2AEFA

Crystal structures of the mthk rck domain in ca2+ bound form
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
224
structure length
221
Chain Sequence
RHVVICGWSESTLECLRELRGSEVFVLAEDENVRKKVLRSGANFVHGDPTRVSDLEKANVRGARAVIVDLESDSETIHCILGIRKIDESVRIIAEAERYENIEQLRMAGADQVISPFVISGRLMSRSIDDGYEAMFVQDVLATRRMVEVPIPEGSKLEGVSVLDADIHDVTGVIIIGVGRGDELIIDPPRDYSFRAGDIILGIGKPEEIERLKNYISALVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the MthK RCK Domain and the Effect of Ca2+ on Gating Ring Stability
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Metal transport, membrane protein
molecule keywords Calcium-gated potassium channel mthK
total genus 73
structure length 221
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02080 TrkA_C TrkA-C domain
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.870 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Voltage-gated potassium channel 2aefA02
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2aefA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2aefA01
2YDYA 4M87A 3GY0A 5GZ6A 2POQX 3CPSA 2HK8A 2X23A 3H65A 3Q1LA 3S2EA 1XCBA 1NQTA 1E7SA 4L74A 2BFOA 3I9OA 4JCOA 1E3JA 4YJDA 1AXEA 2W98A 2X5OA 4JJFA 3OETA 3SEFA 1S7CA 4GLOA 4ALNA 4PN3A 1P1IA 1XEAA 4CV0A 5GY7A 3BHJA 1ZMTA 1WZIA 5DCYA 3A14A 1X7DA 3AY6A 2FPPA 1ISMA 4K6CA 1I32A 1LQUA 3OF2A 1E77A 5A9RA 3BXXA 3WGGA 2HMVA 2JAHA 1T1SA 4RZIA 1CQJA 1ZFNA 5I8ZA 5JCJD 4J1NA 4B79A 1YL5A 3IP1A 2UUPA 4M86A 1N7HA 4WCDA 2YV2A 2A4KA 3ZU2A 1VSUA 3AOGA 4IZIA 4JP2A 3RFTA 2QHXA 3DWFA 2Q3EA 2EP5A 1B14A 1KVTA 1OC4A 1U3UA 1NX6A 3WDSA 5LDHA 1P44A 1MA0A 3PDUA 4ZQGA 3VPHA 5L3ZA 3D4PA 4E5MA 3KXDA 3OFSA 3HG7A 2Y1FA 3K73O 1UJMA 3K30A 4DMMA 5CG1A 4J9VA 4YS2A 4IQ8A 2YZ7A 1GFSA 3W1VA 1VRWA 2V6BA 1GYPA 4WJZA 4ZQEA 4Z9YA 3DZIA 4E2XA 4J91A 1JDJA 2WE8A 5HM8A 3ZV3A 5HTOA 5DP1A 1PS0A 4CODB 2ZQYA 1KETA 2BD0A 1PJCA 3ONDA 1GV1A 3WYCA 3ZHZA 5JY6A 3EK2A 1U9JA 2PZKA 4FCCA 4H7PA 1YS4A 2X58A 2G0TA 2OP0A 4KP7A 3VTFA 3PK0A 1B8VA 3AU9A 1EE9A 3ZH2A 5B4VA 5IDYA 3TDKA 1T2EA 4XKJA 2E4AA 4AVYA 4DPLA 2BH9A 3SX2A 1LUAA 3GGPA 2C5AA 3ZW8A 5A4DA 1ADGA 1T2AA 3U09A 1CIVA 5KIAA 1E92A 4WLUA 5KVSA 3MWDB 1P1FA 1ZXLA 1R16A 2JD2A 3TZQA 2JFFA 1PJ3A 5JO0A 3DZHA 3I83A 3IUSA 4G5HA 1DIAA 2QRLA 1PR3A 3MEQA 4YJGA 1NVTA 2Y68A 3D3EA 1T25A 2OORA 1T1RA 3IUPA 4JXKA 3L07A 3LZ6A 2DBRA 1A4UA 3NDIA 4XRRA 1P33A 4BNKA 3OMLA 2CDCA 2WJPA 2GLXA 3GOHA 3L9WA 4W4TA 4GGOA 5F1PA 4B7UA 5ITWA 4IS2A 3KZVA 3DXFA 3DL2A 3WGYA 5I7VA 3KV3O 3WG9A 1GTMA 3PLNA 4BNVA 5EQFA 4B4WA 5KCZA 3Q9UA 3FNGA 1H6DA 4BMNA 5IDWA 3VH2A 3IQDB 5JW6A 1TB4A 4I1IA 1IULA 5T57A 4NH4A 3SLKA 3P2YA 3DFUA 2QG4A 1K3TA 1LSJA 3OQ6A 4R16A 1J6UA 3W6ZA 4LISA 1I8TA 1C1XB 1PX0A 4LSWA 1H94A 3R3SA 3F4BA 1PS9A 4NJOA 5CEFA 3JCZA 5JXWA 1LX6A 3PQFA 4FW8A 3SC4A 4IZHA 3KO8A 4YAIA 1DXYA 4G81A 4HWKA 3FR7A 3GMDA 3PHIA 2F00A 3KHUA 1QYVA 3HNPA 4CLXA 2FN7A 1D1TA 1MLDA 1HE2A 1R4NB 1DLJA 4NMHA 3WWZA 1A4IA 2A9FA 3FN4A 4TKMA 3I4CA 3WGHA 4XRGA 1MUUA 3E5RA 2YYYA 4B8ZA 2ZJ1A 3IIEA 1Y7TA 1X15A 4GQAA 3EUWA 4INAA 3DDNA 2X0IA 2W2KA 3E18A 3V5NA 1HDRA 4E6PA 1SB9A 1XQ6A 1KEWA 4AJLA 2VYNA 4MIOA 2NV6A 3UGKA 3LC7O 4CPDA 1VM6A 1PQWA 5JS6A 2GF2A 3FWNA 4PG6A 2O50A 2Q1UA 5KJ6A 4XYLA 6ADHA 3BMOA 5GMOA 1OMOA 3WX0A 1KYQA 1B16A 3ZU5A 4E30A 2HJSA 3ZWOA 4CMHA 3JQBC 5IDQA 4FPXA 4PVCA 4U5QA 2NSDA 1U5CA 3VPGA 1OFGA 3U3XA 3NKLA 4URFA 4R1SA 2CUKA 4PLPA 5F1OA 1ADCA 4JK3A 4CL3A 3P7MA 2ZJ0A 1YGYA 2FZEA 3KVOA 5TQVA 1IB6A 3RUDA 3UHAA 3KYDA 5AOVA 1PL7A 4J2OA 4CQLB 4D3DA 1EUDA 1PJTA 1RPNA 3PZRA 2JD0A 4FDAA 1GUYA 4HKTA 4WOKA 4RVFA 5AVOA 3GVIA 4GWGA 4RLHA 3TNLA 1UXKA 4NU6A 3GN2A 1PGPA 2R00A 4J0FA 4R4JA 2WSBA 1WMBA 2E6UX 2W2LD 5TRTA 3RSHA 4FBGA 3PJFA 1GQQA 2Q4EA 4WLFA 4NFSA 1HLDA 3OSUA 3GN1A 3VHRA 1XIVA 3OQBA 4UREA 1D3AA 4ZVVA 1W6UA 2IXBA 5I7EA 1BXGB 4ND3A 1NQAO 3RASA 4RJTA 2D5AA 4CJXA 1XDWA 4YACA 4YPOA 2E82A 4BO8A 5A02A 5ENDA 1Q7CA 4BQRA 3K2EA 2EKPA 3RJ5A 5JAIA 1SAYA 1QP8A 3DAGA 4J1QA 3MTJA 4RVUA 1YL6A 3GGOA 5T8KC 4OYRA 3ZU4A 4BNYA 3ONEA 4G2NA 3OHSX 3JQ9A 4JBHA 5THQA 1LLCA 2QRJA 1DRVA 2Q46A 2DC1A 3FBTA 3ADOA 3OJFA 5AYVA 5KKCA 2DKNA 5G0UA 3V1UA 1U8FO 3JQDA 1YDWA 1QLJA 4XDYA 2NVUB 1EVYA 3ZNPA 1UZMA 3SXPA 1DAPA 3F4LA 4OJNA 1AUPA 3HDYA 1KEUA 2X22A 5KJEA 2GYYA 3L9XA 1LNQA 5C37A 2XAAA 5HS6A 5G0VA 2PWZA 3WMXA 3JQAA 1HDCA 2R6JA 2X6TA 1LC3A 2VTDA 1PZEA 1U3WA 1PSDA 4DC0A 1EEHA 4JIGA 5TC4A 5GZ1A 3A28A 3RUFA 5A9TA 3GFGA 3DBHB 2Q1TA 4M54A 3L4SO 2VUUA 1C0IA 1Q7GA 2EG9A 1MG5A 1GYRA 3MCVA 3BMCB 4GSKA 4TZKA 1L1FA 3RUIA 3ZHBA 3GZNB 4QECA 2PZLA 4F6LA 4R54A 1DSSG 1GUZA 4R5HA 3VVCA 3FNFA 3MJCA 3O8QA 3RJ9A 4RF4A 5KJFA 1PJQA 4IXTA 1SPXA 1PTJA 2DAPA 4FC7A 5TLSA 1RM0A 4Y8VA 2JHFA 5TT1A 1MXFA 2Q99A 1VKOA 1R0SA 5ITVA 1XA0A 1U28A 2PR2A 2HK9A 2GN6A 4XQEA 1X7HA 2JCYA 3DTYA 4Z3KA 1JQBA 4YRDA 3IKTA 2V6MA 1B15A 4WK6A 4ALLA 4YT2A 3MOGA 4GX2A 2EKQA 5I7FA 1R37A 3GEDA 3P5SA 1CETA 3ZHXA 4UAGA 3JQFA 2PZJA 1LEHA 1BXZA 2GN9A 4C7KA 1QYDA 1I5RA 1TT5A 3BTSA 1ZSNA 3KSDO 3WLFA 3WB9A 3DMTA 1VPDA 4KUHA 4CR8A 2BKOA 3CIFA 4F45A 4J6FA 2ILTA 3QVTA 4HBGA 2CSUA 4IJWA 2DUWA 4ALIA 1QYCA 3ON5A 4RDIA 2QYTA 2ZIZA 3IMFA 4U6QA 4NDNE 4BNNA 2EP7A 2RH4A 4QEDA 2W8ZA 3M6IA 3VPSA 1SNYA 4OM8A 3AOEC 4C4OA 5L4LA 3ENKA 4JP3A 2IEDA 1Q0QA 3INRA 2AW5A 3V1YA 1LDYA 1PQUA 4EW6A 4M55A 2P5UA 4PFJA 4WEOA 4CM8B 1F06A 2D59A 3FRJA 5L7TA 1WXDA 3TZ6A 2EW8A 2YJZA 5AXCA 4NBVA 1C1DB 1QG6A 4RDHA 1PL8A 4FGWA 3QHAA 3JQ8A 4BO5A 1A72A 5A06A 4DWVA 3O9ZA 2ET6A 5G2OA 1KY4A 3MOIA 2G1UA 1HDYA 1DJQA 3A06A 3JQBA 3RWBA 4KTVE 1CQIA 4F46A 5MDHA 1JA9A 4U6SA 2FSVA 4A26A 2GDZA 4TRMA 4CQMD 1N92A 2D5CA 4M89A 2BLLA 3UCXA 1IZ0A 4JBIA 1P0FA 1HDOA 5DBGA 4XQGA 1K6IA 4HFNA 4J7XA 4B4OA 2NLOA 4U7WA 5DBIA 3HE3A 2H63A 4ITUA 1U3TA 4S3MA 4NIMA 1BDMA 5ES3A 1U1IA 5KTKA 1IL0A 3GHHA 3GUYA 1IHXA 4MVJP 3PHLA 1DIRA 2BGKA 3HN2A 3DAFA 2XPCA 1GEGA 3QIVA 3WBBA 3BTVA 3TN7A 1WVGA 1YL7A 3ICPA 3AFNA 3GVXA 1GL3A 1Y6JA 2VHWA 3ONFA 3PRJA 1B26A 2YFQA 4O6VA 2AQHA 4MVJD 1U5AA 1YJ8A 5G4KB 4EBFA 4OKIA 1YQGA 2NWQA 4R41A 3JXOA 3F6YA 5JDCC 2ZTMA 4XGIA 2O23A 5H83A 4GX5A 4FJ1A 4BIIA 4RVGA 4WASA 1BDBA 1LU9A 3U62A 4ZGWA 1FJHA 4BO6A 1PGQA 4MVJF 3RKRA 1IPFA 5DCUA 5CEEA 1DFGA 1SZJG 4ZD6A 4YRBA 1I01A 1DRWA 4TSKA 3VOSA 5DCWA 5TIIA 1TA4A 3TQHA 4BGEA 3DHNA 2I76A 3NT4A 5I7SA 4BOYA 1U8XX 3NJ8A 4HFRA 1YQXA 2NU7A 4LN1A 3UKOA 3H3FA 1H9AA 2IZZA 4J43A 4RPJA 1V3TA 1LDNA 3LVFO 4GX1A 4YWJA 5L9AA 1I3NA 1UAYA 1W4ZA 3BA1A 4DIFA 1EQUA 2C2XA 3FR8A 1DDOA 3ANMA 2VWQA 1T2FA 3PIDA 3M2PA 3JYPA 5JE8A 1V35A 2GD1O 1WDLA 1P1KA 2DUUA 3CXRA 3BHIA 4I9HA 3SLGA 4FS3A 4NG5A 4DL9A 2IZ1A 2Z95A 5ADHA 3RUEA 2FOIA 2WWRA 3ZI0A 4F6CA 5KVVA 5F1KA 4D42A 1T2DA 4BGVA 4BNIA 1DC5A 1CDOA 3AI1A 2P68A 1QR6A 1WLYA 1XYGA 5EJ2A 2C59A 4IIVA 1UZNA 3H3JA 4PLWA 3PZBA 4RF5A 2VYND 4MVJI 4NBUA 2AEMA 1DHTA 5JDIA 3BAZA 3KSZO 4KUGA 3CINA 4LVCA 1AXGA 4P4LA 1NHWA 3WIEA 4DREA 5IZ4A 3SVTA 3W8DA 4WGGA 2JJYA 3GEGA 3UCFA 1I0ZA 1NTOA 3DEYX 4QFDA 4CM3A 2NU6A 4Z0PA 5KKAA 1SEPA 4EEXA 3MZ0A 3H9EO 3H9JA 4Z9FA 4YVFA 1Q2XA 5KVCA 1M67A 4MOWA 4PRKA 4Q3BA 3C24A 1MV8A 2PKQO 3DOOA 2WD7A 1A27A 2OP1A 4BNWA 4GH5A 1B3RA 3UVEA 4PZDA 5CG2A 3FI9A 1SB8A 3PQEA 4D44A 1HL3A 2NQ8A 1Z7BA 3FTNA 4XYEA 3GA0A 2NTNA 5BQFA 4Y67A 2DPHA 2IDZA 4OKNA 4WCFC 1SBYA 5DBFA 4DC1A 4ZICA 5DNAA 1O89A 4TROA 1SEVA 3PDJA 1J5PA 2YQ5A 1UAGA 4UEOA 1ZH8A 2LDBA 1GCOA 4MDHA 3HFSA 1HYEA 1Z6ZA 2JD1A 4RORA 2NTVA 2YHIA 1ISIA 4KWHA 4XYGA 1RM5A 3L6OO 1EBUA 4S1VA 4LCEA 1P45A 3NT2A 5A3VA 1FDTA 4J7CA 5G0SA 2VZ9A 2NM0A 3ROQA 1GY8A 4KZPA 1DFIA 1ZJYA 2B4RO 1HE5A 1TI7A 1ARZA 1GZ6A 4DLAA 2PKRA 3N58A 2X5JO 3KEQA 2VTEA 2VT3A 2GNAA 3MJ4A 4CMIA 3OJLA 3QA9A 4IDFA 2VZ0A 4E31A 1LSOA 2WE7A 1NVMB 3JTMA 4XB1A 3IDSA 1GZ4A 4GMFA 4TVOA 3LF1A 5BNFA 1BTOA 2NNLD 2FR1A 2HU2A 4YAEA 3WYBA 1GPJA 5I9LA 4WNCA 4J16A 1VL6A 1PGNA 3CMCO 3ETEA 3U49A 5KNLA 4PLVA 4Y98A 4R9SA 1U3VA 1PIWA 1VJTA 4ND1A 3WGZA 5GZ3A 4NHEA 3WS7A 5H81A 2IODA 4R1NA 2I6TA 3QLJA 4OQYA 3CZMA 1I30A 1NM5A 1XU7A 3T7EA 4CMJA 1Y81A 4RF2A 5A05A 2E37A 4XDZA 4EUFA 3JD3A 1QYWA 3EC7A 4Z0TA 4CLRA 3WQRA 3EMKA 3G0OA 7ADHA 3WSWA 1YBAA 5JDIC 4L76A 1C1DA 2ZTLA 3PWKA 2IE0A 4QFCA 2RHRA 3IL2A 4I5EA 2FP4A 5CPFA 4PGFA 5COQA 1MX3A 2C0CA 3Q2IA 2D1YA 3PWZA 4GKBA 2ZTVA 1F17A 3OEYA 4BKRA 4LRTB 3UFXA 1DB3A 2PH5A 3M1LA 2ZYGA 5JC1A 1ADFA 3PYXA 5EESA 2FHSA 3I1JA 1ENOA 4IJUA 4XA8A 3TZCA 2IYOA 1Y5MA 4E4YA 1G6KA 1ONOA 3DZGA 2Y1EA 1E7YA 1EVIA 3I9NA 3H9GA 2Q45A 2AQIA 4XR9A 4RL6A 6LDHA 3KUXA 2Q2QA 1IY8A 1QV7A 5CHEA 3U4HA 4RPKA 3I52A 4JROA 4KDEA 4ZA2A 4DVJA 2IYPA 2RH8A 1EUCA 3GAZA 5CDTA 1E1NA 3ZWCA 1ISFA 3GAFA 4KQXA 3E03A 5ENVA 1SCUA 1TT5B 3G1TA 3HN7A 3LK7A 4CV1A 3RUAA 1XLTA 4D43A 3C8MA 4KUEA 2J3HA 2IEBA 1KBZA 2W4QA 2BFAA 2FY8A 5B1YA 2B37A 3AM5A 4O5OA 4N7RA 1X1TA 3B1FA 1XU9A 4W99A 3KLMX 2DBVO 2D8AA 4BV9A 5L45A 1V3VA 3GG2A 1DOHA 4BNZA 3OJEA 4NR0A 2OL4A 3JD1A 2O7QA 1Y8RB 2LDXA 2VZ8A 5JSFA 3IJRA 3CZRA 2C7VA 4BL5A 2UAGA 3RI3A 2QW8A 1MGOA 4XIYA 1AN9A 4YYZA 5AQ1A 3H5RA 2AE1A 4PZEA 4RCVA 3GLQA 1ZW1A 4B3HA 1LI4A 3ASUA 3Q3CA 1VLLA 3KBOA 1SOWA 2HSDA 1GR0A 5FEUA 2P9CA 3JSAA 1MFPA 1Q7BA 3AI2A 3GPIA 5JLAA 1F14A 4KQWA 2ZYDA 4E5YA 1HXHA 2X9VA 2YHUA 4BO2A 1JVSA 4RZHA 2X8LA 3U0BA 1GU7A 2X9NA 4O1MA 1K6JA 1R66A 1WAMA 3OQ1A 2HMTA 4XYBA 1EVJA 1KS9A 3S2GA 3B20A 2EV9A 5JMWA 2XXBA 4BB5A 1UDAA 5A1TA 5B37A 4Q3AA 4B8WA 4BKUA 5LCXA 2GRAA 1ZNQO 4I8XA 4CLHA 1O94A 3RBZA 1V8BA 5U1PA 4CM4B 1XR3A 1NWCA 4OSPA 4XIJA 4EYEA 4RVHA 5TX7A 3OBBA 3K9QO 2PD6A 4XJSA 4Y6SA 1PGJA 3C3XA 4DTIA 3UCEA 3JYOA 1PR9A 4FGSA 4PRLA 2WMDA 4D79A 4QO8A 4BO7A 2DU8A 4BNHA 2VHYA 2VRBA 2DTDA 3GVPA 4N18A 1KOLA 4CMCA 1PL6A 1UP7A 4K28A 4MKXA 1HSOA 1TEHA 5CDYA 4OXNA 3C7DB 4I5FA 4ZN6A 3F47A 1LRLA 1NNUA 3JD0A 5BNTA 3DOCA 3GR6A 4YJFB 2ZQZA 2VQ3A 3FCOA 4XYMA 4PZCA 3QSGA 3ZDFA 4P8RA 1G0NA 4NBTA 1LTHR 3CSDA 4Q3CA 3I5MA 1U7HA 3QVOA 4GAEA 4BNTA 1JU9A 1E3SA 3B70A 4O0LA 4Q3EA 4KTTE 4GPD1 1MB4A 2EEZA 3F3SA 2VHZA 3DOJA 4FIZA 4P4GA 2C20A 1EK6A 3AUAA 2Y05A 3HHPA 2DQ4A 2NADA 4DIOA 5BSGA 4WLVA 4J49A 4CUKA 1PZHA 2JL1A 3NV9A 3JV7A 3H5AA 3BMOB 5A03A 5L7WA 5HRUA 1TVEA 1V9LA 2J8ZA 1D7OA 2HKIA 4FFPA 3WTBA 1E5LA 2WDZA 2YY7A 1ADBA 3AM3A 3AUTA 2GZ1A 3ETGA 1FDUA 4XGKA 3WQSB 4XR4A 4LMPA 5L95A 4MVJA 2JAPA 5T5QA 2GN4A 4CM1A 3FSRA 2YQ4A 1I10A 4YAGA 2E48A 4YCAA 1U4SA 5ILOA 2Y0CA 5TGDA 1ULSA 2DBZA 2PA3A 3GC6A 5F5LA 3ST7A 1WPQA 4PLTA 2O2YA 4NJMA 3RUCA 3K8ZA 5ER9A 5LC1A 5MGBA 3HZZA 1ISHA 2OUIA 4B3IA 3EHEA 4MVJG 4OL9A 3F5SA 4B7CA 2Q50A 3ULKA 4I9NA 3MJVA 1P1HA 5U9CA 3IOYA 3WNVA 1B2LA 4B4VA 3IC5A 1HTBA 3LT2A 3PXXA 4NFHA 3I6QA 1R4MB 1P3DA 2FR0A 3T4XA 2HAEA 4CM9D 4RGBA 2QZZA 2AQ8A 2I5PO 3F46A 3QV1A 1ENYA 2B5WA 2C54A 1L7EA 4BHTA 3GGGA 1R4NA 4N5LA 1JAYA 4C7JA 1F8GA 2NUAA 1H9BA 4KMSA 1A7KA 1YXMA 4YAJA 4TKLA 2BI8A 5EINA 4E5NA 5K0ZA 3NX4A 1MG0A 2B69A 4IQ0A 1R0KA 2NU8A 1EUZA 4WUVA 3NTQA 1O9BA 2Y93A 5L51A 3NTRA 1GEEA 3DO5A 3EAGA 3L77A 4BV8A 1B8UA 5JYEA 1QYXA 3NEPX 4ND5A 4D45A 4WEQA 3K92A 1KEVA 2J3KA 3DBVO 4AICA 4IS3A 3LC1O 2OOSA 1HLPA 3G1UA 4MJLA 1BGVA 4BO9A 2G5CA 1CERA 5ICSA 1EQ2A 5TNXA 4DPKA 1LA2A 1XWFA 4J4TA 3RQSA 2ZTUA 2J3JA 1PZFA 2AMFA 3ZHYA 3DBHA 4M49A 1GUFA 1YB5A 2DM6A 1M6WA 1NAIA 4LW8A 1BXKA 1BMDA 3JQ7A 1YH3A 1AHIA 3F9IA 1ISJA 4WOJA 1VL8A 4IJKA 4BKPA 3C7CB 2O4CA 2BKAA 1H2HA 3OM9A 5HWSA 1ID1A 1W0CA 3EZLA 3LT4A 3Q6IA 4IJVA 2HJRA 2I99A 4IIUA 1P1JA 2PD3A 4A27A 7MDHA 2JFHA 1O95A 2B4QA 3D3WA 4Z3DA 1AGNA 1C0LA 1CJCA 4PVDA 3MJEA 4FJ2A 3JYNA 4PLYA 3SJ7A 1X0XA 3AJRA 2BKNA 4I5GA 3H7AA 3WOHA 2ZB7A 3O03A 4AJ4A 2VHVA 2FZWA 3ASVA 3L6EA 4FOOA 2I9PA 2HO5A 2UDPA 4BKOA 4FJ0A 4JX8A 2EERA 3WGQA 4AJ1A 5IF3A 1UDBA 1A5ZA 5B12A 3JQ6A 1ONPA 1O0SA 1B7GO 5JBIA 2AA3A 3H6KA 3RIHA 3BMNB 3CTMA 3X2EA 1GDHA 1KERA 3BTUA 4D41A 1BXGA 1M75A 3RC1A 4AJPA 4FD3A 3DONA 1A9YA 4K9DA 1DJNA 1EMDA 4MIEA 3AK4A 3RUHA 2VCYA 3BIOA 4J4HA 2CVQA 3TRIA 4K1LA 3WICA 8LDHA 2P2SA 3AUSA 2OGUA 1E6WA 2JCVA 2PGLA 5T64A 2I65A 3HUDA 1P74A 2CD9A 3JQAB 3NDJA 1WDKA 2YDXA 4IPTA 3VKVA 3LU1A 1QORA 3KTDA 5CDUA 4LGVA 1IZ9A 3OJOA 2ZCUA 4CMGA 5IZCA 4NBRA 1IPEA 2FWMX 4RPHA 5JFOA 5HS4A 3PGJA 3IS3A 4E12A 3INTA 3IP3A 3LQFA 4X54A 2EWMA 5JC8A 2O3QA 3BMCA 9LDBA 4WLOA 1R0LA 2P4QA 3WIDA 1SMKA 3K6JA 1NVGA 4IQGA 4JGBA 5COBA 4J2HA 5FI5A 4B7XA 4TMFA 3OIGA 3ZZNA 3Q11A 3WGOA 2VYVA 4JJGA 4PLZA 3F5QA 2JKVA 4ZQBA 2I67A 3WYEA 1VSVA 4BNGA 1BW9A 2WYVA 3WBFA 1JKJA 4XQ9A 2WYWA 4CQMB 1XSEA 4DBZA 1PJLA 2PLAA 4L0QA 4D3FA 1PWXA 2OZPA 4IDCA 2AQKA 4HUJA 3M1AA 5F21A 3AOEA 3DB2A 4IGFA 2EJVA 3GMSA 5IDXA 1LJ8A 2C5EA 2W2KB 3EGOA 2BKPA 3DHYA 3L4BC 3DAPA 2VNSA 3TZKA 3PTZA 2B35A 4A73A 1R4MA 1DIGA 5BNIA 1NASA 2DTEA 5JAMA 3ANLA 2GERA 3LT1A 1ZZEA 4OAQA 4TRJA 2C7GA 1JKIA 4UVDA 4U0KA 3DZJA 3KYDB 3PVZA 1Z73A 5TF4A 1E3EA 3GQVA 5G4LA 2H6EA 3OH8A 4NFYA 4A7PA 9LDTA 2O48X 2VOEA 5THKA 4DRYA 1F8FA 1LBEA 3W8EA 2X0JA 4DYVA 1P31A 3GVCA 5H82A 1XGKA 1PJSA 2CFCA 1FDSA 4NPCA 4KDFA 2G17A 4QSMA 3GK3A 1X13A 2I66A 3KYCB 5U4QA 3RC7A 3I9LA 3AI3A 3KYBA 3EZYA 4PG4A 2IRWA 3ZNNA 2PNFA 2GUGA 1Y1PA 1E6EA 5TJHA 2DFVA 2UUOA 1NQ5A 3QVXA 1B3BA 4W82A 1PWZA 3HQ4O 3HADA 1YVEI 2ZKLA 1F0YA 1R15A 2RHCA 3B1JA 3DC2A 2AG5A 1OZAA 4NQZA 3OICA 3S1LA 5CPBA 1LDEA 3TPCA 3PHJA 2Y1GA 3V2UA 3VDRA 5BR7A 3VC7A 2P4HX 2OMEA 3I9MA 5A9SA 4E13A 2HUNA 4HY3A 3RFVA 4AL4A 1A71A 1C14A 1NFQA 3D1LA 4QUKA 2RIRA 1QLHA 4EITA 4LVUA 4YJHB 1M66A 3E5MA 4FFRA 4E21A 4OSOA 4JLWA 1HEUA 4IXWA 4QTZA 4CMEA 1N7GA 5COAA 2YUTA 3STHA 3JQ9C 4TRNA 4BO1A 4J90A 3JD4A 1ML3A 3K96A 4HV4A 1ZUD1 1CWUA 1ORRA 1W73A 5JPIA 4P38A 4GVLA 1LSUA 2ZB8A 1DIBA 2D0IA 2HDHA 1FDVA 2Z1MA 3L0DA 4WPGA 1H6CA 5DP2A 4Z6KA 5A04A 5JY1A 2NVUA 1UH5A 3AFMA 1JKFA 5CDSA 4HX5A 3W4IA 5AXDA 4BNUA 2X7HA 3OA0A 3I3OA 4CLOA 4IY1A 1PZGA 3E9QA 3FNEA 1M2WA 1T4BA 3IJPA 2D4AA 1DAOA 4BUCA 3ENNA 1DC6A 3BMQA 3E48A 1WNTA 1IYZA 3K2BA 3HDJA 4TWRA 4RVDA 3QP9A 1KVRA 4WCFB 3NDRA 5FI3A 4BNJA 4LK3A 4A2CA 2CDBA 3VH4A 4Y9DA 4EDFA 1AE1A 3VPXA 2EKLA 5EN4A 4DLBA 1OAAA 4R9RA 3HB4X 3VKUA 3H9UA 4ILKA 5EIOA 3ZW9A 1NR7A 1C0KA 4EGFA 4N5MA 3CE6A 3RD5A 1ZMOA 4BO3A 3C1TA 5K6AA 4RF3A 4OO3A 1VE9A 1Z75A 1HSZA 3UUWA 3C1OA 2B36A 1HYHA 4PCVA 3QWFA 5BT9A 1NBOA 3PI7A 3U4CA 2YFHA 3DBRA 3VZQA 1NHGA 1NPDA 5AXBA 3PIIA 4WECA 1Y8QB 1WWKA 3WJ7A 5K6AC 1ULUA 5JO9A 4A0SA 5BSHA 1HF3A 3V2GA 3WXBA 3LSYA 3DZFA 4HFJA 4HNHA 2CZCA 4AJEA 4LRSB 2X1HA 4GL4A 2Z5LA 1PJ2A 4L73A 4HXYA 2EHDA 3D64A 4YJHA 3PFFA 3TL3A 3ZWXA 4AJIA 2Y99A 3FBGA 3DQPA 3JYQA 3M2TA 3S55A 3PFWO 4FFLA 4WE3A 1D4FA 3D4OA 4AJOA 1GCUA 2OFPA 2Q1SA 3A4VA 5EERA 1WDMA 3GPDG 4DMLA 1EBFA 4I5DA 1WMAA 1SC6A 1ISGA 4P4NA 3WLEA 4DQXA 2PH3A 4IGEA 4PIVA 3FD8A 3C1AA 1IUKA 4QX6A 3ZNQA 2NTJA 1FXSA 1HT0A 3Q0EA 4UUMA 3JQGB 2WD7B 2RAFA 4XX0A 3PJDA 2W2LA 1HE4A 3ITDA 3RKUA 3Q9NA 3UH1A 2VWHA 3GNQA 3LF2A 4BGIA 1K5HA 4IINA 3NGLA 4OHUA 4RQUA 5I9MA 2O3TA 4GWKA 3H5NA 4BMVA 4OQZA 3GDFA 1JN0A 4ZQFA 4NNJA 4F3YA 3TZHA 3E8XA 3EW7A 1ENZA 2AEFA 3AY7A 3DBLB 1NPTO 1HDGO 3LLVA 4DQUA 2DVMA 2I3GA 1N1GA 5JNLA 1PU2A 1EE2A 4YQYA 2Y1DA 1KVQA 4BGUA 5L53A 2X5KO 3HFGA 5HBRA 2WEKA 2SCUA 4YJFA 3TFQA 2UVDA 1VJ1A 1RYEA 4MP6A 1HWYA 2HRZA 2OBYA 4CM4A 1VI2A 4MPDA 4IDEA 3EDMA 1PQPA 4CQMA 5FWNA 2BGMA 2Y67A 4RV9A 3JYLA 1BVUA 1C0PA 2Y0DA 1SOVA 3W8FA 1MFZA 5ER6A 3QJ5A 1JLLA 2O7SA 2YHIB 2DLDA 2BFMA 1RWBA 1O8CA 4OMUA 2B0JA 4RPGA 4IBOA 4E3ZA 1T2CA 3PWSA 4AJKA 1Y8QA 2EJWA 2ZB4A 4QO7A 2GN8A 3KLPX 4AFNA 4O59O 1YOVB 3DR3A 2P9EA 2B5VA 1H6BA 4TVBA 3H8VA 5KJCA 4H3VA 4FN4A 3TSCA 1U4OA 2UYYA 1NWHA 2VN8A 1FF9A 3PEFA 1F12A 2A35A 2WD8A 1DBVO 3GNSA 4MKRA 3V2HA 5IXSA 3WMWA 5T67A 4NK5A 1N1EA 4AJJA 5KOIA 4W6ZA 3IAHA 2Q2WA 1NAHA 5G4KA 4E32A 3TFOA 1VCTA 5L4NA 3AW9A 2BF7A 1Y9AA 1P0CA 2GPTA 5ICMA 2G76A 2FPIA 2ZCVA 3PYLA 3Q2KA 3QY9A 3TWOA 3LYLA 4Q39A 2GCGA 4FFOA 4DGSA 3BHMA 4NBWA 3OIDA 1Z82A 4W7HA 2R00C 1RJWA 4R1TA 1CYDA 3WWYA 1S6YA 2CF5A 1CRWG 1DO8A 2JFGA 1Y8RA 4RLSA 4AG3A 1IE3A 4NZ9A 1MP0A 1D8AA 1GYQA 3HDHA 3NT5A 3RU7A 3VH3A 4JJIA 3E6AA 3VAZA 3HSKA 4YA6A 3E9NA 2Y1OA 4P22A 2UV8A 4R5MA 4BS9A 3E9MA 1JWAB 3TOZA 2QX7A 1LLUA 5C5IA 2PTGA 3NYWA 1QRRA 1E6UA 3JQGA 3PPIA 3R0IA 1B8PA 2DTXA 4BNLA 3ROPA 4UVHA 3NTOA 2GO1A 3EVTA 5DT9A 5A5EA 4N54A 4JN6B 4J7UA 3ZWNA 3A9WA 3ZGYA 4D46A 3ZU3A 5DF1A 5CDGA 3D4NA 4R69A 1E7WA 2HQ1A 5DOVA 3MTGA 3HDQA 4ESOA 4DQVA 4UVGA 2ZB3A 4ZJUA 3GVHA 3HB5X 4CM8A 1YONA 4CMBA 1HKUA 1U2DA 1V6AA 4BNXA 3ZN2A 4MINA 2P91A 1YQDA 3KETA 2O4UX 2PV7A 3D5QA 3KOUA 4Q9NA 3GEMA 4XWYA 3GG9A 3CH6A 2IXAA 1UXGA 3KB6A 1ZXBA 1H93A 3JQ7B 4YT8A 3N74A 2RCYA 2J3IA 1NQOA 5C7LO 3CEAA 4Y6PA 1YDEA 1P9LA 2VRCA 2E49A 4YJGB 2YW9A 3WGTA 1VJ0A 1A9ZA 1R6DA 3GT0A 4J4BA 3JQFC 2EGGA 4M1QA 4Q3DA 3SC6A 4CMEC 3PQDA 5TJ9A 1T4DA 5CEJA 1YRLA 2DT5A 2J5KA 2CVZA 2QRKA 4QQRA 3HJAA 3RVDA 3FF4A 3VZSA 4PG5A 3FTPA 4OGWA 1LRKA 1T24A 4UUPA 2YV1A 3LT0A 3DBRB 1UDCA 1KY5A 3UW3A 5DDIP 5AXAA 3CMMA 1E1LA 2AG8A 4FR5A 4YBZA 1IHYA 2CVOA 1LXCA 1YWGO 3GZ4A 4D0RA 4JBGA 2FPGA 3DMYA 3H9QA 1GD1O 1N8KA 3L6DA 5KWEA 4ALMA 1KIFA 1ZCJA 4DIBA 3H4VA 4LSMA 1X14A 3ORFA 1C1XA 4YRAA 2B83A 4K26A 3ZWAA 3GZNA 3CKYA 1NXQA 3G17A 5F5NA 3ZV5A 2Y66A 4YTEA 1H6AA 4BVAA 5G0TA 2G82A 4HP8A 3U4IA 3S2FA 2GGSA 2VUSA 1PS8A 1WP4A 1E5QA 2VUTA 4GVXA 2BRUA 3EY4A 4JQCA 3QRWA 4FFNA 5CFZA 4AJ2A 3B1KA 3VZRA 2OHXA 4R01A 2EXXA 4CLOB 1LLDA 1UXIA 3I9JA 3RC9A 3SJUA 2V65A 4GMGA 1YBMA 4NK4A 4XTTA 4ID9A 3N7UA 1KVUA 2Y1CA 3V8BA 1JWBB 4CV3A 1EFKA 4E2WA 4NI5A 5T8KA 4U0JA 5L7YA 4DUPA 1H0KA 4R3WA 2NQTA 4CM6A 3ZWPA 4B3JA 4FFMA 4CM5A 4CL8A 1PJ4A 3G49A 4MP8A 3I4FA 4ZRMA 4L75A 2O3RA 3DZKA 1PEDA 3AWDA 3VPFA 4RO0A 2PGJA 3DBLA 4ZQHA 1NYTA 4EUEA 4E5PA 2HMSA 4H16A 1CF2O 3RAJA 1UR5A 2V6GA 1U2GA 1VC2A 1GAEO 4XJTA 2QIOA 3E82A 4ONEA 1E3WA 3OP4A 3WJAA 1QMGA 2EIHA 4RVSA 4AJHA 3ANNA 3WGIA 4CV2A 4BO4A 3ADPA 1KC1A 3GRPA 1NR1A 1Z45A 4FOSA 1N9GB 3GHYA 4GSLA 4WNIA 1ZKMA 1Q0HA 1EK5A 1DRUA 3BZUA 4YQZA 3VDQA 4B4UA 4D7AA 5IZCC 4N5NA 4CQLA 1UP6A 1RKXA 2DFDA 2FRDA 1QKIA 1NP3A 3BTOA 2NVBA 2PKQP 4WLNA 2EF1A 2Q49A 1EZ4A 1LC0A 3R6DA 5IJZA 4OXYA 1LDBA 1YJQA 3ETDA 3RC2A 4NU5A 3AU8A 1N2SA 4L4XA 1E7QA 2EGHA 2PD4A 5I8WA 1DIHA 1E1MA 1HRDA 3U5TA 1YBVA 3R3JA 4U8GA 4G65A 3T7CA 3UF0A 3PP8A 4PLHA 4CM9A 1LDMA 3D3WB 2PY6A 3PLRA 4DYDA 4YEDA 3OIFA 4II2A 2VYVD 3UOGA 4YR9A 3O26A 2HRBA 2V7PA 4Q3NA 1RM4A 1B0AA 2WTBA 3GF4A 1GZ3A 1BHSA 5IXYA 1FMCA 1TT7A 4CLRB 3DFZA 2QZ9A 3NGXA 4GBJA 1DPGA 3PHGA 3P19A 1DC3A 3WFJA 5JAQA 4FB5A 3HWRA 2DPGA 2CMDA 4LMRA 4OH1A 3WFIA 4DLLA 2EW2A 3K31A 4RQTA 2CY0A 2GSDA 4TQGA 3INGA 2JCXA 1SO8A 4XCVA 4CUZA 1U7TA 1OBFO 1ZK1A 3UAGA 2X9GA 2VT2A 5EL0A 1E1KA 4GLLA 1ZK2A 1E7MA 5A9SB 1XHLA 3RBXA 1IOLA 2ZATA 4ROSA 1H2BA 5BSEA 3AM4A 4YT5A 5B4TA 3E1KA 4BNFA 4XQCA 1Q1NA 2QQ5A 1ENPA 3BYZA 4XEHA 4PG7A 4MVJE 4ALKA 4HFMA 2PZMA 4YXFA 3QW2A 3WSVA 1QXSA 2XXJA 3W6UA 1D1SA 1G0OA 5DULA 3QVSA 3GDOA 4MKZA 3I6IA 5FF9A 4GKVA 1NFFA 4XZ3A 1XELA 2VHXA 1O6ZA 4IUYA 4YAKA 1EDZA 4ZRNA 3D0OA 3RFXA 4UULA 4E2YA 5ILGA 4DA9A 1K6XA 1A7AA 1EDOA 2VOJA 2F1KA 3QQPA 4I9UA 3NJ4A 4BQPA 1G1AA 1OOEA 3PJEA 3TOXA 4W9NA 1JW9B 1LSSA 2ZK7A 1N5DA 4ZU3A 1JTVA 3TJRA 1I3LA 3A1NA 2AHRA 4M8SA 1YOVA 3SBOA 4EUHA 5IG2A 2HLPA 4R68A 1DLIA 3GFBA 8ADHA 4E0BA 1FDWA 5TS3A 3VVBA 3ZWMA 1J49A 1LLQA 3MJTA 3AUUA 5IN4A 2A92A 4FC6A 3TL2A 3JQEA 5EQDA 4UVEA 1CEQA 4L4SA 3VZPA 3WR5A 3KSUA 4YB8A 4IDDA 2PFGA 2XOXA 2ZYAA 3U4DA 1YB1A 1J0XO 3L4BA 2BELA 1MXHA 4IDAA 5HA5A 1XKQA 1ZK3A 4BNMA 4Z9XA 2C29D 4PLGA 3ROKA 1P77A 1VL0A 2HCTA 4IMRA 3OA2A 1ZK4A 3ABIA 1J4AA 1QV6A 3ZWVA 1UXHA 2H5LA 1GQ2A 5FFFA 2D2IA 3B6ZA 3FPCA 1MC5A 4EEZA 5A5FA 1LQTA 2Q1WA 2X4GA 3FWZA 4GGPA 4R3NA 4WKGA 1OC2A 1ZSVA 5FYDA 4CMAA 3G3EA 1EFLA 4E2ZA 2P9GA 4OIMA 5EMHA 1HZZA 3KYCA 3KRTA 1ZBQA 1E0DA 3PGXA 3ZNOA 4L8VA 3DZBA 3OECA 4A5OA 4E33A 2HMWA 2C07A 2FMUA 2FR8A 4BO0A 5A3JA 4IM7A 4BMSA 4OOFA 3K5PA 3RBVA 4FSHA 4IDGA 1HETA 5IFLA 3JD2A 5JYDA 1K89A 1BSVA 1PGOA 3AY3A 1UUFA 3OJ0A 4E5KA 4FQ8A 2O2SA 3WTCA 1V0JA 5L4SA 1GV0A 1LDGA 5DOZA 2NU9A 4Z0HO 3DTTA 1KC3A 4L9RA 4EJ6A 4R51A 4K6FA 1V3UA 4J1TA 3S8MA 2BI7A 3GNTA 3JQAD 3ZWBA 2O3JA 2AXQA 2NACA 3O8QB 3WQQA 1ZJZA 2GZ2A 1XG5A 2C2YA 1BW9B 2BGLA 4W9NC 1Y5RA 4DXHA 3MWEB 3LDHA 4H15A 4KOAA 5IAAA 3EYWA 3D7LA 3DHEA 1BG6A 1KEPA 4MVJH 5J23A 4PLFA 3UXYA 1X7GA 3X2FA 1ZEJA 3QVWA 1DC4A 4PG8A 4UEJA 5DN9A 3JQCA 4J0EA 1ZEMA 3S2IA 4ND4A 1KVSA 4UEKA 4IMPA 2OO5A 3OEWA 4J3FA 3D5TA 1BRMA 4GI2A 4HADA 2O3SA 1YE3A 3QE3A 2Z1NA 4ND2A 4OXKA 4D0SA 3ROMA 1WZEA 1X1EA 4RPLA 4DPMA 3UN1A 3KEOA 3WNQA 4QT0A 2JHGA 1C3VA 3H2SA 4LCJA 4EJMA 1GQYA 1ZK0A 5G0WA 2BHLA 1UZLA 1DEHA 1ZVMA 4WCFA 3V1TC 2WM3A 2TMDA 2BMAA 4UUOA 1X0VA 2X86A 4MIYA 5C7IO 2RBEA 3F1LA 3G79A 2TMGA 3ITKA 4QXMA 4MP3A 2NVWA 2J6IA 5DZSA 4A03A 2GASA 2HMUA 5K9ZA 1LRJA 3QWAA 4CMKA 2B4TO 1E3LA 3QWHA 3IKVA 3O38A 3LC2O 3QWIA 4KWIA 1R12A 2IZ0A 3O4RA 3VTZA 1GADO 1I24A 1M6HA 3W4KA 1MC4A 2PK3A 2AEJA 2Q2VA 3BMNA 3TF5A 2VWPA 1BWSA 1JVBA 4TRRA 2O3UA 4MVJM 4YDRA 4XGNA 1Z74A 5C3MA 1HE3A 4CR7A 5CAEA 1AHHA 1UXJA 4ZHSA 1YKFA 4YT4A 3C85A 2XF8A 1I2BA 5JCXA 1UP4A 3I23A 3RCBA 2X0RA 4UVIA 3I9KA 1NFRA 2DBQA 2VWGA 2X0NA 3JQ8B 1E3IA 1M76A 2PGDA 3FHLA 5IN5A 3ZV4A 3NAQA 4II3A 4PLCA 3P2OA 5EPOA 3FNHA 1EVZA 5CP8A 4DBVO 4MO2A 1BVRA 3DMTC 4A10A 3KM0A 4BB6A 2GZ3A 1K2WA 1WW8A 2OBNA 4JNKA 5L40A 1Q0LA 1I2CA 1ZSYA 1HDZA 3U9LA 3RU9A 3PYMA 1I36A 4XD2A 3LLSA 2HK7A 4CLEA 1YB4A 3GRKA 2YV3A 3ICCA 4J1SA 5BSFA 3GH3A 1I3MA 1RM3A 2Y0EA 1DFHA 1N9GA 3ZV6A 1XQ1A 2Q4BA 1FK8A 3H2ZA 2OXIA 4D3SA 5TT0A 3COSA 1YO6A 1P1RA 4O63O 5JMPA 5I9NA 1L7DA 1I2ZA 1DHRA 4EZBA 5LDGA 3BMQB 2H9IA 5T6BA 1TXGA 4TZTA 3QWBA 1PJBA 1ONNA 1Z7EA 4W7IA 4CUJA 2WYUA 1OI7A 1Y9EA 1RYDA 1HZJA 2C82A 2R2GA 2GR9A 2P5YA 3GDGA 4OOEA 1H5QA 5JCJA 3ZCXA 4CR6A 3FPLA 4J9UE 1K0UA 2J5RA 4HNGA 2VRCD 2CDAA 3VH1A 3R1IA 3CUKA 2W90A 5JAZA 2VNAA 3F1KA 3GUCA 4I08A 2H1SA 1ZIDA 2AE2A 3ZWYA 2FSSA 4XB2A 2I3AA 4ALJA 1ZO8A 2D3TA 2A94A 2QYSA 4GX0A 4NJMB 5KJ1A 3NRCA 4CM7A 5B4UA 5TSDA 1TLTA 1E7RA 2CNBA 3ZWWA 1T26A 4Y6RA 4WLEA 1JAXA 1QSGA 4CMIB 3RROA 3T4EA 5JDCA 2J5QA 2V6FA 1I33A 5KVQA 4EJ0A 3EVNA 3UICA 4R1UA 1NPYA 1E3WB 1I3KA 3MJSA 1VKNA 5F3RA 2BFPA 1HDXA 4EI2A 3W4JA 4CLDA 1W8DA 3PHHA 4BKQA 3NUGA 1GPDG 1HYGA 2CF6A 3PJGA 5C7OO 3C7AA 4IDBA 4UUNA 4L4RA 1O5IA 4AJNA
chains in the Genus database with same CATH superfamily
2YDYA 2C2HA 5ETNA 3V5RA 5A5VA 5EC8A 4NYOA 2P77A 4RBUA 1P4JA 5IT9A 5E6RA 5JJIA 2QL5B 3OETA 3CWQA 1T8YA 3EXG1 4PS0A 5T14A 3IVMA 3TTTA 3LCMA 4B0OA 1T1SA 4U8YA 3I8SA 4JWTA 2NV0A 2PXCA 4P3XA 1Q50A 3CDBA 2DNOA 2YMLA 4GR9A 3L1IA 2QHXA 4QYSA 4Y2GA 1U3UA 2B8JA 4MFBA 3WLAA 5T4FA 2D7JA 2NYVA 1VF5D 3FXAA 2E76B 5HM8A 3GAAA 4Q9JA 5HLFA 2ZRIA 2DGOA 2CJYB 3HTXA 4F4DA 1V8ZA 2Q0SA 3THPA 3WZ2A 3P49B 5E79H 4KB7A 4DEZA 1LUAA 4DU8A 1YVUA 4WHMA 2A86A 4C22A 1OY1A 1KK2A 5JO0A 3I83A 4MLCA 1KNZA 3MWJA 4TYAA 4ZKUA 2F3SA 2F3RA 1Y4SA 2WJPA 1Y47A 4D82A 3BHNA 4B83A 1RLCL 5E5NA 1KP9A 1X3LA 5EQFA 4B4WA 1RHZB 1R3UA 2YCLA 4A8HA 3IQDB 2BFCA 5IZHA 1B8OA 1EDBA 5DWQA 3UKDA 3DFUA 3AJ8A 1W19A 5I4IA 1PX0A 2Q6CA 4RKEA 5IYZB 1HEIA 3W90A 3JCUH 4FYJA 3BJRA 5LMUJ 3NBPB 2ANCA 4XRGA 4NLQA 2ZJ1A 1THTA 2WTAA 3E18A 3M32A 1NK7A 1KB9D 1BS9A 3OFND 3NG8A 5K14A 2JFNA 2V2QA 3O4VA 1AGYA 3T3NA 4XYLA 4JYAB 3TDMA 3S9OA 5ALGA 2INGX 5UKDA 3MMAA 3TLGB 2QRHA 2WW8A 2R47A 4G0MA 1U8CB 1NSYA 5FULA 3NBQA 4CL3A 4ND6A 3ZGOA 3WGKA 1L1EA 1TKXB 1YGYA 1R74A 2FZEA 3KVOA 5TQVA 3K70B 3KYDA 2GJ8A 4D3DA 3PZRA 3I9V9 4WOKA 1U98A 2PBFA 3DP7A 4QJBA 4ZIWA 4X7BA 3H8WA 3GN2A 3VMAA 5DETA 1Q0NA 5TRTA 4NAVA 1XWLA 2Q4EA 4CO2A 4C0QC 3GN1A 4BX0A 4A1FA 1KRPA 3R74A 5J4VA 4CJXA 4BO8A 4UB6E 3DVAB 2EGUA 2A5JA 5ENDA 1PKXA 1Q7CA 1RHRB 5DO9A 1N7SC 1P5JA 2IZ6A 3A1SA 1GG8A 5EVJA 5JQGA 5G0UA 3JQDA 2NVUB 2ILVA 3LANA 4LSZB 1UEXC 1KEUA 2BCCG 2W6PA 5JEDA 3TSAA 5HS6A 2KKHA 2QLBB 3KBBA 1IFDA 4M54A 4ZTUB 5BW8A 2ZE6A 4HKZH 4FCVA 3ZTPA 4DDHA 3FUYA 2PZLA 3VYRB 1RFGE 1SKWA 2CFOA 4MFBB 1N86A 2MHNA 4DABA 2XCUA 3C4QA 3BX1A 1W5CE 3O1IC 3T15A 1R0SA 2JFXA 3T61A 2R2TA 2CJKA 1MJGM 4GPIB 5F8NA 2VAWA 3L3CA 2RRBA 1CZRA 1Y6QA 1I13A 4C7KA 3IVCA 4QLAA 4X66F 1TT5A 4EVRA 1N36F 2VH2A 2FPWA 3QBVA 2ZYHA 4UDOA 2RMZA 3NCHA 2WSCC 1AKNA 2WIDA 2D00A 1QH1A 4OK3A 1UMCA 1VC6A 5KLIB 1HQUA 3AOEC 2YBVA 4G4GA 4USUA 4B6RA 3GLFB 1FZBA 2I9SA 1F20A 2JFVA 4RW6B 5FPTA 3IP9A 2V9KA 2B6AB 3LX8A 4QBKA 5K8IA 4C1BA 5L9XA 4RADA 3E2IA 4DWVA 2GZOA 1QOQB 3BEOA 1HDYA 2HRYA 1T13A 4P53A 1M1YB 1N2CB 1KWGA 4TRMA 4RIIA 1HX7A 5B3LA 1P0FA 2JLWA 4RC9A 1VKJA 4HFNA 1AYEA 2Q9AA 3BCUA 3SBEA 3DE6X 2V3VA 1GFWB 1CS0A 2J6TA 4CN8A 2AQHA 3TSYA 3C48A 4D1YA 1YQUA 4MDFA 2VHTA 5KPDA 4XGIA 3M0DA 2I33A 4TLDA 3FGPA 3A26A 1SZDA 1LD3A 3CY6A 4I1RA 4FIDA 3VOSA 3H16A 3ZZOA 4OBBA 3WQHA 3ZBQA 4QIVA 1W29A 4F0HA 5D3MA 4RABA 4X20A 4H4MA 1V3TA 4YWJA 3GJ3A 4WFBQ 3LUAA 2ZT6A 3BHIA 3B9QA 1G2CB 2C4WA 5CA0A 4QRDA 2ID9A 2FYZA 1JY3N 1F38A 1O6XA 4F11A 2AEMA 2P3LA 5JDIA 5I9LA 4UMDA 1U5BB 2OK8A 1OX3A 3KZCA 2NSBA 3R5GA 2YWKA 2I34A 4CM3A 4CNQA 1SVIA 2ZETA 2Y0BA 3OQIA 5EJEA 5DJBA 2QSWA 1JNZB 3B53X 4AX4A 3S1AB 1SKSA 2Z57B 2VK8A 3OT5A 3FYUC 2H7VA 2P2UA 1J8DA 4LZZA 5CG2A 1VIAA 1FFHA 1WC6A 3RDPA 2G0NA 1WE2A 1WTAA 3ROGA 4D02A 4JI1F 3Q2OA 2C8JA 5SV2A 4WXRA 1L5HA 2M0BA 3LQ2A 3OSPA 1IKWA 4FYHA 3CSUA 1V45E 4XUGB 4EKNB 4FYPA 1YRUA 2WLSA 5JSZA 3TAHA 1PR1A 2BUBA 1N5YB 2ZJZA 2ZRKA 1IBLJ 3IBFB 1GZVA 4UU8A 1W2GA 3GJ6A 2DEIA 1ESCA 4R05A 1LQ9A 1UWCA 2EAUA 4NLYA 3F9CA 4LIWA 2WE7A 4C1NA 5KFGA 2A84A 3VO9A 2VT6A 2RC6A 2C4MA 1SHJA 5FXMA 2MB0B 4IZ6A 5GZ3A 3BSWA 4WADA 4YH1A 4EOTA 4E2FB 4DAEA 3J80Y 5KNCD 4KGKA 3OLVA 2VDRB 4OKSA 5CM9C 2FRDC 3BN3A 4Y6GB 5FTNA 1MLAA 2DR6A 5A76A 3CVKA 2D1YA 1P8GA 1DO0A 1AHNA 4Y2VA 1DB3A 2ZBDA 1RF0C 4I2LC 3I1JA 3KYJB 4OU5A 2HFVA 3I9NA 4UB6H 1U1MA 1Z28A 3KG4A 1QV7A 1F2DA 3HL0A 4RPKA 3DL0A 5B1DA 2ZHBA 4LF6B 2RH8A 1A7JA 3G1TA 1UZHA 3EZ9A 4LF8J 3NAGA 3E3MA 2RHLA 1OT3A 4ENOA 3O8OA 2BMBA 5KB3A 3P9SA 4BNZA 1R0CA 2I6XA 2O7QA 2VZ8A 4FE7A 4ALZA 3OPMA 2X9LA 2QT1A 3THYB 4FCTA 4N5IX 3DHXA 1JLEA 3HCRA 3OWHA 2PQ6A 3TSWA 4S1TA 4F9FA 5FL7A 4W5QA 4I55B 3PW7A 3CCSS 3GPIA 5HIAA 3RUBL 4KQWA 2ZRNA 2Z2JA 4K59A 4EA7A 2XXBA 1Z37A 1HBOA 2QXUA 2CPEA 1N7SD 2GRAA 4IG4A 5LL6P 1E2HA 5AW4B 3A6FA 1NWCA 3TNFA 2VONA 3MTQA 4D9GA 1OXXK 3JYOA 5LMNF 2CVFA 4C7BA 1RAOA 4A0QA 3GRVA 4MKXA 1NNUA 4PJ0E 4Z1MD 1RWMA 4DDUA 2ZSJA 3QSGA 3ZDFA 4NMMA 2VBZA 2BEJA 2OXEA 4NJEB 3QUCA 3EVZA 5CBPB 4LSGA 2KYZA 2ZEJA 3MAAB 3SZOA 5HO4A 1Z29A 4LXTA 2GHQA 1ADBA 3AM3A 3L1VA 1LXJA 3WQSB 2GW8A 2AX3A 2ASDA 2E48A 1M83A 2QV0A 2Y0CA 4Q48A 2PA3A 2YNMA 4BVBA 4OYPA 5E33A 3OX1A 5E6UB 3EHEA 2KZZA 1Z36A 3RRXA 4BX8A 2FB9A 5AKJA 5CIYA 4B4VA 4CWAA 4NA3A 1KQ3A 3MR7A 4BHTA 5F23A 1F8GA 4OZNA 4BXOA 3SQWA 4B3RB 4LV8B 4IUCS 4NENB 4JI6B 1A5BB 4IQ0A 1NWQA 1PIXA 2KJQA 3SS9X 3FBWA 1LTSC 1EP4A 2UUBF 1I14A 3NEPX 2B25A 1H8HA 4F9GA 2HWYA 1JDTA 5HHTA 2DY0A 3AEQA 3KTAB 3NAZA 4ZCQA 2H08A 1CERA 2JH9A 5ICSA 3OE7D 1VCNA 5T4EA 3LUYA 2HU5A 4J4TA 1PK9A 5HQMA 5DNCA 4AUEA 1NAIA 2R4FA 1VBXA 1VL8A 2BCGY 3A1TA 4EA8A 2VSQA 3FSJX 3OZUA 5IT9Y 4NLDA 1ZNWA 2H65B 2J8AA 1A8SA 4I5GA 2W7OA 3IIKA 1X1AA 1A9SA 3JQ6A 2Z58B 5BR8J 4ZVUA 4YAWA 3CTMA 3CC8A 3IQEA 1BOFA 5F78A 2BGUA 2Y9YA 1ULAA 3AZPA 3HH8A 4XPCA 3JVUA 1KKHA 3P9YA 1USUA 3FMGA 4MIEA 5EG5A 2QTFA 4WT7A 5EWJA 1S89A 3J81Y 1MABA 2J9CA 1ONBA 3O3CA 1FYVA 2E5LB 4URHA 3OJOA 2CQ1A 3RAXA 3W2WB 1XKTA 1M0TA 3JYTB 1UPPA 1RXIA 4WZ6A 1NVVQ 4PPYA 3BM7A 2X8JB 3SS7X 3M4YA 4HI2A 3W3ZB 4OIXA 1T0IA 5J47A 2AKEA 2WMOB 2ZJAA 1QGUB 3G87A 5SZTA 2A2CA 4CO4A 4KXNA 4EYGA 3H2GA 2WYVA 5C4MA 2Q6VA 3LP5A 4CQMB 1HYQA 3P2MA 4D4KA 2YMMA 2F8SA 4OJ3A 2LPMA 3EGOA 4Y2RA 1T9XA 1IDOA 4ZOBA 3L79A 2E1PA 1Q0SA 2R7WA 3LT1A 5J2PB 2IXTA 2JLXA 3AF3A 1VHDA 1B74A 3HA2A 5EPEA 4Y18A 1KPIA 1S3JA 4EWTA 4DYVA 1P31A 2BUNA 3WK8A 4KDFA 1IRIA 4QSMA 4IV8A 1CPZA 3OXGA 3W66A 1VQNS 2LCFA 2PJDA 5TJHA 1CV2A 3QVXA 4ACAA 2VNIA 1YVEI 5CB0A 1SC4A 2FUG1 1OZAA 4D4JA 2YOHA 3BWYA 3A3PB 1TIKA 1TEXA 2QENA 2VASA 1KFMA 3AQOA 3H2LA 3WGJA 1HNZF 2W24A 4MWOA 2PA8D 5AKYA 3VAIA 3R7FA 4L51A 4R2HA 1G4CA 4N7TA 1UC4B 2J7KA 2JAXA 2DY1A 3WQBA 4RXUA 4BO1A 5FR1A 3C6QA 3LUHA 4ZREA 1DUIA 5JY1A 2NVUA 4OYOA 2OTLS 1EGVB 2NMVA 3PSAA 1M6YA 3N07A 1ZNXA 3E7WA 1WNTA 4I1UA 4WCFB 4DN6A 4Q15A 5A7GA 4YXWA 1X3SA 4CCSA 1GX5A 2EKLA 4DLBA 3HA7A 1JDNA 4RX6A 3VKUA 3PUVA 1NTMJ 4ZZ2A 3VKWA 1XRPA 1I1QB 1N3LA 4TLRA 3QO9B 3HJUA 1XIQA 2QVXX 4NYIR 1JLAB 2H1IA 5AVRB 2AI1A 3SQXA 4FLEA 1HY3A 1M6EX 2CUZA 5GOTA 1ISPA 3MUNA 1HF3A 5HG0A 3KZIH 4IYQA 4DPXA 4N3CA 1Q83A 1Z1ZA 2G07A 1K3FA 3O0TA 5FDFA 3L6BA 3PFFA 3M1VA 2OLEA 2VF5X 1AXRA 3PW2A 2EFQA 4MKVA 4URYR 3MECA 4R2MA 3KQVA 4RLQA 4URVR 1KR2A 4AJOA 3C3LA 1U8SA 4JHLA 5KYKA 4I5DA 4YRFA 1WMAA 3WLEA 4IGEA 1LFWA 3MAQA 4RESA 2X77A 5AXMA 2NTJA 1FXSA 2AP6A 2CJYA 4XTCS 4JI8J 4PUOA 1N4DA 1NVDA 3LF2A 3OR2A 2ZQ5A 3COVA 2FPMA 2B20A 5LSOA 4OQZA 2VA2A 4RD3A 1WVMA 3W5VA 2DQZA 3OX4A 2JAWA 2XADA 4YJFA 4MWGA 1KTMA 4HRXA 3M4ZA 4JENA 1U0EA 2XB2A 4ZVQB 4IDEA 1S1MA 3FW1A 2MJNA 1NONA 3HWSA 1QRAA 2J67A 3H20A 3HZGA 2EFNA 4JHXA 4RPGA 3PWSA 2DR5A 2RI0A 3DO6A 4O59O 5C51B 1IBLB 2WM9B 1DQAA 4OX8A 3NAHA 1X1RA 3VMMA 1FF9A 2WF9A 3KE9A 1C9NA 4NK5A 4UPDA 4Z37A 1W1WA 1NV8A 4W6ZA 1NAHA 3G89A 4QASA 2AFIE 2Z2YA 1IBMJ 2O8FA 2OMLA 3VR6H 1M1JA 4J0GA 3PACA 3AERB 4FFOA 4NBWA 1Y6FA 1W4BA 5H68A 1CYDA 3HCEA 3OCCA 1AVTA 4RHYA 2XMMA 2FLVA 4ZI7F 1N33F 4DL6A 3LKBA 1V3ZA 4C3LA 2LIPA 3IEMA 5LL6d 2QX7A 2E29A 1MDBA 4QIHA 4BNLA 1T6AA 3DLPX 5E41A 3ZWNA 4TYYA 1DHMA 2HU8A 1VHWA 2PKCA 3D4NA 1E7WA 3GT4A 4ZJUA 3VPAA 3NOXA 3QPBA 2B78A 2ISSD 4JYAF 3DM2B 3H2BA 5B7NA 2UZ3A 1N88A 4DF8A 3N5FA 4Q9NA 3SAJA 2OSVA 3JQ7B 5IC5A 4DJFC 1YR9A 1Z7GA 4MTPA 4O4LF 3UYLA 2VRCA 1FEZA 4YJGB 3P9KA 1PQYA 5BWMA 3ONWA 2EGGA 8ABPA 2BZ0A 3QMPA 5AVWB 4Q8FA 2BEVB 2A9VA 3FF4A 1GL6A 1HWLA 4PG5A 3NS7A 4UUPA 3VQTA 1QU2A 2FFDB 1KY5A 4H7KA 4XOIA 2G40A 3ZXSA 4FR5A 1L7XA 1KSFX 3AL0C 3C45A 4YBZA 1IHYA 4JBGA 1D4ZA 2W8BB 4Z7NB 1X5TA 1R27B 4ALMA 1KIFA 2WG0A 3BEGB 3D5MA 1HNZJ 4HNSA 3PFCA 1NXTA 2Y66A 1H6AA 3AV3A 3MRXA 1ZH4A 3SDZA 2XWXA 3U4IA 2QZSA 3S2FA 2XTJA 4G84A 4FI3F 4BQIA 5FPPA 4XSHA 1FJ7A 3A9CA 2HYNA 3P45A 3TI0A 3W3AA 3RC9A 1V3QE 1G3OA 1QGAA 3BJIC 3MM7B 2KHCA 1AUOA 4WTOB 3AI7A 3P0EA 2BW7A 5CDFA 1RF0A 3AOAA 3WUUA 4KI7A 1WMEA 3TS1A 1NYTA 2Y9ZA 2Z98A 4DCUA 1OXSC 2HMSA 3C6ZA 2A8YA 5KINB 4FS8A 2RJZA 4H7HA 1KC1A 1NR1A 3I55P 1X9WA 3WK4A 4GSLA 2C8KA 4B4UA 4N5NA 4IIJF 1AZSA 3FA2A 2WVRA 1K8AT 1NP3A 1L7MA 5D77A 2RB4A 1QL1A 4MA5A 3PX2A 2Z2ZA 2EGHA 2PD4A 4C04A 4TL8A 1LW0A 1U9IC 1N1MA 3PP8A 3D3WB 4C78A 5DNYB 2J6HA 1FWKA 2HRBA 2V7PA 3H1FA 1GZ3A 3TQRA 2YS6A 4PX3A 2CKMA 4CLRB 1T91A 2MSKA 1RGVA 3HBNA 1KLNA 1W6RA 2OSBA 3ZFVA 3H9CA 5EJ6A 1I3OA 4N0MA 3I0SA 4JI8B 3BWDD 3N8DA 3GRZA 5E38A 4D9HA 2RGBA 2VT2A 2Z43A 3R8XA 1U65A 3MJDA 1S5LE 4TTPA 2PZEA 1E69A 2RQMA 3CURA 3VV2A 3IB3A 3WLLA 1ZM7A 3QVSA 4GOFA 2CPDA 4UTNA 3LIIA 3OHPA 3D0OA 4MR9A 2YV4A 4R40A 1N8NA 4A8MP 3TLMA 1YCHA 3PJEA 1IJDB 4BFUA 4DT1A 1N5DA 2CQIA 2DKOB 3VKFA 4BN5A 1AK1A 4OHFA 4DNFA 2ON6A 1VFNA 4HB0A 3SR0A 1FDWA 1I2DA 2ARKA 1SA0A 5AM5A 4HVCA 1VS3A 5CUQA 5DYGA 1YB1A 3L4BA 2BELA 3EIQA 3FKSD 2RARA 4CFSA 1JE0A 4MMZB 1QV6A 2GM3A 4ML3A 4O2AA 1Y5LA 1EFVA 4JXZA 1PFVA 4H13D 3O5AA 5C2GA 1FZFA 4OZ2A 3GFZA 2FLKA 2MLZA 1P5HA 2QU8A 1D1UA 3KYCA 3ZNOA 2KNCA 1E79D 3BD9A 2E74C 4PM4A 1SQPE 1U3CA 2Q5UA 4RQBA 1R18A 3LTOA 4RIGA 2W9AA 3OTHA 1UJ4A 5A8KB 5JIBA 1LDGA 4HCJA 3GLIA 4JOUA 1L7AA 2GN1A 1JTEA 3PCTA 2BBWA 2GZ2A 1JXQA 5D00A 4KOAA 5IAAA 5EY5B 5H9VA 1CF9A 4KJIA 2GA7A 4L95C 5I6DA 1NAYA 3K89A 4KIJA 3TW0A 3H1LE 3MWDA 4HDSA 1YE3A 4DFDA 1CB7A 4PQFA 3WNQA 2PV0A 1S2MA 1DTTB 3KG2A 1ZK0A 1UKYA 2L5GB 2X5XA 1DEHA 3N5KA 1ZVMA 1Y3JA 2WM3A 3DXZA 3FG9A 1X0VA 2X86A 3VCDA 2WONA 4QWMA 1Z25A 1D6SA 3D4BA 4K6MA 4D5GA 3R5HA 3Q41A 3O8WA 2X4LA 3MUTP 1F4PA 1SZCA 3K8VA 3PEEA 2POHA 1G8GA 2W9CA 1NTZK 3GUUA 3EPGA 5EFZA 2CHQA 1JCDA 1Z34A 1UOPA 3V6JA 3R4CA 4Y1FA 4HATA 3QX3A 2OG1A 1Q78A 2PMFA 1V1JA 1K63A 1G17A 1HPZA 1Q77A 4FKZA 1GGVA 3ND9A 1RQGA 4DSKA 2V6AA 1H42A 1SVKA 4S1OA 5CVDA 1YAJA 4F4AA 3LBHA 5BSFA 4K6GA 3LAKA 4MW2A 1EVQA 4WGFA 3SQGB 3H1LJ 2XKBA 1F3FA 3QVVA 1HZJA 3LPAA 3OIYA 4J9UE 1J90A 2VHGA 2PBRA 3AE9C 3RAMA 3BD7A 3F1KA 1TJNA 3IELA 4LQ9A 2VPTA 4PZAA 1VB5A 1HARA 4DA4A 4CO0A 4UQPA 1QTIA 4JJ8A 1KK1A 3L7UA 1Z4JA 3CEPB 4B44A 1JNXX 3QWOC 1CC8A 4P54A 4CNBA 1ZA1A 4DQKA 1R9MA 3DP9A 4XA4A 5D8HB 3INNA 3BGRB 2W00A 3K7RA 3EVNA 3DPIA 4ARAA 5LR6A 1H85A 4RUKA 1NPYA 1KYOE 5B7QA 3KKQA 2ZUDA 2XVMA 4QUIA 1APBA 5FWXA 3PJGA 2ECPA 1WBDA 4E70A 1XCBA 1H2UX 2Z04A 2PGIA 4YJDA 1WXXA 4R8LA 4H6VA 2FEPA 5GY7A 4N9WA 4K6CA 2WVAA 2HMVA 1UA0A 4B73A 4RIFA 1XDUA 3DOEA 4IAOA 3C4VA 3ZK8A 3N0WA 4IZIA 1M2VA 2FJXA 4LRCA 3ESXA 3OTQA 3KAJA 2IRXA 1Y4ZB 5GP1A 3MA0A 1SQPJ 1XEXA 4RK1A 5ITZA 3W0LB 1GQRA 3ONDA 5HK9A 3WYCA 1KQSO 1JEYA 2PZKA 4CT0A 1SVLA 1RHUB 2M6SA 1IJKA 4K46A 4WCVA 5DX0A 1VYHA 5B4VA 2E75D 2OTCA 3SX2A 3GGPA 4R0JA 1T2AA 3U09A 5DHFA 4F06A 4FZ5A 2XNCA 3TZQA 4A8YA 2CLKB 3MAJA 4W80A 4I6EA 1T1RA 1XWIA 1RTDB 1RAEA 4W8OA 1T4GA 2XHZA 5FJ4A 5JAUA 2GMHA 4RW7A 2HCFA 1JR2A 2I7VA 3D7RA 3Q9UA 2VSFA 1H6DA 3L0OA 4MGKR 3ASYA 5E3PA 5CLIA 1PBAA 2Y4NA 3N4WA 3TIXB 1FDRA 2Q1YA 4DADA 1EQAA 4YAIA 3FUWA 2CVEA 1U7ZA 1Z5ZA 2VAMA 1MLDA 1NBMD 1Q3KA 4HGYA 1FQOA 1GMUA 1A4IA 1GCGA 5KLVJ 4CEJA 3IIEA 4XCQA 4FFWA 5LOVF 2X0IA 1VL1A 5D85A 2Z08A 3NIFB 3M30A 2PO5A 4QGFA 2O59A 1N6RA 1DJOA 4BWGA 1X31C 1N54B 4LZAA 3UEOA 3LDUA 4Z99A 4PKDB 2WOMA 1RWVA 4HDKB 4CMHA 4PQUB 1CYEA 3KD3A 2XMAA 3D6TB 3D66A 1OFGA 2PKYX 3NKLA 2PT9A 2O2XA 3LY8A 4AT1B 1RZMA 4IVQA 2WVGA 5H70A 3BM5A 3DOKA 4XI9A 3RAQA 1G8KA 4J0FA 4PONA 4NEZA 3EX7B 3BWBA 3ORQA 4UREA 4YO8A 4LNHA 4PX2A 1XTRA 3RK4A 1P81A 2HBRB 1NQAO 2HWIA 1JYEA 2CZVC 1GRNA 1P7PA 5L9NA 3H5VA 2O0MA 3JQ9A 3X43A 2DKNA 3EBOA 5HSPA 3LZDA 2CPFA 1WC5A 2D1TA 3GFRA 4EGSA 1AC5A 1T5DX 1Q16A 4YRJA 3EASA 4XGQA 3TI7A 3N9UC 1BHQ1 2CLLB 4ZEOA 3TXYA 1ZTWA 3L9XA 4M7PA 5CT9A 1P4HA 2RILA 5CCGD 2PWZA 4DV6J 1CUIA 3NL0A 1UMKA 2HQFA 4FCWA 2G09A 1EZ1A 1OVRA 1RQPA 5APYA 1FRXA 3O8QA 1K9MT 5TE9A 5BRNA 4R1PA 4ZLPA 3PTAA 1G8HA 3E22B 5F9HA 2WV7A 1GNVA 4RJKA 1VKOA 2Q99A 3EVWA 4HXGA 1X80B 4YRDA 4R84A 3S7RA 1G21E 1K8ZB 4F5DA 1R37A 1XJQA 3GEDA 1KBRA 3HXOA 3GLVA 4DJJA 4D25A 5ETMA 2GN9A 2JLFA 1WNEA 3LW7A 2FWIA 2JVOA 5LKRA 2D2CD 1DEAA 3CA8A 4KN9S 1D9DA 3H17A 2GKOA 4X00A 3NWRA 1KL7A 1P0PA 1YI2S 2CVIA 1ZRMA 2HXSA 1ZN8A 2P9HA 2W8ZA 2QVYX 1RT4B 3AEUA 3BUSA 3I5UA 2ZXEA 1UEUA 1Z2PX 1F06A 3W1WA 1OMIA 4NBVA 3CLUD 4BO5A 3L43A 3C8ZA 3K1AB 3BFPA 3JQBA 4P1ZA 1M5TA 5G1NA 3LWMA 2W4IA 1JEAA 5IDVA 2DR2A 4JI2F 1JMBA 4OF4A 1U2FA 5KQLA 1DJ0A 4YS6A 1C9KA 1U3TA 4TXNA 1PAUB 1OZ0A 2CUNA 4CLKA 3GVXA 1GL3A 3M2UA 1MB0A 3V2QA 4GX5A 4FJ1A 4DPUA 3K0EA 2FVSA 1H7WA 5ALNA 2ZVJA 1WG8A 1L0LD 1S9DA 1LT9A 3EQ6A 4PO8A 1HMYA 2IH5A 3E58A 3RLFA 2F8EX 4B3TJ 2J6BA 3OQPA 2I6QA 3ANMA 3OAKA 2J9RA 3F2VA 2DITA 5JE8A 1WDLA 3PEVA 4A3SA 2SKDA 3CXRA 1C3JA 4JI3F 4LWQA 4PZZA 4HVAA 3J7A1 1CDOA 1RH5B 4CEHB 2C59A 3OE4A 4DUYF 1ZRHA 4GKGA 3AR4A 4MIKA 1FDDA 3O93A 2P79A 3MS7A 4D6YA 4Y0FA 4KB5A 1I0ZA 4QFDA 3DEYX 5LZ2A 2NU6A 1O9HA 4Z0PA 3A0UA 4Z9FA 1ID8A 3BWCA 3ABZA 4U9IS 1PFWA 2IV3A 5CXTA 2PKQO 2WIFA 4YRTA 1YT5A 4ZMDA 4Q1EA 2WHPA 5KG1A 4CF3A 1B3RA 1N5MA 2OZLB 3GT7A 2GF0A 3KOMA 3SFEC 2F7SA 4F8YA 3IHKA 4NU0A 4MV9A 2VU5A 4D9JA 1CQXA 5KBYA 2V8BA 2PS1A 1S1VA 4MLPA 1DBIA 3DKIA 1RT6B 3I28A 3NRBA 5DYTA 4NXMJ 1OVUA 3EYAA 1ISIA 3MMJA 2RH9B 2PMWB 1R0BA 4DIDA 2B4RO 1AQNA 3QLVC 4BFYA 3HFKA 2VTEA 4USWA 5AHWA 3NMRA 3K05A 1AUDA 3K5NA 4L3NA 5BMVA 3L7DA 3FX0A 4B3RF 4YAEA 3KOAA 3D2LA 3U49A 4FNIA 2AN9A 2ERCA 1NMEB 2Q6OA 5D86A 4H0NA 2WOJA 3FSGD 5J4LA 1NM5A 3WAGA 2CSXA 5A05A 2ZI4A 1USVA 4EUFA 1XPUA 4PTYA 3DDWA 3V2IA 3RS3A 2X40A 4UDYX 4RFVA 1Y00A 4CT5A 4LSNB 4O4HF 4NCGB 2RSLA 1MJFA 2PH5A 3OL9A 2EK6A 1GA4A 1QRUA 1TM3E 4DCOA 2IBZI 3VC2A 3H9GA 4DDWA 1DWOA 2WAXA 4RL6A 2OCBA 2XUGA 3RK3B 5LYJF 3Q7SA 4TN5A 4DVJA 4C3VA 3WWCA 1X7WB 1G6HA 2ZFHA 1PN3A 3Q6MA 4CV1A 2QPOA 4ZI3A 1Z6XA 1F9AA 5B1EA 3MMCB 2F1FA 5H1YA 2BFAA 2FY8A 3GJ0A 4HEQA 3B1FA 1P2BA 2HCBA 4YLYA 1V3VA 3TLAA 2I1JA 2IDEA 3N2NA 3IAUA 3OUUA 4Q9LA 3JS5A 4BTVA 3B7PA 2LDXA 3KHHA 5FCDA 2WITA 2V0CA 4IX9A 3VMZA 4HLUC 1LPPA 4MROA 1TQ2A 4P9SA 4HACA 4XIYA 2O8CA 4LRQA 2W9BB 5KT6A 3KBOA 3S4YA 4ZOSA 2C4TA 1T2KD 3DNMA 4TY8B 3AONB 2XNDD 4RWWA 5GAEI 2ZYDA 1KFCB 4P4SA 3NC4A 1JVSA 1M8OB 3IRXA 1GU7A 4XPZA 2QZ4A 2X9NA 1EK0A 3NW9A 4TYMA 1K0TA 1QFYA 2P7IA 1YHNA 5B37A 1FMTA 4YV2A 4D9KA 4KQMA 4NPEA 2W6MA 5EEHA 1FF2A 2QE7D 4FMDB 2VK2A 5DDQC 3VM6A 1UW9A 5B66E 5CHXA 1MKMA 2QM8A 5IJ0A 5BN5A 1G16A 4OXNA 4C0BA 1Y48E 1SWWA 1Z22A 2YH2A 3CZ5A 1A8UA 3U31A 2W2TA 3W7AA 3B2EA 3LWBA 5AVSA 1AX9A 3ITNA 1V5WA 3CSDA 1N33B 3B70A 4OGQB 3ESDA 4AQDA 3ZLUA 4DBLE 2B0CA 4UOEA 3HHPA 1I7QB 2EQ5A 3OQHA 2EWVA 1AH2A 5HPYB 1KYOI 3BMOB 2FJWA 1JNMA 3KJQB 3H1HE 3M33A 1T3NA 2ZIXB 3AF1A 5CTJA 1O5OA 1U8EA 5KT7A 1DG9A 2GHPA 5IT9U 3EODA 4DRXA 3F73A 2DULA 1PO7A 4OL9A 3F5SA 2UYGA 2WAAA 1WD7A 1QVZA 3LZCA 4KJXA 3IX7A 3LQVA 5JMNA 2XHCA 1QO0D 4CM9D 2I5PO 4NATA 2J76E 1SD2A 1T1IA 1QNLA 4WXMA 3H1GA 4FYVB 3MT7A 3NX4A 1SFCB 2NU8A 2K2QB 4AUKA 2WSLA 3ERCA 4R0MA 4YR0A 1RU2A 4BEWA 3CJ4A 2PAJA 3PDWA 1PTJC 3RS5A 4MQFA 4BDSA 5LMUF 5K8UA 2G5CA 3PEJA 3TEGA 3RW6A 3HR8A 5YASA 1J9GA 3AKZA 3KJQA 2H17A 3DCNA 4RA9A 3P5BA 3R7DA 1P2DA 4M9CA 4WESB 3H1ID 2I99A 1BGYD 2ZSFA 2N3OA 1KZUB 1AGNA 1C30B 3CIOA 4H6XA 3HXTA 1WNFA 3RBAA 3ZDRA 3MD9A 2IPNA 1Y3BE 2HQOA 1J5OB 2IHNA 3N2YA 4J76A 3C3AA 2HNYA 1V11A 2AA3A 2WHQA 1U3FA 5LXTA 1M75A 3RC1A 1ZAKA 1A8HA 2EHJA 4Z4GA 1KMIZ 3VHQA 1BNCA 1HYSA 1M2VB 3EBPA 1RWNA 1JUNA 2OGUA 4RZXA 3U19A 2D2EA 2K06A 2DPYA 3T9ZA 4FQ5A 2E21A 1TVKA 2IFXA 3IRXB 4MLDA 3R1HA 3OFJA 1X4CA 2AF6A 4XVRA 2VG6B 3I45A 3I2GA 2ZYWX 5CU7A 3CC2P 3CGGA 4I5IA 2XTJP 1J5XA 1XK6A 3TRGA 4TMFA 3HVWA 3K3PA 4O3PA 3FIJA 2MLYA 3I04M 3ASZA 4EYKA 1GT6A 5ES4B 2DISA 4D3FA 1PWXA 4IDCA 5F21A 1SIWB 1KN7A 2QN3A 2GPBA 3RYCA 2XX3A 1P80A 2N9BA 1R0YA 3L4BC 2SBTA 2VJCA 3OCXA 1JMVA 2HNYB 4B5KA 1T3TA 4RY0A 4M0PA 1RAGB 4BXOB 3MCSA 3JRWA 4GM0A 3K4PA 3DYBA 9LDTA 1G60A 3M4XA 1LBEA 1N6NA 3H25A 3WP0A 3FETA 3D68A 1GKLA 5B0EA 2IRWA 1Y1PA 3HABA 2DFVA 2XQFA 4ENRA 3T1QA 3QBCA 3AHEA 3C3YA 3CD7A 3RYIB 3DLJA 4LFBJ 3VC7A 4MUEA 3HJTA 2FF7A 3RVRA 1YRYE 1AN0A 2DNZA 5F5XA 3E81A 4OSOA 1HLWA 1GUBA 2QA1A 5COAA 2B4PA 2QAJA 3HY6A 4NA1A 721PA 1N73C 4RANA 1XTIA 4GVLA 5JNTA 3L0DA 5CJ4A 3H90A 5CDHA 1BXNA 3GYGA 2AW0A 5AXDA 1JLBB 3CO9A 1RT9A 3KHKA 3EIOA 1TK3A 2F3JA 6PFKA 4UXHA 3K2BA 4AQRD 1R5OA 5F7JA 4FYKA 1LT9C 3EEIA 3BB1A 1ULHA 5T3UA 1H0HA 3H9UA 1Y37A 2WJ4A 5A8RB 1UWKA 3B1YA 1OXVA 4EGFA 1ZD8A 3WQPA 4U2CA 2DHCA 1I7PA 3R7BB 1M2GA 2B4VA 1SK9A 2V50A 2G8NA 4BLRA 4CTAB 1DX6A 2YBEA 4FYWB 2YFHA 1ES9A 5AXBA 2LV8A 4JLNA 1BCCJ 2K5UA 3WXBA 1OFTA 3I96A 4HGRA 4FZ3A 4PAWA 2ZUTA 2Z5LA 4L73A 4OV6B 2BW0A 1EAYC 1JE1A 3JYQA 3OMXA 4BUZA 2VRNA 3DMHA 1BWPA 4FNHA 3HJNA 3NBPA 2QE6A 1EBFA 1YZ6A 1SC6A 2PH3A 5CXSA 1QIJA 3ZNQA 2CLFB 1NZFA 4KPUA 1SKYE 2WD7B 3Q9NA 1T2KC 2BC9A 1D04A 2IGBA 2JJ8A 4E07A 3FPFA 1PD0A 5DHUA 4JR2A 1RAGA 5L53A 3VC1A 5E9WA 4HQRA 1RT1A 1NXOA 4G5OA 4TV8B 3N5CA 4TSFA 4MPDA 1U28C 1GMWA 2Y71A 2A9JA 1FFDA 2LIVA 2PEHA 2EWWA 5BN5B 1COWD 2O7SA 1TP7A 2VH1A 4KR3A 1LB1B 4ZO4A 2J32A 2J9EA 3QFCA 1AM4D 3VR3D 2ONYA 1SR8A 2VBWA 3TLZA 4TVBA 1LXNA 4AWXA 3HCFA 4YQFA 1QHFA 4KGZB 4MZXA 4DYHA 4M1YA 3ZIUA 4ZEXA 1NR5A 2C5LA 2P58A 1A4XA 2OC9A 4QOSA 3U3ZA 4B4KA 5SYNA 5ICMA 2GFFA 1KMNA 1IWAA 3DXBA 1NTZD 2C99A 4EW3A 4Q39A 3AJ1A 4JJ6A 4AK9A 4CKEA 2HGZA 2HNDA 4DCTA 2VJPA 1YUNA 2O8CB 3KK1B 1TK2A 4TS1A 3P4UA 3HSKA 3TAPA 4YA6A 3E9NA 2CXSA 3E9MA 5IJXA 1S0MA 3RTDA 3TOZA 4ZZ0A 4DBQA 3SM9A 4KQCA 5DT9A 4NYPA 2FPSA 4R2KA 3I5XA 1TLFA 4PWUA 5DLFA 3HDQA 4CM8A 5BP7A 4Q02A 2AR7A 2ID4A 1HKUA 4GHWA 1JLKA 2FY1A 2QJKB 2H54B 2J5AA 1Q1AA 3BERA 1RT3A 4P93A 3CLTD 1B4SA 3H1IJ 3T6BA 4CMEC 3AEKB 4YRGA 1UWBB 2F43A 3GYBA 4HWRA 5IT4A 3RVDA 4F67A 3ISZA 4NF2A 4ED6A 5KU1A 1GMJA 3M3DA 4U7DA 3DBRB 5DDIP 3WA6A 2X2FA 3RANA 3E9EA 4MWEA 2BEZF 4TL9A 1MB2A 3DMYA 1F60B 4QHSA 2Q5HA 4A92A 2IIBA 1TU3A 3AC0A 1X14A 3M4JA 4WK4B 2ACEA 2BJ9A 4TOIA 3MFIA 2XYPA 2AZ4A 4GRAA 1LTJC 4Q4LA 2H1HA 3B52X 5F1YA 5CA1F 2JWDA 2WIGA 5D3MB 4XUEA 1KEEB 4R01A 4LGYA 1LLDA 2ORIA 3BGWA 4KREA 5CYQA 3N7UA 2LEPA 4NYMQ 1SQVJ 2AI2A 1WJ9A 4NI5A 1V43A 3GJTA 1VI5A 1XLUA 5I3QA 3KT8A 3BULA 1KQSR 5C25A 3DBLA 3A3KA 1I6MA 5H9EK 3KJIA 3TRKA 2XMDA 3FCWA 1CF2O 3LCUA 3HZEA 1FXLA 4YP1A 4XJTA 3OP4A 3WGIA 4K88A 9GPBA 2XBLA 4K7JA 2WSMA 1XEXB 2E55A 3JSXA 4CQLA 8RUCA 5H7XA 4KHXA 1DAIA 2H4WB 2C9MA 5FEMA 5BNWA 1FXRA 3FMOB 3VR4H 2H43A 4XJVA 3ETDA 3T9FA 4L4XA 5AVQA 3HCNA 1YJTA 4KPGA 1TQ4A 7AT1B 1NSTA 2BL4A 3SD7A 1HDIA 3L8DA 1MIOA 3AFOA 3BL6A 5FUXA 4DOMA 5D3GB 4GBJA 1YBUA 2AI3A 3HWRA 4ES3A 2VVTA 3FF1A 5LVAA 4DL0C 4RQTA 1WCIB 4OA5A 4RLFA 4CUZA 5J2NA 4INOA 1ULZA 1T4MA 3L8FA 2MY8A 4GLLA 1ZK2A 5A9SB 2E7VA 3BJZA 2MZJA 3SWKA 5ALEA 5A6SB 1KJZA 4BVJA 5KG2A 5E2QA 1T94A 3RRHA 4XD7D 3WSVA 1QXSA 2V54A 1TL3B 2GVZC 4MKZA 4GKVA 1QVGO 1NFFA 1DMSA 1U1OA 1N5TA 3J7AC 1LPAB 3B5NB 4ZO9A 2HA6A 3NJ4A 3VYIA 1KF0A 3S2ZA 3M9NB 5C2JB 2WPQA 1RPAA 3OX2A 1GT8A 4EUHA 4RVCA 5IG2A 1PAUA 8ADHA 5I7HA 5IQQA 5EJMA 5KC9A 3PYFA 2FZLA 1APSA 3WIVA 4FC6A 2C2ZB 3WR5A 3DU5A 3SZMA 2XOXA 3IE0A 4H77A 2GD6A 3I09A 1BWQA 4BNMA 3NBYC 3V9AA 4MTCA 2HPAA 2XD4A 2HGNA 5U4XA 5G41A 4GODA 1Z4IA 4G6VB 1EGAA 4JLUA 2Q1WA 2WKSA 2X4GA 1REVB 4UCFA 2GJ2A 2BBSA 2JI8A 2G0AA 2XUOA 3WA7A 4RD4A 3WISA 1FA0A 3WGMA 4QUJA 4L6CA 4TYQA 1VFJA 2FPHX 3EA5A 2BISA 4UMVA 2X7IA 5DRYA 3VVUA 1DV2A 2ZBIA 2FVYA 2W2VA 5DZ7A 1L0NG 1UUFA 3S40A 1KQGA 3ZNUA 2ZRQA 1L0NJ 4B9EA 3N6XA 5K5GB 3PLAE 5GMEA 3L73E 5M2QA 5KAIH 3GNTA 4RGYA 1LFDB