2WSFH

Improved model of plant photosystem i
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
69
structure length
69
Chain Sequence
DLEDIANTTGQWDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSANAPQDVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination and improved model of plant photosystem I.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords AT3G54890
total genus 4
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03244 PSI_PsaH Photosystem I reaction centre subunit VI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wsfH01
1SQVK 1L0NK 3CLQA 1SQPK 2WSEH 3LW5H 1NTZK 1SQBK 5KLVK 1NTMK 2FYUK 2LKMA 2WSCH 1NTKK 3G3ZA 3M9QA 2J59M 1L0LK 1SQQK 1SQXK 2OARA 4IFDK 1NU1K 2WSFH 2O01H
chains in the Genus database with same CATH superfamily
2N9BA 3VP8A 2M3EA 3RL0g 1OXZA 3WUTA 4WY4C 1MFZA 3L72G 1L0LJ 3OJAB 3ITKA 3VYIA 2FYUD 2YMYA 1VQ7P 1RF0A 1N86A 4PD4D 1HWTC 3CWBJ 3H1KG 1GTWA 3TSIA 3CCSP 2ZJSE 4D6TJ 2GM4A 1GZLA 3H6PA 4OVNF 1W2EA 3OA7A 1NTZG 3L70E 2BCCG 3FWNA 3IF4A 3RK2B 4HYTB 2QJPC 2A45G 2CPSA 2OYIA 2OYIC 4EIJA 4IL6X 2KZJA 4C46A 1J1DC 3VP9A 2FY8A 1GW3A 2Y0CA 5B5EE 1URQB 2V7QJ 3MD0A 4PJ0H 4NPFX 3N7NA 1ZP0C 5B66H 3HD7B 5KJ7C 1NWQA 1SQXG 2KI7B 3Q3DA 1FDMA 5KAFH 2ZYGA 1OVRA 1BGYD 1JY3P 2WITA 1KD1Q 2WWWA 3V2RA 1JY3N 1SQXD 2J58A 5CJ4A 3CCRP 3VMXA 3CCLP 1LWUC 1JCCA 1KYOI 2AEFA 2OYHC 1LWUA 1BE3D 3KXDA 4UB6E 3MGNA 1USEA 3EWKA 4WY4D 1PZQA 2K9YA 3HE4A 3U1CA 2Q5UA 2IFMA 2Z5HA 1BCCJ 2JR8A 1URQA 3TDKA 1P84E 3D71A 4W7ZA 1OX3A 1NTKK 4BRYB 5KLIB 3VMYA 2YO3A 1LNQA 3MTUE 4H13C 5APWA 1HJ0A 1KQLA 5AVTB 3JSVC 3M9BA 3P8CE 4EYYQ 1DIPA 3CXHE 3HUSC 2CK3H 2PP6A 3NXSA 3O8ZA 1U7MA 1FE6A 3GHGA 1FZCA 1GDTA 1EZVD 3EQ2A 4GOFA 4RKUJ 2YKQA 1SQPG 3RK2C 1NU1K 1WT6A 2QJYC 1OW7A 1VQKP 3VMAA 1AV1A 3RGUA 2Q1KA 3V2NA 4PD4E 1CI6B 3T97A 2Q9IA 3VOPA 3HE4B 3AE4C 3RK3B 2PRRA 3GMAA 1LTTC 1ZOYC 2MJZA 3WUVA 1OWAA 2OYOA 2QVAA 2JJLA 3V2QA 1USDA 4QMAA 4KHXA 1EDKA 4AYCA 4ZNCA 1NVOA 1IFDA 1KB9H 1X22A 1NTKG 3L74G 4IFFA 4NPDA 3RBZA 3TF5A 2LKMA 1K9MQ 1BSHA 3V4QA 2C0XA 3C9IA 2C0WA 2FYNC 2YMKA 1GL2D 2FYZA 1EXIA 4H0LD 4GIFA 5APVA 1HJBA 1YJNP 4AQRD 2C9NY 1W5CE 3AEGC 3O6QA 1NTKJ 2MKVA 2P1JA 2YIUC 1X8YA 1PP9D 1FU1A 1N7LA 1SQXE 1RQUA 2I8DA 2K37A 1PPJD 3HUSB 3AE6C 3H1LJ 3MUDC 4R4MA 4U3FD 1SFCA 3SSUA 1Q86Q 2XNXA 1NTMJ 1BE3E 4H0LB 4C7RA 1VQ9P 1QVFO 3AE2C 1KV4A 1S5LX 3H1ID 4A7PA 3KZIE 1NYHA 5KLVD 2OTKE 4LGDE 1L4AB 4W7YA 3CCEP 1KB9E 1NTZK 2E75B 2W6JH 1WMKA 5H2FH 4IL6H 3SWKA 4EOTA 1FOSF 1VQ5P 4BWNA 4XA4A 4XE5B 2ZVOB 1RF0C 4B86A 1VQLP 1P84I 2ZVNB 2BASA 2POHA 5KAFE 3AE5C 1ZRTD 3H32B 2A06G 2WSCH 5GTIH 1IFPA 3JC22 2ZFCA 3SFEC 4PD4H 2G8YA 5CBOA 2W8ZA 1N73B 1QGKB 2RMZA 3AEAC 2M3BA 1NOHA 2G3AA 2I1JA 2ZT9D 3GW6A 3H1JJ 3KPEA 5AW0B 5AW8B 3RL0B 2YIUB 5APSA 5GTIE 3CWBE 3OAKA 1KN7A 1JTHA 1LTJA 4Y99C 1R5LA 1KYOD 2KS1B 3IR9A 5E79H 1NH4A 5APQA 3H25A 5TJHA 3NFQA 2R32A 1IFNA 1K05A 3TK1A 1J1EC 3BVHA 3FWLA 3CI9A 2WZ7A 2ZT9C 2JO1A 2IYPA 3CPWO 1LGHB 3AE8C 1H89A 3MIWA 2W6BA 3RK3D 3SWFA 1LTBC 2I1KA 1NAFA 1PV3A 2FBWC 5KLVK 2KXPB 5AVQB 5K5GB 3CX5H 2FFDA 1JY2P 1SQVG 2GUSA 1KORA 4UB6H 5CCGD 3NMDA 1FZCB 3AEFC 1CZQA 2O01J 1YJ9P 3A0BH 3AE1C 1SFCB 3B71A 4AUWA 1G2CB 1NTKD 2P2UA 3Q1MA 1ZR2A 1KC8Q 1HH0A 1MUUA 3BCCD 4PD4I 1SQQJ 1U7JA 1RH5B 1AVOA 3ABVC 1H88A 2P7JA 3Q5SA 1SQPE 3KZIH 4K35A 1K8AQ 2NPSB 2GA1A 3CCUP 1PP9J 2AXTE 3B5ND 1BGYE 5C39A 5AVRB 2FFDB 3MZWB 2ZT9B 1RF1C 3BRVB 4H0LC 4H44D 5CCGA 1RF1A 2NPSA 1JOCA 4YXDC 1Q81Q 2FXOA 3HTKB 4WY4B 4I6MC 3AE9C 1NTMK 1DEBA 2E74D 2XV5A 2K9JB 5TISE 3HD7D 3A0BE 2B88A 1FZBA 2WT7B 2QJKB 2LXCB 3CX5I 2WPRA 2P10A 4L73A 3A5TA 2QG4A 1IO4A 3CXHI 1Y8AA 4L75A 2R5DA 2FYUJ 3L35A 5AW3B 2BEZF 1JY2O 2J5UA 1QLED 1S9KD 1LT1A 3B5NA 3H1HJ 1IK9A 3FX0A 1OMIA 1J1DB 4JF7A 1YJWP 2HR3A 3L72J 3L71G 4BRYA 3E1IA 1KB9I 1VPCA 1NJIQ 3K5BA 2ZAEB 1YTZT 2NZ2A 1UIXA 2BCCJ 2K9JA 1BCCE 3AEDC 3IFMA 3L71D 3PRJA 2YXQB 5BU8B 2OTLP 4D6TG 3PLNA 1L0NG 4W80A 4GKGA 1K73Q 1L0NE 5TISH 1J1EB 3S9OA 1NHLA 1VL2A 3ZDMA 1EC5A 1YIJP 1RF1B 1FZFA 3B5NC 3L72E 4K3AA 3L75E 3W67A 3G6EP 1M8OB 3HE5B 3RBXA 2E76D 1LP1B 2E76B 5B66E 1RY3A 2O01N 3TGUJ 1BE3J 1QEXA 2M8RA 2A06E 2ZXXA 2WSCJ 1N73A 2H7HA 1OW6A 1MKMA 2CPBA 2KB7P 2RH0A 2XDJA 2H89C 3HUSA 4HJGH 1FZCC 2E5YA 4HH2A 1KMIZ 1YYCA 3H32A 1KILE 1ZN5A 3M9HA 3FXEA 1BGYJ 4ASWA 1RE3A 4C7NB 1GU5A 4KT0J 1IFJA 4LLHA 3MHVA 1ZV8A 3A7OA 1PPJE 4U3FE 1EZVI 4WVZA 1LWUB 3BASA 1SQBG 1VQPP 2QRXA 2WSSH 5M1BA 4ASVA 1SQBE 3L36A 2W90A 1SQVK 1FS0E 3HE5A 3L70J 2KIKA 1IK7A 2P67A 5AW7B 1SQPK 1NU1E 1M7LA 4EI2A 1FZEA 2JWDA 3KHUA 1NU1G 1G1JA 3LW5H 3H1IJ 2QA4P 1U57A 4ZKPA 3KQGA 1JY2N 1T6AA 3A0HE 3W68A 2KZIA 3JCUH 5B5EH 1JUNA 1HVVA 1NTMD 1GW4A 3AEBC 3U1AA 3CXHD 1SQQE 3D6YA 2OTJP 1CI6A 1ZW0A 2WPQA 1RHZB 2K1AA 4WWIA 1Q7YQ 1NKZB 1ZRTE 1SQVD 3CX5D 3H1JD 4L76A 5L8RJ 1DX7A 3GHGB 1T3JA 1TU3F 1KILC 3L37A 3L71E 1KILA 1YI2P 1BSNA 1SFCC 3AECC 2BCCD 2LR2A 3L4FA 3NTNA 3V5BA 2O3JA 5KKZC 1YTZI 2BEQD 5KLVJ 1L0NJ 2E42A 2ZYAA 1GK6A 2QIWA 2ZXEB 4N78D 3M0DA 2WSFH 4OGQD 3L72D 4UB8E 4WBAA 3SFDC 1DD4A 1KYOE 3V2PA 5BVZA 1EZVG 4YXWH 3L73J 1BDDA 3Q5PA 2PGDA 5AW5B 1XTGB 2AEMA 2L91A 2QM8A 2YXRB 3L71J 4WY4A 5KAIE 2B9BA 1E5WA 1E79H 1JCDA 1LJ2A 2NPSC 1PGOA 1S4XA 5CCHD 4HKZH 2WSEJ 5AVUB 2WT7A 3B5NB 5E79E 2WPVB 1X79B 3L73E 5APYA 3RL0C 3M9QA 1P84H 1KQFB 1SP4A 3V6IA 4U3FJ 1Y9BA 1OW8A 1L0LK 2AEJA 2Y0EA 5AVXB 3CC4P 3L70D 3CWBG 3L74J 4H13D 1L2PA 1T2KD 3USSA 2YNYA 3H1IG 4I2LC 1PGJA 2O1KA 3FGAD 1VQ6P 5KJ7A 1GL2C 3TNUA 3Q5RA 1IFIA 1HTLC 4O9BA 4N6JA 2A45I 1SS1A 2XU6A 1M1JB 4TLFA 2E75C 3OW2O 1DH3A 1EXJA 2GUVA 1SQPD 2HG5D 3FXDA 5KAIH 1VQ4P 2QM7A 4H44B 2H88C 2FYUG 2HFED 2IYOA 1BCCG 2PAJA 3WUUA 5CCHA 5CBNA 2E43A 5CCHC 1IFMA 1FDIA 1R5SA 2E74B 1SQVE 3CX5E 3H1JE 1X0TA 3TNUB 2KLUA 2D2CB 2IPPA 3H1LE 1M1JC 2Y9ZA 4D6TD 1K04A 1URQC 3CWBD 1KQGB 2IBZE 3P8CD 4OGQC 1JTHB 1LTJB 3L74D 5EFWB 2V4HA 1SQQK 3HD7C 3H1HD 3PHLA 4RESB 4Y99B 2OYIB 1SFCD 3D6ZA 1LT9A 3GF7A 1S5LE 2Y9YA 3A2AA 1VQOP 4PV1B 1RE3C 1S9KE 3RK3E 1T3UA 2M5AA 4GDOA 1R8EA 2OQQA 1EZVE 1ZLLA 1NO4A 2VRSA 4NPEA 1YQ4C 2R3SA 4OH8B 5CMZA 2RN0A 5AW9B 2Q3IA 3TGUG 2O01H 4UB8H 3CD6P 3TGUE 2Z4EA 1GMJA 2JKVA 3L73D 1KQSO 5AW4B 3V4WA 1RE4A 4M3LA 5DJUB 1RE4C 2KK7A 3D70A 2Q6QA 2XZRA 2NRGA 1S72P 4IL6E 3L73G 1NTKE 2N1TA 1OFCX 1ZR4A 3VMZA 2B87A 2KNCA 3UIAA 5AVWB 1VQ8P 2N9YB 1PP9G 3EFGA 3M0AA 4I7ZC 3BCCJ 1PP9E 2KLVA 4OWFA 1NTMG 2W83C 4DOJA 2HODB 4ZMDA 3CCQP 2OARA 3CXHH 3H1KJ 1LTGC 1JO5A 3MUDA 4JQ0D 4RJTA 1J2JB 3A3YB 2HODA 1QL1A 1S2EA 1EDIA 2QJPB 3E1RA 1M1KQ 1H0TA 3E7KA 1MZ9A 3I5CA 2JDIH 3C1LA 1VF5D 2QSIA 3HRNA 1QVGO 1BE3G 4HB1A 1ZXGA 5AVZB 3CCMP 4U7JA 1LP1A 3BCCG 3H1LD 3SWYA 1EQ7A 2E76C 4GODA 4D6TE 2FXMA 1WRGA 1HUCA 1X9VA 1SVFA 2IBZD 3L75G 1IC2A 4DZOA 5AVSB 1BGYG 4JYBA 1BDCA 3MP7B 1H0TB 1VQMP 4DJGA 2KSEA 3TYYA 2D2CD 1AVYA 3AE7C 3GG2A 4C7NA 3P32A 1GK4A 1PGPA 3LW5J 3BRTB 3WMM0 1N7SD 1N7SB 2E5TA 5CHXA 3GLMA 4YPCA 3I55P 1YHQP 3H1KD 2FYNB 1SQXK 3RL0D 4I7ZB 1PGQA 4IFDK 1NTZD 1QL2A 5KLIC 3TGUD 4RO0A 2R3CA 3G4SP 1NKNA 1LTJC 1L4AD 2JEEA 2M0BA 3M06A 1S5LH 2NPSD 1GL2A 3KYQA 1L4AC 1YQ3C 2B89A 2K88A 2KP8A 2WSFJ 2YO2A 1JEKA 1H8AA 1A02F 4JPZB 1HGZA 1NTZJ 2ITAA 2Y0DA 2Z5IA 3CL3D 4N78E 4DT0A 3B8EB 2E74C 1FBMA 2FYUE 2HPCA 3CCJP 2IDBA 1SQBK 5AW1B 2OYHA 2FKWB 4H44C 1LTIC 3WU2H 1A02J 3CC2P 1NGMB 1SQQG 5AVYB 2O1JA 4ZKUA 1VF5B 1KILB 1KILD 5CJ0A 2WTYA 1LT9B 1M1JA 1PIXA 2K3RA 2H43A 3R4YA 2A45H 4BXLA 5KKZB 1S3JA 2ZYDA 5AW6B 1SQBD 1Y47A 3U59A 3M91A 1NU1J 2UWJE 5H2FE 1VQNP 1CSBA 3P8MC 2KOGA 3GHGC 4I1LA 1VF5C 4OGQB 1FC2C 3L75J 3BCCE 1FDOA 3GF3A 3M0DC 5GTHE 3WU2E 2QEXP 3CMEP 1Q82Q 1PPJG 1Q90D 1SQQD 2N1TB 4LC1A 4U3FG 3CMAP 1GD2E 4JYCA 4GT1A 5CCGC 1FZAA 1SQXJ 1G1IA 3CCVP 1LTAC 2QJYB 2WPSA 3H1KE 3RK3C 1IZNB 1P84D 2IBZI 2IZ0A 1VDFA 1Z56A 1NTZE 2WQYC 3L70G 3T97B 4TT3H 1N8RQ 1AQ5A 1AFOA 3AEEC 1ZMEC 3H1HG 2QE7H 2BCCE 1HF9A 1GL2B 2KS1A 1KYOH 2E75D 3VN0A 1AQTA 1M90Q 3AE3C 1JB0J 4L74A 3LIDA 2HYNA 4R4LA 5DJTB 3G9RA 4WB4A 1L0LG 1D7MA 4Y28J 2LXBA 2OYHB 1BCCD 2AXCA 2JP3A 2Q3EA 3PH0A 3BATA 1L0LD 5APTA 4CPGA 5BU5A 1XTCC 5KJ7D 2IZ1A 2R5BA 1MV8A 3QH9A 4IOIH 4MN4C 1JNMA 2JWAA 2WVRA 3S4RA 4PV1D 1URQD 1CW5A 1EDLA 2M5AB 3JCUE 1SQPJ 3H1LG 1KFMA 1L0ND 3A0HH 2FYUK 1LTSC 2H8PD 1HGVA 3PJSK 2IBZG 2OGUA 1IJDB 2SPZA 3L75D 1QX8A 1S1CX 3Q2YA 1N73C 1FOSE 1GU4A 1KTMA 2YKPA 2AXTH 3F5HA 3B4SA 3HD7A 3IAOA 2WMMA 3CC7P 1SQVJ 1OVVA 2IFNA 1KZUB 3C8VA 1N7SA 2A06D 1SQBJ 1LT9C 1M57D 2FXPA 1N7SC 1JMBA 1UIIA 2RKLA 4H13B 1HBWA 1FAVA 3O6QB 1PFIA 1FJKA 3EFFK 3KDPB 1N2DC 3QWOC 1YBKA 5AVVB 3H1IE 1OIPA 2DW3A 2B87B 3HTKA 1JM0A 2Q7CA 1L4AA 4XFJA 5KLVG 1NAYA 1NU1D 1KFNA 2HLOA 5KLVE 1EDJA 4N3YB 1L0NK 1M56D 1KB9D 1OVUA 3CLQA 5AW2B 3S1KA 4Z1MH 1T2KC 1FJPA 2WSEH 2R44A 2P58A 1MFTA 2V7QH 3R2PA 3P7KA 1OZHA 4PJ0E 3L74E 5KTBA 4GOEA 3LIEA 2N1TC 3H1HE 3IN6A 3PP5A 1DEEG 1PL5A 4IFMA 2FFDC 2C9LY 5APXA 3G71P 1AJYA 5GTHH 2XNDH 3H1JG 1NTME 1SLQA 2IX7C 1G2CA 2W27A 3G3ZA 2J59M 3N4XA 3PTZA 4JBZA 4EDFA 4PV1C 1YITP 3RK2D 3VTPC 1W2BO 1AA0A 1JY3O 2KNCB 1RQVA 2QJKC 2N1TD 1FZGA 1T8ZA 2KUBA 1L0LE 2PFXA 2YKOA 4DCKA 3II6A 4KJMA 5APUA 2KSJA 2L5GB 1DD3A 2W6AA 1JMMA 2KYVA 4YTPC 2XKMA 2D2CC 3I56P 3F89A 1Q2NA 2HPCB
chains in the Genus database with same CATH topology
2N9BA 3VP8A 1OXZA 4WY4C 1MFZA 3OJAB 3VYIA 2YMYA 1RF0A 1N86A 1HWTC 1GTWA 3TSIA 2GM4A 1GZLA 3H6PA 1W2EA 3OA7A 3RK2B 2OYIA 4HYTB 2A45G 2CPSA 2OYIC 4EIJA 4C46A 1J1DC 3VP9A 1GW3A 1URQB 3MD0A 3N7NA 5KJ7C 3HD7B 1NWQA 1FDMA 1JY3P 2WITA 2WWWA 3V2RA 1JY3N 2J58A 5CJ4A 3VMXA 1LWUC 1JCCA 2OYHC 1LWUA 3MGNA 4WY4D 3U1CA 3HE4A 2Q5UA 2IFMA 2Z5HA 1URQA 4W7ZA 1NTKK 3VMYA 2YO3A 3MTUE 5APWA 1KQLA 5AVTB 3M9BA 3P8CE 3HUSC 3NXSA 2PP6A 3O8ZA 1FZCA 1GDTA 3GHGA 3EQ2A 2YKQA 3RK2C 1NU1K 1WT6A 3V2NA 1CI6B 3T97A 2Q9IA 3VOPA 3HE4B 3RK3B 1LTTC 2MJZA 1OWAA 2JJLA 3V2QA 4KHXA 4AYCA 1IFDA 4IFFA 2LKMA 3V4QA 2C0XA 3C9IA 2C0WA 1GL2D 2FYZA 4GIFA 5APVA 1HJBA 4AQRD 2C9NY 3B5NC 2P1JA 1X8YA 1FU1A 1N7LA 3HUSB 1SFCA 2XNXA 4C7RA 4LGDE 1L4AB 4W7YA 1NTZK 1FOSF 4EOTA 4XA4A 4XE5B 1RF0C 4B86A 2BASA 2POHA 3H32B 2WSCH 2ZFCA 1N73B 2M3BA 1NOHA 2I1JA 3KPEA 5AW0B 3RL0B 5AW8B 5APSA 3OAKA 1JTHA 1LTJA 4Y99C 5APQA 3IR9A 1NH4A 1HBWA 3NFQA 2R32A 1IFNA 3TK1A 3BVHA 1J1EC 3CI9A 2WZ7A 1H89A 1LGHB 3MIWA 2W6BA 3RK3D 3SWFA 1LTBC 2I1KA 1NAFA 5KLVK 5AVQB 2FFDA 1JY2P 2GUSA 5CCGD 3NMDA 1FZCB 1CZQA 1SFCB 4AUWA 1G2CB 2P2UA 1ZR2A 1HH0A 1MUUA 1H88A 2P7JA 2NPSB 3B5ND 5AVRB 2FFDB 1RF1C 3BRVB 5CCGA 1RF1A 2NPSA 1JOCA 4WY4B 3HTKB 4I6MC 1NTMK 1DEBA 2XV5A 3HD7D 2WT7B 1FZBA 1IO4A 3A5TA 2WPRA 2R5DA 3L35A 5AW3B 1JY2O 1S9KD 3B5NA 1IK9A 1J1DB 4JF7A 3E1IA 1VPCA 1YTZT 3IFMA 5BU8B 4W80A 4GKGA 1RF1B 1J1EB 1NHLA 3HE5B 1RY3A 2M8RA 1N73A 2H7HA 2CPBA 2KB7P 2XDJA 3HUSA 1FZCC 4HH2A 3H32A 1YYCA 3M9HA 1GU5A 1ZN5A 4C7NB 1RE3A 1IFJA 4LLHA 1ZV8A 3A7OA 1LWUB 3BASA 3L36A 1SQVK 3HE5A 2P67A 5AW7B 1SQPK 1M7LA 1FZEA 3LW5H 1G1JA 4ZKPA 3KQGA 1JY2N 1JUNA 1HVVA 1GW4A 3U1AA 1CI6A 2WPQA 1NKZB 1DX7A 3GHGB 1T3JA 1KILC 3L37A 1KILA 1SFCC 3V5BA 3L4FA 3NTNA 1YTZI 2E42A 1GK6A 2ZXEB 4N78D 3M0DA 2WSFH 3V2PA 1FZFA 4WBAA 5BVZA 5AW5B 1XTGB 2QM8A 4WY4A 1E5WA 1JCDA 2NPSC 5CCHD 5AVUB 3B5NB 1X79B 5APYA 3RL0C 3M9QA 1SP4A 1L0LK 5AVXB 1T2KD 2YNYA 4I2LC 2O1KA 5KJ7A 1GL2C 3TNUA 1IFIA 1HTLC 4O9BA 4N6JA 2A45I 1DH3A 2XU6A 1M1JB 2GUVA 2HG5D 2QM7A 2HFED 2PAJA 5CCHA 5CCHC 1IFMA 3TNUB 2IPPA 1M1JC 1URQC 3P8CD 1JTHB 1LTJB 3HD7C 1SQQK 4RESB 4Y99B 2OYIB 1SFCD 1LT9A 3A2AA 1RE3C 1S9KE 1T3UA 1ZLLA 1NO4A 2VRSA 4OH8B 5CMZA 5AW9B 2Q3IA 2O01H 2Z4EA 5AW4B 3V4WA 1RE4A 4M3LA 1RE4C 2XZRA 1ZR4A 2N1TA 3VMZA 3UIAA 5AVWB 3EFGA 3M0AA 2KLVA 2E43A 4DOJA 1JO5A 2HODB 2OARA 1LTGC 3MUDA 1J2JB 3A3YB 2HODA 1QL1A 1MZ9A 3I5CA 3HRNA 5AVZB 3SWYA 1EQ7A 2FXMA 1WRGA 1HUCA 1X9VA 1SVFA 4DZOA 1IC2A 5AVSB 4JYBA 3TYYA 4C7NA 3P32A 1GK4A 3WMM0 3BRTB 1N7SD 1N7SB 5CHXA 1SQXK 3RL0D 4IFDK 1QL2A 2R3CA 1NKNA 1LTJC 1L4AD 2JEEA 3M06A 2NPSD 1GL2A 3KYQA 1L4AC 2YO2A 2KP8A 1H8AA 1A02F 1HGZA 3CL3D 2Z5IA 4N78E 3B8EB 1FBMA 2HPCA 1SQBK 5AW1B 2OYHA 2FKWB 1A02J 1LTIC 5AVYB 2O1JA 4ZKUA 1KILB 1KILD 5CJ0A 2WTYA 1LT9B 1M1JA 2H43A 2A45H 5AW6B 3U59A 3M91A 1CSBA 3P8MC 2KOGA 3GHGC 4I1LA 3M0DC 4LC1A 2N1TB 1GD2E 4JYCA 4GT1A 5CCGC 1FZAA 1G1IA 1LTAC 2WPSA 3RK3C 1VDFA 1Z56A 1AFOA 1AQ5A 1GL2B 3VN0A 3LIDA 2HYNA 4WB4A 2OYHB 3BATA 5APTA 5BU5A 1XTCC 5KJ7D 2R5BA 1MV8A 1JNMA 1URQD 1CW5A 1KFMA 2FYUK 1LTSC 2H8PD 1HGVA 1IJDB 1FOSE 1N73C 1GU4A 2YKPA 3HD7A 2IFNA 1KZUB 1N7SA 1LT9C 1N7SC 1FAVA 1PFIA 1FJKA 3KDPB 1N2DC 5AVVB 3HTKA 2Q7CA 1L4AA 2HLOA 1KFNA 4N3YB 1L0NK 5AW2B 1T2KC 3CLQA 1FJPA 2WSEH 5KTBA 3R2PA 3P7KA 3LIEA 2N1TC 3PP5A 4IFMA 2FFDC 2C9LY 5APXA 1SLQA 2IX7C 1G2CA 2W27A 3G3ZA 2J59M 3N4XA 3RK2D 3VTPC 1JY3O 2N1TD 1FZGA 1T8ZA 2YKOA 3II6A 5APUA 2KSJA 2L5GB 2W6AA 1JMMA 2KYVA 2XKMA 2WT7A 2HPCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQV K;  1L0N K;  3CLQ A;  1SQP K;  2WSE H;  3LW5 H;  1NTZ K;  1SQB K;  5KLV K;  1NTM K;  2FYU K;  2LKM A;  2WSC H;  1NTK K;  3G3Z A;  3M9Q A;  2J59 M;  1L0L K;  1SQQ K;  1SQX K;  2OAR A;  4IFD K;  1NU1 K;  2WSF H;  2O01 H; 
#chains in the Genus database with same CATH topology
 2N9B A;  3VP8 A;  2M3E A;  3RL0 g;  1OXZ A;  3WUT A;  4WY4 C;  1MFZ A;  3L72 G;  1L0L J;  3OJA B;  3ITK A;  3VYI A;  2FYU D;  2YMY A;  1VQ7 P;  1RF0 A;  1N86 A;  4PD4 D;  1HWT C;  3CWB J;  3H1K G;  1GTW A;  3TSI A;  3CCS P;  2ZJS E;  4D6T J;  2GM4 A;  1GZL A;  3H6P A;  4OVN F;  1W2E A;  3OA7 A;  1NTZ G;  3L70 E;  2BCC G;  3FWN A;  3IF4 A;  3RK2 B;  4HYT B;  2QJP C;  2A45 G;  2CPS A;  2OYI A;  2OYI C;  4EIJ A;  4IL6 X;  2KZJ A;  4C46 A;  1J1D C;  3VP9 A;  2FY8 A;  1GW3 A;  2Y0C A;  5B5E E;  1URQ B;  2V7Q J;  3MD0 A;  4PJ0 H;  4NPF X;  3N7N A;  1ZP0 C;  5B66 H;  3HD7 B;  5KJ7 C;  1NWQ A;  1SQX G;  2KI7 B;  3Q3D A;  1FDM A;  5KAF H;  2ZYG A;  1OVR A;  1BGY D;  1JY3 P;  2WIT A;  1KD1 Q;  2WWW A;  3V2R A;  1JY3 N;  1SQX D;  2J58 A;  5CJ4 A;  3CCR P;  3VMX A;  3CCL P;  1LWU C;  1JCC A;  1KYO I;  2AEF A;  2OYH C;  1LWU A;  1BE3 D;  3KXD A;  4UB6 E;  3MGN A;  1USE A;  3EWK A;  4WY4 D;  1PZQ A;  2K9Y A;  3HE4 A;  3U1C A;  2Q5U A;  2IFM A;  2Z5H A;  1BCC J;  2JR8 A;  1URQ A;  3TDK A;  1P84 E;  3D71 A;  4W7Z A;  1OX3 A;  1NTK K;  4BRY B;  5KLI B;  3VMY A;  2YO3 A;  1LNQ A;  3MTU E;  4H13 C;  5APW A;  1HJ0 A;  1KQL A;  5AVT B;  3JSV C;  3M9B A;  3P8C E;  4EYY Q;  1DIP A;  3CXH E;  3HUS C;  2CK3 H;  2PP6 A;  3NXS A;  3O8Z A;  1U7M A;  1FE6 A;  3GHG A;  1FZC A;  1GDT A;  1EZV D;  3EQ2 A;  4GOF A;  4RKU J;  2YKQ A;  1SQP G;  3RK2 C;  1NU1 K;  1WT6 A;  2QJY C;  1OW7 A;  1VQK P;  3VMA A;  1AV1 A;  3RGU A;  2Q1K A;  3V2N A;  4PD4 E;  1CI6 B;  3T97 A;  2Q9I A;  3VOP A;  3HE4 B;  3AE4 C;  3RK3 B;  2PRR A;  3GMA A;  1LTT C;  1ZOY C;  2MJZ A;  3WUV A;  1OWA A;  2OYO A;  2QVA A;  2JJL A;  3V2Q A;  1USD A;  4QMA A;  4KHX A;  1EDK A;  4AYC A;  4ZNC A;  1NVO A;  1IFD A;  1KB9 H;  1X22 A;  1NTK G;  3L74 G;  4IFF A;  4NPD A;  3RBZ A;  3TF5 A;  2LKM A;  1K9M Q;  1BSH A;  3V4Q A;  2C0X A;  3C9I A;  2C0W A;  2FYN C;  2YMK A;  1GL2 D;  2FYZ A;  1EXI A;  4H0L D;  4GIF A;  5APV A;  1HJB A;  1YJN P;  4AQR D;  2C9N Y;  1W5C E;  3AEG C;  3O6Q A;  1NTK J;  2MKV A;  2P1J A;  2YIU C;  1X8Y A;  1PP9 D;  1FU1 A;  1N7L A;  1SQX E;  1RQU A;  2I8D A;  2K37 A;  1PPJ D;  3HUS B;  3AE6 C;  3H1L J;  3MUD C;  4R4M A;  4U3F D;  1SFC A;  3SSU A;  1Q86 Q;  2XNX A;  1NTM J;  1BE3 E;  4H0L B;  4C7R A;  1VQ9 P;  1QVF O;  3AE2 C;  1KV4 A;  1S5L X;  3H1I D;  4A7P A;  3KZI E;  1NYH A;  5KLV D;  2OTK E;  4LGD E;  1L4A B;  4W7Y A;  3CCE P;  1KB9 E;  1NTZ K;  2E75 B;  2W6J H;  1WMK A;  5H2F H;  4IL6 H;  3SWK A;  4EOT A;  1FOS F;  1VQ5 P;  4BWN A;  4XA4 A;  4XE5 B;  2ZVO B;  1RF0 C;  4B86 A;  1VQL P;  1P84 I;  2ZVN B;  2BAS A;  2POH A;  5KAF E;  3AE5 C;  1ZRT D;  3H32 B;  2A06 G;  2WSC H;  5GTI H;  1IFP A;  3JC2 2;  2ZFC A;  3SFE C;  4PD4 H;  2G8Y A;  5CBO A;  2W8Z A;  1N73 B;  1QGK B;  2RMZ A;  3AEA C;  2M3B A;  1NOH A;  2G3A A;  2I1J A;  2ZT9 D;  3GW6 A;  3H1J J;  3KPE A;  5AW0 B;  5AW8 B;  3RL0 B;  2YIU B;  5APS A;  5GTI E;  3CWB E;  3OAK A;  1KN7 A;  1JTH A;  1LTJ A;  4Y99 C;  1R5L A;  1KYO D;  2KS1 B;  3IR9 A;  5E79 H;  1NH4 A;  5APQ A;  3H25 A;  5TJH A;  3NFQ A;  2R32 A;  1IFN A;  1K05 A;  3TK1 A;  1J1E C;  3BVH A;  3FWL A;  3CI9 A;  2WZ7 A;  2ZT9 C;  2JO1 A;  2IYP A;  3CPW O;  1LGH B;  3AE8 C;  1H89 A;  3MIW A;  2W6B A;  3RK3 D;  3SWF A;  1LTB C;  2I1K A;  1NAF A;  1PV3 A;  2FBW C;  5KLV K;  2KXP B;  5AVQ B;  5K5G B;  3CX5 H;  2FFD A;  1JY2 P;  1SQV G;  2GUS A;  1KOR A;  4UB6 H;  5CCG D;  3NMD A;  1FZC B;  3AEF C;  1CZQ A;  2O01 J;  1YJ9 P;  3A0B H;  3AE1 C;  1SFC B;  3B71 A;  4AUW A;  1G2C B;  1NTK D;  2P2U A;  3Q1M A;  1ZR2 A;  1KC8 Q;  1HH0 A;  1MUU A;  3BCC D;  4PD4 I;  1SQQ J;  1U7J A;  1RH5 B;  1AVO A;  3ABV C;  1H88 A;  2P7J A;  3Q5S A;  1SQP E;  3KZI H;  4K35 A;  1K8A Q;  2NPS B;  2GA1 A;  3CCU P;  1PP9 J;  2AXT E;  3B5N D;  1BGY E;  5C39 A;  5AVR B;  2FFD B;  3MZW B;  2ZT9 B;  1RF1 C;  3BRV B;  4H0L C;  4H44 D;  5CCG A;  1RF1 A;  2NPS A;  1JOC A;  4YXD C;  1Q81 Q;  2FXO A;  3HTK B;  4WY4 B;  4I6M C;  3AE9 C;  1NTM K;  1DEB A;  2E74 D;  2XV5 A;  2K9J B;  5TIS E;  3HD7 D;  3A0B E;  2B88 A;  1FZB A;  2WT7 B;  2QJK B;  2LXC B;  3CX5 I;  2WPR A;  2P10 A;  4L73 A;  3A5T A;  2QG4 A;  1IO4 A;  3CXH I;  1Y8A A;  4L75 A;  2R5D A;  2FYU J;  3L35 A;  5AW3 B;  2BEZ F;  1JY2 O;  2J5U A;  1QLE D;  1S9K D;  1LT1 A;  3B5N A;  3H1H J;  1IK9 A;  3FX0 A;  1OMI A;  1J1D B;  4JF7 A;  1YJW P;  2HR3 A;  3L72 J;  3L71 G;  4BRY A;  3E1I A;  1KB9 I;  1VPC A;  1NJI Q;  3K5B A;  2ZAE B;  1YTZ T;  2NZ2 A;  1UIX A;  2BCC J;  2K9J A;  1BCC E;  3AED C;  3IFM A;  3L71 D;  3PRJ A;  2YXQ B;  5BU8 B;  2OTL P;  4D6T G;  3PLN A;  1L0N G;  4W80 A;  4GKG A;  1K73 Q;  1L0N E;  5TIS H;  1J1E B;  3S9O A;  1NHL A;  1VL2 A;  3ZDM A;  1EC5 A;  1YIJ P;  1RF1 B;  1FZF A;  3B5N C;  3L72 E;  4K3A A;  3L75 E;  3W67 A;  3G6E P;  1M8O B;  3HE5 B;  3RBX A;  2E76 D;  1LP1 B;  2E76 B;  5B66 E;  1RY3 A;  2O01 N;  3TGU J;  1BE3 J;  1QEX A;  2M8R A;  2A06 E;  2ZXX A;  2WSC J;  1N73 A;  2H7H A;  1OW6 A;  1MKM A;  2CPB A;  2KB7 P;  2RH0 A;  2XDJ A;  2H89 C;  3HUS A;  4HJG H;  1FZC C;  2E5Y A;  4HH2 A;  1KMI Z;  1YYC A;  3H32 A;  1KIL E;  1ZN5 A;  3M9H A;  3FXE A;  1BGY J;  4ASW A;  1RE3 A;  4C7N B;  1GU5 A;  4KT0 J;  1IFJ A;  4LLH A;  3MHV A;  1ZV8 A;  3A7O A;  1PPJ E;  4U3F E;  1EZV I;  4WVZ A;  1LWU B;  3BAS A;  1SQB G;  1VQP P;  2QRX A;  2WSS H;  5M1B A;  4ASV A;  1SQB E;  3L36 A;  2W90 A;  1SQV K;  1FS0 E;  3HE5 A;  3L70 J;  2KIK A;  1IK7 A;  2P67 A;  5AW7 B;  1SQP K;  1NU1 E;  1M7L A;  4EI2 A;  1FZE A;  2JWD A;  3KHU A;  1NU1 G;  1G1J A;  3LW5 H;  3H1I J;  2QA4 P;  1U57 A;  4ZKP A;  3KQG A;  1JY2 N;  1T6A A;  3A0H E;  3W68 A;  2KZI A;  3JCU H;  5B5E H;  1JUN A;  1HVV A;  1NTM D;  1GW4 A;  3AEB C;  3U1A A;  3CXH D;  1SQQ E;  3D6Y A;  2OTJ P;  1CI6 A;  1ZW0 A;  2WPQ A;  1RHZ B;  2K1A A;  4WWI A;  1Q7Y Q;  1NKZ B;  1ZRT E;  1SQV D;  3CX5 D;  3H1J D;  4L76 A;  5L8R J;  1DX7 A;  3GHG B;  1T3J A;  1TU3 F;  1KIL C;  3L37 A;  3L71 E;  1KIL A;  1YI2 P;  1BSN A;  1SFC C;  3AEC C;  2BCC D;  2LR2 A;  3L4F A;  3NTN A;  3V5B A;  2O3J A;  5KKZ C;  1YTZ I;  2BEQ D;  5KLV J;  1L0N J;  2E42 A;  2ZYA A;  1GK6 A;  2QIW A;  2ZXE B;  4N78 D;  3M0D A;  2WSF H;  4OGQ D;  3L72 D;  4UB8 E;  4WBA A;  3SFD C;  1DD4 A;  1KYO E;  3V2P A;  5BVZ A;  1EZV G;  4YXW H;  3L73 J;  1BDD A;  3Q5P A;  2PGD A;  5AW5 B;  1XTG B;  2AEM A;  2L91 A;  2QM8 A;  2YXR B;  3L71 J;  4WY4 A;  5KAI E;  2B9B A;  1E5W A;  1E79 H;  1JCD A;  1LJ2 A;  2NPS C;  1PGO A;  1S4X A;  5CCH D;  4HKZ H;  2WSE J;  5AVU B;  2WT7 A;  3B5N B;  5E79 E;  2WPV B;  1X79 B;  3L73 E;  5APY A;  3RL0 C;  3M9Q A;  1P84 H;  1KQF B;  1SP4 A;  3V6I A;  4U3F J;  1Y9B A;  1OW8 A;  1L0L K;  2AEJ A;  2Y0E A;  5AVX B;  3CC4 P;  3L70 D;  3CWB G;  3L74 J;  4H13 D;  1L2P A;  1T2K D;  3USS A;  2YNY A;  3H1I G;  4I2L C;  1PGJ A;  2O1K A;  3FGA D;  1VQ6 P;  5KJ7 A;  1GL2 C;  3TNU A;  3Q5R A;  1IFI A;  1HTL C;  4O9B A;  4N6J A;  2A45 I;  1SS1 A;  2XU6 A;  1M1J B;  4TLF A;  2E75 C;  3OW2 O;  1DH3 A;  1EXJ A;  2GUV A;  1SQP D;  2HG5 D;  3FXD A;  5KAI H;  1VQ4 P;  2QM7 A;  4H44 B;  2H88 C;  2FYU G;  2HFE D;  2IYO A;  1BCC G;  2PAJ A;  3WUU A;  5CCH A;  5CBN A;  2E43 A;  5CCH C;  1IFM A;  1FDI A;  1R5S A;  2E74 B;  1SQV E;  3CX5 E;  3H1J E;  1X0T A;  3TNU B;  2KLU A;  2D2C B;  2IPP A;  3H1L E;  1M1J C;  2Y9Z A;  4D6T D;  1K04 A;  1URQ C;  3CWB D;  1KQG B;  2IBZ E;  3P8C D;  4OGQ C;  1JTH B;  1LTJ B;  3L74 D;  5EFW B;  2V4H A;  1SQQ K;  3HD7 C;  3H1H D;  3PHL A;  4RES B;  4Y99 B;  2OYI B;  1SFC D;  3D6Z A;  1LT9 A;  3GF7 A;  1S5L E;  2Y9Y A;  3A2A A;  1VQO P;  4PV1 B;  1RE3 C;  1S9K E;  3RK3 E;  1T3U A;  2M5A A;  4GDO A;  1R8E A;  2OQQ A;  1EZV E;  1ZLL A;  1NO4 A;  2VRS A;  4NPE A;  1YQ4 C;  2R3S A;  4OH8 B;  5CMZ A;  2RN0 A;  5AW9 B;  2Q3I A;  3TGU G;  2O01 H;  4UB8 H;  3CD6 P;  3TGU E;  2Z4E A;  1GMJ A;  2JKV A;  3L73 D;  1KQS O;  5AW4 B;  3V4W A;  1RE4 A;  4M3L A;  5DJU B;  1RE4 C;  2KK7 A;  3D70 A;  2Q6Q A;  2XZR A;  2NRG A;  1S72 P;  4IL6 E;  3L73 G;  1NTK E;  2N1T A;  1OFC X;  1ZR4 A;  3VMZ A;  2B87 A;  2KNC A;  3UIA A;  5AVW B;  1VQ8 P;  2N9Y B;  1PP9 G;  3EFG A;  3M0A A;  4I7Z C;  3BCC J;  1PP9 E;  2KLV A;  4OWF A;  1NTM G;  2W83 C;  4DOJ A;  2HOD B;  4ZMD A;  3CCQ P;  2OAR A;  3CXH H;  3H1K J;  1LTG C;  1JO5 A;  3MUD A;  4JQ0 D;  4RJT A;  1J2J B;  3A3Y B;  2HOD A;  1QL1 A;  1S2E A;  1EDI A;  2QJP B;  3E1R A;  1M1K Q;  1H0T A;  3E7K A;  1MZ9 A;  3I5C A;  2JDI H;  3C1L A;  1VF5 D;  2QSI A;  3HRN A;  1QVG O;  1BE3 G;  4HB1 A;  1ZXG A;  5AVZ B;  3CCM P;  4U7J A;  1LP1 A;  3BCC G;  3H1L D;  3SWY A;  1EQ7 A;  2E76 C;  4GOD A;  4D6T E;  2FXM A;  1WRG A;  1HUC A;  1X9V A;  1SVF A;  2IBZ D;  3L75 G;  1IC2 A;  4DZO A;  5AVS B;  1BGY G;  4JYB A;  1BDC A;  3MP7 B;  1H0T B;  1VQM P;  4DJG A;  2KSE A;  3TYY A;  2D2C D;  1AVY A;  3AE7 C;  3GG2 A;  4C7N A;  3P32 A;  1GK4 A;  1PGP A;  3LW5 J;  3BRT B;  3WMM 0;  1N7S D;  1N7S B;  2E5T A;  5CHX A;  3GLM A;  4YPC A;  3I55 P;  1YHQ P;  3H1K D;  2FYN B;  1SQX K;  3RL0 D;  4I7Z B;  1PGQ A;  4IFD K;  1NTZ D;  1QL2 A;  5KLI C;  3TGU D;  4RO0 A;  2R3C A;  3G4S P;  1NKN A;  1LTJ C;  1L4A D;  2JEE A;  2M0B A;  3M06 A;  1S5L H;  2NPS D;  1GL2 A;  3KYQ A;  1L4A C;  1YQ3 C;  2B89 A;  2K88 A;  2KP8 A;  2WSF J;  2YO2 A;  1JEK A;  1H8A A;  1A02 F;  4JPZ B;  1HGZ A;  1NTZ J;  2ITA A;  2Y0D A;  2Z5I A;  3CL3 D;  4N78 E;  4DT0 A;  3B8E B;  2E74 C;  1FBM A;  2FYU E;  2HPC A;  3CCJ P;  2IDB A;  1SQB K;  5AW1 B;  2OYH A;  2FKW B;  4H44 C;  1LTI C;  3WU2 H;  1A02 J;  3CC2 P;  1NGM B;  1SQQ G;  5AVY B;  2O1J A;  4ZKU A;  1VF5 B;  1KIL B;  1KIL D;  5CJ0 A;  2WTY A;  1LT9 B;  1M1J A;  1PIX A;  2K3R A;  2H43 A;  3R4Y A;  2A45 H;  4BXL A;  5KKZ B;  1S3J A;  2ZYD A;  5AW6 B;  1SQB D;  1Y47 A;  3U59 A;  3M91 A;  1NU1 J;  2UWJ E;  5H2F E;  1VQN P;  1CSB A;  3P8M C;  2KOG A;  3GHG C;  4I1L A;  1VF5 C;  4OGQ B;  1FC2 C;  3L75 J;  3BCC E;  1FDO A;  3GF3 A;  3M0D C;  5GTH E;  3WU2 E;  2QEX P;  3CME P;  1Q82 Q;  1PPJ G;  1Q90 D;  1SQQ D;  2N1T B;  4LC1 A;  4U3F G;  3CMA P;  1GD2 E;  4JYC A;  4GT1 A;  5CCG C;  1FZA A;  1SQX J;  1G1I A;  3CCV P;  1LTA C;  2QJY B;  2WPS A;  3H1K E;  3RK3 C;  1IZN B;  1P84 D;  2IBZ I;  2IZ0 A;  1VDF A;  1Z56 A;  1NTZ E;  2WQY C;  3L70 G;  3T97 B;  4TT3 H;  1N8R Q;  1AQ5 A;  1AFO A;  3AEE C;  1ZME C;  3H1H G;  2QE7 H;  2BCC E;  1HF9 A;  1GL2 B;  2KS1 A;  1KYO H;  2E75 D;  3VN0 A;  1AQT A;  1M90 Q;  3AE3 C;  1JB0 J;  4L74 A;  3LID A;  2HYN A;  4R4L A;  5DJT B;  3G9R A;  4WB4 A;  1L0L G;  1D7M A;  4Y28 J;  2LXB A;  2OYH B;  1BCC D;  2AXC A;  2JP3 A;  2Q3E A;  3PH0 A;  3BAT A;  1L0L D;  5APT A;  4CPG A;  5BU5 A;  1XTC C;  5KJ7 D;  2IZ1 A;  2R5B A;  1MV8 A;  3QH9 A;  4IOI H;  4MN4 C;  1JNM A;  2JWA A;  2WVR A;  3S4R A;  4PV1 D;  1URQ D;  1CW5 A;  1EDL A;  2M5A B;  3JCU E;  1SQP J;  3H1L G;  1KFM A;  1L0N D;  3A0H H;  2FYU K;  1LTS C;  2H8P D;  1HGV A;  3PJS K;  2IBZ G;  2OGU A;  1IJD B;  2SPZ A;  3L75 D;  1QX8 A;  1S1C X;  3Q2Y A;  1N73 C;  1FOS E;  1GU4 A;  1KTM A;  2YKP A;  2AXT H;  3F5H A;  3B4S A;  3HD7 A;  3IAO A;  2WMM A;  3CC7 P;  1SQV J;  1OVV A;  2IFN A;  1KZU B;  3C8V A;  1N7S A;  2A06 D;  1SQB J;  1LT9 C;  1M57 D;  2FXP A;  1N7S C;  1JMB A;  1UII A;  2RKL A;  4H13 B;  1HBW A;  1FAV A;  3O6Q B;  1PFI A;  1FJK A;  3EFF K;  3KDP B;  1N2D C;  3QWO C;  1YBK A;  5AVV B;  3H1I E;  1OIP A;  2DW3 A;  2B87 B;  3HTK A;  1JM0 A;  2Q7C A;  1L4A A;  4XFJ A;  5KLV G;  1NAY A;  1NU1 D;  1KFN A;  2HLO A;  5KLV E;  1EDJ A;  4N3Y B;  1L0N K;  1M56 D;  1KB9 D;  1OVU A;  3CLQ A;  5AW2 B;  3S1K A;  4Z1M H;  1T2K C;  1FJP A;  2WSE H;  2R44 A;  2P58 A;  1MFT A;  2V7Q H;  3R2P A;  3P7K A;  1OZH A;  4PJ0 E;  3L74 E;  5KTB A;  4GOE A;  3LIE A;  2N1T C;  3H1H E;  3IN6 A;  3PP5 A;  1DEE G;  1PL5 A;  4IFM A;  2FFD C;  2C9L Y;  5APX A;  3G71 P;  1AJY A;  5GTH H;  2XND H;  3H1J G;  1NTM E;  1SLQ A;  2IX7 C;  1G2C A;  2W27 A;  3G3Z A;  2J59 M;  3N4X A;  3PTZ A;  4JBZ A;  4EDF A;  4PV1 C;  1YIT P;  3RK2 D;  3VTP C;  1W2B O;  1AA0 A;  1JY3 O;  2KNC B;  1RQV A;  2QJK C;  2N1T D;  1FZG A;  1T8Z A;  2KUB A;  1L0L E;  2PFX A;  2YKO A;  4DCK A;  3II6 A;  4KJM A;  5APU A;  2KSJ A;  2L5G B;  1DD3 A;  2W6A A;  1JMM A;  2KYV A;  4YTP C;  2XKM A;  2D2C C;  3I56 P;  3F89 A;  1Q2N A;  2HPC B; 
#chains in the Genus database with same CATH homology
 2N9B A;  3VP8 A;  1OXZ A;  4WY4 C;  1MFZ A;  3OJA B;  3VYI A;  2YMY A;  1RF0 A;  1N86 A;  1HWT C;  1GTW A;  3TSI A;  2GM4 A;  1GZL A;  3H6P A;  1W2E A;  3OA7 A;  3RK2 B;  2OYI A;  4HYT B;  2A45 G;  2CPS A;  2OYI C;  4EIJ A;  4C46 A;  1J1D C;  3VP9 A;  1GW3 A;  1URQ B;  3MD0 A;  3N7N A;  5KJ7 C;  3HD7 B;  1NWQ A;  1FDM A;  1JY3 P;  2WIT A;  2WWW A;  3V2R A;  1JY3 N;  2J58 A;  5CJ4 A;  3VMX A;  1LWU C;  1JCC A;  2OYH C;  1LWU A;  3MGN A;  4WY4 D;  3U1C A;  3HE4 A;  2Q5U A;  2IFM A;  2Z5H A;  1URQ A;  4W7Z A;  1NTK K;  3VMY A;  2YO3 A;  3MTU E;  5APW A;  1KQL A;  5AVT B;  3M9B A;  3P8C E;  3HUS C;  3NXS A;  2PP6 A;  3O8Z A;  1FZC A;  1GDT A;  3GHG A;  3EQ2 A;  2YKQ A;  3RK2 C;  1NU1 K;  1WT6 A;  3V2N A;  1CI6 B;  3T97 A;  2Q9I A;  3VOP A;  3HE4 B;  3RK3 B;  1LTT C;  2MJZ A;  1OWA A;  2JJL A;  3V2Q A;  4KHX A;  4AYC A;  1IFD A;  4IFF A;  2LKM A;  3V4Q A;  2C0X A;  3C9I A;  2C0W A;  1GL2 D;  2FYZ A;  4GIF A;  5APV A;  1HJB A;  4AQR D;  2C9N Y;  3B5N C;  2P1J A;  1X8Y A;  1FU1 A;  1N7L A;  3HUS B;  1SFC A;  2XNX A;  4C7R A;  4LGD E;  1L4A B;  4W7Y A;  1NTZ K;  1FOS F;  4EOT A;  4XA4 A;  4XE5 B;  1RF0 C;  4B86 A;  2BAS A;  2POH A;  3H32 B;  2WSC H;  2ZFC A;  1N73 B;  2M3B A;  1NOH A;  2I1J A;  3KPE A;  5AW0 B;  3RL0 B;  5AW8 B;  5APS A;  3OAK A;  1JTH A;  1LTJ A;  4Y99 C;  5APQ A;  3IR9 A;  1NH4 A;  1HBW A;  3NFQ A;  2R32 A;  1IFN A;  3TK1 A;  3BVH A;  1J1E C;  3CI9 A;  2WZ7 A;  1H89 A;  1LGH B;  3MIW A;  2W6B A;  3RK3 D;  3SWF A;  1LTB C;  2I1K A;  1NAF A;  5KLV K;  5AVQ B;  2FFD A;  1JY2 P;  2GUS A;  5CCG D;  3NMD A;  1FZC B;  1CZQ A;  1SFC B;  4AUW A;  1G2C B;  2P2U A;  1ZR2 A;  1HH0 A;  1MUU A;  1H88 A;  2P7J A;  2NPS B;  3B5N D;  5AVR B;  2FFD B;  1RF1 C;  3BRV B;  5CCG A;  1RF1 A;  2NPS A;  1JOC A;  4WY4 B;  3HTK B;  4I6M C;  1NTM K;  1DEB A;  2XV5 A;  3HD7 D;  2WT7 B;  1FZB A;  1IO4 A;  3A5T A;  2WPR A;  2R5D A;  3L35 A;  5AW3 B;  1JY2 O;  1S9K D;  3B5N A;  1IK9 A;  1J1D B;  4JF7 A;  3E1I A;  1VPC A;  1YTZ T;  3IFM A;  5BU8 B;  4W80 A;  4GKG A;  1RF1 B;  1J1E B;  1NHL A;  3HE5 B;  1RY3 A;  2M8R A;  1N73 A;  2H7H A;  2CPB A;  2KB7 P;  2XDJ A;  3HUS A;  1FZC C;  4HH2 A;  3H32 A;  1YYC A;  3M9H A;  1GU5 A;  1ZN5 A;  4C7N B;  1RE3 A;  1IFJ A;  4LLH A;  1ZV8 A;  3A7O A;  1LWU B;  3BAS A;  3L36 A;  1SQV K;  3HE5 A;  2P67 A;  5AW7 B;  1SQP K;  1M7L A;  1FZE A;  3LW5 H;  1G1J A;  4ZKP A;  3KQG A;  1JY2 N;  1JUN A;  1HVV A;  1GW4 A;  3U1A A;  1CI6 A;  2WPQ A;  1NKZ B;  1DX7 A;  3GHG B;  1T3J A;  1KIL C;  3L37 A;  1KIL A;  1SFC C;  3V5B A;  3L4F A;  3NTN A;  1YTZ I;  2E42 A;  1GK6 A;  2ZXE B;  4N78 D;  3M0D A;  2WSF H;  3V2P A;  1FZF A;  4WBA A;  5BVZ A;  5AW5 B;  1XTG B;  2QM8 A;  4WY4 A;  1E5W A;  1JCD A;  2NPS C;  5CCH D;  5AVU B;  3B5N B;  1X79 B;  5APY A;  3RL0 C;  3M9Q A;  1SP4 A;  1L0L K;  5AVX B;  1T2K D;  2YNY A;  4I2L C;  2O1K A;  5KJ7 A;  1GL2 C;  3TNU A;  1IFI A;  1HTL C;  4O9B A;  4N6J A;  2A45 I;  1DH3 A;  2XU6 A;  1M1J B;  2GUV A;  2HG5 D;  2QM7 A;  2HFE D;  2PAJ A;  5CCH A;  5CCH C;  1IFM A;  3TNU B;  2IPP A;  1M1J C;  1URQ C;  3P8C D;  1JTH B;  1LTJ B;  3HD7 C;  1SQQ K;  4RES B;  4Y99 B;  2OYI B;  1SFC D;  1LT9 A;  3A2A A;  1RE3 C;  1S9K E;  1T3U A;  1ZLL A;  1NO4 A;  2VRS A;  4OH8 B;  5CMZ A;  5AW9 B;  2Q3I A;  2O01 H;  2Z4E A;  5AW4 B;  3V4W A;  1RE4 A;  4M3L A;  1RE4 C;  2XZR A;  1ZR4 A;  2N1T A;  3VMZ A;  3UIA A;  5AVW B;  3EFG A;  3M0A A;  2KLV A;  2E43 A;  4DOJ A;  1JO5 A;  2HOD B;  2OAR A;  1LTG C;  3MUD A;  1J2J B;  3A3Y B;  2HOD A;  1QL1 A;  1MZ9 A;  3I5C A;  3HRN A;  5AVZ B;  3SWY A;  1EQ7 A;  2FXM A;  1WRG A;  1HUC A;  1X9V A;  1SVF A;  4DZO A;  1IC2 A;  5AVS B;  4JYB A;  3TYY A;  4C7N A;  3P32 A;  1GK4 A;  3WMM 0;  3BRT B;  1N7S D;  1N7S B;  5CHX A;  1SQX K;  3RL0 D;  4IFD K;  1QL2 A;  2R3C A;  1NKN A;  1LTJ C;  1L4A D;  2JEE A;  3M06 A;  2NPS D;  1GL2 A;  3KYQ A;  1L4A C;  2YO2 A;  2KP8 A;  1H8A A;  1A02 F;  1HGZ A;  3CL3 D;  2Z5I A;  4N78 E;  3B8E B;  1FBM A;  2HPC A;  1SQB K;  5AW1 B;  2OYH A;  2FKW B;  1A02 J;  1LTI C;  5AVY B;  2O1J A;  4ZKU A;  1KIL B;  1KIL D;  5CJ0 A;  2WTY A;  1LT9 B;  1M1J A;  2H43 A;  2A45 H;  5AW6 B;  3U59 A;  3M91 A;  1CSB A;  3P8M C;  2KOG A;  3GHG C;  4I1L A;  3M0D C;  4LC1 A;  2N1T B;  1GD2 E;  4JYC A;  4GT1 A;  5CCG C;  1FZA A;  1G1I A;  1LTA C;  2WPS A;  3RK3 C;  1VDF A;  1Z56 A;  1AFO A;  1AQ5 A;  1GL2 B;  3VN0 A;  3LID A;  2HYN A;  4WB4 A;  2OYH B;  3BAT A;  5APT A;  5BU5 A;  1XTC C;  5KJ7 D;  2R5B A;  1MV8 A;  1JNM A;  1URQ D;  1CW5 A;  1KFM A;  2FYU K;  1LTS C;  2H8P D;  1HGV A;  1IJD B;  1FOS E;  1N73 C;  1GU4 A;  2YKP A;  3HD7 A;  2IFN A;  1KZU B;  1N7S A;  1LT9 C;  1N7S C;  1FAV A;  1PFI A;  1FJK A;  3KDP B;  1N2D C;  5AVV B;  3HTK A;  2Q7C A;  1L4A A;  2HLO A;  1KFN A;  4N3Y B;  1L0N K;  5AW2 B;  1T2K C;  3CLQ A;  1FJP A;  2WSE H;  5KTB A;  3R2P A;  3P7K A;  3LIE A;  2N1T C;  3PP5 A;  4IFM A;  2FFD C;  2C9L Y;  5APX A;  1SLQ A;  2IX7 C;  1G2C A;  2W27 A;  3G3Z A;  2J59 M;  3N4X A;  3RK2 D;  3VTP C;  1JY3 O;  2N1T D;  1FZG A;  1T8Z A;  2YKO A;  3II6 A;  5APU A;  2KSJ A;  2L5G B;  2W6A A;  1JMM A;  2KYV A;  2XKM A;  2WT7 A;  2HPC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...