2WSFH

Improved model of plant photosystem i
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
69
structure length
69
Chain Sequence
DLEDIANTTGQWDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSANAPQDVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords AT3G54890
publication title Structure determination and improved model of plant photosystem I.
pubmed doi rcsb
total genus 4
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03244 PSI_PsaH Photosystem I reaction centre subunit VI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wsfH01
2OARA 2WSEH 5KLVK 1SQXK 3CLQA 1L0LK 1SQBK 3LW5H 1NTKK 1L0NK 1NU1K 2J59M 2WSCH 1NTZK 1SQVK 4IFDK 1SQQK 1NTMK 2WSFH 2LKMA 3G3ZA 1SQPK 2O01H 3M9QA 2FYUK
chains in the Genus database with same CATH superfamily
1IC2A 1WMKA 2QVAA 3RBZA 3LW5J 2E75B 2Q5UA 1L0NK 2POHA 2YMYA 2NRGA 3PTZA 2QM7A 1JNMA 5KJ7C 4AQRD 3HD7B 4WY4A 1ZMEC 1LT9B 1S9KE 1MV8A 1KV4A 3NMDA 1AA0A 2J59M 3PJSK 1GW4A 2QJYC 3L74J 5CMZA 1ZRTE 3L70E 3CCVP 1OW7A 2R3CA 1KILB 5M1BA 1HJ0A 1Q86Q 1JOCA 4PD4D 2AEMA 1LWUB 1QL2A 3M0DA 2PP6A 5KAFE 3JC22 3A0HE 1SQBE 1M56D 3KXDA 1Y47A 5AW1B 3VMAA 3QWOC 4OGQD 4RKUJ 2OYIA 1OVVA 3CX5H 2O1KA 2I1KA 3L70J 4HH2A 2FFDB 1FZCC 2ZYDA 3G4SP 2GUSA 3FX0A 3Q2YA 3N7NA 2E75C 3PH0A 1KILE 2WPSA 3AE5C 1NO4A 1Z56A 5KLIC 2JKVA 2OTLP 3OW2O 4U3FE 1X22A 1SQBJ 3R2PA 3HD7C 2E5YA 1URQA 2E76B 5APUA 3WU2E 4EYYQ 1QVFO 2L91A 2MJZA 1QGKB 1LTJA 2YMKA 4HB1A 1URQB 2Y0EA 2WPVB 1NTMK 1QVGO 3OJAB 2QE7H 1KILC 3HE5B 2R3SA 3KZIE 1LTJB 1IFMA 3M9HA 4C7NA 1LTIC 3H1KD 3O6QA 1LWUC 3A2AA 4H13D 2FXMA 2WWWA 2XZRA 1YQ3C 2IBZE 4U3FJ 3GLMA 2AEJA 1RE4A 4H44D 2LR2A 1RH5B 3SWKA 2D2CD 3P32A 2FYNB 1NTMD 4GOEA 3W68A 4H0LB 3MGNA 4PV1B 4L73A 3GHGC 2BCCE 3CX5D 1GZLA 2IZ1A 1BCCD 3H1KG 3V2RA 4AUWA 1S5LE 1JMMA 2YO2A 1M1JB 1KQLA 2WTYA 4U7JA 1NTMG 1HGVA 1PPJD 1L4AD 3LIEA 1BCCG 1N86A 3P8MC 5CBOA 4QMAA 3H1HD 1YHQP 1W5CE 4YTPC 3H1IE 1AVYA 2RN0A 1Q90D 2BCCJ 5B66E 1JY3N 1PPJG 4RO0A 1YJ9P 2Q3EA 4B86A 2R5DA 1YYCA 1Q82Q 3JCUE 3H1HG 3O8ZA 2AXTE 3CI9A 2FYZA 4DOJA 4JF7A 5BU8B 3RL0B 2M3BA 3IAOA 4CPGA 1SQPK 1FU1A 3PHLA 4GKGA 1S4XA 1G1IA 3AE1C 3CCLP 1BSHA 1IFIA 1FBMA 4GT1A 1VQOP 1IZNB 1CZQA 3GG2A 4OGQB 3AEBC 3G3ZA 4L74A 3BVHA 5KTBA 3CWBJ 2IBZI 4MN4C 1MFTA 1OVRA 1ZRTD 4PD4E 1H0TB 1X79B 1AVOA 5AW5B 4OH8B 3TDKA 1LTSC 1ZN5A 2P7JA 2KK7A 2CK3H 1SQQK 2HFED 1OFCX 3V4QA 1L0NJ 4N3YB 2WMMA 4I2LC 1FOSE 3ITKA 2HODB 5K5GB 3TF5A 2KSEA 1J1DC 5E79H 5CCHA 1VQ9P 1J1EB 3SFEC 1XTCC 1NU1K 2HR3A 1IFDA 2WSCH 4KT0J 4H13B 1KFMA 5AVRB 1FC2C 3B5NA 4YXDC 4IFMA 1SQQD 4H44B 1LTGC 1RQVA 2HYNA 1EDIA 2D2CB 3L71D 1DX7A 4NPDA 5KLVK 3ABVC 2NZ2A 4GDOA 1LP1B 2SPZA 3D6YA 4U3FD 3G6EP 1SQVK 1NU1D 4EIJA 1ZV8A 2N1TD 3K5BA 1SQQG 1IK9A 5APVA 2WSEH 3L71G 2E43A 1CI6B 1L4AB 5APXA 1VQNP 1NTKK 4U3FG 3H1KE 1HWTC 3IF4A 1SQVD 3M91A 1NU1G 2OQQA 3HE4B 4W7YA 3AE7C 2YXRB 2WSFH 3Q5RA 4YXWH 2QJPB 3CD6P 1GU5A 1NTME 2WZ7A 1KYOH 1T3UA 3H1LJ 5KJ7A 1VQLP 3A3YB 1IO4A 3WUVA 3CX5E 2NPSA 4UB8H 1BCCE 3P8CD 2W27A 3Q3DA 1PIXA 1G1JA 1KD1Q 2IFMA 3MD0A 2IX7C 4I7ZC 1DD4A 1YI2P 5APQA 5B5EH 1J1EC 1M8OB 5KKZC 2W6BA 3L37A 1PPJE 4PD4I 2Q7CA 4H13C 3Q5SA 3H1KJ 3V2QA 3SFDC 2IZ0A 2OYOA 1SFCA 1GL2D 3H1HE 1RHZB 3VP9A 3VYIA 2K9JB 2Y9ZA 1NTMJ 2FYUK 2Z4EA 3L4FA 1EXIA 1KORA 1X9VA 4JPZB 5APYA 2QRXA 4IFFA 1HJBA 2WPRA 1BCCJ 1OIPA 1FS0E 2JR8A 2PGDA 2K88A 2HPCA 2CPBA 2YXQB 1T8ZA 3CXHH 4PJ0E 3WUUA 1KZUB 4M3LA 1L4AC 2FYUD 2WQYC 4OVNF 4NPFX 1FZCA 5AVTB 4N6JA 1G2CB 3VMXA 3MP7B 2QJPC 2KP8A 3CCRP 3H1HJ 5CJ4A 1M1KQ 2B89A 3CWBD 1JTHB 1PFIA 1SQXK 4A7PA 2A45G 2FYUG 1NAFA 2ZVNB 1YITP 3HD7A 1FZGA 2H88C 2RKLA 2R5BA 1LT9A 1GK6A 3A0BH 5KLIB 3CPWO 4IL6H 3AECC 1JUNA 1RF0A 3CWBG 1HH0A 3FXDA 1SQXD 5KAIH 2KZIA 1KILA 1TU3F 2K3RA 1Y9BA 4KHXA 2KLVA 1L0ND 3D71A 1ZLLA 3AE9C 2P1JA 1LWUA 1U57A 2JWDA 3VMZA 5H2FH 1N7LA 3VN0A 5AW0B 3F89A 1VQKP 3U59A 3CX5I 1P84H 1PZQA 3CXHD 2MKVA 1L0NG 3W67A 1QLED 4L75A 3V2PA 3L35A 2N1TB 3CCSP 3BATA 2B88A 1SQPJ 3GHGB 1YTZT 2FFDA 1K73Q 4O9BA 5AVVB 1NTZK 3I5CA 1HUCA 1VF5C 5DJTB 3NTNA 1RE3A 2H89C 1SQQE 2WVRA 3UIAA 3L71E 3B8EB 1GDTA 5APWA 3AEFC 3MUDC 1FZAA 1FJKA 1RF1C 1A02F 5TJHA 1NU1E 5AW3B 3Q1MA 2KUBA 3CL3D 4RESB 2Q3IA 3H1LD 5CCGA 1Y8AA 3HE5A 2V7QH 3T97B 1ZOYC 1KQGB 5KLVE 2XDJA 3TK1A 2QEXP 1EZVD 4HKZH 1DIPA 3RGUA 1SQVE 1SQQJ 1GL2B 3BRTB 1X8YA 3L71J 3TNUA 1FOSF 3H1LG 4WY4C 3LW5H 1DEBA 2E42A 4R4MA 4L76A 3ZDMA 1NH4A 2XKMA 1NU1J 2N1TC 3TNUB 1EZVG 3AE8C 3P8CE 3KHUA 4JYCA 3GF3A 5E79E 3OAKA 5AVZB 5L8RJ 3EFGA 1M1JA 5DJUB 1PGJA 5KLVJ 4ZNCA 5CCHD 1NJIQ 4YPCA 4DZOA 1PGPA 3R4YA 3BASA 1SQVJ 2M3EA 1R5LA 1LT1A 3GMAA 1QL1A 3SSUA 3AE3C 1FDMA 2BEQD 1U7JA 1NTKJ 1H88A 1LTBC 1VQ8P 3L75D 4Y99B 2M0BA 1KMIZ 2KOGA 2WSCJ 4GOFA 2N9BA 1AQ5A 1VDFA 2PAJA 3CCUP 2FYUE 2AXCA 3SWYA 2Q9IA 4EI2A 2E5TA 1NVOA 2KS1B 2QA4P 5APSA 3C9IA 2FXPA 4I6MC 2Q1KA 3RK3D 2O01H 1GL2C 1VQ4P 4HYTB 3L75G 2P2UA 2G8YA 4ZKPA 1JY2O 1USDA 1KB9H 1ZW0A 3CWBE 1FE6A 1J1DB 4UB8E 4W7ZA 3PLNA 1FZBA 1H8AA 3H6PA 1NWQA 2WSEJ 1VQMP 1IFPA 5TISH 5B5EE 3MIWA 3JSVC 1BGYD 4JQ0D 2FYUJ 2WSFJ 2J58A 1SQXE 2YKPA 4BXLA 1IK7A 3H32B 2B87B 4ZMDA 1DEEG 1L0NE 4TT3H 2DW3A 1RE4C 1SQPD 1H0TA 2KSJA 2WT7B 1BGYG 2RH0A 2W83C 3CMAP 1VF5D 1MUUA 1JY2P 3VTPC 1R8EA 3CXHE 2IDBA 4Y99C 3TGUD 4XE5B 3D70A 3NXSA 3WU2H 1AJYA 1SQPG 2ZYAA 1GD2E 2HODA 1GMJA 1SQXJ 3VP8A 1MFZA 1NAYA 1LNQA 3CCEP 1WT6A 4TLFA 1T2KD 3PRJA 1KB9D 5AW9B 3VOPA 1FJPA 3KZIH 3P7KA 3V2NA 3TGUG 4I7ZB 1N7SD 1EDKA 2QM8A 2V4HA 1FZFA 2C9LY 3AEEC 5KKZB 1OXZA 4EDFA 2UWJE 3A0BE 1LP1A 4IL6E 3M9BA 2HLOA 2L5GB 4LGDE 2A45I 5KAIE 1UIIA 1YJNP 2H7HA 4NPEA 4W80A 3KYQA 1GTWA 4WY4D 1H89A 3H1LE 4K35A 1CI6A 2OTJP 1L4AA 2ZAEB 5H2FE 1EZVE 1T3JA 3KPEA 2ZT9C 3HE4A 1QEXA 1S72P 1BDCA 3WUTA 5BVZA 5KLVD 1IFJA 3L73D 1BSNA 2LXBA 1OVUA 1NHLA 1SP4A 2P10A 1GU4A 1NTZJ 2W8ZA 2PRRA 4BRYB 3C1LA 1VQ7P 2XV5A 5KLVG 3FGAD 1OX3A 1NTKD 1M57D 3AE6C 2FKWB 1NOHA 2LKMA 3JCUH 1SQVG 2PFXA 2BEZF 2M5AB 2AXTH 5AVYB 1IJDB 1PP9D 3CCQP 2QJKB 1PGOA 2K9JA 5AW4B 1VL2A 3CXHI 2R32A 2N9YB 1NTKG 2W6JH 2E76D 2HG5D 3M0AA 2RMZA 1D7MA 1KC8Q 1RQUA 4WVZA 1PP9G 2AEFA 2Z5IA 3L75E 1N8RQ 1URQD 1E79H 1LTTC 4LLHA 2QG4A 5CCHC 1N2DC 2G3AA 4I1LA 1HVVA 2YKOA 1KN7A 1IFNA 3AEGC 1XTGB 3B5NC 1G2CA 3E1IA 3RK3E 2OYHB 2K37A 1ZR2A 1JTHA 4H0LD 1VF5B 4PD4H 4JYBA 1KTMA 1KYOD 1N73B 1SLQA 2JDIH 3MUDA 2V7QJ 3L72E 3L75J 1RF1A 4DJGA 1BGYE 2R44A 1JY3O 1JB0J 1EZVI 4XFJA 3VMYA 3USSA 4WB4A 2Y9YA 2FY8A 1AV1A 3RK3C 1RF1B 1FDOA 1NKZB 2IYOA 2QJKC 1JCDA 1N7SB 1DH3A 1SQPE 2M8RA 1BE3D 3C8VA 3HTKB 3MTUE 2BASA 4IFDK 1W2BO 3F5HA 2FXOA 2O1JA 1ZP0C 2ZJSE 5GTIH 2NPSC 3N4XA 3L72J 1S2EA 2W6AA 3TGUE 1NGMB 1QX8A 4AYCA 1L0LK 2LXCB 2N1TA 1BGYJ 2IFNA 1SQXG 1BE3G 3AEDC 4WY4B 2YO3A 1LJ2A 3GHGA 1K9MQ 1JMBA 2KNCA 3HUSC 5AVUB 3RK2D 1FAVA 2JO1A 1KB9E 1JY3P 1SFCC 1JCCA 2OYHC 3RL0D 2I8DA 1HTLC 2KNCB 2KI7B 1L0LD 3LIDA 2WITA 3CC2P 3G9RA 3B4SA 3H1JD 1N73C 3A7OA 3TYYA 3HRNA 1ZR4A 1EDLA 5TISE 1UIXA 2ZT9D 3TGUJ 1K04A 1HF9A 3BCCD 1EQ7A 1HBWA 4Y28J 3L36A 3WMM0 2O01N 4K3AA 4LC1A 1L0LG 1NTZD 2O01J 1S1CX 3H1JG 3V6IA 1T2KC 3T97A 5AW8B 3H25A 1OZHA 1YJWP 2QIWA 4UB6H 1N7SC 2OYIB 2ZXXA 1SVFA 2Y0DA 3MZWB 2ZFCA 2KYVA 2KIKA 3BCCG 4RJTA 1GL2A 2OGUA 3L73E 5BU5A 2XU6A 1NTZG 1P84D 2O3JA 1KQFB 1LT9C 2H8PD 5AW7B 2KB7P 3FWNA 4ZKUA 3NFQA 4WBAA 1RF0C 3SWFA 2QSIA 4D6TD 4N78D 1NTKE 5AW2B 1GW3A 3I55P 2OTKE 4PJ0H 3CCJP 2A06D 1USEA 1YBKA 1PP9E 5GTHH 1CW5A 3L73J 5AVXB 1PGQA 4HJGH 3V4WA 4C7NB 1RY3A 3Q5PA 4D6TG 3I56P 3O6QB 5AW6B 3GF7A 3M0DC 3B5ND 2W90A 2B9BA 2WPQA 1S5LX 4JBZA 3EFFK 2A06G 1OWAA 2J5UA 3IR9A 2FFDC 1KB9I 3PP5A 1K05A 3II6A 2KS1A 2OYIC 2E74D 1RE3C 1PP9J 2VRSA 2C0WA 4ASVA 2E76C 2GM4A 1Q81Q 1KYOE 2KLUA 3CCMP 1URQC 2JWAA 3CC7P 3EWKA 4KJMA 5CCGC 4BWNA 4OWFA 5KAFH 1S3JA 2C0XA 1LTJC 5KJ7D 4DT0A 3A0HH 3L72D 4DCKA 3V5BA 2NPSD 3RK2B 2I1JA 2K1AA 1YQ4C 2FBWC 1L2PA 3H32A 2B87A 2P67A 3L74D 1AQTA 3H1IJ 2FYNC 2WT7A 1BE3E 1K8AQ 4H0LC 4PV1C 3E7KA 3L72G 1EXJA 1FZEA 2JEEA 1SFCD 2ZT9B 3QH9A 3S1KA 3L74G 4C46A 5APTA 1M90Q 3BRVB 2ZVOB 1EDJA 1M1JC 1LGHB 1S9KD 3KDPB 2OARA 2YKQA 3A5TA 4EOTA 2YNYA 5C39A 1SQBK 1E5WA 2KZJA 3S4RA 3AE4C 1BE3J 3L70D 1Q2NA 1MKMA 5AVWB 1L0LE 3H1JE 2C9NY 2E75D 3OA7A 1T6AA 3FXEA 1OW6A 3G71P 1NKNA 4GODA 2ZYGA 1SQBD 1W2EA 3BCCE 3IN6A 2GA1A 3CC4P 3L70G 1R5SA 3HD7D 3RK2C 2YIUB 1EC5A 1NTZE 2XNDH 1FDIA 2JJLA 2K9YA 3M06A 2KXPB 1VQ5P 4IL6X 2GUVA 3RL0C 3E1RA 3U1AA 1A02J 3RL0g 1SQBG 1L0LJ 1U7MA 5GTIE 1KYOI 1S5LH 3H1JJ 1KILD 4C7RA 1CSBA 2P58A 1YTZI 1P84E 3B5NB 3CMEP 5CJ0A 4OGQC 4BRYA 4R4LA 3BCCJ 1BDDA 5CBNA 4Z1MH 3RBXA 1OW8A 1PL5A 4WWIA 2IPPA 4D6TE 4N78E 3KQGA 3AE2C 5B66H 3S9OA 2E74B 1J2JB 2M5AA 3GW6A 1VQPP 1Q7YQ 2A45H 1KQSO 1AFOA 3L73G 1JEKA 2A06E 1JM0A 3MHVA 1HGZA 3TSIA 1VPCA 3RK3B 5AVQB 2IBZD 3FWLA 3EQ2A 1YIJP 1DD3A 4ASWA 3IFMA 1ZXGA 2JP3A 1WRGA 2YIUC 2XNXA 4IOIH 4D6TJ 2BCCD 3M9QA 3B71A 4UB6E 1OMIA 2NPSB 3U1CA 3HUSA 2IBZG 2CPSA 2IYPA 4XA4A 1MZ9A 5AVSB 4H44C 2QJYB 5CCGD 1JY2N 2D2CC 2OYHA 3HUSB 1KFNA 5EFWB 2BCCG 5CHXA 2WSSH 1N73A 1SFCB 1M7LA 3H1ID 1X0TA 1JO5A 1NYHA 4PV1D 1VQ6P 1GK4A 4GIFA 2E74C 2Q6QA 3CLQA 2HPCB 2ZXEB 5GTHE 2ITAA 1LTAC 1SS1A 3H1IG 1PV3A 3L74E 3AEAC 2Z5HA 1N7SA 2H43A 3HTKA 1P84I 3D6ZA 1FZCB 2Y0CA
chains in the Genus database with same CATH topology
2WSEH 3MIWA 5AW7B 2E43A 1IC2A 2KB7P 1CI6B 4ZKUA 1L4AB 3NFQA 5APXA 4WBAA 2Q5UA 1RF0C 1NTKK 1L0NK 2POHA 3SWFA 2J58A 1HWTC 2YMYA 3M91A 2YKPA 4N78D 3HE4B 4W7YA 2WSFH 2QM7A 1JNMA 5KJ7C 4AQRD 3H32B 5AW2B 3HD7B 4WY4A 1GU5A 1RE4C 1GW3A 1LT9B 2WZ7A 1S9KE 1T3UA 2KSJA 1MV8A 2WT7B 3NMDA 5KJ7A 3A3YB 2J59M 1IO4A 1GW4A 1CW5A 2NPSA 5CMZA 5AVXB 3P8CD 2W27A 1MUUA 1JY2P 3V4WA 1G1JA 4C7NB 1RY3A 3VTPC 2IFMA 5AW6B 3MD0A 4Y99C 2IX7C 2R3CA 5APQA 3M0DC 4XE5B 1KILB 3NXSA 3B5ND 1J1EC 1GD2E 2WPQA 2W6BA 1JOCA 3L37A 2Q7CA 1LWUB 2HODA 3V2QA 1QL2A 3M0DA 3VP8A 1OWAA 1MFZA 2PP6A 1WT6A 3IR9A 2FFDC 1SFCA 1T2KD 3PP5A 5AW9B 1GL2D 3II6A 3VP9A 3VYIA 3VOPA 1FJPA 2FYUK 3P7KA 3V2NA 2OYIC 2Z4EA 3L4FA 1N7SD 1X9VA 2QM8A 1RE3C 5AW1B 1FZFA 2C9LY 5APYA 4IFFA 1HJBA 1OXZA 2VRSA 2WPRA 2C0WA 2OYIA 2O1KA 2I1KA 2HPCA 4HH2A 2FFDB 1FZCC 2GM4A 3M9BA 2CPBA 2HLOA 1T8ZA 2GUSA 2L5GB 3N7NA 4LGDE 2A45I 1KZUB 4M3LA 1L4AC 2H7HA 4W80A 1URQC 2WPSA 3KYQA 1GTWA 1FZCA 5AVTB 4WY4D 1NO4A 1Z56A 1H89A 4N6JA 1CI6A 1G2CB 5CCGC 3VMXA 1L4AA 2KP8A 2C0XA 3R2PA 1LTJC 3HD7C 5KJ7D 5CJ4A 1URQA 5APUA 3V5BA 2NPSD 3RK2B 1T3JA 2I1JA 3KPEA 1JTHB 1PFIA 3HE4A 1SQXK 2MJZA 5BVZA 2A45G 3H32A 1NAFA 2P67A 1LTJA 3HD7A 1IFJA 1FZGA 1URQB 2R5BA 1LT9A 1GK6A 2WT7A 1NHLA 1NTMK 1SP4A 3OJAB 1GU4A 1KILC 3HE5B 1JUNA 1RF0A 1LTJB 1IFMA 1FZEA 1HH0A 3M9HA 4C7NA 2JEEA 1SFCD 1LTIC 1LWUC 3A2AA 2XV5A 2FXMA 2WWWA 1KILA 2XZRA 4C46A 5APTA 4KHXA 3BRVB 2KLVA 1RE4A 1M1JC 1ZLLA 1LGHB 1NOHA 2FKWB 2LKMA 2P1JA 3P32A 1LWUA 1S9KD 3MGNA 5AVYB 3VMZA 1N7LA 3GHGC 3KDPB 2OARA 3VN0A 1IJDB 5AW0B 2YKQA 3A5TA 3U59A 4EOTA 2YNYA 1GZLA 1SQBK 1E5WA 5AW4B 3V2RA 2R32A 4AUWA 5AVWB 1JMMA 2YO2A 1M1JB 2HG5D 3V2PA 1KQLA 3L35A 2WTYA 2N1TB 3BATA 3M0AA 2C9NY 1HGVA 3OA7A 1L4AD 3GHGB 2Z5IA 1YTZT 2FFDA 3LIEA 1URQD 1NKNA 4O9BA 1LTTC 5AVVB 1NTZK 4LLHA 3I5CA 1N86A 1HUCA 3P8MC 1W2EA 5CCHC 1N2DC 4I1LA 3NTNA 3HD7D 1HVVA 1RE3A 2YKOA 3RK2C 1IFNA 1XTGB 3B5NC 1G2CA 2JJLA 3M06A 3E1IA 1JY3N 3UIAA 2GUVA 3RL0C 3U1AA 1A02J 3B8EB 2OYHB 4B86A 1GDTA 5APWA 1ZR2A 1JTHA 2R5DA 1YYCA 1FZAA 1FJKA 1RF1C 4JYBA 1N73B 1A02F 3O8ZA 1KILD 5AW3B 4C7RA 1SLQA 1CSBA 3CI9A 1YTZI 2FYZA 3CL3D 4RESB 3MUDA 2Q3IA 3B5NB 5CJ0A 5CCGA 1RF1A 4DOJA 3HE5A 4JF7A 5BU8B 3RL0B 2M3BA 1JY3O 2XDJA 3TK1A 3VMYA 4WB4A 1SQPK 3RK3C 1FU1A 1RF1B 4GKGA 2IPPA 1G1IA 4N78E 1GL2B 3BRTB 1X8YA 1IFIA 1NKZB 3KQGA 3TNUA 1FBMA 4GT1A 1JCDA 1FOSF 1N7SB 1DH3A 1J2JB 1CZQA 2M8RA 3LW5H 3HTKB 1DEBA 4WY4C 2E42A 3MTUE 2A45H 2BASA 4IFDK 1AFOA 1NH4A 2XKMA 2O1JA 2N1TC 3TNUB 3G3ZA 1HGZA 3TSIA 3BVHA 3P8CE 2NPSC 1VPCA 3N4XA 4JYCA 3RK3B 5KTBA 3OAKA 5AVQB 5AVZB 2W6AA 3EFGA 3EQ2A 1M1JA 4AYCA 1L0LK 2N1TA 2IFNA 4WY4B 2YO3A 3IFMA 5CCHD 3GHGA 4DZOA 1X79B 3HUSC 5AW5B 1WRGA 3BASA 5AVUB 2XNXA 4OH8B 3RK2D 3M9QA 1FAVA 1LTSC 2NPSB 1JY3P 3U1CA 1SFCC 1JCCA 1ZN5A 2P7JA 3RL0D 1QL1A 2OYHC 1HTLC 3HUSA 2CPSA 4XA4A 1FDMA 3LIDA 1MZ9A 2WITA 5AVSB 1SQQK 2HFED 5CCGD 1JY2N 1N73C 3A7OA 3V4QA 4N3YB 3TYYA 4I2LC 3HRNA 1H88A 2OYHA 1ZR4A 1LTBC 3HUSB 1FOSE 1KFNA 2HODB 4Y99B 5CHXA 1J1DC 5CCHA 2KOGA 1N73A 2N9BA 1EQ7A 1J1EB 1HBWA 1SFCB 1M7LA 1AQ5A 1VDFA 1XTCC 1NU1K 2PAJA 1IFDA 2WSCH 3L36A 2Q9IA 3SWYA 1KFMA 5AVRB 3WMM0 4LC1A 3B5NA 1JO5A 5APSA 4IFMA 3C9IA 1LTGC 4I6MC 2HYNA 1T2KC 3RK3D 3T97A 5AW8B 2O01H 1GL2C 1DX7A 1GK4A 4HYTB 4GIFA 2P2UA 5KLVK 1N7SC 4ZKPA 2OYIB 1JY2O 1SVFA 2ZFCA 2KYVA 3CLQA 2HPCB 2ZXEB 1J1DB 1GL2A 1LTAC 4W7ZA 1SQVK 4EIJA 2Z5HA 1FZBA 1N7SA 3H6PA 5BU5A 1ZV8A 1H8AA 2N1TD 2XU6A 1NWQA 2H43A 3HTKA 1FZCB 1IK9A 1LT9C 5APVA 2H8PD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OAR A;  2WSE H;  5KLV K;  1SQX K;  3CLQ A;  1L0L K;  1SQB K;  3LW5 H;  1NTK K;  1L0N K;  1NU1 K;  2J59 M;  2WSC H;  1NTZ K;  1SQV K;  4IFD K;  1SQQ K;  1NTM K;  2WSF H;  2LKM A;  3G3Z A;  1SQP K;  2O01 H;  3M9Q A;  2FYU K; 
#chains in the Genus database with same CATH topology
 1IC2 A;  1WMK A;  2QVA A;  3RBZ A;  3LW5 J;  2E75 B;  2Q5U A;  1L0N K;  2POH A;  2YMY A;  2NRG A;  3PTZ A;  2QM7 A;  1JNM A;  5KJ7 C;  4AQR D;  3HD7 B;  4WY4 A;  1ZME C;  1LT9 B;  1S9K E;  1MV8 A;  1KV4 A;  3NMD A;  1AA0 A;  2J59 M;  3PJS K;  1GW4 A;  2QJY C;  3L74 J;  5CMZ A;  1ZRT E;  3L70 E;  3CCV P;  1OW7 A;  2R3C A;  1KIL B;  5M1B A;  1HJ0 A;  1Q86 Q;  1JOC A;  4PD4 D;  2AEM A;  1LWU B;  1QL2 A;  3M0D A;  2PP6 A;  5KAF E;  3JC2 2;  3A0H E;  1SQB E;  1M56 D;  3KXD A;  1Y47 A;  5AW1 B;  3VMA A;  3QWO C;  4OGQ D;  4RKU J;  2OYI A;  1OVV A;  3CX5 H;  2O1K A;  2I1K A;  3L70 J;  4HH2 A;  2FFD B;  1FZC C;  2ZYD A;  3G4S P;  2GUS A;  3FX0 A;  3Q2Y A;  3N7N A;  2E75 C;  3PH0 A;  1KIL E;  2WPS A;  3AE5 C;  1NO4 A;  1Z56 A;  5KLI C;  2JKV A;  2OTL P;  3OW2 O;  4U3F E;  1X22 A;  1SQB J;  3R2P A;  3HD7 C;  2E5Y A;  1URQ A;  2E76 B;  5APU A;  3WU2 E;  4EYY Q;  1QVF O;  2L91 A;  2MJZ A;  1QGK B;  1LTJ A;  2YMK A;  4HB1 A;  1URQ B;  2Y0E A;  2WPV B;  1NTM K;  1QVG O;  3OJA B;  2QE7 H;  1KIL C;  3HE5 B;  2R3S A;  3KZI E;  1LTJ B;  1IFM A;  3M9H A;  4C7N A;  1LTI C;  3H1K D;  3O6Q A;  1LWU C;  3A2A A;  4H13 D;  2FXM A;  2WWW A;  2XZR A;  1YQ3 C;  2IBZ E;  4U3F J;  3GLM A;  2AEJ A;  1RE4 A;  4H44 D;  2LR2 A;  1RH5 B;  3SWK A;  2D2C D;  3P32 A;  2FYN B;  1NTM D;  4GOE A;  3W68 A;  4H0L B;  3MGN A;  4PV1 B;  4L73 A;  3GHG C;  2BCC E;  3CX5 D;  1GZL A;  2IZ1 A;  1BCC D;  3H1K G;  3V2R A;  4AUW A;  1S5L E;  1JMM A;  2YO2 A;  1M1J B;  1KQL A;  2WTY A;  4U7J A;  1NTM G;  1HGV A;  1PPJ D;  1L4A D;  3LIE A;  1BCC G;  1N86 A;  3P8M C;  5CBO A;  4QMA A;  3H1H D;  1YHQ P;  1W5C E;  4YTP C;  3H1I E;  1AVY A;  2RN0 A;  1Q90 D;  2BCC J;  5B66 E;  1JY3 N;  1PPJ G;  4RO0 A;  1YJ9 P;  2Q3E A;  4B86 A;  2R5D A;  1YYC A;  1Q82 Q;  3JCU E;  3H1H G;  3O8Z A;  2AXT E;  3CI9 A;  2FYZ A;  4DOJ A;  4JF7 A;  5BU8 B;  3RL0 B;  2M3B A;  3IAO A;  4CPG A;  1SQP K;  1FU1 A;  3PHL A;  4GKG A;  1S4X A;  1G1I A;  3AE1 C;  3CCL P;  1BSH A;  1IFI A;  1FBM A;  4GT1 A;  1VQO P;  1IZN B;  1CZQ A;  3GG2 A;  4OGQ B;  3AEB C;  3G3Z A;  4L74 A;  3BVH A;  5KTB A;  3CWB J;  2IBZ I;  4MN4 C;  1MFT A;  1OVR A;  1ZRT D;  4PD4 E;  1H0T B;  1X79 B;  1AVO A;  5AW5 B;  4OH8 B;  3TDK A;  1LTS C;  1ZN5 A;  2P7J A;  2KK7 A;  2CK3 H;  1SQQ K;  2HFE D;  1OFC X;  3V4Q A;  1L0N J;  4N3Y B;  2WMM A;  4I2L C;  1FOS E;  3ITK A;  2HOD B;  5K5G B;  3TF5 A;  2KSE A;  1J1D C;  5E79 H;  5CCH A;  1VQ9 P;  1J1E B;  3SFE C;  1XTC C;  1NU1 K;  2HR3 A;  1IFD A;  2WSC H;  4KT0 J;  4H13 B;  1KFM A;  5AVR B;  1FC2 C;  3B5N A;  4YXD C;  4IFM A;  1SQQ D;  4H44 B;  1LTG C;  1RQV A;  2HYN A;  1EDI A;  2D2C B;  3L71 D;  1DX7 A;  4NPD A;  5KLV K;  3ABV C;  2NZ2 A;  4GDO A;  1LP1 B;  2SPZ A;  3D6Y A;  4U3F D;  3G6E P;  1SQV K;  1NU1 D;  4EIJ A;  1ZV8 A;  2N1T D;  3K5B A;  1SQQ G;  1IK9 A;  5APV A;  2WSE H;  3L71 G;  2E43 A;  1CI6 B;  1L4A B;  5APX A;  1VQN P;  1NTK K;  4U3F G;  3H1K E;  1HWT C;  3IF4 A;  1SQV D;  3M91 A;  1NU1 G;  2OQQ A;  3HE4 B;  4W7Y A;  3AE7 C;  2YXR B;  2WSF H;  3Q5R A;  4YXW H;  2QJP B;  3CD6 P;  1GU5 A;  1NTM E;  2WZ7 A;  1KYO H;  1T3U A;  3H1L J;  5KJ7 A;  1VQL P;  3A3Y B;  1IO4 A;  3WUV A;  3CX5 E;  2NPS A;  4UB8 H;  1BCC E;  3P8C D;  2W27 A;  3Q3D A;  1PIX A;  1G1J A;  1KD1 Q;  2IFM A;  3MD0 A;  2IX7 C;  4I7Z C;  1DD4 A;  1YI2 P;  5APQ A;  5B5E H;  1J1E C;  1M8O B;  5KKZ C;  2W6B A;  3L37 A;  1PPJ E;  4PD4 I;  2Q7C A;  4H13 C;  3Q5S A;  3H1K J;  3V2Q A;  3SFD C;  2IZ0 A;  2OYO A;  1SFC A;  1GL2 D;  3H1H E;  1RHZ B;  3VP9 A;  3VYI A;  2K9J B;  2Y9Z A;  1NTM J;  2FYU K;  2Z4E A;  3L4F A;  1EXI A;  1KOR A;  1X9V A;  4JPZ B;  5APY A;  2QRX A;  4IFF A;  1HJB A;  2WPR A;  1BCC J;  1OIP A;  1FS0 E;  2JR8 A;  2PGD A;  2K88 A;  2HPC A;  2CPB A;  2YXQ B;  1T8Z A;  3CXH H;  4PJ0 E;  3WUU A;  1KZU B;  4M3L A;  1L4A C;  2FYU D;  2WQY C;  4OVN F;  4NPF X;  1FZC A;  5AVT B;  4N6J A;  1G2C B;  3VMX A;  3MP7 B;  2QJP C;  2KP8 A;  3CCR P;  3H1H J;  5CJ4 A;  1M1K Q;  2B89 A;  3CWB D;  1JTH B;  1PFI A;  1SQX K;  4A7P A;  2A45 G;  2FYU G;  1NAF A;  2ZVN B;  1YIT P;  3HD7 A;  1FZG A;  2H88 C;  2RKL A;  2R5B A;  1LT9 A;  1GK6 A;  3A0B H;  5KLI B;  3CPW O;  4IL6 H;  3AEC C;  1JUN A;  1RF0 A;  3CWB G;  1HH0 A;  3FXD A;  1SQX D;  5KAI H;  2KZI A;  1KIL A;  1TU3 F;  2K3R A;  1Y9B A;  4KHX A;  2KLV A;  1L0N D;  3D71 A;  1ZLL A;  3AE9 C;  2P1J A;  1LWU A;  1U57 A;  2JWD A;  3VMZ A;  5H2F H;  1N7L A;  3VN0 A;  5AW0 B;  3F89 A;  1VQK P;  3U59 A;  3CX5 I;  1P84 H;  1PZQ A;  3CXH D;  2MKV A;  1L0N G;  3W67 A;  1QLE D;  4L75 A;  3V2P A;  3L35 A;  2N1T B;  3CCS P;  3BAT A;  2B88 A;  1SQP J;  3GHG B;  1YTZ T;  2FFD A;  1K73 Q;  4O9B A;  5AVV B;  1NTZ K;  3I5C A;  1HUC A;  1VF5 C;  5DJT B;  3NTN A;  1RE3 A;  2H89 C;  1SQQ E;  2WVR A;  3UIA A;  3L71 E;  3B8E B;  1GDT A;  5APW A;  3AEF C;  3MUD C;  1FZA A;  1FJK A;  1RF1 C;  1A02 F;  5TJH A;  1NU1 E;  5AW3 B;  3Q1M A;  2KUB A;  3CL3 D;  4RES B;  2Q3I A;  3H1L D;  5CCG A;  1Y8A A;  3HE5 A;  2V7Q H;  3T97 B;  1ZOY C;  1KQG B;  5KLV E;  2XDJ A;  3TK1 A;  2QEX P;  1EZV D;  4HKZ H;  1DIP A;  3RGU A;  1SQV E;  1SQQ J;  1GL2 B;  3BRT B;  1X8Y A;  3L71 J;  3TNU A;  1FOS F;  3H1L G;  4WY4 C;  3LW5 H;  1DEB A;  2E42 A;  4R4M A;  4L76 A;  3ZDM A;  1NH4 A;  2XKM A;  1NU1 J;  2N1T C;  3TNU B;  1EZV G;  3AE8 C;  3P8C E;  3KHU A;  4JYC A;  3GF3 A;  5E79 E;  3OAK A;  5AVZ B;  5L8R J;  3EFG A;  1M1J A;  5DJU B;  1PGJ A;  5KLV J;  4ZNC A;  5CCH D;  1NJI Q;  4YPC A;  4DZO A;  1PGP A;  3R4Y A;  3BAS A;  1SQV J;  2M3E A;  1R5L A;  1LT1 A;  3GMA A;  1QL1 A;  3SSU A;  3AE3 C;  1FDM A;  2BEQ D;  1U7J A;  1NTK J;  1H88 A;  1LTB C;  1VQ8 P;  3L75 D;  4Y99 B;  2M0B A;  1KMI Z;  2KOG A;  2WSC J;  4GOF A;  2N9B A;  1AQ5 A;  1VDF A;  2PAJ A;  3CCU P;  2FYU E;  2AXC A;  3SWY A;  2Q9I A;  4EI2 A;  2E5T A;  1NVO A;  2KS1 B;  2QA4 P;  5APS A;  3C9I A;  2FXP A;  4I6M C;  2Q1K A;  3RK3 D;  2O01 H;  1GL2 C;  1VQ4 P;  4HYT B;  3L75 G;  2P2U A;  2G8Y A;  4ZKP A;  1JY2 O;  1USD A;  1KB9 H;  1ZW0 A;  3CWB E;  1FE6 A;  1J1D B;  4UB8 E;  4W7Z A;  3PLN A;  1FZB A;  1H8A A;  3H6P A;  1NWQ A;  2WSE J;  1VQM P;  1IFP A;  5TIS H;  5B5E E;  3MIW A;  3JSV C;  1BGY D;  4JQ0 D;  2FYU J;  2WSF J;  2J58 A;  1SQX E;  2YKP A;  4BXL A;  1IK7 A;  3H32 B;  2B87 B;  4ZMD A;  1DEE G;  1L0N E;  4TT3 H;  2DW3 A;  1RE4 C;  1SQP D;  1H0T A;  2KSJ A;  2WT7 B;  1BGY G;  2RH0 A;  2W83 C;  3CMA P;  1VF5 D;  1MUU A;  1JY2 P;  3VTP C;  1R8E A;  3CXH E;  2IDB A;  4Y99 C;  3TGU D;  4XE5 B;  3D70 A;  3NXS A;  3WU2 H;  1AJY A;  1SQP G;  2ZYA A;  1GD2 E;  2HOD A;  1GMJ A;  1SQX J;  3VP8 A;  1MFZ A;  1NAY A;  1LNQ A;  3CCE P;  1WT6 A;  4TLF A;  1T2K D;  3PRJ A;  1KB9 D;  5AW9 B;  3VOP A;  1FJP A;  3KZI H;  3P7K A;  3V2N A;  3TGU G;  4I7Z B;  1N7S D;  1EDK A;  2QM8 A;  2V4H A;  1FZF A;  2C9L Y;  3AEE C;  5KKZ B;  1OXZ A;  4EDF A;  2UWJ E;  3A0B E;  1LP1 A;  4IL6 E;  3M9B A;  2HLO A;  2L5G B;  4LGD E;  2A45 I;  5KAI E;  1UII A;  1YJN P;  2H7H A;  4NPE A;  4W80 A;  3KYQ A;  1GTW A;  4WY4 D;  1H89 A;  3H1L E;  4K35 A;  1CI6 A;  2OTJ P;  1L4A A;  2ZAE B;  5H2F E;  1EZV E;  1T3J A;  3KPE A;  2ZT9 C;  3HE4 A;  1QEX A;  1S72 P;  1BDC A;  3WUT A;  5BVZ A;  5KLV D;  1IFJ A;  3L73 D;  1BSN A;  2LXB A;  1OVU A;  1NHL A;  1SP4 A;  2P10 A;  1GU4 A;  1NTZ J;  2W8Z A;  2PRR A;  4BRY B;  3C1L A;  1VQ7 P;  2XV5 A;  5KLV G;  3FGA D;  1OX3 A;  1NTK D;  1M57 D;  3AE6 C;  2FKW B;  1NOH A;  2LKM A;  3JCU H;  1SQV G;  2PFX A;  2BEZ F;  2M5A B;  2AXT H;  5AVY B;  1IJD B;  1PP9 D;  3CCQ P;  2QJK B;  1PGO A;  2K9J A;  5AW4 B;  1VL2 A;  3CXH I;  2R32 A;  2N9Y B;  1NTK G;  2W6J H;  2E76 D;  2HG5 D;  3M0A A;  2RMZ A;  1D7M A;  1KC8 Q;  1RQU A;  4WVZ A;  1PP9 G;  2AEF A;  2Z5I A;  3L75 E;  1N8R Q;  1URQ D;  1E79 H;  1LTT C;  4LLH A;  2QG4 A;  5CCH C;  1N2D C;  2G3A A;  4I1L A;  1HVV A;  2YKO A;  1KN7 A;  1IFN A;  3AEG C;  1XTG B;  3B5N C;  1G2C A;  3E1I A;  3RK3 E;  2OYH B;  2K37 A;  1ZR2 A;  1JTH A;  4H0L D;  1VF5 B;  4PD4 H;  4JYB A;  1KTM A;  1KYO D;  1N73 B;  1SLQ A;  2JDI H;  3MUD A;  2V7Q J;  3L72 E;  3L75 J;  1RF1 A;  4DJG A;  1BGY E;  2R44 A;  1JY3 O;  1JB0 J;  1EZV I;  4XFJ A;  3VMY A;  3USS A;  4WB4 A;  2Y9Y A;  2FY8 A;  1AV1 A;  3RK3 C;  1RF1 B;  1FDO A;  1NKZ B;  2IYO A;  2QJK C;  1JCD A;  1N7S B;  1DH3 A;  1SQP E;  2M8R A;  1BE3 D;  3C8V A;  3HTK B;  3MTU E;  2BAS A;  4IFD K;  1W2B O;  3F5H A;  2FXO A;  2O1J A;  1ZP0 C;  2ZJS E;  5GTI H;  2NPS C;  3N4X A;  3L72 J;  1S2E A;  2W6A A;  3TGU E;  1NGM B;  1QX8 A;  4AYC A;  1L0L K;  2LXC B;  2N1T A;  1BGY J;  2IFN A;  1SQX G;  1BE3 G;  3AED C;  4WY4 B;  2YO3 A;  1LJ2 A;  3GHG A;  1K9M Q;  1JMB A;  2KNC A;  3HUS C;  5AVU B;  3RK2 D;  1FAV A;  2JO1 A;  1KB9 E;  1JY3 P;  1SFC C;  1JCC A;  2OYH C;  3RL0 D;  2I8D A;  1HTL C;  2KNC B;  2KI7 B;  1L0L D;  3LID A;  2WIT A;  3CC2 P;  3G9R A;  3B4S A;  3H1J D;  1N73 C;  3A7O A;  3TYY A;  3HRN A;  1ZR4 A;  1EDL A;  5TIS E;  1UIX A;  2ZT9 D;  3TGU J;  1K04 A;  1HF9 A;  3BCC D;  1EQ7 A;  1HBW A;  4Y28 J;  3L36 A;  3WMM 0;  2O01 N;  4K3A A;  4LC1 A;  1L0L G;  1NTZ D;  2O01 J;  1S1C X;  3H1J G;  3V6I A;  1T2K C;  3T97 A;  5AW8 B;  3H25 A;  1OZH A;  1YJW P;  2QIW A;  4UB6 H;  1N7S C;  2OYI B;  2ZXX A;  1SVF A;  2Y0D A;  3MZW B;  2ZFC A;  2KYV A;  2KIK A;  3BCC G;  4RJT A;  1GL2 A;  2OGU A;  3L73 E;  5BU5 A;  2XU6 A;  1NTZ G;  1P84 D;  2O3J A;  1KQF B;  1LT9 C;  2H8P D;  5AW7 B;  2KB7 P;  3FWN A;  4ZKU A;  3NFQ A;  4WBA A;  1RF0 C;  3SWF A;  2QSI A;  4D6T D;  4N78 D;  1NTK E;  5AW2 B;  1GW3 A;  3I55 P;  2OTK E;  4PJ0 H;  3CCJ P;  2A06 D;  1USE A;  1YBK A;  1PP9 E;  5GTH H;  1CW5 A;  3L73 J;  5AVX B;  1PGQ A;  4HJG H;  3V4W A;  4C7N B;  1RY3 A;  3Q5P A;  4D6T G;  3I56 P;  3O6Q B;  5AW6 B;  3GF7 A;  3M0D C;  3B5N D;  2W90 A;  2B9B A;  2WPQ A;  1S5L X;  4JBZ A;  3EFF K;  2A06 G;  1OWA A;  2J5U A;  3IR9 A;  2FFD C;  1KB9 I;  3PP5 A;  1K05 A;  3II6 A;  2KS1 A;  2OYI C;  2E74 D;  1RE3 C;  1PP9 J;  2VRS A;  2C0W A;  4ASV A;  2E76 C;  2GM4 A;  1Q81 Q;  1KYO E;  2KLU A;  3CCM P;  1URQ C;  2JWA A;  3CC7 P;  3EWK A;  4KJM A;  5CCG C;  4BWN A;  4OWF A;  5KAF H;  1S3J A;  2C0X A;  1LTJ C;  5KJ7 D;  4DT0 A;  3A0H H;  3L72 D;  4DCK A;  3V5B A;  2NPS D;  3RK2 B;  2I1J A;  2K1A A;  1YQ4 C;  2FBW C;  1L2P A;  3H32 A;  2B87 A;  2P67 A;  3L74 D;  1AQT A;  3H1I J;  2FYN C;  2WT7 A;  1BE3 E;  1K8A Q;  4H0L C;  4PV1 C;  3E7K A;  3L72 G;  1EXJ A;  1FZE A;  2JEE A;  1SFC D;  2ZT9 B;  3QH9 A;  3S1K A;  3L74 G;  4C46 A;  5APT A;  1M90 Q;  3BRV B;  2ZVO B;  1EDJ A;  1M1J C;  1LGH B;  1S9K D;  3KDP B;  2OAR A;  2YKQ A;  3A5T A;  4EOT A;  2YNY A;  5C39 A;  1SQB K;  1E5W A;  2KZJ A;  3S4R A;  3AE4 C;  1BE3 J;  3L70 D;  1Q2N A;  1MKM A;  5AVW B;  1L0L E;  3H1J E;  2C9N Y;  2E75 D;  3OA7 A;  1T6A A;  3FXE A;  1OW6 A;  3G71 P;  1NKN A;  4GOD A;  2ZYG A;  1SQB D;  1W2E A;  3BCC E;  3IN6 A;  2GA1 A;  3CC4 P;  3L70 G;  1R5S A;  3HD7 D;  3RK2 C;  2YIU B;  1EC5 A;  1NTZ E;  2XND H;  1FDI A;  2JJL A;  2K9Y A;  3M06 A;  2KXP B;  1VQ5 P;  4IL6 X;  2GUV A;  3RL0 C;  3E1R A;  3U1A A;  1A02 J;  3RL0 g;  1SQB G;  1L0L J;  1U7M A;  5GTI E;  1KYO I;  1S5L H;  3H1J J;  1KIL D;  4C7R A;  1CSB A;  2P58 A;  1YTZ I;  1P84 E;  3B5N B;  3CME P;  5CJ0 A;  4OGQ C;  4BRY A;  4R4L A;  3BCC J;  1BDD A;  5CBN A;  4Z1M H;  3RBX A;  1OW8 A;  1PL5 A;  4WWI A;  2IPP A;  4D6T E;  4N78 E;  3KQG A;  3AE2 C;  5B66 H;  3S9O A;  2E74 B;  1J2J B;  2M5A A;  3GW6 A;  1VQP P;  1Q7Y Q;  2A45 H;  1KQS O;  1AFO A;  3L73 G;  1JEK A;  2A06 E;  1JM0 A;  3MHV A;  1HGZ A;  3TSI A;  1VPC A;  3RK3 B;  5AVQ B;  2IBZ D;  3FWL A;  3EQ2 A;  1YIJ P;  1DD3 A;  4ASW A;  3IFM A;  1ZXG A;  2JP3 A;  1WRG A;  2YIU C;  2XNX A;  4IOI H;  4D6T J;  2BCC D;  3M9Q A;  3B71 A;  4UB6 E;  1OMI A;  2NPS B;  3U1C A;  3HUS A;  2IBZ G;  2CPS A;  2IYP A;  4XA4 A;  1MZ9 A;  5AVS B;  4H44 C;  2QJY B;  5CCG D;  1JY2 N;  2D2C C;  2OYH A;  3HUS B;  1KFN A;  5EFW B;  2BCC G;  5CHX A;  2WSS H;  1N73 A;  1SFC B;  1M7L A;  3H1I D;  1X0T A;  1JO5 A;  1NYH A;  4PV1 D;  1VQ6 P;  1GK4 A;  4GIF A;  2E74 C;  2Q6Q A;  3CLQ A;  2HPC B;  2ZXE B;  5GTH E;  2ITA A;  1LTA C;  1SS1 A;  3H1I G;  1PV3 A;  3L74 E;  3AEA C;  2Z5H A;  1N7S A;  2H43 A;  3HTK A;  1P84 I;  3D6Z A;  1FZC B;  2Y0C A; 
#chains in the Genus database with same CATH homology
 2WSE H;  3MIW A;  5AW7 B;  2E43 A;  1IC2 A;  2KB7 P;  1CI6 B;  4ZKU A;  1L4A B;  3NFQ A;  5APX A;  4WBA A;  2Q5U A;  1RF0 C;  1NTK K;  1L0N K;  2POH A;  3SWF A;  2J58 A;  1HWT C;  2YMY A;  3M91 A;  2YKP A;  4N78 D;  3HE4 B;  4W7Y A;  2WSF H;  2QM7 A;  1JNM A;  5KJ7 C;  4AQR D;  3H32 B;  5AW2 B;  3HD7 B;  4WY4 A;  1GU5 A;  1RE4 C;  1GW3 A;  1LT9 B;  2WZ7 A;  1S9K E;  1T3U A;  2KSJ A;  1MV8 A;  2WT7 B;  3NMD A;  5KJ7 A;  3A3Y B;  2J59 M;  1IO4 A;  1GW4 A;  1CW5 A;  2NPS A;  5CMZ A;  5AVX B;  3P8C D;  2W27 A;  1MUU A;  1JY2 P;  3V4W A;  1G1J A;  4C7N B;  1RY3 A;  3VTP C;  2IFM A;  5AW6 B;  3MD0 A;  4Y99 C;  2IX7 C;  2R3C A;  5APQ A;  3M0D C;  4XE5 B;  1KIL B;  3NXS A;  3B5N D;  1J1E C;  1GD2 E;  2WPQ A;  2W6B A;  1JOC A;  3L37 A;  2Q7C A;  1LWU B;  2HOD A;  3V2Q A;  1QL2 A;  3M0D A;  3VP8 A;  1OWA A;  1MFZ A;  2PP6 A;  1WT6 A;  3IR9 A;  2FFD C;  1SFC A;  1T2K D;  3PP5 A;  5AW9 B;  1GL2 D;  3II6 A;  3VP9 A;  3VYI A;  3VOP A;  1FJP A;  2FYU K;  3P7K A;  3V2N A;  2OYI C;  2Z4E A;  3L4F A;  1N7S D;  1X9V A;  2QM8 A;  1RE3 C;  5AW1 B;  1FZF A;  2C9L Y;  5APY A;  4IFF A;  1HJB A;  1OXZ A;  2VRS A;  2WPR A;  2C0W A;  2OYI A;  2O1K A;  2I1K A;  2HPC A;  4HH2 A;  2FFD B;  1FZC C;  2GM4 A;  3M9B A;  2CPB A;  2HLO A;  1T8Z A;  2GUS A;  2L5G B;  3N7N A;  4LGD E;  2A45 I;  1KZU B;  4M3L A;  1L4A C;  2H7H A;  4W80 A;  1URQ C;  2WPS A;  3KYQ A;  1GTW A;  1FZC A;  5AVT B;  4WY4 D;  1NO4 A;  1Z56 A;  1H89 A;  4N6J A;  1CI6 A;  1G2C B;  5CCG C;  3VMX A;  1L4A A;  2KP8 A;  2C0X A;  3R2P A;  1LTJ C;  3HD7 C;  5KJ7 D;  5CJ4 A;  1URQ A;  5APU A;  3V5B A;  2NPS D;  3RK2 B;  1T3J A;  2I1J A;  3KPE A;  1JTH B;  1PFI A;  3HE4 A;  1SQX K;  2MJZ A;  5BVZ A;  2A45 G;  3H32 A;  1NAF A;  2P67 A;  1LTJ A;  3HD7 A;  1IFJ A;  1FZG A;  1URQ B;  2R5B A;  1LT9 A;  1GK6 A;  2WT7 A;  1NHL A;  1NTM K;  1SP4 A;  3OJA B;  1GU4 A;  1KIL C;  3HE5 B;  1JUN A;  1RF0 A;  1LTJ B;  1IFM A;  1FZE A;  1HH0 A;  3M9H A;  4C7N A;  2JEE A;  1SFC D;  1LTI C;  1LWU C;  3A2A A;  2XV5 A;  2FXM A;  2WWW A;  1KIL A;  2XZR A;  4C46 A;  5APT A;  4KHX A;  3BRV B;  2KLV A;  1RE4 A;  1M1J C;  1ZLL A;  1LGH B;  1NOH A;  2FKW B;  2LKM A;  2P1J A;  3P32 A;  1LWU A;  1S9K D;  3MGN A;  5AVY B;  3VMZ A;  1N7L A;  3GHG C;  3KDP B;  2OAR A;  3VN0 A;  1IJD B;  5AW0 B;  2YKQ A;  3A5T A;  3U59 A;  4EOT A;  2YNY A;  1GZL A;  1SQB K;  1E5W A;  5AW4 B;  3V2R A;  2R32 A;  4AUW A;  5AVW B;  1JMM A;  2YO2 A;  1M1J B;  2HG5 D;  3V2P A;  1KQL A;  3L35 A;  2WTY A;  2N1T B;  3BAT A;  3M0A A;  2C9N Y;  1HGV A;  3OA7 A;  1L4A D;  3GHG B;  2Z5I A;  1YTZ T;  2FFD A;  3LIE A;  1URQ D;  1NKN A;  4O9B A;  1LTT C;  5AVV B;  1NTZ K;  4LLH A;  3I5C A;  1N86 A;  1HUC A;  3P8M C;  1W2E A;  5CCH C;  1N2D C;  4I1L A;  3NTN A;  3HD7 D;  1HVV A;  1RE3 A;  2YKO A;  3RK2 C;  1IFN A;  1XTG B;  3B5N C;  1G2C A;  2JJL A;  3M06 A;  3E1I A;  1JY3 N;  3UIA A;  2GUV A;  3RL0 C;  3U1A A;  1A02 J;  3B8E B;  2OYH B;  4B86 A;  1GDT A;  5APW A;  1ZR2 A;  1JTH A;  2R5D A;  1YYC A;  1FZA A;  1FJK A;  1RF1 C;  4JYB A;  1N73 B;  1A02 F;  3O8Z A;  1KIL D;  5AW3 B;  4C7R A;  1SLQ A;  1CSB A;  3CI9 A;  1YTZ I;  2FYZ A;  3CL3 D;  4RES B;  3MUD A;  2Q3I A;  3B5N B;  5CJ0 A;  5CCG A;  1RF1 A;  4DOJ A;  3HE5 A;  4JF7 A;  5BU8 B;  3RL0 B;  2M3B A;  1JY3 O;  2XDJ A;  3TK1 A;  3VMY A;  4WB4 A;  1SQP K;  3RK3 C;  1FU1 A;  1RF1 B;  4GKG A;  2IPP A;  1G1I A;  4N78 E;  1GL2 B;  3BRT B;  1X8Y A;  1IFI A;  1NKZ B;  3KQG A;  3TNU A;  1FBM A;  4GT1 A;  1JCD A;  1FOS F;  1N7S B;  1DH3 A;  1J2J B;  1CZQ A;  2M8R A;  3LW5 H;  3HTK B;  1DEB A;  4WY4 C;  2E42 A;  3MTU E;  2A45 H;  2BAS A;  4IFD K;  1AFO A;  1NH4 A;  2XKM A;  2O1J A;  2N1T C;  3TNU B;  3G3Z A;  1HGZ A;  3TSI A;  3BVH A;  3P8C E;  2NPS C;  1VPC A;  3N4X A;  4JYC A;  3RK3 B;  5KTB A;  3OAK A;  5AVQ B;  5AVZ B;  2W6A A;  3EFG A;  3EQ2 A;  1M1J A;  4AYC A;  1L0L K;  2N1T A;  2IFN A;  4WY4 B;  2YO3 A;  3IFM A;  5CCH D;  3GHG A;  4DZO A;  1X79 B;  3HUS C;  5AW5 B;  1WRG A;  3BAS A;  5AVU B;  2XNX A;  4OH8 B;  3RK2 D;  3M9Q A;  1FAV A;  1LTS C;  2NPS B;  1JY3 P;  3U1C A;  1SFC C;  1JCC A;  1ZN5 A;  2P7J A;  3RL0 D;  1QL1 A;  2OYH C;  1HTL C;  3HUS A;  2CPS A;  4XA4 A;  1FDM A;  3LID A;  1MZ9 A;  2WIT A;  5AVS B;  1SQQ K;  2HFE D;  5CCG D;  1JY2 N;  1N73 C;  3A7O A;  3V4Q A;  4N3Y B;  3TYY A;  4I2L C;  3HRN A;  1H88 A;  2OYH A;  1ZR4 A;  1LTB C;  3HUS B;  1FOS E;  1KFN A;  2HOD B;  4Y99 B;  5CHX A;  1J1D C;  5CCH A;  2KOG A;  1N73 A;  2N9B A;  1EQ7 A;  1J1E B;  1HBW A;  1SFC B;  1M7L A;  1AQ5 A;  1VDF A;  1XTC C;  1NU1 K;  2PAJ A;  1IFD A;  2WSC H;  3L36 A;  2Q9I A;  3SWY A;  1KFM A;  5AVR B;  3WMM 0;  4LC1 A;  3B5N A;  1JO5 A;  5APS A;  4IFM A;  3C9I A;  1LTG C;  4I6M C;  2HYN A;  1T2K C;  3RK3 D;  3T97 A;  5AW8 B;  2O01 H;  1GL2 C;  1DX7 A;  1GK4 A;  4HYT B;  4GIF A;  2P2U A;  5KLV K;  1N7S C;  4ZKP A;  2OYI B;  1JY2 O;  1SVF A;  2ZFC A;  2KYV A;  3CLQ A;  2HPC B;  2ZXE B;  1J1D B;  1GL2 A;  1LTA C;  4W7Z A;  1SQV K;  4EIJ A;  2Z5H A;  1FZB A;  1N7S A;  3H6P A;  5BU5 A;  1ZV8 A;  1H8A A;  2N1T D;  2XU6 A;  1NWQ A;  2H43 A;  3HTK A;  1FZC B;  1IK9 A;  1LT9 C;  5APV A;  2H8P D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...