1OFCX 2CPBA 2B87A 5DJTB 4YXWH 5KTBA 2XKMA 3PTZA 3U1CA 4WVZA 3D6ZA 1RE3C 1PGPA 3WU2E 2WPSA 2QSIA 3SWKA 1PV3A 3RK3D 1LWUC 1ZRTD 1VDFA 2FYUJ 2O1JA 3CL3D 1E79H 5H2FE 3Q5SA 4PD4E 1NTZG 1SQQG 1L4AA 2CPSA 3H1JD 1G1JA 2YKQA 3M9HA 2IYPA 4RO0A 1RQVA 3M9QA 4W80A 2O01J 2Z5IA 2C0XA 2Q6QA 2WT7A 1Y9BA 1NU1J 1GW4A 4GODA 3MIWA 4N6JA 1S5LH 1NOHA 4NPFX 1FOSF 2MJZA 2Q7CA 3P7KA 3I55P 4WY4A 1JCCA 2A06D 2NRGA 3VTPC 3H1IG 2XV5A 1JMMA 1HJ0A 2XNDH 5CCHD 2YKPA 2XZRA 1USDA 2IPPA 3EQ2A 5BU8B 1GD2E 3KPEA 4HYTB 3L4FA 5KAIE 2M8RA 2BEQD 5KLVD 3H1LD 4L74A 2KXPB 5B66E 1NYHA 4NPDA 1URQD 4W7YA 1NTZE 1NTZD 3SWFA 1QL2A 3H32A 3K5BA 1A02J 1L4AB 3H32B 2P67A 4DJGA 1ZLLA 2E76D 3MP7B 5AW3B 4PD4D 1P84E 1PL5A 1CI6B 1LTGC 2XDJA 3AECC 1QL1A 3AE8C 1IK7A 4ZKPA 3E1RA 4Y99C 1A02F 4C7NB 1KYOI 3WMM0 5KAFH 1AVOA 2W83C 4IL6H 3CCMP 3MZWB 3L73G 2QJPC 5APVA 3SWYA 4RJTA 5KJ7A 1JO5A 1U7MA 2OYOA 2ZXXA 3IR9A 1P84I 3MD0A 1YBKA 1AVYA 4GOEA 4DOJA 3RBZA 1IFIA 2HG5D 1KQFB 3FX0A 1FZBA 1S3JA 2KP8A 2J5UA 1VQ4P 1RE4A 4WY4C 1IO4A 2BCCD 4B86A 1N73A 1KQSO 3BATA 1SQPK 2WSSH 4K35A 2W6BA 4C46A 4D6TE 1SQPE 1KYOD 1EZVD 2E76B 2WSCH 1MKMA 1NTKK 4JYBA 3H1LE 2FYUD 2KS1A 4WY4D 5CBOA 4H13D 2AXTE 2H88C 2IZ1A 4N78E 5K5GB 1UIIA 3AE1C 3MHVA 1HH0A 4UB6E 5APUA 1KTMA 1D7MA 2L91A 1USEA 2FYUE 2K9JA 2B87B 2KSEA 3HRNA 3R2PA 5GTHH 1VQPP 1JCDA 1YHQP 2QVAA 2GUSA 3TNUB 3VMXA 1LWUA 2G3AA 1NAYA 1J1EC 1NTKG 1QGKB 3Q5RA 1YTZI 5AVXB 3V6IA 2Y9ZA 1HVVA 3H1IJ 1LT9A 1OIPA 2E5TA 2JWDA 2O1KA 4HB1A 1L4AC 2PRRA 4OH8B 5AW2B 3V2QA 1L0NJ 1VQLP 3OA7A 2IYOA 1N8RQ 3CX5H 3OAKA 3H1HG 4L73A 3CD6P 2YO2A 3BCCE 2KYVA 4OGQD 3L70D 3P8CE 1LT1A 5KKZB 1SQBG 1KFNA 3B5ND 1NU1E 4H0LC 3M0DA 1M1JB 3HTKB 1NKNA 3BRTB 1CZQA 1EQ7A 3F5HA 1VF5C 3L73E 4WB4A 1SQQE 4PV1C 1AV1A 2K3RA 5APSA 3RK3B 3V2PA 4D6TD 1M8OB 4QMAA 2M5AB 4L75A 2BASA 3CX5I 1KILA 1PP9G 3CWBG 3R4YA 2H8PD 4IFFA 1LTJB 3RK2B 1BDCA 2CK3H 2K37A 1L0LJ 4U7JA 1GK4A 3W68A 3RL0B 1X8YA 1N7SC 5L8RJ 1HBWA 3V4QA 1KQGB 2ZT9C 1KC8Q 2D2CD 3A0BE 1S5LX 1ZRTE 3AE2C 1FZCB 2Y0EA 3C8VA 3L75J 1TU3F 2D2CC 1SFCB 2KSJA 2RMZA 2ZT9D 1Q81Q 3D71A 3CCRP 2FFDB 2K9YA 1KILD 3HE4A 3PP5A 4IOIH 4W7ZA 3H1HE 4A7PA 2UWJE 1NO4A 1IZNB 1HUCA 3H1JJ 1MZ9A 3NXSA 1H88A 3B8EB 3JC22 1KMIZ 5APTA 1VQ8P 3FWNA 1SQXD 2KS1B 3AEGC 3GF7A 1FZCC 1SP4A 3CI9A 3D6YA 2A06E 1M1KQ 2Y0CA 3HD7C 1J1DC 1FDOA 3T97A 1R5LA 3M06A 3VMYA 3I56P 1YITP 3IFMA 2JO1A 1SQBK 4H0LD 1FZFA 5KLIB 3B5NC 1N73B 4O9BA 5CCHC 1GU4A 1GDTA 3VOPA 1NTKE 2HFED 1K73Q 3MTUE 5E79E 2OTLP 4KT0J 4U3FE 1PPJD 1DIPA 1PPJE 1T8ZA 2KIKA 2W6AA 3F89A 3KYQA 2QEXP 3WUTA 2LXBA 3L75E 5KLVK 1Z56A 1SQVE 3HD7A 5EFWB 4N3YB 4OVNF 1X9VA 3MUDA 4DZOA 3AEDC 1SQQK 2ZYDA 4RESB 2GUVA 5H2FH 3RL0C 1VQMP 3L74G 5CJ0A 4H13B 4ASWA 3GW6A 4WY4B 1EZVE 4ZNCA 1EDKA 2OYHB 5CJ4A 2FXOA 2Z5HA 1K9MQ 1P84D 3CCLP 3Q5PA 1EDIA 1VF5B 3LW5H 2WT7B 1CI6A 1L0ND 3IN6A 3MGNA 3L71J 4PJ0E 1WMKA 3ITKA 1SS1A 3A0BH 1SLQA 2ZVOB 1AFOA 5AVZB 1L0NE 2IBZG 2VRSA 2W90A 1NKZB 1EZVI 4OGQB 5AW8B 1L0NK 1M7LA 2Q3EA 2IZ0A 1HGZA 2MKVA 3L75G 3CC4P 2KB7P 1SQVG 3CMEP 1VQ6P 1SQPJ 1NTZJ 1GW3A 3SFDC 2XU6A 1RE3A 1DD4A 1NTKJ 2FYUK 3HE4B 1LGHB 3AEAC 2WMMA 1VQOP 3VN0A 1VQKP 1OW7A 1BCCD 1S72P 1ZR4A 1T3UA 2OARA 3CCVP 5DJUB 2OQQA 1RQUA 3TGUE 1SQPD 3M0DC 1DEBA 1PP9E 4U3FD 1FU1A 5AVUB 3TDKA 3VP9A 2B9BA 2E75B 2ITAA 1K05A 1ZR2A 3LIDA 2AEMA 4ZKUA 1M1JC 1PPJG 1BCCJ 1LNQA 2A45I 2E74B 2QA4P 2ZYGA 3H1KD 1JTHB 1Q82Q 1LP1A 1OW8A 1VQ9P 2R5BA 3QWOC 2ZJSE 1CW5A 3LIEA 5TISH 1SQBE 1LT9C 1S1CX 1JUNA 3CXHD 3C9IA 5B66H 1G2CA 1BE3E 3CX5E 1QEXA 2L5GB 3TSIA 1YJNP 4UB6H 3S4RA 4HJGH 2RN0A 3RL0g 3U59A 3V5BA 1H89A 3GG2A 4H44D 1GL2D 2PFXA 1MFZA 1SFCA 1PP9J 2KUBA 2ZXEB 2O01H 3G3ZA 1T3JA 3GHGC 1ZXGA 3TGUG 5TISE 2IBZD 3AE3C 5AVYB 1PGQA 2P2UA 3S1KA 1JY3P 1NHLA 1R5SA 3WUVA 2C9LY 3G6EP 1JY2P 2YIUB 1KILB 1L0LK 2R32A 1KB9H 5AVRB 2ZFCA 1PP9D 1SFCD 3FXDA 1K8AQ 1IJDB 1N7LA 3A0HE 2D2CB 2Q5UA 2AXTH 3VYIA 1RE4C 4C7RA 1SQPG 1W2BO 1R8EA 1H0TA 1NH4A 1QLED 2WSEJ 1YI2P 2SPZA 1JM0A 2Y0DA 1URQB 1LP1B 2HODA 4YTPC 1DEEG 2N1TB 2KZIA 3BASA 1HWTC 1QX8A 1CSBA 2OTKE 2GM4A 5KJ7C 1SVFA 1UIXA 1W5CE 1HTLC 2JR8A 4PV1B 4TT3H 3L70J 5AVTB 3RK3C 5CCGA 1NJIQ 3CC2P 4GKGA 1NAFA 2JWAA 2BEZF 3VMZA 3B5NB 1W2EA 2E75D 2E43A 1SQBJ 4AUWA 1RF1B 2FKWB 2QJKB 3KZIE 2Q9IA 1X22A 1ZP0C 1IFMA 1LWUB 1JNMA 3V2NA 3A7OA 2OGUA 2IX7C 4D6TJ 2WPRA 1GU5A 1VQNP 3JSVC 1U7JA 1PIXA 1BE3D 5GTHE 1MV8A 2E75C 2BCCJ 2I8DA 3BCCG 4C7NA 3BCCD 1RF1C 1L0LG 3II6A 5AW1B 1SQVD 5KAIH 3AE5C 2NPSA 3HUSB 2QIWA 2E5YA 1Q2NA 1NTMG 4LGDE 1XTGB 3L75D 2FBWC 2QRXA 3E7KA 4OWFA 5KJ7D 2FYUG 1J1DB 2JDIH 2QG4A 3N7NA 4XE5B 2OYIA 1JTHA 3HD7D 3L72J 1FBMA 5C39A 3BVHA 4IFDK 1FJPA 1HGVA 4Y99B 1LTIC 1NVOA 1GZLA 3OW2O 1Q90D 1S9KD 1PGJA 2WSCJ 3CWBD 5CCHA 1OZHA 4D6TG 1SFCC 2FFDC 1JY2O 2FYZA 3FWLA 2Q1KA 2OYHA 3RGUA 4BWNA 2KOGA 1LTJC 2N9YB 3FGAD 2O3JA 2M3BA 3CCQP 3HD7B 1OW6A 1T6AA 4H44C 1LTBC 2P7JA 1KILE 2WQYC 2ZYAA 3P8MC 2G8YA 3M9BA 4CPGA 1MUUA 3ABVC 1KB9D 2K1AA 4JBZA 3TYYA 5CMZA 1FDMA 1YYCA 1NU1K 1Y47A 5KKZC 3TGUD 1EDLA 2YNYA 1N86A 1NTKD 4OGQC 1BCCE 5AVWB 1NTMD 2GA1A 2C9NY 1PGOA 2O01N 2IDBA 2K88A 2POHA 2QE7H 1H8AA 4JF7A 1L0LD 5AVSB 4I6MC 3WUUA 1BE3G 2R3SA 1L4AD 1KB9I 1RH5B 2WZ7A 3H1HJ 4I2LC 3OJAB 4IL6X 1J1EB 2I1JA 3CLQA 1EDJA 3L74E 2ZAEB 2IBZI 3L74D 1NTMJ 4TLFA 1LTSC 1DD3A 1SQBD 1LTTC 3V2RA 3KZIH 2HLOA 2I1KA 2N1TD 3JCUE 4IFMA 5B5EH 1Q86Q 1VL2A 1SQVJ 1EC5A 3L71E 5CHXA 4AYCA 1ZOYC 1EXJA 3Q3DA 1VPCA 1FE6A 2Z4EA 3RK2D 3L74J 3M91A 2NPSD 4EOTA 4DCKA 1BE3J 4H13C 5GTIE 3NTNA 1ZV8A 4XFJA 1HF9A 2IBZE 1RF0A 2YIUC 1IC2A 1U57A 2ZVNB 2OYIB 1URQA 1ZN5A 3KDPB 1YIJP 1SQXE 2WSFH 5KLIC 4BRYA 3AE6C 2HPCA 1ZMEC 2QJKC 1BDDA 2WITA 3A2AA 2WVRA 1KFMA 4MN4C 2HYNA 2HR3A 3EWKA 3GF3A 3H1KJ 1L2PA 2JKVA 5AW0B 1GL2B 2W6JH 4H44B 2RH0A 2FFDA 2Q3IA 2JEEA 1J2JB 5CBNA 3Q2YA 2P10A 2B88A 3RL0D 1H0TB 5M1BA 2BCCG 1BSHA 3FXEA 1L0NG 3W67A 1AA0A 3KHUA 1NWQA 4JPZB 5GTIH 1GL2A 4RKUJ 1YJWP 1QVGO 1LTAC 2WSEH 5KLVG 3SSUA 2YO3A 1SQQJ 4I7ZB 2E74D 3TGUJ 1OVUA 1LJ2A 1ZW0A 2E76C 2V4HA 3AEFC 1JB0J 1FZAA 3L37A 1IFPA 3A3YB 3G9RA 3KXDA 2PP6A 3CXHE 1YQ3C 2A06G 3H1KG 4IL6E 1URQC 2JJLA 4Y28J 1PZQA 2QJPB 3VP8A 4JYCA 3AE4C 3H1HD 3C1LA 3PRJA 1N2DC 2FXPA 2W8ZA 1GMJA 3N4XA 3L72E 4U3FG 5APWA 3QH9A 3H1JE 1P84H 3BRVB 1KILC 2WPVB 1BCCG 2AEFA 1FZEA 1EXIA 2IFMA 2OTJP 3TNUA 3HE5B 3AEEC 4LLHA 3SFEC 1N7SD 1KYOH 2K9JB 3L70G 1SQXG 2YXRB 3GHGB 5KLVE 3S9OA 2KK7A 3H1LG 3HE5A 4BRYB 1M90Q 1FOSE 1E5WA 3CMAP 3HUSC 1AJYA 4U3FJ 3IF4A 1IFNA 3L73J 3H25A 4PV1D 2HPCB 1VQ7P 1VF5D 3H1KE 2P58A 3H6PA 3PJSK 4PD4H 3M0AA 1KN7A 2KNCB 4YXDC 3O6QA 1FDIA 1SQXK 1WT6A 3Q1MA 2KZJA 3AE7C 2YMYA 1FS0E 1S4XA 5AW9B 1IFDA 2E74C 3AE9C 3CCSP 1OX3A 2QM8A 2V7QJ 4EIJA 4K3AA 3NFQA 1FAVA 2WPQA 1JY3N 4YPCA 5BU5A 1XTCC 4UB8E 2IFNA 3CX5D 3UIAA 1KD1Q 1GTWA 2AXCA 3H1LJ 2M3EA 3CCJP 1BGYD 3L70E 1AQ5A 2R44A 2E42A 3CWBJ 2KLUA 3PH0A 2FYNC 1NTZK 2PGDA 1RHZB 3L36A 1L0LE 2LKMA 4WBAA 1M56D 3VMAA 1BGYE 2YKOA 2A45G 3P8CD 4I1LA 1NTME 2WTYA 2YMKA 2FXMA 1OVVA 1NTMK 3U1AA 5CCGD 4HH2A 3NMDA 3CWBE 1Y8AA 4R4LA 2LR2A 2FY8A 2Y9YA 1SQQD 2BCCE 3H1JG 3O6QB 4DT0A 1OMIA 5TJHA 2NZ2A 2J58A 2ZT9B 4WWIA 2W27A 4XA4A 4M3LA 3G71P 4BXLA 3A0HH 1GK6A 1DX7A 3L71D 4AQRD 2NPSC 4R4MA 2J59M 2PAJA 3RK2C 3RK3E 3KQGA 1JOCA 2C0WA 1G1IA 1NU1G
chains in the Genus database with same CATH topology
5APQA 1RY3A 4N78D 2N1TC 2OYHC 1JY3O 5BVZA 1OWAA 1FJKA 1GL2C 1LTJA 3E1IA 1FZGA 1YTZT 5AW5B 4GT1A 1T2KC 2QM7A 2HODB 2OYIC 1N73C 1T2KD 1HJBA 3TK1A 2NPSB 3HUSA 3L35A 2H7HA 2A45H 2KLVA 3EFGA 5AW6B 5APYA 3GHGA 5AVQB 3P32A 5AW7B 1RF0C 5AW4B 1S9KE 1JY2N 1FZCA 1DH3A 1LT9B 1KZUB 3A5TA 1IK9A 1RF1A 1PFIA 3B5NA 4LC1A 3O8ZA 1N7SB 2WWWA 1OXZA 5AVVB 1IFJA 1KQLA 2H43A 2N1TA 2R5DA 1G2CB 1M1JA 1X79B 3HTKA 2XNXA 2P1JA 4GIFA 3I5CA 5CCGC 5APXA 1N7SA 1SQVK 2N9BA 3V4WA 2R3CA 1WRGA 2C0WA 4KHXA 5KTBA 2CPBA 3U1CA 2XKMA 1RE3C 2WPSA 3RK3D 1LWUC 1VDFA 2O1JA 3CL3D 3M9HA 1L4AA 2CPSA 1G1JA 2YKQA 3M9QA 4W80A 2Z5IA 2C0XA 2WT7A 1GW4A 3MIWA 4N6JA 1NOHA 1FOSF 2MJZA 2Q7CA 3P7KA 4WY4A 1JCCA 3VTPC 2XV5A 1JMMA 2YKPA 2XZRA 2IPPA 3EQ2A 5BU8B 1GD2E 3KPEA 4HYTB 3L4FA 2M8RA 1URQD 4W7YA 3SWFA 1QL2A 3H32A 1A02J 1L4AB 3H32B 2P67A 1ZLLA 5AW3B 1CI6B 1LTGC 2XDJA 1QL1A 4ZKPA 4Y99C 1A02F 4C7NB 3WMM0 5APVA 3SWYA 1JO5A 5KJ7A 3IR9A 4DOJA 1IFIA 2HG5D 1FZBA 2KP8A 1RE4A 4WY4C 1IO4A 4B86A 1N73A 3BATA 1SQPK 4C46A 2W6BA 2WSCH 1NTKK 4JYBA 4WY4D 4N78E 1HH0A 5APUA 3HRNA 3R2PA 1JCDA 2GUSA 3TNUB 3VMXA 1LWUA 1J1EC 1YTZI 5AVXB 1HVVA 1LT9A 2O1KA 4OH8B 5AW2B 1L4AC 3V2QA 3OA7A 3OAKA 2YO2A 2KYVA 3P8CE 1KFNA 3B5ND 3M0DA 1M1JB 3HTKB 1NKNA 3BRTB 1CZQA 1EQ7A 4WB4A 5APSA 3V2PA 3RK3B 2BASA 1KILA 3RK2B 4IFFA 2H8PD 1LTJB 1GK4A 3RL0B 1X8YA 1N7SC 1HBWA 3V4QA 1FZCB 1SFCB 2KSJA 2FFDB 1KILD 3HE4A 3PP5A 4W7ZA 1NO4A 1HUCA 3NXSA 1MZ9A 1H88A 3B8EB 5APTA 1FZCC 1SP4A 3CI9A 3HD7C 1J1DC 3T97A 3M06A 3VMYA 3IFMA 1FZFA 1SQBK 3B5NC 1N73B 4O9BA 5CCHC 1GU4A 1GDTA 3VOPA 2HFED 3MTUE 1T8ZA 2W6AA 3KYQA 5KLVK 1Z56A 3HD7A 4N3YB 1X9VA 3MUDA 4DZOA 1SQQK 4RESB 2GUVA 3RL0C 5CJ0A 4WY4B 2OYHB 5CJ4A 2Z5HA 3LW5H 2WT7B 1CI6A 3MGNA 1SLQA 1AFOA 5AVZB 2VRSA 5AW8B 1NKZB 1L0NK 1M7LA 1HGZA 2KB7P 1GW3A 2XU6A 2FYUK 1RE3A 3HE4B 1LGHB 3VN0A 1ZR4A 1T3UA 2OARA 3M0DC 1DEBA 3VP9A 5AVUB 1FU1A 1ZR2A 3LIDA 4ZKUA 1M1JC 2A45I 1JTHB 2R5BA 1CW5A 3LIEA 1LT9C 1JUNA 3C9IA 1G2CA 3TSIA 2L5GB 3U59A 3V5BA 1H89A 1GL2D 1MFZA 1SFCA 2ZXEB 3GHGC 2O01H 3G3ZA 1T3JA 5AVYB 2P2UA 1JY3P 1NHLA 2C9LY 1JY2P 1KILB 1L0LK 2R32A 5AVRB 2ZFCA 1SFCD 1IJDB 1N7LA 2Q5UA 3VYIA 1RE4C 4C7RA 1NH4A 1URQB 1HWTC 2HODA 2N1TB 3BASA 2GM4A 1CSBA 5KJ7C 1SVFA 3RK3C 1HTLC 5CCGA 5AVTB 4GKGA 1NAFA 2E43A 3VMZA 3B5NB 1W2EA 4AUWA 1RF1B 2FKWB 2Q9IA 1IFMA 1LWUB 1JNMA 3V2NA 3A7OA 2IX7C 2WPRA 1GU5A 1MV8A 4C7NA 1RF1C 3II6A 5AW1B 2NPSA 3HUSB 4LGDE 1XTGB 5KJ7D 5CCHD 1J1DB 3N7NA 4XE5B 2OYIA 1JTHA 3HD7D 1FBMA 4IFDK 1FJPA 1HGVA 4Y99B 1LTIC 1GZLA 1S9KD 5CCHA 1SFCC 2FFDC 1JY2O 2FYZA 2OYHA 2KOGA 1LTJC 2M3BA 3HD7B 1LTBC 2P7JA 3P8MC 3M9BA 1MUUA 1FDMA 3TYYA 5CMZA 1YYCA 1NU1K 2YNYA 1N86A 5AVWB 2C9NY 2POHA 1H8AA 4JF7A 5AVSB 4I6MC 1L4AD 2WZ7A 4I2LC 3OJAB 2I1JA 1J1EB 3CLQA 1LTSC 1LTTC 3V2RA 2HLOA 2I1KA 2N1TD 4IFMA 5CHXA 4AYCA 1VPCA 2Z4EA 3RK2D 3M91A 2NPSD 4EOTA 3NTNA 1ZV8A 1RF0A 1IC2A 2OYIB 1URQA 1ZN5A 3KDPB 2WSFH 2HPCA 2WITA 3A2AA 1KFMA 2HYNA 5AW0B 1GL2B 2FFDA 2Q3IA 2JEEA 1J2JB 3RL0D 1NWQA 1GL2A 1LTAC 2WSEH 2YO3A 1FZAA 3L37A 3A3YB 2PP6A 1URQC 2JJLA 3VP8A 4JYCA 1N2DC 3N4XA 5APWA 3BRVB 1KILC 1FZEA 2IFMA 3TNUA 3HE5B 4LLHA 1N7SD 3BVHA 3GHGB 1FOSE 3HE5A 1E5WA 3HUSC 1IFNA 2HPCB 3H6PA 3M0AA 1SQXK 1WT6A 2YMYA 5AW9B 1IFDA 2QM8A 4EIJA 3NFQA 1FAVA 2WPQA 1JY3N 5BU5A 1XTCC 2IFNA 3UIAA 1GTWA 1AQ5A 2E42A 1NTZK 3L36A 2LKMA 4WBAA 2YKOA 2A45G 3P8CD 4I1LA 2WTYA 2FXMA 1NTMK 3U1AA 5CCGD 4HH2A 3NMDA 2J58A 2W27A 4XA4A 4M3LA 1DX7A 1GK6A 4AQRD 2NPSC 3RK2C 2J59M 2PAJA 3KQGA 1JOCA 3MD0A 1G1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G3Z A;  2O01 H;  1SQQ K;  2OAR A;  1NTZ K;  2LKM A;  1L0L K;  2WSE H;  1NTM K;  3LW5 H;  1SQP K;  1NU1 K;  2WSC H;  1SQB K;  2WSF H;  1NTK K;  1SQX K;  1L0N K;  4IFD K;  3M9Q A;  2J59 M;  1SQV K;  5KLV K;  2FYU K;  3CLQ A; 
#chains in the Genus database with same CATH topology
 2AEJ A;  5APQ A;  1RY3 A;  4N78 D;  3AEB C;  1EZV G;  2N1T C;  2RKL A;  2OYH C;  1JY3 O;  5BVZ A;  1BGY G;  1OWA A;  4GOF A;  3BCC J;  1FJK A;  1GL2 C;  3L72 G;  1SQX J;  2LXC B;  1VQ5 P;  1LTJ A;  3E1I A;  3CPW O;  1FZG A;  1KB9 E;  1YTZ T;  5AW5 B;  3MUD C;  1YJ9 P;  3L72 D;  4GT1 A;  4ASV A;  1T2K C;  1AQT A;  4EYY Q;  1KV4 A;  2KNC A;  2QM7 A;  2HOD B;  2OYI C;  3T97 B;  1N73 C;  3PHL A;  4PD4 I;  2WSF J;  1T2K D;  1X0T A;  2B89 A;  3GLM A;  4UB8 H;  3TK1 A;  1NU1 D;  2NPS B;  3HUS A;  3L35 A;  1NGM B;  1HJB A;  2KI7 B;  1KOR A;  1S5L E;  4EDF A;  2A45 H;  3G4S P;  2H7H A;  2KLV A;  3EFG A;  5AW6 B;  1OVR A;  5APY A;  3WU2 H;  3GHG A;  1Q7Y Q;  1BGY J;  3P32 A;  5AVQ B;  4KJM A;  5AW7 B;  4NPE A;  5E79 H;  1KYO E;  1RF0 C;  5AW4 B;  1JY2 N;  4Z1M H;  3TF5 A;  2M0B A;  1FC2 C;  1S9K E;  1LT9 B;  1KZU B;  4EI2 A;  3A5T A;  1FZC A;  1DH3 A;  1IK9 A;  2QJY B;  1BSN A;  1RF1 A;  2YXQ B;  3B4S A;  1PFI A;  1M57 D;  3B5N A;  4LC1 A;  5KAF E;  1QVF O;  3O8Z A;  1N7S B;  2M5A A;  3IAO A;  3B71 A;  2WWW A;  3PLN A;  1OXZ A;  5AVV B;  1IFJ A;  1KQL A;  3CCU P;  2H43 A;  1MFT A;  2N1T A;  2R5D A;  1G2C B;  1M1J A;  1X79 B;  2QJY C;  3GMA A;  3HTK A;  3H1I D;  1K04 A;  3H1I E;  3JCU H;  1YQ4 C;  4ZMD A;  5B5E E;  5KLV J;  3CCE P;  2XNX A;  4L76 A;  2P1J A;  3D70 A;  3RBX A;  4GIF A;  4H0L B;  4GDO A;  4HKZ H;  3I5C A;  5CCG C;  1JEK A;  4PJ0 H;  3EFF K;  2H89 C;  5APX A;  3L71 G;  1N7S A;  1S2E A;  2DW3 A;  1SQV K;  2N9B A;  3USS A;  2JP3 A;  2FYN B;  3CC7 P;  1JMB A;  3ZDM A;  3CXH I;  2V7Q H;  3L73 D;  3CXH H;  3V4W A;  2R3C A;  4I7Z C;  1WRG A;  3LW5 J;  4JQ0 D;  4KHX A;  1OFC X;  2CPB A;  2B87 A;  5DJT B;  4YXW H;  5KTB A;  2XKM A;  3PTZ A;  3U1C A;  4WVZ A;  3D6Z A;  1RE3 C;  1PGP A;  3WU2 E;  2WPS A;  2QSI A;  3SWK A;  1PV3 A;  3RK3 D;  1LWU C;  1ZRT D;  1VDF A;  2FYU J;  2O1J A;  3CL3 D;  1E79 H;  5H2F E;  3Q5S A;  4PD4 E;  1NTZ G;  1SQQ G;  1L4A A;  2CPS A;  3H1J D;  1G1J A;  2YKQ A;  3M9H A;  2IYP A;  4RO0 A;  1RQV A;  3M9Q A;  4W80 A;  2O01 J;  2Z5I A;  2C0X A;  2Q6Q A;  2WT7 A;  1Y9B A;  1NU1 J;  1GW4 A;  4GOD A;  3MIW A;  4N6J A;  1S5L H;  1NOH A;  4NPF X;  1FOS F;  2MJZ A;  2Q7C A;  3P7K A;  3I55 P;  4WY4 A;  1JCC A;  2A06 D;  2NRG A;  3VTP C;  3H1I G;  2XV5 A;  1JMM A;  1HJ0 A;  2XND H;  5CCH D;  2YKP A;  2XZR A;  1USD A;  2IPP A;  3EQ2 A;  5BU8 B;  1GD2 E;  3KPE A;  4HYT B;  3L4F A;  5KAI E;  2M8R A;  2BEQ D;  5KLV D;  3H1L D;  4L74 A;  2KXP B;  5B66 E;  1NYH A;  4NPD A;  1URQ D;  4W7Y A;  1NTZ E;  1NTZ D;  3SWF A;  1QL2 A;  3H32 A;  3K5B A;  1A02 J;  1L4A B;  3H32 B;  2P67 A;  4DJG A;  1ZLL A;  2E76 D;  3MP7 B;  5AW3 B;  4PD4 D;  1P84 E;  1PL5 A;  1CI6 B;  1LTG C;  2XDJ A;  3AEC C;  1QL1 A;  3AE8 C;  1IK7 A;  4ZKP A;  3E1R A;  4Y99 C;  1A02 F;  4C7N B;  1KYO I;  3WMM 0;  5KAF H;  1AVO A;  2W83 C;  4IL6 H;  3CCM P;  3MZW B;  3L73 G;  2QJP C;  5APV A;  3SWY A;  4RJT A;  5KJ7 A;  1JO5 A;  1U7M A;  2OYO A;  2ZXX A;  3IR9 A;  1P84 I;  3MD0 A;  1YBK A;  1AVY A;  4GOE A;  4DOJ A;  3RBZ A;  1IFI A;  2HG5 D;  1KQF B;  3FX0 A;  1FZB A;  1S3J A;  2KP8 A;  2J5U A;  1VQ4 P;  1RE4 A;  4WY4 C;  1IO4 A;  2BCC D;  4B86 A;  1N73 A;  1KQS O;  3BAT A;  1SQP K;  2WSS H;  4K35 A;  2W6B A;  4C46 A;  4D6T E;  1SQP E;  1KYO D;  1EZV D;  2E76 B;  2WSC H;  1MKM A;  1NTK K;  4JYB A;  3H1L E;  2FYU D;  2KS1 A;  4WY4 D;  5CBO A;  4H13 D;  2AXT E;  2H88 C;  2IZ1 A;  4N78 E;  5K5G B;  1UII A;  3AE1 C;  3MHV A;  1HH0 A;  4UB6 E;  5APU A;  1KTM A;  1D7M A;  2L91 A;  1USE A;  2FYU E;  2K9J A;  2B87 B;  2KSE A;  3HRN A;  3R2P A;  5GTH H;  1VQP P;  1JCD A;  1YHQ P;  2QVA A;  2GUS A;  3TNU B;  3VMX A;  1LWU A;  2G3A A;  1NAY A;  1J1E C;  1NTK G;  1QGK B;  3Q5R A;  1YTZ I;  5AVX B;  3V6I A;  2Y9Z A;  1HVV A;  3H1I J;  1LT9 A;  1OIP A;  2E5T A;  2JWD A;  2O1K A;  4HB1 A;  1L4A C;  2PRR A;  4OH8 B;  5AW2 B;  3V2Q A;  1L0N J;  1VQL P;  3OA7 A;  2IYO A;  1N8R Q;  3CX5 H;  3OAK A;  3H1H G;  4L73 A;  3CD6 P;  2YO2 A;  3BCC E;  2KYV A;  4OGQ D;  3L70 D;  3P8C E;  1LT1 A;  5KKZ B;  1SQB G;  1KFN A;  3B5N D;  1NU1 E;  4H0L C;  3M0D A;  1M1J B;  3HTK B;  1NKN A;  3BRT B;  1CZQ A;  1EQ7 A;  3F5H A;  1VF5 C;  3L73 E;  4WB4 A;  1SQQ E;  4PV1 C;  1AV1 A;  2K3R A;  5APS A;  3RK3 B;  3V2P A;  4D6T D;  1M8O B;  4QMA A;  2M5A B;  4L75 A;  2BAS A;  3CX5 I;  1KIL A;  1PP9 G;  3CWB G;  3R4Y A;  2H8P D;  4IFF A;  1LTJ B;  3RK2 B;  1BDC A;  2CK3 H;  2K37 A;  1L0L J;  4U7J A;  1GK4 A;  3W68 A;  3RL0 B;  1X8Y A;  1N7S C;  5L8R J;  1HBW A;  3V4Q A;  1KQG B;  2ZT9 C;  1KC8 Q;  2D2C D;  3A0B E;  1S5L X;  1ZRT E;  3AE2 C;  1FZC B;  2Y0E A;  3C8V A;  3L75 J;  1TU3 F;  2D2C C;  1SFC B;  2KSJ A;  2RMZ A;  2ZT9 D;  1Q81 Q;  3D71 A;  3CCR P;  2FFD B;  2K9Y A;  1KIL D;  3HE4 A;  3PP5 A;  4IOI H;  4W7Z A;  3H1H E;  4A7P A;  2UWJ E;  1NO4 A;  1IZN B;  1HUC A;  3H1J J;  1MZ9 A;  3NXS A;  1H88 A;  3B8E B;  3JC2 2;  1KMI Z;  5APT A;  1VQ8 P;  3FWN A;  1SQX D;  2KS1 B;  3AEG C;  3GF7 A;  1FZC C;  1SP4 A;  3CI9 A;  3D6Y A;  2A06 E;  1M1K Q;  2Y0C A;  3HD7 C;  1J1D C;  1FDO A;  3T97 A;  1R5L A;  3M06 A;  3VMY A;  3I56 P;  1YIT P;  3IFM A;  2JO1 A;  1SQB K;  4H0L D;  1FZF A;  5KLI B;  3B5N C;  1N73 B;  4O9B A;  5CCH C;  1GU4 A;  1GDT A;  3VOP A;  1NTK E;  2HFE D;  1K73 Q;  3MTU E;  5E79 E;  2OTL P;  4KT0 J;  4U3F E;  1PPJ D;  1DIP A;  1PPJ E;  1T8Z A;  2KIK A;  2W6A A;  3F89 A;  3KYQ A;  2QEX P;  3WUT A;  2LXB A;  3L75 E;  5KLV K;  1Z56 A;  1SQV E;  3HD7 A;  5EFW B;  4N3Y B;  4OVN F;  1X9V A;  3MUD A;  4DZO A;  3AED C;  1SQQ K;  2ZYD A;  4RES B;  2GUV A;  5H2F H;  3RL0 C;  1VQM P;  3L74 G;  5CJ0 A;  4H13 B;  4ASW A;  3GW6 A;  4WY4 B;  1EZV E;  4ZNC A;  1EDK A;  2OYH B;  5CJ4 A;  2FXO A;  2Z5H A;  1K9M Q;  1P84 D;  3CCL P;  3Q5P A;  1EDI A;  1VF5 B;  3LW5 H;  2WT7 B;  1CI6 A;  1L0N D;  3IN6 A;  3MGN A;  3L71 J;  4PJ0 E;  1WMK A;  3ITK A;  1SS1 A;  3A0B H;  1SLQ A;  2ZVO B;  1AFO A;  5AVZ B;  1L0N E;  2IBZ G;  2VRS A;  2W90 A;  1NKZ B;  1EZV I;  4OGQ B;  5AW8 B;  1L0N K;  1M7L A;  2Q3E A;  2IZ0 A;  1HGZ A;  2MKV A;  3L75 G;  3CC4 P;  2KB7 P;  1SQV G;  3CME P;  1VQ6 P;  1SQP J;  1NTZ J;  1GW3 A;  3SFD C;  2XU6 A;  1RE3 A;  1DD4 A;  1NTK J;  2FYU K;  3HE4 B;  1LGH B;  3AEA C;  2WMM A;  1VQO P;  3VN0 A;  1VQK P;  1OW7 A;  1BCC D;  1S72 P;  1ZR4 A;  1T3U A;  2OAR A;  3CCV P;  5DJU B;  2OQQ A;  1RQU A;  3TGU E;  1SQP D;  3M0D C;  1DEB A;  1PP9 E;  4U3F D;  1FU1 A;  5AVU B;  3TDK A;  3VP9 A;  2B9B A;  2E75 B;  2ITA A;  1K05 A;  1ZR2 A;  3LID A;  2AEM A;  4ZKU A;  1M1J C;  1PPJ G;  1BCC J;  1LNQ A;  2A45 I;  2E74 B;  2QA4 P;  2ZYG A;  3H1K D;  1JTH B;  1Q82 Q;  1LP1 A;  1OW8 A;  1VQ9 P;  2R5B A;  3QWO C;  2ZJS E;  1CW5 A;  3LIE A;  5TIS H;  1SQB E;  1LT9 C;  1S1C X;  1JUN A;  3CXH D;  3C9I A;  5B66 H;  1G2C A;  1BE3 E;  3CX5 E;  1QEX A;  2L5G B;  3TSI A;  1YJN P;  4UB6 H;  3S4R A;  4HJG H;  2RN0 A;  3RL0 g;  3U59 A;  3V5B A;  1H89 A;  3GG2 A;  4H44 D;  1GL2 D;  2PFX A;  1MFZ A;  1SFC A;  1PP9 J;  2KUB A;  2ZXE B;  2O01 H;  3G3Z A;  1T3J A;  3GHG C;  1ZXG A;  3TGU G;  5TIS E;  2IBZ D;  3AE3 C;  5AVY B;  1PGQ A;  2P2U A;  3S1K A;  1JY3 P;  1NHL A;  1R5S A;  3WUV A;  2C9L Y;  3G6E P;  1JY2 P;  2YIU B;  1KIL B;  1L0L K;  2R32 A;  1KB9 H;  5AVR B;  2ZFC A;  1PP9 D;  1SFC D;  3FXD A;  1K8A Q;  1IJD B;  1N7L A;  3A0H E;  2D2C B;  2Q5U A;  2AXT H;  3VYI A;  1RE4 C;  4C7R A;  1SQP G;  1W2B O;  1R8E A;  1H0T A;  1NH4 A;  1QLE D;  2WSE J;  1YI2 P;  2SPZ A;  1JM0 A;  2Y0D A;  1URQ B;  1LP1 B;  2HOD A;  4YTP C;  1DEE G;  2N1T B;  2KZI A;  3BAS A;  1HWT C;  1QX8 A;  1CSB A;  2OTK E;  2GM4 A;  5KJ7 C;  1SVF A;  1UIX A;  1W5C E;  1HTL C;  2JR8 A;  4PV1 B;  4TT3 H;  3L70 J;  5AVT B;  3RK3 C;  5CCG A;  1NJI Q;  3CC2 P;  4GKG A;  1NAF A;  2JWA A;  2BEZ F;  3VMZ A;  3B5N B;  1W2E A;  2E75 D;  2E43 A;  1SQB J;  4AUW A;  1RF1 B;  2FKW B;  2QJK B;  3KZI E;  2Q9I A;  1X22 A;  1ZP0 C;  1IFM A;  1LWU B;  1JNM A;  3V2N A;  3A7O A;  2OGU A;  2IX7 C;  4D6T J;  2WPR A;  1GU5 A;  1VQN P;  3JSV C;  1U7J A;  1PIX A;  1BE3 D;  5GTH E;  1MV8 A;  2E75 C;  2BCC J;  2I8D A;  3BCC G;  4C7N A;  3BCC D;  1RF1 C;  1L0L G;  3II6 A;  5AW1 B;  1SQV D;  5KAI H;  3AE5 C;  2NPS A;  3HUS B;  2QIW A;  2E5Y A;  1Q2N A;  1NTM G;  4LGD E;  1XTG B;  3L75 D;  2FBW C;  2QRX A;  3E7K A;  4OWF A;  5KJ7 D;  2FYU G;  1J1D B;  2JDI H;  2QG4 A;  3N7N A;  4XE5 B;  2OYI A;  1JTH A;  3HD7 D;  3L72 J;  1FBM A;  5C39 A;  3BVH A;  4IFD K;  1FJP A;  1HGV A;  4Y99 B;  1LTI C;  1NVO A;  1GZL A;  3OW2 O;  1Q90 D;  1S9K D;  1PGJ A;  2WSC J;  3CWB D;  5CCH A;  1OZH A;  4D6T G;  1SFC C;  2FFD C;  1JY2 O;  2FYZ A;  3FWL A;  2Q1K A;  2OYH A;  3RGU A;  4BWN A;  2KOG A;  1LTJ C;  2N9Y B;  3FGA D;  2O3J A;  2M3B A;  3CCQ P;  3HD7 B;  1OW6 A;  1T6A A;  4H44 C;  1LTB C;  2P7J A;  1KIL E;  2WQY C;  2ZYA A;  3P8M C;  2G8Y A;  3M9B A;  4CPG A;  1MUU A;  3ABV C;  1KB9 D;  2K1A A;  4JBZ A;  3TYY A;  5CMZ A;  1FDM A;  1YYC A;  1NU1 K;  1Y47 A;  5KKZ C;  3TGU D;  1EDL A;  2YNY A;  1N86 A;  1NTK D;  4OGQ C;  1BCC E;  5AVW B;  1NTM D;  2GA1 A;  2C9N Y;  1PGO A;  2O01 N;  2IDB A;  2K88 A;  2POH A;  2QE7 H;  1H8A A;  4JF7 A;  1L0L D;  5AVS B;  4I6M C;  3WUU A;  1BE3 G;  2R3S A;  1L4A D;  1KB9 I;  1RH5 B;  2WZ7 A;  3H1H J;  4I2L C;  3OJA B;  4IL6 X;  1J1E B;  2I1J A;  3CLQ A;  1EDJ A;  3L74 E;  2ZAE B;  2IBZ I;  3L74 D;  1NTM J;  4TLF A;  1LTS C;  1DD3 A;  1SQB D;  1LTT C;  3V2R A;  3KZI H;  2HLO A;  2I1K A;  2N1T D;  3JCU E;  4IFM A;  5B5E H;  1Q86 Q;  1VL2 A;  1SQV J;  1EC5 A;  3L71 E;  5CHX A;  4AYC A;  1ZOY C;  1EXJ A;  3Q3D A;  1VPC A;  1FE6 A;  2Z4E A;  3RK2 D;  3L74 J;  3M91 A;  2NPS D;  4EOT A;  4DCK A;  1BE3 J;  4H13 C;  5GTI E;  3NTN A;  1ZV8 A;  4XFJ A;  1HF9 A;  2IBZ E;  1RF0 A;  2YIU C;  1IC2 A;  1U57 A;  2ZVN B;  2OYI B;  1URQ A;  1ZN5 A;  3KDP B;  1YIJ P;  1SQX E;  2WSF H;  5KLI C;  4BRY A;  3AE6 C;  2HPC A;  1ZME C;  2QJK C;  1BDD A;  2WIT A;  3A2A A;  2WVR A;  1KFM A;  4MN4 C;  2HYN A;  2HR3 A;  3EWK A;  3GF3 A;  3H1K J;  1L2P A;  2JKV A;  5AW0 B;  1GL2 B;  2W6J H;  4H44 B;  2RH0 A;  2FFD A;  2Q3I A;  2JEE A;  1J2J B;  5CBN A;  3Q2Y A;  2P10 A;  2B88 A;  3RL0 D;  1H0T B;  5M1B A;  2BCC G;  1BSH A;  3FXE A;  1L0N G;  3W67 A;  1AA0 A;  3KHU A;  1NWQ A;  4JPZ B;  5GTI H;  1GL2 A;  4RKU J;  1YJW P;  1QVG O;  1LTA C;  2WSE H;  5KLV G;  3SSU A;  2YO3 A;  1SQQ J;  4I7Z B;  2E74 D;  3TGU J;  1OVU A;  1LJ2 A;  1ZW0 A;  2E76 C;  2V4H A;  3AEF C;  1JB0 J;  1FZA A;  3L37 A;  1IFP A;  3A3Y B;  3G9R A;  3KXD A;  2PP6 A;  3CXH E;  1YQ3 C;  2A06 G;  3H1K G;  4IL6 E;  1URQ C;  2JJL A;  4Y28 J;  1PZQ A;  2QJP B;  3VP8 A;  4JYC A;  3AE4 C;  3H1H D;  3C1L A;  3PRJ A;  1N2D C;  2FXP A;  2W8Z A;  1GMJ A;  3N4X A;  3L72 E;  4U3F G;  5APW A;  3QH9 A;  3H1J E;  1P84 H;  3BRV B;  1KIL C;  2WPV B;  1BCC G;  2AEF A;  1FZE A;  1EXI A;  2IFM A;  2OTJ P;  3TNU A;  3HE5 B;  3AEE C;  4LLH A;  3SFE C;  1N7S D;  1KYO H;  2K9J B;  3L70 G;  1SQX G;  2YXR B;  3GHG B;  5KLV E;  3S9O A;  2KK7 A;  3H1L G;  3HE5 A;  4BRY B;  1M90 Q;  1FOS E;  1E5W A;  3CMA P;  3HUS C;  1AJY A;  4U3F J;  3IF4 A;  1IFN A;  3L73 J;  3H25 A;  4PV1 D;  2HPC B;  1VQ7 P;  1VF5 D;  3H1K E;  2P58 A;  3H6P A;  3PJS K;  4PD4 H;  3M0A A;  1KN7 A;  2KNC B;  4YXD C;  3O6Q A;  1FDI A;  1SQX K;  1WT6 A;  3Q1M A;  2KZJ A;  3AE7 C;  2YMY A;  1FS0 E;  1S4X A;  5AW9 B;  1IFD A;  2E74 C;  3AE9 C;  3CCS P;  1OX3 A;  2QM8 A;  2V7Q J;  4EIJ A;  4K3A A;  3NFQ A;  1FAV A;  2WPQ A;  1JY3 N;  4YPC A;  5BU5 A;  1XTC C;  4UB8 E;  2IFN A;  3CX5 D;  3UIA A;  1KD1 Q;  1GTW A;  2AXC A;  3H1L J;  2M3E A;  3CCJ P;  1BGY D;  3L70 E;  1AQ5 A;  2R44 A;  2E42 A;  3CWB J;  2KLU A;  3PH0 A;  2FYN C;  1NTZ K;  2PGD A;  1RHZ B;  3L36 A;  1L0L E;  2LKM A;  4WBA A;  1M56 D;  3VMA A;  1BGY E;  2YKO A;  2A45 G;  3P8C D;  4I1L A;  1NTM E;  2WTY A;  2YMK A;  2FXM A;  1OVV A;  1NTM K;  3U1A A;  5CCG D;  4HH2 A;  3NMD A;  3CWB E;  1Y8A A;  4R4L A;  2LR2 A;  2FY8 A;  2Y9Y A;  1SQQ D;  2BCC E;  3H1J G;  3O6Q B;  4DT0 A;  1OMI A;  5TJH A;  2NZ2 A;  2J58 A;  2ZT9 B;  4WWI A;  2W27 A;  4XA4 A;  4M3L A;  3G71 P;  4BXL A;  3A0H H;  1GK6 A;  1DX7 A;  3L71 D;  4AQR D;  2NPS C;  4R4M A;  2J59 M;  2PAJ A;  3RK2 C;  3RK3 E;  3KQG A;  1JOC A;  2C0W A;  1G1I A;  1NU1 G; 
#chains in the Genus database with same CATH homology
 5APQ A;  1RY3 A;  4N78 D;  2N1T C;  2OYH C;  1JY3 O;  5BVZ A;  1OWA A;  1FJK A;  1GL2 C;  1LTJ A;  3E1I A;  1FZG A;  1YTZ T;  5AW5 B;  4GT1 A;  1T2K C;  2QM7 A;  2HOD B;  2OYI C;  1N73 C;  1T2K D;  1HJB A;  3TK1 A;  2NPS B;  3HUS A;  3L35 A;  2H7H A;  2A45 H;  2KLV A;  3EFG A;  5AW6 B;  5APY A;  3GHG A;  5AVQ B;  3P32 A;  5AW7 B;  1RF0 C;  5AW4 B;  1S9K E;  1JY2 N;  1FZC A;  1DH3 A;  1LT9 B;  1KZU B;  3A5T A;  1IK9 A;  1RF1 A;  1PFI A;  3B5N A;  4LC1 A;  3O8Z A;  1N7S B;  2WWW A;  1OXZ A;  5AVV B;  1IFJ A;  1KQL A;  2H43 A;  2N1T A;  2R5D A;  1G2C B;  1M1J A;  1X79 B;  3HTK A;  2XNX A;  2P1J A;  4GIF A;  3I5C A;  5CCG C;  5APX A;  1N7S A;  1SQV K;  2N9B A;  3V4W A;  2R3C A;  1WRG A;  2C0W A;  4KHX A;  5KTB A;  2CPB A;  3U1C A;  2XKM A;  1RE3 C;  2WPS A;  3RK3 D;  1LWU C;  1VDF A;  2O1J A;  3CL3 D;  3M9H A;  1L4A A;  2CPS A;  1G1J A;  2YKQ A;  3M9Q A;  4W80 A;  2Z5I A;  2C0X A;  2WT7 A;  1GW4 A;  3MIW A;  4N6J A;  1NOH A;  1FOS F;  2MJZ A;  2Q7C A;  3P7K A;  4WY4 A;  1JCC A;  3VTP C;  2XV5 A;  1JMM A;  2YKP A;  2XZR A;  2IPP A;  3EQ2 A;  5BU8 B;  1GD2 E;  3KPE A;  4HYT B;  3L4F A;  2M8R A;  1URQ D;  4W7Y A;  3SWF A;  1QL2 A;  3H32 A;  1A02 J;  1L4A B;  3H32 B;  2P67 A;  1ZLL A;  5AW3 B;  1CI6 B;  1LTG C;  2XDJ A;  1QL1 A;  4ZKP A;  4Y99 C;  1A02 F;  4C7N B;  3WMM 0;  5APV A;  3SWY A;  1JO5 A;  5KJ7 A;  3IR9 A;  4DOJ A;  1IFI A;  2HG5 D;  1FZB A;  2KP8 A;  1RE4 A;  4WY4 C;  1IO4 A;  4B86 A;  1N73 A;  3BAT A;  1SQP K;  4C46 A;  2W6B A;  2WSC H;  1NTK K;  4JYB A;  4WY4 D;  4N78 E;  1HH0 A;  5APU A;  3HRN A;  3R2P A;  1JCD A;  2GUS A;  3TNU B;  3VMX A;  1LWU A;  1J1E C;  1YTZ I;  5AVX B;  1HVV A;  1LT9 A;  2O1K A;  4OH8 B;  5AW2 B;  1L4A C;  3V2Q A;  3OA7 A;  3OAK A;  2YO2 A;  2KYV A;  3P8C E;  1KFN A;  3B5N D;  3M0D A;  1M1J B;  3HTK B;  1NKN A;  3BRT B;  1CZQ A;  1EQ7 A;  4WB4 A;  5APS A;  3V2P A;  3RK3 B;  2BAS A;  1KIL A;  3RK2 B;  4IFF A;  2H8P D;  1LTJ B;  1GK4 A;  3RL0 B;  1X8Y A;  1N7S C;  1HBW A;  3V4Q A;  1FZC B;  1SFC B;  2KSJ A;  2FFD B;  1KIL D;  3HE4 A;  3PP5 A;  4W7Z A;  1NO4 A;  1HUC A;  3NXS A;  1MZ9 A;  1H88 A;  3B8E B;  5APT A;  1FZC C;  1SP4 A;  3CI9 A;  3HD7 C;  1J1D C;  3T97 A;  3M06 A;  3VMY A;  3IFM A;  1FZF A;  1SQB K;  3B5N C;  1N73 B;  4O9B A;  5CCH C;  1GU4 A;  1GDT A;  3VOP A;  2HFE D;  3MTU E;  1T8Z A;  2W6A A;  3KYQ A;  5KLV K;  1Z56 A;  3HD7 A;  4N3Y B;  1X9V A;  3MUD A;  4DZO A;  1SQQ K;  4RES B;  2GUV A;  3RL0 C;  5CJ0 A;  4WY4 B;  2OYH B;  5CJ4 A;  2Z5H A;  3LW5 H;  2WT7 B;  1CI6 A;  3MGN A;  1SLQ A;  1AFO A;  5AVZ B;  2VRS A;  5AW8 B;  1NKZ B;  1L0N K;  1M7L A;  1HGZ A;  2KB7 P;  1GW3 A;  2XU6 A;  2FYU K;  1RE3 A;  3HE4 B;  1LGH B;  3VN0 A;  1ZR4 A;  1T3U A;  2OAR A;  3M0D C;  1DEB A;  3VP9 A;  5AVU B;  1FU1 A;  1ZR2 A;  3LID A;  4ZKU A;  1M1J C;  2A45 I;  1JTH B;  2R5B A;  1CW5 A;  3LIE A;  1LT9 C;  1JUN A;  3C9I A;  1G2C A;  3TSI A;  2L5G B;  3U59 A;  3V5B A;  1H89 A;  1GL2 D;  1MFZ A;  1SFC A;  2ZXE B;  3GHG C;  2O01 H;  3G3Z A;  1T3J A;  5AVY B;  2P2U A;  1JY3 P;  1NHL A;  2C9L Y;  1JY2 P;  1KIL B;  1L0L K;  2R32 A;  5AVR B;  2ZFC A;  1SFC D;  1IJD B;  1N7L A;  2Q5U A;  3VYI A;  1RE4 C;  4C7R A;  1NH4 A;  1URQ B;  1HWT C;  2HOD A;  2N1T B;  3BAS A;  2GM4 A;  1CSB A;  5KJ7 C;  1SVF A;  3RK3 C;  1HTL C;  5CCG A;  5AVT B;  4GKG A;  1NAF A;  2E43 A;  3VMZ A;  3B5N B;  1W2E A;  4AUW A;  1RF1 B;  2FKW B;  2Q9I A;  1IFM A;  1LWU B;  1JNM A;  3V2N A;  3A7O A;  2IX7 C;  2WPR A;  1GU5 A;  1MV8 A;  4C7N A;  1RF1 C;  3II6 A;  5AW1 B;  2NPS A;  3HUS B;  4LGD E;  1XTG B;  5KJ7 D;  5CCH D;  1J1D B;  3N7N A;  4XE5 B;  2OYI A;  1JTH A;  3HD7 D;  1FBM A;  4IFD K;  1FJP A;  1HGV A;  4Y99 B;  1LTI C;  1GZL A;  1S9K D;  5CCH A;  1SFC C;  2FFD C;  1JY2 O;  2FYZ A;  2OYH A;  2KOG A;  1LTJ C;  2M3B A;  3HD7 B;  1LTB C;  2P7J A;  3P8M C;  3M9B A;  1MUU A;  1FDM A;  3TYY A;  5CMZ A;  1YYC A;  1NU1 K;  2YNY A;  1N86 A;  5AVW B;  2C9N Y;  2POH A;  1H8A A;  4JF7 A;  5AVS B;  4I6M C;  1L4A D;  2WZ7 A;  4I2L C;  3OJA B;  2I1J A;  1J1E B;  3CLQ A;  1LTS C;  1LTT C;  3V2R A;  2HLO A;  2I1K A;  2N1T D;  4IFM A;  5CHX A;  4AYC A;  1VPC A;  2Z4E A;  3RK2 D;  3M91 A;  2NPS D;  4EOT A;  3NTN A;  1ZV8 A;  1RF0 A;  1IC2 A;  2OYI B;  1URQ A;  1ZN5 A;  3KDP B;  2WSF H;  2HPC A;  2WIT A;  3A2A A;  1KFM A;  2HYN A;  5AW0 B;  1GL2 B;  2FFD A;  2Q3I A;  2JEE A;  1J2J B;  3RL0 D;  1NWQ A;  1GL2 A;  1LTA C;  2WSE H;  2YO3 A;  1FZA A;  3L37 A;  3A3Y B;  2PP6 A;  1URQ C;  2JJL A;  3VP8 A;  4JYC A;  1N2D C;  3N4X A;  5APW A;  3BRV B;  1KIL C;  1FZE A;  2IFM A;  3TNU A;  3HE5 B;  4LLH A;  1N7S D;  3BVH A;  3GHG B;  1FOS E;  3HE5 A;  1E5W A;  3HUS C;  1IFN A;  2HPC B;  3H6P A;  3M0A A;  1SQX K;  1WT6 A;  2YMY A;  5AW9 B;  1IFD A;  2QM8 A;  4EIJ A;  3NFQ A;  1FAV A;  2WPQ A;  1JY3 N;  5BU5 A;  1XTC C;  2IFN A;  3UIA A;  1GTW A;  1AQ5 A;  2E42 A;  1NTZ K;  3L36 A;  2LKM A;  4WBA A;  2YKO A;  2A45 G;  3P8C D;  4I1L A;  2WTY A;  2FXM A;  1NTM K;  3U1A A;  5CCG D;  4HH2 A;  3NMD A;  2J58 A;  2W27 A;  4XA4 A;  4M3L A;  1DX7 A;  1GK6 A;  4AQR D;  2NPS C;  3RK2 C;  2J59 M;  2PAJ A;  3KQG A;  1JOC A;  3MD0 A;  1G1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...