2WSFH

Improved model of plant photosystem i
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
69
structure length
69
Chain Sequence
DLEDIANTTGQWDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSANAPQDVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT3G54890
publication title Structure determination and improved model of plant photosystem I.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 4
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03244 PSI_PsaH Photosystem I reaction centre subunit VI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wsfH01
2J59M 2LKMA 3LW5H 2OARA 1NTKK 1SQPK 2WSFH 1NTZK 2O01H 2WSEH 1L0LK 1SQQK 1SQBK 3CLQA 3G3ZA 4IFDK 1NTMK 1SQXK 5KLVK 1L0NK 2FYUK 2WSCH 1SQVK 1NU1K 3M9QA
chains in the Genus database with same CATH superfamily
4JYBA 3GW6A 1K05A 1SFCD 1UIIA 2K9JB 1SFCA 3NTNA 1KB9D 3T97B 3S9OA 2OYOA 2KZJA 1J1DB 1BGYE 1L0ND 3M0DC 1KYOD 3CX5H 3HE5A 4WB4A 2LXCB 1U7JA 2J58A 2ZAEB 5EFWB 4BXLA 1YTZI 4JBZA 1YQ3C 1VQ8P 2KP8A 1LP1A 3BCCJ 1L4AB 1FJKA 1LT9B 3F5HA 1RQUA 4I1LA 1N7LA 1MZ9A 1T3JA 3Q3DA 4H13B 3D70A 1JM0A 5APTA 2ZYDA 1GL2C 2B89A 3A3YB 4UB6E 4AQRD 2YNYA 3GLMA 3KZIE 4W7ZA 1OVUA 2WSFJ 3L72E 3A0HE 2WITA 2BCCE 2J59M 2Q9IA 2FY8A 1WRGA 4NPEA 1FZBA 1KFMA 3A5TA 4LC1A 2A06G 3R2PA 2Y0EA 1VQ7P 4EI2A 3AE9C 3RBZA 3CCUP 3BRVB 3PJSK 4PD4D 1SQPJ 4H44B 2RMZA 2Q6QA 4D6TJ 5BVZA 1LT1A 2H43A 1L4AC 1LT9C 1VPCA 1FZFA 2GA1A 1IK7A 4H13C 1Q86Q 2QJPB 4QMAA 1A02J 4NPDA 4KJMA 5KAFH 3LIEA 4U3FJ 2KNCB 1K73Q 1U7MA 2KK7A 1CSBA 1KV4A 1VQLP 3H1LD 2M3BA 2WVRA 4ZNCA 3L70D 3L75J 4KT0J 3RK3B 3H1IJ 3U59A 3CCSP 4O9BA 1SQPG 3H1JG 1KTMA 2M5AB 3S1KA 4ZMDA 1GTWA 1P84D 2KIKA 4H44C 1SQXJ 3TGUJ 1QL2A 2BEZF 1SQVJ 1IFDA 4N3YB 1E79H 1NGMB 2V7QH 2YMKA 1AQ5A 5KLIB 1VQPP 1W5CE 3M91A 1NO4A 3GG2A 1ZP0C 1OW6A 2QJPC 3L73E 2QIWA 1OMIA 3IN6A 3CX5D 1WMKA 2QSIA 2FYZA 1EZVD 5AW9B 1BCCJ 3IR9A 1CZQA 3RK3C 4YXDC 2FXOA 2M3EA 3VTPC 1SQXG 1JTHB 1SQVG 1PPJD 1AV1A 3KZIH 4IOIH 1SQQK 1KILD 1ZW0A 3A0HH 1KILA 1FOSF 3TF5A 4IL6E 2V4HA 2N9YB 5KLIC 4JF7A 2FFDA 3H1HJ 3HUSA 3CMEP 2FXMA 3CWBD 4H0LB 1LTJA 3AEEC 1G2CA 2RN0A 2YMYA 2OYIB 2OGUA 4HH2A 4NPFX 4PV1D 1BCCG 1KC8Q 3QWOC 3D6YA 2WT7B 1IFNA 1L0NJ 1PL5A 4C7RA 3BATA 1M90Q 4U7JA 1T2KD 1XTCC 4GOEA 2E75D 1SQBG 4OGQC 1GMJA 1KFNA 1T8ZA 1R5LA 2W6BA 2P1JA 3HE4B 3FWNA 3KQGA 3PRJA 2FYUG 1KB9I 3H1KJ 2HODB 1VF5B 4I7ZB 3VN0A 2P58A 5GTHH 5AW8B 2O3JA 1KYOI 5CCHD 3L71E 2AXCA 5CCHA 1K04A 3RK3E 2QG4A 5AVSB 3Q5SA 1URQD 1KMIZ 1EC5A 2YKPA 1URQA 2WSSH 3II6A 2R44A 1RH5B 4HB1A 5E79E 2YIUB 1FDOA 2J5UA 5C39A 3L74E 2KYVA 1NHLA 3H25A 4I7ZC 4XA4A 3TDKA 3B5ND 2R5DA 3GF3A 3CCVP 5AW4B 3B5NA 3G71P 3A7OA 1SQPK 2W27A 3AEAC 3HD7B 1EDIA 5AVWB 4PD4I 1VL2A 4WY4B 3L72D 3H1LJ 1HBWA 2FXPA 1NTZJ 3L70J 2BCCD 3GHGC 1NAFA 3KYQA 2B88A 1BE3E 1M1JA 3CXHE 2MJZA 1KB9H 3O8ZA 3OW2O 3ABVC 2XZRA 1FE6A 5GTIE 4L73A 3CL3D 2IDBA 2H8PD 2Q5UA 3KXDA 5KLVG 3NMDA 1KQLA 3CCRP 1LJ2A 3MD0A 1YITP 3AE1C 1FOSE 5CJ0A 5TISE 5BU5A 2ZT9D 3H1LG 1P84I 1NU1K 2AEMA 4WY4C 3VP9A 1ZOYC 1PP9E 4TLFA 1FZAA 2HPCB 1VQ5P 2Q3IA 3CI9A 4RO0A 3MUDC 3TSIA 3BASA 1VQKP 3PH0A 3USSA 2O01N 5AVXB 5KTBA 1KQSO 3CX5I 3V2NA 4N78D 1N2DC 1S2EA 1N7SD 1AVYA 1VDFA 1KZUB 3W67A 1YJWP 2XNXA 1A02F 3AE7C 1EZVI 4GIFA 1N7SA 2Q7CA 3V6IA 5H2FH 2KLUA 5E79H 3L73D 2FBWC 4XE5B 4HKZH 4TT3H 1R5SA 3T97A 1JY2O 5KKZB 4B86A 1RF1B 3A2AA 3R4YA 1SQQE 1GU5A 1T6AA 4L76A 5B5EE 2LKMA 3FXEA 1L4AD 4I6MC 1L4AA 1SQBD 5B66H 4YXWH 2QEXP 4DCKA 1L0NK 1S5LE 3CWBG 3HTKB 1HVVA 1QEXA 2YO3A 5KJ7D 1GL2B 5CJ4A 2G3AA 5KJ7A 3TNUA 4RJTA 5KKZC 1RF1C 3CC4P 3SFEC 4IL6X 2PFXA 3M9QA 5AVUB 2V7QJ 4JYCA 4H44D 5TISH 2O1KA 1M56D 3AEFC 3VOPA 3AE3C 2W6AA 1EDKA 1EDJA 1L0LE 2YXRB 1GW4A 4Y28J 5DJTB 1BSHA 1NTMG 1VQ6P 4K3AA 3BCCE 3IF4A 3VP8A 3WUTA 4C7NB 1S4XA 1OVVA 2QJYB 3RGUA 1N73A 5CCGC 5AVVB 3L71D 1MFZA 2WPQA 2W8ZA 1N86A 3RK3D 2OYHA 3L72J 1BGYG 2BCCJ 4WBAA 4YPCA 1SFCB 1M8OB 3H1JJ 1XTGB 2R3CA 1L0LG 1OX3A 3C9IA 2QM7A 1IK9A 2H89C 1NTZK 3HE5B 3JCUE 3A0BE 3GMAA 4GOFA 4D6TE 3E1IA 1NJIQ 5KLVD 1YI2P 1U57A 2QJYC 2E76D 2HG5D 5AW5B 4PJ0E 4CPGA 3L72G 1LGHB 2BCCG 3AE6C 2ZJSE 2P7JA 1RE3A 3G9RA 4U3FE 5CBOA 5APQA 2MKVA 2K3RA 2Y9YA 1SFCC 1FZCA 1BE3D 3H1IE 3S4RA 2BEQD 3KHUA 2WQYC 4BRYB 3B4SA 1Q82Q 4AYCA 1FZGA 4JPZB 1Y47A 4H0LD 2JR8A 1NU1E 1AFOA 2OARA 1LWUB 2OYIA 2QJKC 1PZQA 3L73J 3RL0B 1W2EA 5L8RJ 1LTAC 1USEA 1JY2N 3P8CE 4OH8B 2Z4EA 1QLED 3Q5PA 2JWDA 5APVA 3WUUA 3L4FA 1G1IA 1PP9D 1BDCA 1FJPA 1FDIA 4Z1MH 2VRSA 1NTKK 3Q1MA 1AA0A 2KXPB 3V2RA 2WZ7A 1KQFB 3CMAP 4UB6H 3RBXA 1Q81Q 4OGQB 3V4WA 3IAOA 2N1TD 1LTGC 2Y9ZA 1SQBJ 1VF5D 1AVOA 2JO1A 2N1TA 1H0TA 3GF7A 2IZ0A 4YTPC 2CPSA 2FYUJ 3L73G 4WWIA 1LWUC 1WT6A 3RL0C 1LTTC 1YHQP 2PAJA 3IFMA 1DEEG 1EDLA 1USDA 2Y0DA 1ZR2A 4OWFA 2NRGA 2XNDH 3JCUH 4HJGH 5BU8B 2Z5HA 2W83C 3OAKA 1MUUA 3OA7A 4PJ0H 1Y8AA 3O6QB 4LLHA 1L0NE 1NYHA 1KYOE 1QVGO 2WSEH 3CCQP 2NPSD 1NTMD 2NPSA 2NZ2A 3HD7D 1QX8A 1KILB 5AW2B 3AE5C 1PGOA 3H1KE 2FYNB 3HD7A 3UIAA 1ZR4A 4HYTB 5AW1B 1JO5A 4UB8E 1JUNA 5M1BA 2KUBA 3L71J 1KD1Q 1NKZB 1YTZT 2XV5A 3HUSB 3FX0A 5AVZB 2WPRA 3BVHA 4AUWA 1LTJB 1JEKA 1G2CB 1BGYD 5AW6B 2RH0A 3GHGB 3BRTB 1K8AQ 1S3JA 1H89A 1S5LX 2IX7C 4PV1B 1RE4A 2OTLP 2H7HA 1L0LD 1JY2P 3CLQA 5AVTB 3G3ZA 3SFDC 1RF0A 1EXJA 4PD4E 2I1KA 3RK2D 3C8VA 1QGKB 1ZLLA 3MGNA 5KLVJ 2E75B 3CD6P 1KILC 1SP4A 2FYNC 2O01H 3L71G 1FDMA 4IL6H 2B87A 1GZLA 5KAIE 2FFDC 1W2BO 2IBZE 3CC7P 3HUSC 1FU1A 2KS1B 1KQGB 1LTJC 1OVRA 2POHA 1LTSC 3VMXA 1X9VA 3E7KA 1PGJA 5AVRB 1NTZE 2K1AA 3L70E 1OW7A 3H32A 4PV1C 4K35A 3L74G 2IFNA 1URQB 4GT1A 1IZNB 1T2KC 1GD2E 1GK6A 2E75C 1L2PA 3I5CA 1NAYA 3L36A 2BASA 1SQXK 5CMZA 1NH4A 1ZRTE 2C9LY 1SQVK 5AW3B 1CI6B 3M0DA 3CX5E 2R5BA 2JDIH 3B5NB 4U3FD 1PP9J 3P8MC 1BE3G 4UB8H 5CCHC 3CC2P 1EZVE 2E5YA 1YQ4C 4RKUJ 3V2PA 1IO4A 3H1ID 2JKVA 4C46A 1URQC 2KSEA 2E42A 1QVFO 1KILE 1GL2D 5CHXA 3EWKA 3Q5RA 2Q3EA 1ZXGA 2ZYAA 3TYYA 5AVQB 1GL2A 3CWBJ 1NU1D 1QL1A 1J1EB 1MFTA 2K9JA 1NOHA 3NXSA 2IZ1A 3MZWB 2KB7P 3U1AA 3PP5A 1NTKE 3VMYA 1JY3O 2GUVA 1SQBK 3P8CD 1PP9G 2DW3A 3B5NC 3G4SP 2FYUK 1DEBA 2WSCH 5AW0B 3EQ2A 2QE7H 1FZEA 3AE2C 2KSJA 1X22A 3WMM0 2ZXXA 1OFCX 5KAIH 1BDDA 1LTIC 5CBNA 1LT9A 3CCMP 4H13D 3KDPB 1OW8A 2ZYGA 3I55P 4L74A 3B71A 1NVOA 1JCDA 1M1JC 1Z56A 5KAFE 4EYYQ 3CXHH 1NTMJ 1MKMA 1S9KE 5GTIH 1J1EC 2KI7B 2CK3H 1HF9A 2B9BA 1VQMP 1N7SB 4M3LA 1SQQG 2ITAA 3CCJP 1E5WA 2N9BA 2A45H 1MV8A 3N7NA 1BGYJ 2AEJA 4LGDE 2WMMA 2ZT9C 1SS1A 3N4XA 1L0LJ 2IYOA 2CPBA 1PIXA 2A06E 5K5GB 2E43A 2D2CB 3D6ZA 1HH0A 2KNCA 2E74B 3G6EP 1Q2NA 3H1KD 4JQ0D 1GU4A 2ZVNB 1FC2C 4Y99C 1N7SC 2Z5IA 1TU3F 3D71A 3C1LA 3NFQA 3M9BA 3AEBC 1AJYA 2M5AA 3AE8C 3PHLA 5KLVK 3TNUB 2QVAA 1J2JB 4R4LA 4N6JA 2ZXEB 2JEEA 2RKLA 2PRRA 1J1DC 4BRYA 2R32A 4DT0A 1HGVA 2AEFA 3AE4C 3L74D 1SQPE 3H1JE 1D7MA 5B5EH 1FAVA 2D2CC 3B8EB 3SWYA 3WUVA 3BCCG 2QA4P 1LWUA 3RL0D 2QJKB 2E74C 1LP1B 1EQ7A 3LW5H 2O1JA 1PGQA 2IPPA 4EOTA 1DD3A 1GW3A 2K9YA 1VQNP 2OTKE 2UWJE 2JP3A 1T3UA 1S5LH 3PTZA 2IBZD 1S72P 1RHZB 5KJ7C 1N73B 5APYA 2WSEJ 1JTHA 3L75E 4OGQD 3CXHD 1VQ4P 1NTZD 2OYHB 4GDOA 2QM8A 2K88A 3VYIA 1UIXA 2C0XA 1HGZA 1YJ9P 3W68A 1SQXE 3L37A 5GTHE 3TGUE 3WU2E 1YJNP 1SQVE 4D6TG 1IJDB 2XDJA 4N78E 1NU1J 5DJUB 3EFGA 2IYPA 2HYNA 2M8RA 1ZRTD 3V2QA 2C0WA 1JY3N 2WT7A 3JC22 4U3FG 1N8RQ 2HR3A 1VQOP 1N73C 1NKNA 3L75G 1BCCE 2E76B 3V5BA 1IFJA 3H1IG 3O6QA 4GKGA 1RY3A 2OYHC 2R3SA 1ZN5A 1IC2A 3P7KA 3HE4A 2O01J 4IFMA 2HODA 1IFPA 2P10A 3TGUG 2WSFH 1Q90D 1FZCB 1NU1G 3SWKA 2AXTE 2M0BA 1NWQA 1SQBE 4ASWA 2GUSA 4WVZA 3KPEA 2FYUE 3H1HE 2YO2A 1NTKD 3FGAD 1FBMA 3A0BH 1PV3A 3P32A 2QRXA 3GHGA 1DIPA 1SQQD 1OWAA 1KB9E 1X8YA 1NTMK 4OVNF 3CPWO 2IFMA 2E76C 4MN4C 4EIJA 4R4MA 3I56P 2YKOA 1RE3C 1LNQA 1SVFA 1AQTA 3QH9A 3PLNA 2C9NY 1KN7A 3LIDA 3SSUA 1KORA 5TJHA 1FZCC 2I1JA 1SLQA 3SWFA 3MP7B 4WY4D 1S9KD 3H1HG 1K9MQ 1JNMA 3RL0g 2N1TB 1HJBA 4WY4A 1H0TB 2FFDB 1L0LK 3CCLP 5APWA 3WU2H 2KS1A 4H0LC 3MHVA 3Q2YA 2OYIC 3M9HA 4IFFA 3MUDA 2E5TA 3V4QA 2PGDA 2PP6A 2ZFCA 3E1RA 1L0NG 1OZHA 3ZDMA 4I2LC 4ASVA 1JY3P 2WTYA 1VQ9P 4L75A 1ZMEC 3L74J 2A06D 3ITKA 5H2FE 1X79B 1OIPA 3H1KG 3BCCD 1YBKA 3M0AA 2GM4A 2I8DA 2WSCJ 3AEGC 2N1TC 3AECC 1VF5C 2SPZA 1CI6A 2KLVA 1IFIA 5KLVE 2P2UA 3MTUE 2W6JH 2HPCA 2NPSB 2AXTH 1PGPA 3H1LE 4KHXA 4DZOA 4ZKUA 1BE3J 2KOGA 2G8YA 1GK4A 5B66E 1H88A 4GODA 2XU6A 1YIJP 1JMMA 2OTJP 4DJGA 1P84E 1JMBA 1SQPD 3H1JD 2JWAA 4RESB 4W7YA 2IBZI 1HJ0A 4D6TD 2P67A 3CCEP 2YIUC 4IFDK 2HLOA 1KYOH 2YXQB 5APSA 1RF1A 1DH3A 3CXHI 1IFMA 2IBZG 3RK2B 1EXIA 2WWWA 2WPSA 2NPSC 1Q7YQ 2LR2A 1OXZA 3HD7C 3JSVC 2K37A 2H88C 2B87B 1NTZG 3L70G 1JOCA 3L75D 1R8EA 3VMAA 2A45I 4W80A 5AW7B 1HTLC 1X0TA 1G1JA 1PPJE 3FWLA 1M1JB 1FS0E 3HRNA 3FXDA 2A45G 3HTKA 1SQXD 3TGUD 3H32B 1SQVD 1RE4C 5CCGD 2ZVOB 2Q1KA 5CCGA 2JJLA 1DX7A 4A7PA 3AEDC 3K5BA 1RF0C 2KZIA 2YKQA 1PFIA 4ZKPA 1BSNA 4PD4H 1YYCA 1RQVA 3CWBE 3RK2C 1M1KQ 1NTKJ 1HUCA 5AVYB 2Y0CA 3H6PA 1ZV8A 1SQQJ 2OQQA 4DOJA 2LXBA 1EZVG 1DD4A 2ZT9B 1BCCD 1H8AA 3L35A 1GDTA 1M7LA 2XKMA 3OJAB 4EDFA 4XFJA 3LW5J 3U1CA 2D2CD 1HWTC 1PPJG 2L5GB 5APXA 4BWNA 2L91A 1Y9BA 1CW5A 4C7NA 2E74D 5APUA 1JCCA 2FKWB 3TK1A 2W90A 1M57D 3F89A 3VMZA 1NTKG 2HFED 3MIWA 1LTBC 3EFFK 1JB0J 2FYUD 3H1HD 4Y99B 1NTME 1P84H 3M06A 1S1CX 2WPVB
chains in the Genus database with same CATH topology
5APYA 4JYBA 2H8PD 1JTHA 2Q5UA 3NMDA 1SFCD 1KQLA 2OYHB 2WSEH 3MD0A 1SFCA 2QM8A 3NTNA 1FOSE 5CJ0A 3VYIA 2NPSD 5BU5A 2C0XA 1J1DB 2NPSA 1HGZA 3HD7D 3L37A 3M0DC 1KILB 1NU1K 4WY4C 5AW2B 3HD7A 3UIAA 3VP9A 1ZR4A 4HYTB 5AW1B 1JO5A 3HE5A 1IJDB 4WB4A 1JUNA 2XDJA 4N78E 2J58A 1FZAA 1NKZB 2HPCB 2Q3IA 3CI9A 1YTZT 3EFGA 2HYNA 2XV5A 1YTZI 3HUSB 5AVZB 2WPRA 3TSIA 3BVHA 2M8RA 4AUWA 3BASA 1LTJB 2KP8A 1G2CB 5AW6B 3V2QA 1L4AB 2C0WA 3BRTB 3GHGB 1FJKA 1JY3N 1LT9B 2WT7A 4I1LA 5AVXB 1N7LA 5KTBA 1MZ9A 1H89A 2IX7C 1T3JA 3V2NA 4N78D 1N2DC 5APTA 1RE4A 2H7HA 1N73C 1NKNA 1N7SD 1VDFA 1KZUB 1GL2C 2XNXA 1A02F 1JY2P 3CLQA 4GIFA 5AVTB 3V5BA 1IFJA 3A3YB 1N7SA 4GKGA 1RY3A 3G3ZA 1RF0A 2Q7CA 2OYHC 2I1KA 4AQRD 2YNYA 3RK2D 1ZN5A 4W7ZA 1IC2A 3P7KA 3HE4A 2WITA 4IFMA 2J59M 4XE5B 1ZLLA 2Q9IA 2HODA 3MGNA 1WRGA 3T97A 1JY2O 1FZBA 1KILC 1SP4A 2WSFH 4B86A 1KFMA 3A5TA 4LC1A 1RF1B 2O01H 3A2AA 1FZCB 1FDMA 3R2PA 1NWQA 1GZLA 3BRVB 1GU5A 2FFDC 2GUSA 3HUSC 3KPEA 1FU1A 1LTJC 5BVZA 2LKMA 2H43A 2POHA 1LTSC 1L4AC 3VMXA 2YO2A 1LT9C 1VPCA 1FZFA 1L4AD 1FBMA 1X9VA 3P32A 4I6MC 5AVRB 1L4AA 3GHGA 3H32A 1OWAA 1A02J 1X8YA 1NTMK 1L0NK 2IFMA 2IFNA 3LIEA 1URQB 3HTKB 4EIJA 1HVVA 4GT1A 2YO3A 5KJ7D 2YKOA 1GL2B 1RE3C 5CJ4A 1CSBA 5KJ7A 1T2KC 1SVFA 2M3BA 1GD2E 3TNUA 1GK6A 3RK3B 2C9NY 3U59A 3LIDA 3I5CA 4O9BA 1RF1C 3L36A 2BASA 1FZCC 1SQXK 5CMZA 1NH4A 2C9LY 1SQVK 3M9QA 5AW3B 1GTWA 2I1JA 5AVUB 1CI6B 4JYCA 1SLQA 3SWFA 4WY4D 1S9KD 1QL2A 2O1KA 3M0DA 1JNMA 1IFDA 2N1TB 1HJBA 4WY4A 2R5BA 3B5NB 4N3YB 2FFDB 1L0LK 3VOPA 3P8MC 5APWA 2W6AA 1AQ5A 3M91A 5CCHC 1GW4A 1NO4A 2OYIC 3M9HA 4IFFA 3MUDA 3V2PA 1IO4A 3V4QA 2PP6A 2ZFCA 4C46A 1URQC 4I2LC 3VP8A 2FYZA 2E42A 4C7NB 1GL2D 1N73A 1JY3P 5AW9B 5CHXA 5CCGC 5AVVB 3TYYA 5AVQB 1GL2A 3IR9A 2WTYA 1CZQA 3RK3C 2WPQA 1QL1A 1MFZA 1N86A 3RK3D 1J1EB 2OYHA 1X79B 1NOHA 3VTPC 3NXSA 3U1AA 2KB7P 1JTHB 3PP5A 3VMYA 1JY3O 2GUVA 3M0AA 4WBAA 2GM4A 1SQBK 1KILD 1SQQK 3P8CD 1KILA 2N1TC 1FOSF 1SFCB 3B5NC 1CI6A 2KLVA 2FYUK 1IFIA 1XTGB 1DEBA 2R3CA 2WSCH 5AW0B 3C9IA 3EQ2A 2P2UA 3MTUE 4JF7A 2HPCA 2QM7A 2NPSB 2FFDA 1FZEA 2KSJA 1IK9A 3HUSA 3WMM0 2FXMA 1NTZK 3HE5B 1LTJA 1G2CA 1LTIC 4DZOA 4KHXA 2YMYA 1LT9A 2OYIB 4ZKUA 4HH2A 3KDPB 2KOGA 1GK4A 3E1IA 1H88A 1JCDA 2XU6A 1M1JC 1Z56A 1JMMA 2WT7B 2HG5D 5AW5B 1IFNA 4C7RA 1LGHB 3BATA 1S9KE 1J1EC 4RESB 4W7YA 1T2KD 2P7JA 1RE3A 1XTCC 2P67A 4IFDK 2HLOA 5APQA 1N7SB 4M3LA 5APSA 1T8ZA 1KFNA 1E5WA 2N9BA 2A45H 1MV8A 2W6BA 1RF1A 1DH3A 1SFCC 1FZCA 3N7NA 1IFMA 2P1JA 3HE4B 3KQGA 2WWWA 3RK2B 2WPSA 2HODB 4LGDE 2NPSC 3VN0A 1OXZA 3HD7C 4AYCA 5AW8B 1FZGA 3N4XA 1JOCA 5CCHD 2CPBA 2A45I 2E43A 1AFOA 5CCHA 2OARA 1LWUB 4W80A 5AW7B 2OYIA 1HTLC 5AVSB 3RL0B 1G1JA 1W2EA 1LTAC 1URQD 1HH0A 1JY2N 3P8CE 4OH8B 2YKPA 1M1JB 1URQA 3HRNA 2A45G 3HTKA 2Z4EA 3H32B 1RE4C 3II6A 1GU4A 5APVA 3L4FA 1G1IA 5CCGD 1FJPA 4Y99C 5CCGA 2JJLA 1DX7A 2VRSA 1N7SC 1NTKK 1RF0C 2Z5IA 3V2RA 2WZ7A 2YKQA 1PFIA 4ZKPA 1YYCA 3RK2C 2KYVA 3NFQA 3M9BA 1NHLA 1HUCA 5AVYB 3V4WA 3H6PA 5KLVK 3TNUB 4XA4A 1J2JB 1ZV8A 2N1TD 4N6JA 2ZXEB 1LTGC 2JEEA 3B5ND 2R5DA 4DOJA 2N1TA 1J1DC 5AW4B 3B5NA 2R32A 2CPSA 3A7OA 1SQPK 2W27A 1HGVA 3HD7B 5AVWB 1H8AA 3L35A 1LWUC 1GDTA 1M7LA 2XKMA 1FAVA 4WY4B 3B8EB 3OJAB 1WT6A 3SWYA 3RL0C 1LTTC 2PAJA 1HBWA 3U1CA 1HWTC 1LWUA 3RL0D 2L5GB 3IFMA 5APXA 1ZR2A 3GHGC 1CW5A 1EQ7A 1NAFA 3LW5H 2O1JA 3KYQA 4C7NA 5APUA 2IPPA 5BU8B 4EOTA 2Z5HA 1JCCA 2FKWB 1GW3A 1M1JA 3TK1A 2MJZA 3O8ZA 2XZRA 3VMZA 1T3UA 2HFED 3CL3D 3MIWA 3OAKA 1LTBC 1MUUA 3OA7A 4Y99B 3M06A 5KJ7C 4LLHA 1N73B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J59 M;  2LKM A;  3LW5 H;  2OAR A;  1NTK K;  1SQP K;  2WSF H;  1NTZ K;  2O01 H;  2WSE H;  1L0L K;  1SQQ K;  1SQB K;  3CLQ A;  3G3Z A;  4IFD K;  1NTM K;  1SQX K;  5KLV K;  1L0N K;  2FYU K;  2WSC H;  1SQV K;  1NU1 K;  3M9Q A; 
#chains in the Genus database with same CATH topology
 4JYB A;  3GW6 A;  1K05 A;  1SFC D;  1UII A;  2K9J B;  1SFC A;  3NTN A;  1KB9 D;  3T97 B;  3S9O A;  2OYO A;  2KZJ A;  1J1D B;  1BGY E;  1L0N D;  3M0D C;  1KYO D;  3CX5 H;  3HE5 A;  4WB4 A;  2LXC B;  1U7J A;  2J58 A;  2ZAE B;  5EFW B;  4BXL A;  1YTZ I;  4JBZ A;  1YQ3 C;  1VQ8 P;  2KP8 A;  1LP1 A;  3BCC J;  1L4A B;  1FJK A;  1LT9 B;  3F5H A;  1RQU A;  4I1L A;  1N7L A;  1MZ9 A;  1T3J A;  3Q3D A;  4H13 B;  3D70 A;  1JM0 A;  5APT A;  2ZYD A;  1GL2 C;  2B89 A;  3A3Y B;  4UB6 E;  4AQR D;  2YNY A;  3GLM A;  3KZI E;  4W7Z A;  1OVU A;  2WSF J;  3L72 E;  3A0H E;  2WIT A;  2BCC E;  2J59 M;  2Q9I A;  2FY8 A;  1WRG A;  4NPE A;  1FZB A;  1KFM A;  3A5T A;  4LC1 A;  2A06 G;  3R2P A;  2Y0E A;  1VQ7 P;  4EI2 A;  3AE9 C;  3RBZ A;  3CCU P;  3BRV B;  3PJS K;  4PD4 D;  1SQP J;  4H44 B;  2RMZ A;  2Q6Q A;  4D6T J;  5BVZ A;  1LT1 A;  2H43 A;  1L4A C;  1LT9 C;  1VPC A;  1FZF A;  2GA1 A;  1IK7 A;  4H13 C;  1Q86 Q;  2QJP B;  4QMA A;  1A02 J;  4NPD A;  4KJM A;  5KAF H;  3LIE A;  4U3F J;  2KNC B;  1K73 Q;  1U7M A;  2KK7 A;  1CSB A;  1KV4 A;  1VQL P;  3H1L D;  2M3B A;  2WVR A;  4ZNC A;  3L70 D;  3L75 J;  4KT0 J;  3RK3 B;  3H1I J;  3U59 A;  3CCS P;  4O9B A;  1SQP G;  3H1J G;  1KTM A;  2M5A B;  3S1K A;  4ZMD A;  1GTW A;  1P84 D;  2KIK A;  4H44 C;  1SQX J;  3TGU J;  1QL2 A;  2BEZ F;  1SQV J;  1IFD A;  4N3Y B;  1E79 H;  1NGM B;  2V7Q H;  2YMK A;  1AQ5 A;  5KLI B;  1VQP P;  1W5C E;  3M91 A;  1NO4 A;  3GG2 A;  1ZP0 C;  1OW6 A;  2QJP C;  3L73 E;  2QIW A;  1OMI A;  3IN6 A;  3CX5 D;  1WMK A;  2QSI A;  2FYZ A;  1EZV D;  5AW9 B;  1BCC J;  3IR9 A;  1CZQ A;  3RK3 C;  4YXD C;  2FXO A;  2M3E A;  3VTP C;  1SQX G;  1JTH B;  1SQV G;  1PPJ D;  1AV1 A;  3KZI H;  4IOI H;  1SQQ K;  1KIL D;  1ZW0 A;  3A0H H;  1KIL A;  1FOS F;  3TF5 A;  4IL6 E;  2V4H A;  2N9Y B;  5KLI C;  4JF7 A;  2FFD A;  3H1H J;  3HUS A;  3CME P;  2FXM A;  3CWB D;  4H0L B;  1LTJ A;  3AEE C;  1G2C A;  2RN0 A;  2YMY A;  2OYI B;  2OGU A;  4HH2 A;  4NPF X;  4PV1 D;  1BCC G;  1KC8 Q;  3QWO C;  3D6Y A;  2WT7 B;  1IFN A;  1L0N J;  1PL5 A;  4C7R A;  3BAT A;  1M90 Q;  4U7J A;  1T2K D;  1XTC C;  4GOE A;  2E75 D;  1SQB G;  4OGQ C;  1GMJ A;  1KFN A;  1T8Z A;  1R5L A;  2W6B A;  2P1J A;  3HE4 B;  3FWN A;  3KQG A;  3PRJ A;  2FYU G;  1KB9 I;  3H1K J;  2HOD B;  1VF5 B;  4I7Z B;  3VN0 A;  2P58 A;  5GTH H;  5AW8 B;  2O3J A;  1KYO I;  5CCH D;  3L71 E;  2AXC A;  5CCH A;  1K04 A;  3RK3 E;  2QG4 A;  5AVS B;  3Q5S A;  1URQ D;  1KMI Z;  1EC5 A;  2YKP A;  1URQ A;  2WSS H;  3II6 A;  2R44 A;  1RH5 B;  4HB1 A;  5E79 E;  2YIU B;  1FDO A;  2J5U A;  5C39 A;  3L74 E;  2KYV A;  1NHL A;  3H25 A;  4I7Z C;  4XA4 A;  3TDK A;  3B5N D;  2R5D A;  3GF3 A;  3CCV P;  5AW4 B;  3B5N A;  3G71 P;  3A7O A;  1SQP K;  2W27 A;  3AEA C;  3HD7 B;  1EDI A;  5AVW B;  4PD4 I;  1VL2 A;  4WY4 B;  3L72 D;  3H1L J;  1HBW A;  2FXP A;  1NTZ J;  3L70 J;  2BCC D;  3GHG C;  1NAF A;  3KYQ A;  2B88 A;  1BE3 E;  1M1J A;  3CXH E;  2MJZ A;  1KB9 H;  3O8Z A;  3OW2 O;  3ABV C;  2XZR A;  1FE6 A;  5GTI E;  4L73 A;  3CL3 D;  2IDB A;  2H8P D;  2Q5U A;  3KXD A;  5KLV G;  3NMD A;  1KQL A;  3CCR P;  1LJ2 A;  3MD0 A;  1YIT P;  3AE1 C;  1FOS E;  5CJ0 A;  5TIS E;  5BU5 A;  2ZT9 D;  3H1L G;  1P84 I;  1NU1 K;  2AEM A;  4WY4 C;  3VP9 A;  1ZOY C;  1PP9 E;  4TLF A;  1FZA A;  2HPC B;  1VQ5 P;  2Q3I A;  3CI9 A;  4RO0 A;  3MUD C;  3TSI A;  3BAS A;  1VQK P;  3PH0 A;  3USS A;  2O01 N;  5AVX B;  5KTB A;  1KQS O;  3CX5 I;  3V2N A;  4N78 D;  1N2D C;  1S2E A;  1N7S D;  1AVY A;  1VDF A;  1KZU B;  3W67 A;  1YJW P;  2XNX A;  1A02 F;  3AE7 C;  1EZV I;  4GIF A;  1N7S A;  2Q7C A;  3V6I A;  5H2F H;  2KLU A;  5E79 H;  3L73 D;  2FBW C;  4XE5 B;  4HKZ H;  4TT3 H;  1R5S A;  3T97 A;  1JY2 O;  5KKZ B;  4B86 A;  1RF1 B;  3A2A A;  3R4Y A;  1SQQ E;  1GU5 A;  1T6A A;  4L76 A;  5B5E E;  2LKM A;  3FXE A;  1L4A D;  4I6M C;  1L4A A;  1SQB D;  5B66 H;  4YXW H;  2QEX P;  4DCK A;  1L0N K;  1S5L E;  3CWB G;  3HTK B;  1HVV A;  1QEX A;  2YO3 A;  5KJ7 D;  1GL2 B;  5CJ4 A;  2G3A A;  5KJ7 A;  3TNU A;  4RJT A;  5KKZ C;  1RF1 C;  3CC4 P;  3SFE C;  4IL6 X;  2PFX A;  3M9Q A;  5AVU B;  2V7Q J;  4JYC A;  4H44 D;  5TIS H;  2O1K A;  1M56 D;  3AEF C;  3VOP A;  3AE3 C;  2W6A A;  1EDK A;  1EDJ A;  1L0L E;  2YXR B;  1GW4 A;  4Y28 J;  5DJT B;  1BSH A;  1NTM G;  1VQ6 P;  4K3A A;  3BCC E;  3IF4 A;  3VP8 A;  3WUT A;  4C7N B;  1S4X A;  1OVV A;  2QJY B;  3RGU A;  1N73 A;  5CCG C;  5AVV B;  3L71 D;  1MFZ A;  2WPQ A;  2W8Z A;  1N86 A;  3RK3 D;  2OYH A;  3L72 J;  1BGY G;  2BCC J;  4WBA A;  4YPC A;  1SFC B;  1M8O B;  3H1J J;  1XTG B;  2R3C A;  1L0L G;  1OX3 A;  3C9I A;  2QM7 A;  1IK9 A;  2H89 C;  1NTZ K;  3HE5 B;  3JCU E;  3A0B E;  3GMA A;  4GOF A;  4D6T E;  3E1I A;  1NJI Q;  5KLV D;  1YI2 P;  1U57 A;  2QJY C;  2E76 D;  2HG5 D;  5AW5 B;  4PJ0 E;  4CPG A;  3L72 G;  1LGH B;  2BCC G;  3AE6 C;  2ZJS E;  2P7J A;  1RE3 A;  3G9R A;  4U3F E;  5CBO A;  5APQ A;  2MKV A;  2K3R A;  2Y9Y A;  1SFC C;  1FZC A;  1BE3 D;  3H1I E;  3S4R A;  2BEQ D;  3KHU A;  2WQY C;  4BRY B;  3B4S A;  1Q82 Q;  4AYC A;  1FZG A;  4JPZ B;  1Y47 A;  4H0L D;  2JR8 A;  1NU1 E;  1AFO A;  2OAR A;  1LWU B;  2OYI A;  2QJK C;  1PZQ A;  3L73 J;  3RL0 B;  1W2E A;  5L8R J;  1LTA C;  1USE A;  1JY2 N;  3P8C E;  4OH8 B;  2Z4E A;  1QLE D;  3Q5P A;  2JWD A;  5APV A;  3WUU A;  3L4F A;  1G1I A;  1PP9 D;  1BDC A;  1FJP A;  1FDI A;  4Z1M H;  2VRS A;  1NTK K;  3Q1M A;  1AA0 A;  2KXP B;  3V2R A;  2WZ7 A;  1KQF B;  3CMA P;  4UB6 H;  3RBX A;  1Q81 Q;  4OGQ B;  3V4W A;  3IAO A;  2N1T D;  1LTG C;  2Y9Z A;  1SQB J;  1VF5 D;  1AVO A;  2JO1 A;  2N1T A;  1H0T A;  3GF7 A;  2IZ0 A;  4YTP C;  2CPS A;  2FYU J;  3L73 G;  4WWI A;  1LWU C;  1WT6 A;  3RL0 C;  1LTT C;  1YHQ P;  2PAJ A;  3IFM A;  1DEE G;  1EDL A;  1USD A;  2Y0D A;  1ZR2 A;  4OWF A;  2NRG A;  2XND H;  3JCU H;  4HJG H;  5BU8 B;  2Z5H A;  2W83 C;  3OAK A;  1MUU A;  3OA7 A;  4PJ0 H;  1Y8A A;  3O6Q B;  4LLH A;  1L0N E;  1NYH A;  1KYO E;  1QVG O;  2WSE H;  3CCQ P;  2NPS D;  1NTM D;  2NPS A;  2NZ2 A;  3HD7 D;  1QX8 A;  1KIL B;  5AW2 B;  3AE5 C;  1PGO A;  3H1K E;  2FYN B;  3HD7 A;  3UIA A;  1ZR4 A;  4HYT B;  5AW1 B;  1JO5 A;  4UB8 E;  1JUN A;  5M1B A;  2KUB A;  3L71 J;  1KD1 Q;  1NKZ B;  1YTZ T;  2XV5 A;  3HUS B;  3FX0 A;  5AVZ B;  2WPR A;  3BVH A;  4AUW A;  1LTJ B;  1JEK A;  1G2C B;  1BGY D;  5AW6 B;  2RH0 A;  3GHG B;  3BRT B;  1K8A Q;  1S3J A;  1H89 A;  1S5L X;  2IX7 C;  4PV1 B;  1RE4 A;  2OTL P;  2H7H A;  1L0L D;  1JY2 P;  3CLQ A;  5AVT B;  3G3Z A;  3SFD C;  1RF0 A;  1EXJ A;  4PD4 E;  2I1K A;  3RK2 D;  3C8V A;  1QGK B;  1ZLL A;  3MGN A;  5KLV J;  2E75 B;  3CD6 P;  1KIL C;  1SP4 A;  2FYN C;  2O01 H;  3L71 G;  1FDM A;  4IL6 H;  2B87 A;  1GZL A;  5KAI E;  2FFD C;  1W2B O;  2IBZ E;  3CC7 P;  3HUS C;  1FU1 A;  2KS1 B;  1KQG B;  1LTJ C;  1OVR A;  2POH A;  1LTS C;  3VMX A;  1X9V A;  3E7K A;  1PGJ A;  5AVR B;  1NTZ E;  2K1A A;  3L70 E;  1OW7 A;  3H32 A;  4PV1 C;  4K35 A;  3L74 G;  2IFN A;  1URQ B;  4GT1 A;  1IZN B;  1T2K C;  1GD2 E;  1GK6 A;  2E75 C;  1L2P A;  3I5C A;  1NAY A;  3L36 A;  2BAS A;  1SQX K;  5CMZ A;  1NH4 A;  1ZRT E;  2C9L Y;  1SQV K;  5AW3 B;  1CI6 B;  3M0D A;  3CX5 E;  2R5B A;  2JDI H;  3B5N B;  4U3F D;  1PP9 J;  3P8M C;  1BE3 G;  4UB8 H;  5CCH C;  3CC2 P;  1EZV E;  2E5Y A;  1YQ4 C;  4RKU J;  3V2P A;  1IO4 A;  3H1I D;  2JKV A;  4C46 A;  1URQ C;  2KSE A;  2E42 A;  1QVF O;  1KIL E;  1GL2 D;  5CHX A;  3EWK A;  3Q5R A;  2Q3E A;  1ZXG A;  2ZYA A;  3TYY A;  5AVQ B;  1GL2 A;  3CWB J;  1NU1 D;  1QL1 A;  1J1E B;  1MFT A;  2K9J A;  1NOH A;  3NXS A;  2IZ1 A;  3MZW B;  2KB7 P;  3U1A A;  3PP5 A;  1NTK E;  3VMY A;  1JY3 O;  2GUV A;  1SQB K;  3P8C D;  1PP9 G;  2DW3 A;  3B5N C;  3G4S P;  2FYU K;  1DEB A;  2WSC H;  5AW0 B;  3EQ2 A;  2QE7 H;  1FZE A;  3AE2 C;  2KSJ A;  1X22 A;  3WMM 0;  2ZXX A;  1OFC X;  5KAI H;  1BDD A;  1LTI C;  5CBN A;  1LT9 A;  3CCM P;  4H13 D;  3KDP B;  1OW8 A;  2ZYG A;  3I55 P;  4L74 A;  3B71 A;  1NVO A;  1JCD A;  1M1J C;  1Z56 A;  5KAF E;  4EYY Q;  3CXH H;  1NTM J;  1MKM A;  1S9K E;  5GTI H;  1J1E C;  2KI7 B;  2CK3 H;  1HF9 A;  2B9B A;  1VQM P;  1N7S B;  4M3L A;  1SQQ G;  2ITA A;  3CCJ P;  1E5W A;  2N9B A;  2A45 H;  1MV8 A;  3N7N A;  1BGY J;  2AEJ A;  4LGD E;  2WMM A;  2ZT9 C;  1SS1 A;  3N4X A;  1L0L J;  2IYO A;  2CPB A;  1PIX A;  2A06 E;  5K5G B;  2E43 A;  2D2C B;  3D6Z A;  1HH0 A;  2KNC A;  2E74 B;  3G6E P;  1Q2N A;  3H1K D;  4JQ0 D;  1GU4 A;  2ZVN B;  1FC2 C;  4Y99 C;  1N7S C;  2Z5I A;  1TU3 F;  3D71 A;  3C1L A;  3NFQ A;  3M9B A;  3AEB C;  1AJY A;  2M5A A;  3AE8 C;  3PHL A;  5KLV K;  3TNU B;  2QVA A;  1J2J B;  4R4L A;  4N6J A;  2ZXE B;  2JEE A;  2RKL A;  2PRR A;  1J1D C;  4BRY A;  2R32 A;  4DT0 A;  1HGV A;  2AEF A;  3AE4 C;  3L74 D;  1SQP E;  3H1J E;  1D7M A;  5B5E H;  1FAV A;  2D2C C;  3B8E B;  3SWY A;  3WUV A;  3BCC G;  2QA4 P;  1LWU A;  3RL0 D;  2QJK B;  2E74 C;  1LP1 B;  1EQ7 A;  3LW5 H;  2O1J A;  1PGQ A;  2IPP A;  4EOT A;  1DD3 A;  1GW3 A;  2K9Y A;  1VQN P;  2OTK E;  2UWJ E;  2JP3 A;  1T3U A;  1S5L H;  3PTZ A;  2IBZ D;  1S72 P;  1RHZ B;  5KJ7 C;  1N73 B;  5APY A;  2WSE J;  1JTH A;  3L75 E;  4OGQ D;  3CXH D;  1VQ4 P;  1NTZ D;  2OYH B;  4GDO A;  2QM8 A;  2K88 A;  3VYI A;  1UIX A;  2C0X A;  1HGZ A;  1YJ9 P;  3W68 A;  1SQX E;  3L37 A;  5GTH E;  3TGU E;  3WU2 E;  1YJN P;  1SQV E;  4D6T G;  1IJD B;  2XDJ A;  4N78 E;  1NU1 J;  5DJU B;  3EFG A;  2IYP A;  2HYN A;  2M8R A;  1ZRT D;  3V2Q A;  2C0W A;  1JY3 N;  2WT7 A;  3JC2 2;  4U3F G;  1N8R Q;  2HR3 A;  1VQO P;  1N73 C;  1NKN A;  3L75 G;  1BCC E;  2E76 B;  3V5B A;  1IFJ A;  3H1I G;  3O6Q A;  4GKG A;  1RY3 A;  2OYH C;  2R3S A;  1ZN5 A;  1IC2 A;  3P7K A;  3HE4 A;  2O01 J;  4IFM A;  2HOD A;  1IFP A;  2P10 A;  3TGU G;  2WSF H;  1Q90 D;  1FZC B;  1NU1 G;  3SWK A;  2AXT E;  2M0B A;  1NWQ A;  1SQB E;  4ASW A;  2GUS A;  4WVZ A;  3KPE A;  2FYU E;  3H1H E;  2YO2 A;  1NTK D;  3FGA D;  1FBM A;  3A0B H;  1PV3 A;  3P32 A;  2QRX A;  3GHG A;  1DIP A;  1SQQ D;  1OWA A;  1KB9 E;  1X8Y A;  1NTM K;  4OVN F;  3CPW O;  2IFM A;  2E76 C;  4MN4 C;  4EIJ A;  4R4M A;  3I56 P;  2YKO A;  1RE3 C;  1LNQ A;  1SVF A;  1AQT A;  3QH9 A;  3PLN A;  2C9N Y;  1KN7 A;  3LID A;  3SSU A;  1KOR A;  5TJH A;  1FZC C;  2I1J A;  1SLQ A;  3SWF A;  3MP7 B;  4WY4 D;  1S9K D;  3H1H G;  1K9M Q;  1JNM A;  3RL0 g;  2N1T B;  1HJB A;  4WY4 A;  1H0T B;  2FFD B;  1L0L K;  3CCL P;  5APW A;  3WU2 H;  2KS1 A;  4H0L C;  3MHV A;  3Q2Y A;  2OYI C;  3M9H A;  4IFF A;  3MUD A;  2E5T A;  3V4Q A;  2PGD A;  2PP6 A;  2ZFC A;  3E1R A;  1L0N G;  1OZH A;  3ZDM A;  4I2L C;  4ASV A;  1JY3 P;  2WTY A;  1VQ9 P;  4L75 A;  1ZME C;  3L74 J;  2A06 D;  3ITK A;  5H2F E;  1X79 B;  1OIP A;  3H1K G;  3BCC D;  1YBK A;  3M0A A;  2GM4 A;  2I8D A;  2WSC J;  3AEG C;  2N1T C;  3AEC C;  1VF5 C;  2SPZ A;  1CI6 A;  2KLV A;  1IFI A;  5KLV E;  2P2U A;  3MTU E;  2W6J H;  2HPC A;  2NPS B;  2AXT H;  1PGP A;  3H1L E;  4KHX A;  4DZO A;  4ZKU A;  1BE3 J;  2KOG A;  2G8Y A;  1GK4 A;  5B66 E;  1H88 A;  4GOD A;  2XU6 A;  1YIJ P;  1JMM A;  2OTJ P;  4DJG A;  1P84 E;  1JMB A;  1SQP D;  3H1J D;  2JWA A;  4RES B;  4W7Y A;  2IBZ I;  1HJ0 A;  4D6T D;  2P67 A;  3CCE P;  2YIU C;  4IFD K;  2HLO A;  1KYO H;  2YXQ B;  5APS A;  1RF1 A;  1DH3 A;  3CXH I;  1IFM A;  2IBZ G;  3RK2 B;  1EXI A;  2WWW A;  2WPS A;  2NPS C;  1Q7Y Q;  2LR2 A;  1OXZ A;  3HD7 C;  3JSV C;  2K37 A;  2H88 C;  2B87 B;  1NTZ G;  3L70 G;  1JOC A;  3L75 D;  1R8E A;  3VMA A;  2A45 I;  4W80 A;  5AW7 B;  1HTL C;  1X0T A;  1G1J A;  1PPJ E;  3FWL A;  1M1J B;  1FS0 E;  3HRN A;  3FXD A;  2A45 G;  3HTK A;  1SQX D;  3TGU D;  3H32 B;  1SQV D;  1RE4 C;  5CCG D;  2ZVO B;  2Q1K A;  5CCG A;  2JJL A;  1DX7 A;  4A7P A;  3AED C;  3K5B A;  1RF0 C;  2KZI A;  2YKQ A;  1PFI A;  4ZKP A;  1BSN A;  4PD4 H;  1YYC A;  1RQV A;  3CWB E;  3RK2 C;  1M1K Q;  1NTK J;  1HUC A;  5AVY B;  2Y0C A;  3H6P A;  1ZV8 A;  1SQQ J;  2OQQ A;  4DOJ A;  2LXB A;  1EZV G;  1DD4 A;  2ZT9 B;  1BCC D;  1H8A A;  3L35 A;  1GDT A;  1M7L A;  2XKM A;  3OJA B;  4EDF A;  4XFJ A;  3LW5 J;  3U1C A;  2D2C D;  1HWT C;  1PPJ G;  2L5G B;  5APX A;  4BWN A;  2L91 A;  1Y9B A;  1CW5 A;  4C7N A;  2E74 D;  5APU A;  1JCC A;  2FKW B;  3TK1 A;  2W90 A;  1M57 D;  3F89 A;  3VMZ A;  1NTK G;  2HFE D;  3MIW A;  1LTB C;  3EFF K;  1JB0 J;  2FYU D;  3H1H D;  4Y99 B;  1NTM E;  1P84 H;  3M06 A;  1S1C X;  2WPV B; 
#chains in the Genus database with same CATH homology
 5APY A;  4JYB A;  2H8P D;  1JTH A;  2Q5U A;  3NMD A;  1SFC D;  1KQL A;  2OYH B;  2WSE H;  3MD0 A;  1SFC A;  2QM8 A;  3NTN A;  1FOS E;  5CJ0 A;  3VYI A;  2NPS D;  5BU5 A;  2C0X A;  1J1D B;  2NPS A;  1HGZ A;  3HD7 D;  3L37 A;  3M0D C;  1KIL B;  1NU1 K;  4WY4 C;  5AW2 B;  3HD7 A;  3UIA A;  3VP9 A;  1ZR4 A;  4HYT B;  5AW1 B;  1JO5 A;  3HE5 A;  1IJD B;  4WB4 A;  1JUN A;  2XDJ A;  4N78 E;  2J58 A;  1FZA A;  1NKZ B;  2HPC B;  2Q3I A;  3CI9 A;  1YTZ T;  3EFG A;  2HYN A;  2XV5 A;  1YTZ I;  3HUS B;  5AVZ B;  2WPR A;  3TSI A;  3BVH A;  2M8R A;  4AUW A;  3BAS A;  1LTJ B;  2KP8 A;  1G2C B;  5AW6 B;  3V2Q A;  1L4A B;  2C0W A;  3BRT B;  3GHG B;  1FJK A;  1JY3 N;  1LT9 B;  2WT7 A;  4I1L A;  5AVX B;  1N7L A;  5KTB A;  1MZ9 A;  1H89 A;  2IX7 C;  1T3J A;  3V2N A;  4N78 D;  1N2D C;  5APT A;  1RE4 A;  2H7H A;  1N73 C;  1NKN A;  1N7S D;  1VDF A;  1KZU B;  1GL2 C;  2XNX A;  1A02 F;  1JY2 P;  3CLQ A;  4GIF A;  5AVT B;  3V5B A;  1IFJ A;  3A3Y B;  1N7S A;  4GKG A;  1RY3 A;  3G3Z A;  1RF0 A;  2Q7C A;  2OYH C;  2I1K A;  4AQR D;  2YNY A;  3RK2 D;  1ZN5 A;  4W7Z A;  1IC2 A;  3P7K A;  3HE4 A;  2WIT A;  4IFM A;  2J59 M;  4XE5 B;  1ZLL A;  2Q9I A;  2HOD A;  3MGN A;  1WRG A;  3T97 A;  1JY2 O;  1FZB A;  1KIL C;  1SP4 A;  2WSF H;  4B86 A;  1KFM A;  3A5T A;  4LC1 A;  1RF1 B;  2O01 H;  3A2A A;  1FZC B;  1FDM A;  3R2P A;  1NWQ A;  1GZL A;  3BRV B;  1GU5 A;  2FFD C;  2GUS A;  3HUS C;  3KPE A;  1FU1 A;  1LTJ C;  5BVZ A;  2LKM A;  2H43 A;  2POH A;  1LTS C;  1L4A C;  3VMX A;  2YO2 A;  1LT9 C;  1VPC A;  1FZF A;  1L4A D;  1FBM A;  1X9V A;  3P32 A;  4I6M C;  5AVR B;  1L4A A;  3GHG A;  3H32 A;  1OWA A;  1A02 J;  1X8Y A;  1NTM K;  1L0N K;  2IFM A;  2IFN A;  3LIE A;  1URQ B;  3HTK B;  4EIJ A;  1HVV A;  4GT1 A;  2YO3 A;  5KJ7 D;  2YKO A;  1GL2 B;  1RE3 C;  5CJ4 A;  1CSB A;  5KJ7 A;  1T2K C;  1SVF A;  2M3B A;  1GD2 E;  3TNU A;  1GK6 A;  3RK3 B;  2C9N Y;  3U59 A;  3LID A;  3I5C A;  4O9B A;  1RF1 C;  3L36 A;  2BAS A;  1FZC C;  1SQX K;  5CMZ A;  1NH4 A;  2C9L Y;  1SQV K;  3M9Q A;  5AW3 B;  1GTW A;  2I1J A;  5AVU B;  1CI6 B;  4JYC A;  1SLQ A;  3SWF A;  4WY4 D;  1S9K D;  1QL2 A;  2O1K A;  3M0D A;  1JNM A;  1IFD A;  2N1T B;  1HJB A;  4WY4 A;  2R5B A;  3B5N B;  4N3Y B;  2FFD B;  1L0L K;  3VOP A;  3P8M C;  5APW A;  2W6A A;  1AQ5 A;  3M91 A;  5CCH C;  1GW4 A;  1NO4 A;  2OYI C;  3M9H A;  4IFF A;  3MUD A;  3V2P A;  1IO4 A;  3V4Q A;  2PP6 A;  2ZFC A;  4C46 A;  1URQ C;  4I2L C;  3VP8 A;  2FYZ A;  2E42 A;  4C7N B;  1GL2 D;  1N73 A;  1JY3 P;  5AW9 B;  5CHX A;  5CCG C;  5AVV B;  3TYY A;  5AVQ B;  1GL2 A;  3IR9 A;  2WTY A;  1CZQ A;  3RK3 C;  2WPQ A;  1QL1 A;  1MFZ A;  1N86 A;  3RK3 D;  1J1E B;  2OYH A;  1X79 B;  1NOH A;  3VTP C;  3NXS A;  3U1A A;  2KB7 P;  1JTH B;  3PP5 A;  3VMY A;  1JY3 O;  2GUV A;  3M0A A;  4WBA A;  2GM4 A;  1SQB K;  1KIL D;  1SQQ K;  3P8C D;  1KIL A;  2N1T C;  1FOS F;  1SFC B;  3B5N C;  1CI6 A;  2KLV A;  2FYU K;  1IFI A;  1XTG B;  1DEB A;  2R3C A;  2WSC H;  5AW0 B;  3C9I A;  3EQ2 A;  2P2U A;  3MTU E;  4JF7 A;  2HPC A;  2QM7 A;  2NPS B;  2FFD A;  1FZE A;  2KSJ A;  1IK9 A;  3HUS A;  3WMM 0;  2FXM A;  1NTZ K;  3HE5 B;  1LTJ A;  1G2C A;  1LTI C;  4DZO A;  4KHX A;  2YMY A;  1LT9 A;  2OYI B;  4ZKU A;  4HH2 A;  3KDP B;  2KOG A;  1GK4 A;  3E1I A;  1H88 A;  1JCD A;  2XU6 A;  1M1J C;  1Z56 A;  1JMM A;  2WT7 B;  2HG5 D;  5AW5 B;  1IFN A;  4C7R A;  1LGH B;  3BAT A;  1S9K E;  1J1E C;  4RES B;  4W7Y A;  1T2K D;  2P7J A;  1RE3 A;  1XTC C;  2P67 A;  4IFD K;  2HLO A;  5APQ A;  1N7S B;  4M3L A;  5APS A;  1T8Z A;  1KFN A;  1E5W A;  2N9B A;  2A45 H;  1MV8 A;  2W6B A;  1RF1 A;  1DH3 A;  1SFC C;  1FZC A;  3N7N A;  1IFM A;  2P1J A;  3HE4 B;  3KQG A;  2WWW A;  3RK2 B;  2WPS A;  2HOD B;  4LGD E;  2NPS C;  3VN0 A;  1OXZ A;  3HD7 C;  4AYC A;  5AW8 B;  1FZG A;  3N4X A;  1JOC A;  5CCH D;  2CPB A;  2A45 I;  2E43 A;  1AFO A;  5CCH A;  2OAR A;  1LWU B;  4W80 A;  5AW7 B;  2OYI A;  1HTL C;  5AVS B;  3RL0 B;  1G1J A;  1W2E A;  1LTA C;  1URQ D;  1HH0 A;  1JY2 N;  3P8C E;  4OH8 B;  2YKP A;  1M1J B;  1URQ A;  3HRN A;  2A45 G;  3HTK A;  2Z4E A;  3H32 B;  1RE4 C;  3II6 A;  1GU4 A;  5APV A;  3L4F A;  1G1I A;  5CCG D;  1FJP A;  4Y99 C;  5CCG A;  2JJL A;  1DX7 A;  2VRS A;  1N7S C;  1NTK K;  1RF0 C;  2Z5I A;  3V2R A;  2WZ7 A;  2YKQ A;  1PFI A;  4ZKP A;  1YYC A;  3RK2 C;  2KYV A;  3NFQ A;  3M9B A;  1NHL A;  1HUC A;  5AVY B;  3V4W A;  3H6P A;  5KLV K;  3TNU B;  4XA4 A;  1J2J B;  1ZV8 A;  2N1T D;  4N6J A;  2ZXE B;  1LTG C;  2JEE A;  3B5N D;  2R5D A;  4DOJ A;  2N1T A;  1J1D C;  5AW4 B;  3B5N A;  2R32 A;  2CPS A;  3A7O A;  1SQP K;  2W27 A;  1HGV A;  3HD7 B;  5AVW B;  1H8A A;  3L35 A;  1LWU C;  1GDT A;  1M7L A;  2XKM A;  1FAV A;  4WY4 B;  3B8E B;  3OJA B;  1WT6 A;  3SWY A;  3RL0 C;  1LTT C;  2PAJ A;  1HBW A;  3U1C A;  1HWT C;  1LWU A;  3RL0 D;  2L5G B;  3IFM A;  5APX A;  1ZR2 A;  3GHG C;  1CW5 A;  1EQ7 A;  1NAF A;  3LW5 H;  2O1J A;  3KYQ A;  4C7N A;  5APU A;  2IPP A;  5BU8 B;  4EOT A;  2Z5H A;  1JCC A;  2FKW B;  1GW3 A;  1M1J A;  3TK1 A;  2MJZ A;  3O8Z A;  2XZR A;  3VMZ A;  1T3U A;  2HFE D;  3CL3 D;  3MIW A;  3OAK A;  1LTB C;  1MUU A;  3OA7 A;  4Y99 B;  3M06 A;  5KJ7 C;  4LLH A;  1N73 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...