2AEFA

Crystal structures of the mthk rck domain in ca2+ bound form
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
224
structure length
221
Chain Sequence
b'RHVVICGWSESTLECLRELRGSEVFVLAEDENVRKKVLRSGANFVHGDPTRVSDLEKANVRGARAVIVDLESDSETIHCILGIRKIDESVRIIAEAERYENIEQLRMAGADQVISPFVISGRLMSRSIDDGYEAMFVQDVLATRRMVEVPIPEGSKLEGVSVLDADIHDVTGVIIIGVGRGDELIIDPPRDYSFRAGDIILGIGKPEEIERLKNYISALVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-gated potassium channel mthK
publication title Structures of the MthK RCK Domain and the Effect of Ca2+ on Gating Ring Stability
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Metal transport, membrane protein
total genus 73
structure length 221
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02080 TrkA_C TrkA-C domain
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.870 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Voltage-gated potassium channel 2aefA02
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2aefA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2aefA01
1DC3A 3FBGA 5ES3A 3LT4A 4E2XA 3RC1A 4BNWA 1ZK3A 1Q7CA 2I5PO 4ZQGA 3AFNA 2BFAA 5ER6A 3DOCA 3V5NA 3AOEC 2WYVA 3GDOA 2J3IA 2OL4A 4LVUA 3ZW8A 2Y68A 5KVQA 4L74A 2VTEA 2EJWA 4CM1A 2PH5A 3QWHA 4NMHA 1YVEI 2Y1OA 3JQCA 1U5CA 4XQCA 5CEEA 1EK6A 2RCYA 4NFYA 2OBYA 3U4DA 3PEFA 1H2HA 1HYEA 3W8FA 4ZN6A 1MG5A 2P68A 3ONDA 2NU8A 2D2IA 1GYRA 2R00C 3ZDFA 5JYDA 2W2LD 4FJ1A 3E8XA 4ND4A 3AJRA 3RU7A 3E03A 5CP8A 3NJ8A 5KJCA 5DN9A 1QSGA 3QWBA 4HFNA 4MOWA 3KUXA 3H7AA 3GVPA 5EQFA 4WOKA 1N9GA 2OP0A 4MVJG 2AQIA 2PH3A 4WASA 1EDZA 3AFMA 2JCXA 2UVDA 1OC2A 4YT4A 2WD7B 5L3ZA 3SJUA 2IRWA 4Q3NA 3JV7A 2J3HA 4K6CA 3UAGA 3PJGA 3L4BC 1TXGA 1HE3A 3JQDA 1E3WA 4IJVA 3Q0EA 4Y98A 3ANMA 2NVBA 3DAGA 4J1SA 3ZNQA 4LMPA 3WWZA 3B20A 1LBEA 2EWMA 1NR7A 3PQFA 4PLPA 3IL2A 8ADHA 4MO2A 3FNFA 3DAFA 3MJ4A 1EBFA 4K26A 1AN9A 1I8TA 4CLDA 2UUPA 2DBVO 1CDOA 4XZ3A 3WYBA 3QQPA 1LDMA 3MWEB 5AYVA 5IDYA 4H7PA 5CAEA 2EXXA 2B69A 4GX1A 4JBHA 4DBVO 5A9SA 2YW9A 1ZMTA 2YFHA 3GFBA 3PFFA 2DBZA 3ZU3A 2B4QA 2FOIA 1ZXBA 3BA1A 3ON5A 3ZV6A 1BW9A 1E7QA 3PI7A 4HFRA 4RF4A 1ZSVA 1Q0LA 2XXBA 4CL8A 2Q2VA 1A4UA 1Y81A 3BTSA 3B6ZA 1VE9A 4XIJA 1R4NB 3WMXA 5KNLA 2PV7A 2VHWA 1T2CA 3DZHA 5DZSA 1EUDA 3HNPA 4CM8A 1KEPA 4WECA 4ID9A 4Z0TA 1IYZA 1P0FA 3FI9A 4NU6A 3EYWA 3PHGA 4RPGA 4IIVA 4IMPA 2CD9A 5EMHA 4EW6A 1Y6JA 4YXFA 4ZD6A 4PLZA 1CETA 5JAQA 2PK3A 4R5MA 3OFSA 5GMOA 3CMMA 4QFDA 1LRLA 1N92A 1P1FA 2YY7A 2X23A 1DRUA 5K9ZA 4JGBA 2HSDA 2PY6A 4MKZA 4M87A 1BMDA 2Q1WA 4FJ2A 4MIEA 5U9CA 1JWBB 4PLYA 5H83A 4CPDA 3L07A 1EVJA 4WNCA 3S1LA 4CM7A 1ZFNA 4L73A 4BO1A 2VYVD 3O38A 2WM3A 3OIGA 1ZXLA 3WGQA 3QVXA 4IIUA 1ZUD1 2EKPA 3RUFA 3Q2IA 3NV9A 1U3UA 4BB5A 2C5AA 2P2SA 3VH4A 5TX7A 2BF7A 4YJGA 1KOLA 5TRTA 4Y6RA 3D3WB 4BNNA 2C20A 4F3YA 4XRRA 5A9RA 1ZEMA 3Q6IA 5DBFA 3FPLA 2VHVA 3TPCA 4DA9A 4IM7A 3PZBA 2FN7A 1KVSA 5ICMA 3ZNNA 3E82A 2OORA 4Q3EA 3SVTA 1UUFA 2IEDA 4ND2A 1QRRA 4PLWA 1MXHA 2BD0A 3QLJA 3EUWA 1UH5A 3WXBA 2EGHA 3B1FA 3DZKA 2EW8A 3WNVA 4YACA 3I23A 2DPHA 4ALLA 4OKNA 1HDXA 4XR9A 1A4IA 2V6MA 1Q2XA 3M2TA 1YXMA 2NADA 3VTFA 5CG1A 1A71A 3RASA 2YHUA 2NTVA 5IZCA 2B4RO 3CIFA 2E6UX 4FW8A 4CR6A 3TDKA 5AOVA 3ROQA 1MGOA 4RL6A 1HDYA 4M55A 4RQTA 1O9BA 1DXYA 3LT1A 2HO5A 3ETDA 3WJ7A 5I7FA 3DEYX 3K92A 1B0AA 1TVEA 2HCTA 1QG6A 4WE3A 3GVCA 1NASA 1P45A 5BSGA 5BQFA 1NM5A 3NGXA 4QECA 3W4KA 1DB3A 1I5RA 4JROA 4E2ZA 3ADOA 2ZCVA 3KBOA 1I2CA 4YAIA 2GNAA 3HDQA 1E3SA 2B4TO 3ZU2A 3HDJA 1U8FO 4WLEA 2AE1A 4J7XA 4E21A 3D4NA 3U9LA 1ADBA 4OXNA 2EIHA 1DLJA 4RVUA 1TT5B 5JMWA 1EK5A 2GN4A 1ZIDA 3UGKA 3WLEA 3UCEA 2WD7A 2R6JA 1GDHA 2D3TA 3RWBA 4ZGWA 3H9JA 1UDAA 2BLLA 3QWFA 3LC2O 2C59A 3WQQA 3ZWAA 4C7JA 1X7DA 1JKJA 1YBAA 2I99A 1AUPA 2QRLA 5JDCC 5A5EA 1OOEA 1JTVA 4NIMA 5K6AA 4EYEA 1N7HA 2G0TA 2HUNA 4UUPA 1GYPA 4YQZA 5JE8A 1DIHA 1GPJA 2Q46A 2Y66A 2I9PA 3INTA 3ZH2A 5IDQA 3TZQA 4BV9A 4ND3A 3JYQA 2DBRA 2NWQA 4FOOA 4EEZA 1DOHA 5EPOA 3WSWA 2QW8A 2E82A 2B0JA 1UXJA 3K2BA 4E2YA 1GYQA 4DIBA 1V35A 2ZQZA 3PPIA 3PYXA 4R16A 5U4QA 1PTJA 3TN7A 4BMSA 2Y1EA 1MP0A 1DC6A 2DKNA 2JAPA 2EV9A 4RGBA 4JXKA 2IEBA 2DTDA 5IFLA 3FN4A 2BKNA 2C2XA 3PIIA 1Y8RB 2VQ3A 2BHLA 4IMRA 3K6JA 4R1UA 4OO3A 4RJTA 3DBRA 4J43A 3NUGA 4BGEA 4DMLA 3GY0A 2FMUA 5GZ1A 1U4OA 1S6YA 4GSKA 1EUCA 3JQGB 1JKIA 3KEOA 3LQFA 4K6FA 4AJHA 1VC2A 4B8ZA 5JAIA 5B12A 1DBVO 5C3MA 1IUKA 5FYDA 3F1LA 2G1UA 3IKVA 3ZWVA 1HT0A 1LLCA 3SEFA 4N5NA 1I3KA 2DTXA 1LLDA 3DMTC 4GLOA 4BGUA 5AXDA 3OEYA 4O0LA 4W9NA 3VPHA 4NJMB 4BGVA 1DJNA 1RPNA 4AJ1A 1E3IA 1E7RA 1H6BA 2OOSA 1C0PA 3ETGA 4BKPA 5KTKA 2ZKLA 2FZEA 4Z9YA 1T24A 3NX4A 2P4QA 3UVEA 2YDXA 3JYNA 3OQ1A 3IUSA 2CVOA 2J5RA 1M6WA 1YDEA 1MV8A 4AJPA 4FGSA 2C7GA 4D3SA 3F1KA 1XHLA 1UXKA 3ENNA 5JCXA 3IKTA 1X7GA 4WOJA 4JQCA 1KEUA 2HMWA 2BKAA 1ML3A 3FNHA 4GWGA 3VKUA 4BO9A 4OXYA 1D8AA 1N8KA 5JAZA 1HXHA 1LDBA 3JD0A 1O94A 2NQ8A 4IQ0A 3BTVA 3T7CA 1GZ6A 4XGKA 3WB9A 3ZCXA 2NUAA 3DOOA 4GMGA 4XDYA 3D0OA 5IDWA 3JQAD 3IP3A 2Q4BA 1NHGA 4IBOA 3WFIA 5F21A 1QYVA 3PK0A 3V2UA 5L40A 6ADHA 1YQXA 1SB8A 3GHYA 2Y0CA 3BMNB 4P8RA 7MDHA 1DRVA 1VJ0A 5IF3A 2DTEA 2X7HA 1NHWA 4A26A 4DPKA 1T1RA 2E49A 4BIIA 3TQHA 3F3SA 4L75A 1DIGA 2VRCD 3WBBA 3VDRA 4D3FA 4BOYA 1DJQA 2DVMA 3OQ6A 4QTZA 4CM3A 4WLFA 4YQYA 3AY6A 3V1TC 4OOFA 1X0XA 1E1NA 1GV0A 2Z1NA 2ZB4A 4FGWA 1V6AA 4KWHA 3OECA 1NWCA 2ZTMA 3AUSA 1I01A 2E48A 3DBLB 3OBBA 2ZYAA 4ITUA 3V1UA 1B7GO 3KB6A 1ADCA 2YJZA 4E0BA 1I3LA 3ASUA 3M6IA 4D0RA 1JAYA 5DP2A 2BMAA 4IS3A 1OI7A 2GR9A 1XIVA 1GAEO 4CQMA 1PGNA 3VPXA 4IINA 1YH3A 1XR3A 2YHIB 5THQA 2HJRA 4KUEA 4NK5A 4QUKA 1ZK1A 4WCFC 2O2SA 4OM8A 3TZ6A 4YJDA 3PHJA 2C7VA 3UH1A 4MP8A 1BTOA 2WYUA 1YOVB 4ESOA 2WE7A 2AQ8A 1CIVA 2GLXA 2Y1CA 4QO8A 3BHMA 2VZ9A 1TT5A 5HA5A 2H6EA 4CUKA 3NDRA 1ZK2A 2C82A 4L0QA 4BV8A 2BKOA 5DF1A 4CMGA 1VLLA 1PJBA 2JKVA 5T67A 1TB4A 2CUKA 5G0TA 4GAEA 4U6SA 1QYCA 1R66A 5CEFA 4YAEA 4DUPA 3JQ8B 4RVSA 2D1YA 3RBVA 4J4TA 5CG2A 3DZIA 5L53A 4B4WA 3EDMA 4ZQHA 3D4PA 1W0CA 2BELA 4CMKA 1P33A 4IDGA 5ER9A 4CL3A 3WOHA 1LXCA 3GPDG 2PZMA 3DL2A 4FFMA 3OP4A 4FFRA 2VZ0A 1Y9AA 4G5HA 4MVJH 1A7KA 2W90A 4Z0HO 4EUFA 1KEVA 1NAHA 2DAPA 1ZZEA 1BVRA 1HTBA 1XQ1A 1N1EA 2OP1A 4L4XA 3ROKA 5JXWA 1KVTA 1P31A 3ENKA 2EP5A 4KQWA 3VOSA 4HFMA 4Q39A 1UXGA 3I9JA 4AJ4A 1FF9A 3OJOA 1I33A 4Z0PA 3FHLA 4PZEA 1Q7GA 1Z82A 1B8VA 3RSHA 1Y8RA 3W8DA 2GGSA 1DRWA 5F1PA 3T7EA 2X5OA 4ZICA 4CV3A 1PJ4A 3AUUA 4WLUA 1UR5A 5AXCA 3DXFA 1SOVA 4JIGA 5JDIA 2PNFA 4YWJA 2QQ5A 2PTGA 3BIOA 3DR3A 3TFOA 1G6KA 1ENPA 1A9YA 2DT5A 1BSVA 3AUAA 4FD3A 4N7RA 5HTOA 3TL3A 3DBVO 3I9KA 4JJIA 3MZ0A 1DLIA 2Q3EA 2W4QA 5CDUA 1PJQA 4BS9A 1GUYA 3NTQA 3K31A 1KY4A 2CDBA 3K8ZA 4IDDA 1E3WB 1JU9A 4J91A 3BMQB 2VNSA 4O1MA 4CM9D 3G79A 3TZHA 1OZAA 3CINA 1XKQA 1E1MA 4BNUA 2B5VA 2PD4A 1HLDA 1AXGA 1GL3A 2V65A 3HB4X 3TFQA 1U4SA 1DC5A 1JA9A 4TRMA 3DHEA 1P1RA 3QY9A 3ZWNA 1H2BA 3L6EA 1NX6A 3GRPA 4J4BA 3P5SA 3V2GA 3UW3A 2HMTA 2Z95A 1YB4A 3NDJA 4FIZA 5C5IA 5B4VA 5JAMA 1SPXA 2E37A 4ONEA 4RVFA 4I1IA 1YB1A 1QV7A 4I5DA 3A14A 1X14A 5A9SB 2EF1A 5L7TA 2X0JA 1ENZA 3HN2A 3JD4A 1CWUA 3BMOB 2ZB8A 4OHUA 3OA2A 4OMUA 3X2EA 4DVJA 5CDYA 4BNLA 2X4GA 3U3XA 4YRAA 3WGTA 1ZK4A 3GT0A 3PDUA 4BL5A 4DXHA 1F8GA 3PGJA 3WYCA 2P9EA 3IJRA 1LC3A 1Z7BA 3RI3A 4CM8B 5ENDA 2WE8A 3AUTA 3F5SA 1UXIA 3OH8A 4AFNA 2O7SA 4O6VA 2Y67A 2Y93A 1K5HA 1E5QA 4TRJA 4ZU3A 2V6BA 3FBTA 2VZ8A 1YBMA 2O2YA 5I8WA 1A27A 2AG8A 5ILOA 1M67A 1QXSA 4GMFA 4DMMA 3JSAA 4NFHA 2PZLA 2GD1O 4UVEA 5EQDA 3IIEA 1QKIA 2YYYA 3LF1A 5LDGA 2DM6A 5TIIA 4PVCA 2EHDA 4J9UE 3UCXA 1XLTA 3WYEA 3OICA 4CODB 3QVSA 2Y05A 2AXQA 2GO1A 1BXGA 4QO7A 3WIDA 2OFPA 1DHRA 3UICA 1YGYA 4OGWA 4A03A 3I1JA 3RC2A 1T4DA 3CKYA 3I52A 2JCVA 1IHYA 4NR0A 3ZWWA 3JQ9A 3KZVA 1BRMA 1PJTA 4KMSA 4XYLA 2O4UX 4FBGA 1YO6A 5TLSA 2P9CA 4GWKA 5IN5A 4PZCA 3QIVA 1R16A 4OH1A 4IJUA 1PS9A 1ZK0A 3GPIA 4R9RA 1EVZA 4DREA 5JW6A 2QZ9A 3GNQA 3C7CB 2C2YA 2AEJA 2EP7A 3CXRA 5GZ6A 4YS2A 4CLRB 4B8WA 4NQZA 1FDSA 1WMBA 2VWHA 3ZWYA 5IJZA 4AJIA 2OBNA 2IDZA 3WTBA 1PGJA 5DULA 1E7WA 3VZQA 2E4AA 4DTIA 4RVHA 1D4FA 5T6BA 4RZIA 4BNMA 4PCVA 4J1TA 4CMEC 3PP8A 4IDBA 4FN4A 3SLKA 3UKOA 4ZQBA 4P22A 1B14A 1PWZA 3HADA 4ZQFA 2Q45A 4NU5A 2VWGA 4EUEA 3I3OA 4QFCA 1PU2A 3FD8A 2X9GA 4R3NA 3WS7A 5HS4A 1TLTA 3JQ8A 1QYDA 3MOGA 4YAKA 1ULSA 1I36A 1ADGA 3PYMA 5G0WA 2W2LA 4F46A 4CV1A 3TJRA 5EINA 3HSKA 2B37A 1LJ8A 3HWRA 4RF3A 1IPEA 4HBGA 4INAA 1RYDA 2C5EA 2H63A 3JQFC 4XRGA 4B79A 1K6XA 1V8BA 4IJWA 3AOEA 4TVBA 1K2WA 4BMNA 3AI1A 4DIOA 3W1VA 1KYQA 5L9AA 1EBUA 3N58A 3NAQA 5COBA 3JQ7B 5TGDA 4BO0A 4RPKA 1L7DA 1JVSA 1MB4A 2X6TA 5MDHA 2XPCA 3W6ZA 1IHXA 3HE3A 3B1KA 3TZKA 3ZWOA 1XCBA 1H94A 1E5LA 4I9NA 4ZRMA 4WCDA 4R01A 2JL1A 2R00A 3PTZA 1MXFA 3D1LA 1IOLA 4NBTA 1NFQA 2X1HA 3QWAA 3M1AA 4UVGA 2IZ1A 1EFLA 1T2DA 2JHFA 3QHAA 5ITVA 3DAPA 1LRKA 4M89A 4TVOA 5KJ1A 1A7AA 5B1YA 1KY5A 4RVGA 3GG9A 1C0KA 5JNLA 1ZKMA 3BMQA 1KVUA 3I9NA 1ORRA 4U5QA 3KYCB 3KOUA 4DBZA 4Q9NA 4XJTA 4XQGA 2ZTVA 3ICCA 5KIAA 4AJLA 1LLQA 3GC6A 3L4BA 3E18A 2FP4A 3ADPA 1SAYA 4WGGA 2YFQA 4CV0A 2IXBA 4QSMA 3SC6A 4PLVA 1HSOA 1H6DA 1K6IA 1HDGO 5HS6A 4PRLA 1GU7A 3T4XA 3I4CA 2H9IA 2NU7A 3EZLA 3NJ4A 4RPLA 3NGLA 1GQQA 1UJMA 1V3UA 3TSCA 3WR5A 3F46A 3LC1O 3S2FA 3BMOA 2JFGA 3DBRB 1M6HA 3D5QA 2O3QA 4UREA 3I4FA 2J5QA 3S55A 4PRKA 2ZATA 1XYGA 4KOAA 5L4NA 5DBIA 5A3JA 2EW2A 3KSUA 1E3EA 1UZMA 2GERA 1WDLA 2HAEA 3RUCA 1GCUA 3JTMA 1LC0A 2WSBA 3JD3A 2HDHA 1GEEA 3QJ5A 5TT1A 4DL9A 1R12A 1W8DA 4YBZA 4BKOA 1LSSA 4MVJI 1PL6A 4HFJA 1BGVA 3QRWA 1GUZA 2BI7A 1WPQA 4E5YA 5IDXA 3KXDA 1PL7A 2JHGA 2LDBA 4J2OA 3KLMX 4R9SA 3AWDA 3WGIA 3FTPA 4XYMA 3LSYA 2VYVA 1AXEA 4B7CA 5CDSA 3DONA 2RBEA 4XWYA 5BT9A 2O23A 4CV2A 4Q3AA 3NEPX 4I5EA 3NKLA 3DQPA 1CYDA 3I9LA 4A0SA 1KBZA 3WTCA 1I32A 1N5DA 3C7AA 2POQX 4U0KA 3JQAB 4JN6B 2Q1TA 5HWSA 4DQXA 1CJCA 3G49A 3VPSA 1SB9A 3GAZA 4XA8A 3UUWA 4CM4B 4OQYA 4U7WA 1QYXA 5T57A 5FF9A 4WUVA 3H2ZA 1OMOA 4YCAA 3MJTA 1JLLA 3QW2A 4O5OA 1DHTA 5C7LO 2Q49A 1P77A 4CLRA 3H9QA 3IJPA 4YDRA 4BO6A 4PLHA 1WZEA 4LRTB 3R1IA 5TS3A 2J6IA 2HMVA 4MVJM 4J2HA 4XYBA 1I10A 3B70A 3WWYA 3RD5A 3MTJA 3NTOA 3O4RA 1ZCJA 1ENYA 3DZBA 2WYWA 5I7EA 4WKGA 1Q0QA 4YRBA 2A35A 4ROSA 4HNHA 1Y7TA 2VHZA 3L4SO 5DCWA 4QEDA 4E5PA 5COAA 2Y99A 4UVIA 1YJ8A 3HQ4O 4NDNE 4BNGA 3DFZA 1DSSG 1JW9B 1RM4A 1X15A 5DCYA 4CMIB 4JCOA 1O0SA 3H6KA 1JN0A 1N7GA 1Q0HA 1QLHA 3MOIA 2FSSA 4OOEA 1ID1A 1DIRA 4J16A 4N54A 4PFJA 4LISA 1T4BA 1LLUA 3QWIA 4BNXA 2HRBA 2DU8A 4CR7A 1C0LA 4IS2A 2VRBA 3KO8A 4CLEA 4GKBA 5KJ6A 2YZ7A 4RZHA 5JO0A 1SBYA 3PQDA 4CQMB 1CERA 1T26A 3HJAA 4R5HA 1Q1NA 4MIOA 3JQ7A 2HRZA 3W4JA 4UAGA 1LDYA 1N1GA 4I5FA 3OIFA 3IAHA 4L4SA 1UZNA 5JYEA 3JYPA 1U3WA 1HYGA 4H16A 4MKXA 4D42A 2X8LA 3E5RA 3D7LA 2QHXA 4PGFA 2PWZA 3LZ6A 5ENVA 1PGPA 4F6LA 1BDMA 4YJFB 4RQUA 3WSVA 3JQBC 4D3DA 2PLAA 4Y6SA 2VYNA 2ZYDA 3KEQA 1U2GA 3PJEA 3GDGA 3EY4A 4TKMA 2FPPA 2GASA 1YRLA 4HX5A 3DOJA 5FFFA 4JP3A 1PZEA 3FNGA 1KEWA 2DPGA 2CDAA 1LQTA 2VTDA 1HDOA 4CUZA 4TQGA 5KKAA 2W98A 3KYCA 1XDWA 3TWOA 3ZZNA 1BVUA 2Y1DA 3WJAA 5A05A 1MX3A 3GAFA 4EZBA 1OAAA 4W7IA 5TQVA 3S2IA 1ZJYA 4XR4A 3AI2A 4J9VA 1XQ6A 5A4DA 3GGPA 2VYND 1F17A 4YAJA 1YB5A 5JDCA 5THKA 1IZ0A 2Q2WA 5BSFA 1J4AA 2B83A 3LC7O 4BKQA 1ZW1A 3GUCA 3MTGA 1QYWA 5F3RA 2F00A 3INRA 3N74A 5KJEA 4D79A 3DB2A 4CUJA 1VKNA 3RROA 1H93A 4GX5A 5DOZA 2FPIA 3GGGA 4GVLA 3ROPA 1HKUA 5JPIA 2DC1A 4MVJE 1KS9A 2WD8A 1K0UA 4M8SA 2RAFA 4EUHA 1A72A 2HLPA 1XU9A 3H9GA 4ZJUA 4ALKA 3H65A 3GLQA 5J23A 3DBHB 4GH5A 3BYZA 2EGGA 3BTOA 3PVZA 2GN6A 3RFXA 1NYTA 3ITDA 3E6AA 3EHEA 3ORFA 4H3VA 2I66A 1I2BA 1GR0A 3DHNA 3EGOA 4OYRA 3A4VA 4F45A 5JLAA 4E6PA 3K5PA 2HK7A 2IXAA 3DWFA 3MJSA 1E6WA 5H81A 4UUOA 3UF0A 4YPOA 3PHIA 3GGOA 4IY1A 4CM6A 2FSVA 3DMTA 4Z9FA 5T8KC 4CLOB 4CQLB 4UUMA 3L0DA 1ISFA 1HL3A 5DCUA 2BH9A 4IPTA 4K9DA 5JY1A 2QRJA 4ZVVA 1K3TA 3MWDB 1HE4A 5HM8A 1PEDA 4KQXA 3JQAA 3R3JA 2I6TA 5T8KA 1VJTA 3JD1A 2DLDA 4CM4A 1E1LA 3P2YA 2JJYA 1NFFA 5DOVA 4B3JA 2Y1GA 3DTTA 1Z45A 4XJSA 3FSRA 3OETA 4NK4A 5L4LA 4IDCA 1UAYA 2I67A 4FOSA 1DAOA 3LF2A 3FWZA 4EJ0A 1V9LA 3CZRA 4Y9DA 4JBGA 1ZSNA 2VRCA 3IP1A 3SC4A 3PGXA 1B16A 4YT8A 5G4LA 1P1IA 1YQDA 3RCBA 2NACA 2VNAA 1UXHA 2W8ZA 2ZCUA 2EKLA 1ISGA 3OMLA 4B3HA 1B8PA 1DPGA 1LSUA 4DWVA 4OAQA 1HLPA 1P3DA 4Q3CA 1VL6A 1ZNQO 1FDTA 1RYEA 2G17A 1PX0A 3RUIA 1SO8A 2GN9A 1H0KA 3BTUA 3IUPA 5I9MA 3RFVA 5BR7A 3GEGA 1NQOA 3JCZA 1TEHA 3QV1A 1NXQA 1U3TA 1LUAA 4W6ZA 2EERA 4LVCA 2GYYA 4DLAA 1B26A 4IDEA 1HDCA 4CMIA 1W4ZA 1BXGB 3S2EA 3W8EA 1CQJA 1NTOA 5TNXA 2NTNA 3G17A 3GOHA 1VKOA 4MVJD 2IYPA 3ZV5A 4E3ZA 3FR7A 1PIWA 3M1LA 5A9TA 4A7PA 3GMSA 3UHAA 3H5AA 3PWZA 3GVXA 5A04A 1C0IA 1QLJA 2C07A 2Q1UA 4RV9A 4PZDA 1SZJG 4DPMA 3VH2A 1EFKA 1UDCA 2HKIA 2WWRA 3ZN2A 3ZWBA 3VHRA 1U8XX 4HP8A 1XWFA 3H8VA 4J4HA 2RHCA 4U6QA 3DZGA 2DUUA 3PQEA 4GPD1 4CMCA 4DPLA 1UP7A 1D7OA 3PYLA 2NU9A 4JBIA 1MA0A 3U49A 3U4CA 2A92A 2O3TA 1E7YA 2P9GA 4DQUA 2BI8A 2PGLA 2XAAA 4J0EA 4WCFA 2CF6A 4YJFA 3RC9A 3M2PA 4IXWA 1ZVMA 4CMAA 1MFZA 4A73A 3U5TA 3BZUA 2D5AA 4KTVE 4XIYA 3C1AA 5B4TA 4LSWA 2DQ4A 1G0NA 3C7DB 2FPGA 4BO4A 1GUFA 2V6GA 4LW8A 4XYGA 1NFRA 3VPGA 1O5IA 2WMDA 4NG5A 3HFSA 4BO5A 1QORA 1T25A 5L51A 4BO8A 4GI2A 2OO5A 2BFOA 4EGFA 3U62A 2ZQYA 2NU6A 2CSUA 1Q7BA 3F5QA 1JKFA 3LVFO 1DAPA 2R2GA 5JCJD 4Y67A 4CLHA 1P9LA 5T64A 4BNKA 2AEFA 3LT0A 1GADO 3S2GA 3CH6A 1MC4A 1H6CA 1CEQA 4BGIA 5DT9A 2D59A 2FZWA 4IDAA 4OXKA 5AVOA 4RDHA 1Z6ZA 1B15A 4AG3A 2UV8A 3WGOA 3SJ7A 3I83A 1DC4A 4ALNA 4WPGA 1NVTA 4YYZA 4TKLA 4CM9A 3ZHZA 3WMWA 4PIVA 1P1JA 1R0LA 1HE2A 4DLLA 5EIOA 3DBHA 3GUYA 1I3MA 4E31A 1NQ5A 3E5MA 3LDHA 3WGYA 2Q50A 1ZBQA 2ILTA 3HG7A 4XD2A 1FJHA 2PKQO 1ZSYA 2X5KO 3GFGA 4OSOA 5I7SA 2NNLD 4NH4A 4GVXA 2B35A 1DDOA 1XGKA 3GG2A 3EMKA 3ZW9A 1X0VA 3CZMA 1CQIA 3Q3CA 5TT0A 4NBWA 1KVRA 2B5WA 1IULA 1PQUA 3VAZA 2HJSA 5CDTA 1SCUA 4CQLA 4CLOA 4TMFA 4FC6A 4I5GA 2LDXA 4URFA 2GSDA 3QE3A 3RFTA 4EJMA 5H82A 5FI3A 1QP8A 3GK3A 2QYTA 3L9WA 1ULUA 5L4SA 5EN4A 3RUAA 4W4TA 2RIRA 5DDIP 3K73O 1E7MA 3NDIA 3NT5A 4P4NA 2Y1FA 5L95A 5CPFA 2D4AA 1VRWA 1Y9EA 5HBRA 5TJ9A 1LDNA 3AY7A 3P7MA 4EJ6A 3CPSA 4M86A 1NNUA 3GRKA 1MC5A 1A9ZA 1RM3A 2P4HX 4W82A 1LSJA 5TJHA 4Y6PA 4XTTA 4A10A 3QVWA 1LA2A 3UCFA 1VI2A 3TF5A 2B36A 1VJ1A 4GQAA 3K9QO 4XGNA 4TROA 1I24A 3OM9A 5F1OA 1PJ3A 3JQ6A 3ZWPA 3NYWA 4II2A 5COQA 4CLXA 3COSA 5A03A 1MUUA 4YEDA 1VM6A 3D4OA 2AG5A 3KETA 4WEQA 2YV2A 3LK7A 4J7UA 1EMDA 2X22A 3TL2A 4PG5A 1H9AA 2PZJA 1GV1A 4E32A 1GFSA 5C7OO 1XSEA 1RKXA 1EVYA 1D1TA 4JX8A 5CFZA 1R4MB 1E0DA 2ZB3A 4ND1A 2Z5LA 3O8QA 5IN4A 4NBRA 3WBFA 4BB6A 1GTMA 4UEOA 3R6DA 4E30A 1IE3A 1WZIA 2I65A 4BO2A 1J49A 1I3NA 3VC7A 4D41A 5KKCA 4C4OA 1YL6A 3GVIA 1IPFA 1ZJZA 5JSFA 4LRSB 1ISMA 2JD1A 1X1TA 4AJEA 4FFLA 3FNEA 4B7XA 1AE1A 3GZ4A 4RPJA 1VSVA 4XYEA 2GZ1A 4UULA 3OJ0A 5IXYA 3STHA 5FEUA 1NQAO 1ONNA 3GEDA 4E5MA 1ISJA 5JC1A 3RU9A 5IG2A 4BQPA 3ST7A 3DZJA 1H5QA 3AK4A 4L4RA 3RKRA 5ILGA 5BSHA 1EZ4A 4MVJF 3GZNB 1EQUA 2AMFA 1PJCA 2QZZA 2YV1A 4PG6A 1JAXA 5BNIA 4MP3A 3A9WA 3EK2A 3O26A 2PD3A 4MP6A 2GPTA 2O50A 1DO8A 1H9BA 3P2OA 1JVBA 2JD2A 4DC1A 1YL7A 3EZYA 4J49A 2VUTA 3ONEA 3RVDA 2YUTA 2CF5A 1Y5RA 3AM5A 4YTEA 4CMEA 2DBQA 3WGHA 5IZ4A 3CE6A 3ZWMA 2A4KA 3VTZA 3Q9UA 3WX0A 1OFGA 4NHEA 2WJPA 4DIFA 2HU2A 2ZTUA 3VZRA 2EJVA 3WGZA 3C3XA 1X7HA 3DHYA 4NBUA 4EBFA 4HV4A 4I08A 4X54A 1MLDA 4W99A 3VPFA 4YR9A 2BGLA 2PD6A 1AHHA 2TMGA 4RCVA 3G1TA 4PG8A 4FCCA 4NBVA 4E5NA 1XELA 3PWKA 1EVIA 1ISHA 2QG4A 3EC7A 1M66A 1MFPA 2I76A 3JQFA 2UUOA 3GH3A 4Q3DA 4FSHA 3GR6A 5AQ1A 1WLYA 5I7VA 5KCZA 8LDHA 1I2ZA 5FWNA 1J5PA 4GGOA 3L77A 4QQRA 4IJKA 2O48X 1NBOA 3TZCA 3F4BA 9LDTA 1JQBA 2RH4A 4I8XA 2BKPA 4XB2A 5CEJA 1GY8A 1IB6A 4RF5A 3NT2A 1T2FA 2NTJA 1TI7A 1PWXA 2NVWA 4HXYA 3VVCA 4E12A 1RM0A 1U2DA 4TWRA 2QX7A 2Q2QA 1IZ9A 1NR1A 1SMKA 4B7UA 1EDOA 4UVHA 2GZ3A 4Y8VA 4ND5A 2XF8A 4MKRA 4J1QA 4FC7A 3GMDA 2BRUA 3RAJA 3U09A 2CNBA 5I9LA 3U0BA 5KVSA 1G0OA 3SBOA 3KLPX 3QA9A 3RUEA 4R69A 1HE5A 3R3SA 2AHRA 4PVDA 1PQWA 2V6FA 4HKTA 4IQGA 2GDZA 2ET6A 1C1XA 3JQEA 4HY3A 1UZLA 1DFHA 4JLWA 3TOXA 4S1VA 2OXIA 4FFNA 1AGNA 1FMCA 3AI3A 5GY7A 3ULKA 1TT7A 3ASVA 3ZNPA 3ZHBA 1WP4A 1EEHA 1RWBA 5B37A 3FWNA 4C7KA 3EVTA 3RBXA 2UAGA 1YWGO 3OJFA 2AEMA 2BGKA 4OL9A 4OIMA 4Z6KA 3MCVA 3BAZA 3GF4A 3AM4A 5T5QA 4GL4A 4JJFA 3C1TA 4NI5A 1GZ3A 1D1SA 3OA0A 1GCOA 4XQEA 2IODA 3F4LA 2X58A 1U7TA 3W6UA 1LX6A 2VUSA 2VCYA 1NWHA 3V1YA 2CY0A 2FR8A 5TF4A 3I6IA 5C37A 1KVQA 1EE2A 4WK6A 3SLGA 3VDQA 1LTHR 4WLNA 5EL0A 2X0IA 1V3VA 3PLNA 1J6UA 5MGBA 4DQVA 5A1TA 2V7PA 3NTRA 1SOWA 3RUDA 1NVMB 3GN1A 1FXSA 5A02A 4UEKA 4E2WA 4NZ9A 1VL8A 2VWPA 4HWKA 2QRKA 5KWEA 3U4IA 5GZ3A 1R4MA 2W2KB 4GBJA 3ZWCA 3E1KA 5FI5A 2WTBA 3HZZA 4BHTA 1HZZA 3PXXA 4D45A 1VL0A 2PKRA 4ALMA 3RKUA 1KC1A 4YA6A 5L7WA 1WDKA 3P19A 4YRDA 4I9HA 1GD1O 1SEVA 5BSEA 4YT2A 2I3AA 1MG0A 3H5RA 3QVTA 4LCEA 4XGIA 3V2HA 4KDEA 5KOIA 3KTDA 3PJFA 3PFWO 4R51A 5A06A 1E6UA 4BKRA 4WEOA 4R4JA 4D44A 1AHIA 5JO9A 4ALIA 1QV6A 5F5NA 1U9JA 1JDJA 4P38A 3ZU5A 3WIEA 5K0ZA 3AY3A 5G0UA 3RBZA 4A2CA 1S7CA 3GZNA 3F9IA 2P5UA 2ZYGA 4WLVA 3T4EA 1K89A 4E4YA 3DTYA 3C85A 1P1KA 1P74A 2I3GA 3F6YA 3A28A 4J3FA 5JMPA 2FRDA 2C54A 3E9QA 2UDPA 1Z73A 4XDZA 4JP2A 4PG7A 2NLOA 3CEAA 1NQTA 4HADA 4LN1A 1ZH8A 2CMDA 5EJ2A 4ILKA 2PZKA 2CFCA 4KUGA 3EVNA 4QT0A 5LC1A 1KERA 2TMDA 4HUJA 3H9EO 3AU9A 1LEHA 3IS3A 2GN8A 4HNGA 5JY6A 4BNHA 3UFXA 4J6FA 3OSUA 4D0SA 2VOEA 2VHYA 3FF4A 5IZCC 3IQDB 1XA0A 1SNYA 4NJOA 1E1KA 1B2LA 1KIFA 2PR2A 4YJHB 4AVYA 2O4CA 3FRJA 4CJXA 4Z3DA 5HRUA 1YONA 4AJ2A 4ZHSA 1WNTA 3ZV4A 5F1KA 3TRIA 3W4IA 3ZV3A 4E13A 2G82A 1LRJA 3PIDA 4AICA 3D64A 4XCVA 5JBIA 4BO3A 2OGUA 1E3JA 1WXDA 3A1NA 5BNTA 1BWSA 2O3JA 4WCFB 3WQSB 1P1HA 2IYOA 2VN8A 3MJVA 2ZIZA 1HDZA 4TZTA 5G4KB 4BNZA 5JS6A 3PLRA 1R0KA 1R6DA 2BFMA 3CUKA 3ROMA 4ZQEA 4IZIA 4BNIA 1PGQA 2O3UA 1BXKA 4UUNA 4N5MA 2QIOA 3RC7A 3FTNA 1XEAA 4P4LA 4BQRA 1PZGA 2AA3A 3JQBA 2Q4EA 1LI4A 1LSOA 2BGMA 4RF2A 1U7HA 4LK3A 4BNTA 3L6DA 1PJ2A 4M54A 4M1QA 3VZPA 3ZNOA 2C29D 3G3EA 3G1UA 3C24A 3MEQA 4YT5A 1JWAB 1YDWA 4E33A 3FPCA 5K6AC 4RPHA 1WW8A 4OQZA 4CMHA 1CRWG 2FHSA 1PJSA 4U0JA 2D0IA 1PSDA 4BUCA 3OQBA 4D43A 1YJQA 3LU1A 3KSZO 4R1SA 5CPBA 2EG9A 4BNJA 2NQTA 1XU7A 2Z1MA 1PS0A 3QSGA 4RVDA 4BKUA 2JFFA 1NPYA 3V8BA 2P91A 3WG9A 2NV6A 2JD0A 3A06A 5L45A 2CVZA 5IAAA 3NT4A 2IZZA 1BHSA 3R0IA 2XXJA 2VT2A 1NPTO 1P44A 3BMCB 1UAGA 4G65A 3KYDB 3PHLA 1Z74A 4IQ8A 3WFJA 4FJ0A 3TNLA 2IE0A 4BO7A 1WMAA 4AJKA 4O63O 4GGPA 4FDAA 2ZJ1A 3RJ9A 5A3VA 3WGGA 1Y8QB 3WQRA 1J0XO 4IGEA 4EI2A 1ZO8A 2OMEA 1B3RA 2IZ0A 3NRCA 1R0SA 3OF2A 4UEJA 1W73A 3K2EA 1R4NA 1HETA 4MINA 1T2EA 1U3VA 1GQ2A 4W9NC 1F12A 2ZK7A 4FFOA 4S3MA 1A5ZA 1KETA 3DC2A 3UOGA 5ADHA 3D3EA 3IMFA 2O3SA 1YL5A 4L76A 4YVFA 2W2KA 4G2NA 4B3IA 4R3WA 3PJDA 4UVDA 4DYVA 4FFPA 2JFHA 1LNQA 1BXZA 2WDZA 1B3BA 3KHUA 5KVVA 4GX2A 1VSUA 4EEXA 3RQSA 5ITWA 9LDBA 2HK8A 3WNQA 1L7EA 1HRDA 2G5CA 1WDMA 2OZPA 3E48A 2VWQA 4MVJP 2VUUA 4KWIA 1YQGA 2X5JO 4W7HA 2X9VA 3ETEA 2X86A 1O89A 1C1DB 2AE2A 2C0CA 3L9XA 4O59O 1GEGA 4AJOA 3IC5A 4GLLA 2WEKA 1O6ZA 2QYSA 2OUIA 2NVUB 3RUHA 4PN3A 4L8VA 3FCOA 5KVCA 3LLVA 1SC6A 3LYLA 4MVJA 1U5AA 4J1NA 2YQ4A 4CM5A 4RORA 3I6QA 4TZKA 3BXXA 4I9UA 3HUDA 3KYBA 3HB5X 1ZMOA 3RIHA 3KRTA 4BNVA 2J5KA 1KC3A 2BFPA 5G0VA 4D46A 1DFIA 3D3WA 4KZPA 1FDWA 3WDSA 4XKJA 2A94A 4Z3KA 3MJCA 4ALJA 3INGA 4NFSA 3VH3A 3GEMA 4PLTA 5BNFA 5A5FA 1WVGA 3DFUA 3O8QB 4K28A 2Y0EA 4F6CA 4J0FA 4KDFA 2OHXA 3Q9NA 5LDHA 4Z9XA 1F06A 3N7UA 1Y5MA 3O9ZA 4GSLA 3KM0A 4KP7A 4XB1A 4BNFA 2X0NA 3S8MA 4JNKA 1E7SA 2HK9A 3C8MA 1I0ZA 2D8AA 4YJHA 1M76A 2AQHA 4FB5A 2PGJA 4PLFA 4CR8A 1FK8A 1EE9A 1HYHA 1ONOA 2VOJA 3D5TA 1E6EA 1X1EA 2ZB7A 4FR5A 4TRNA 4U8GA 3CMCO 4WNIA 2RH8A 1H6AA 4D7AA 1GPDG 4MPDA 5EESA 3IOYA 4WJZA 1T1SA 5G4KA 1EUZA 4R41A 1G1AA 1W6UA 2Q99A 3HFGA 4Q3BA 4RO0A 5JCJA 4R68A 7ADHA 4FS3A 1O95A 1YS4A 4AL4A 3C1OA 1WWKA 4BNYA 2GF2A 2HMUA 4XQ9A 2YQ5A 1HSZA 4DRYA 3GNSA 1C3VA 2J8ZA 4BVAA 4IUYA 3PWSA 4KTTE 1N2SA 3GDFA 3GNTA 4RLSA 3UN1A 1SEPA 3QP9A 4CMBA 1XG5A 2O3RA 4A27A 2GUGA 1BDBA 2GRAA 5I9NA 4CQMD 2PA3A 3DDNA 2YDYA 3H9UA 1HDRA 3H5NA 2FY8A 2CDCA 4MIYA 5DBGA 4BMVA 2A9FA 5JC8A 1PGOA 1DFGA 1K6JA 2Q1SA 4KUHA 3JYLA 3OIDA 4ZRNA 4DLBA 4LSMA 4IXTA 3LLSA 3CSDA 4QXMA 1IL0A 3ONFA 5L7YA 3PZRA 3ANLA 3JYOA 3OEWA 3ZHYA 4PG4A 4YAGA 3ZWXA 5DNAA 1PZHA 1ADFA 3DO5A 3GN2A 3QVOA 4NNJA 4L9RA 3WICA 5IXSA 4B4VA 2CZCA 3SXPA 1NPDA 3GQVA 5F5LA 3JD2A 5I8ZA 3VH1A 3Q11A 1L1FA 1VPDA 3K30A 1PR9A 4FQ8A 3VZSA 2AW5A 4OSPA 1T2AA 2SCUA 3E9MA 2D5CA 3BMCA 3KYDA 5JDIC 3TOZA 4AJJA 1QMGA 4IGFA 1DIAA 3GVHA 2GCGA 5C7IO 3AOGA 1LDEA 2PFGA 2DUWA 4P4GA 1LDGA 2H1SA 3OHSX 1N9GB 1X13A 1Y8QA 2NSDA 4H15A 1LQUA 4M49A 1EQ2A 4AJNA 5TC4A 3JQGA 5B4UA 5U1PA 1IY8A 3ZGYA 1E3LA 1R37A 3LT2A 4EITA 1O8CA 2DFDA 2J3JA 4OJNA 4J7CA 4TSKA 1PQPA 1C1XB 3ITKA 1FDUA 3GHHA 1U1IA 3EW7A 3KV3O 4LCJA 4ZA2A 1E77A 3RJ5A 2X0RA 3EAGA 4RLHA 3SX2A 4NJMA 3UXYA 1NAIA 1V3TA 1D3AA 2JAHA 3GA0A 3Q1LA 4EDFA 4N5LA 1E92A 2X9NA 4PLGA 5LCXA 1F0YA 3H2SA 3IDSA 1U28A 4IDFA 1UP6A 2NM0A 4NPCA 5ICSA 3K96A 4LGVA 3BHJA 2CVQA 2O7QA 4J90A 3BHIA 5G0SA 3AU8A 4XEHA 1PZFA 1RM5A 4II3A 3OJEA 1C1DA 3G0OA 5KJFA 3F47A 2Y0DA 1HF3A 2NVUA 4K1LA 1GZ4A 1YBVA 1CF2O 4JK3A 1HZJA 1BW9B 4MJLA 1V0JA 2VHXA 3FR8A 4WLOA 3DZFA 3ZU4A 4CMJA 1F8FA 3HHPA 1RJWA 3L6OO 2FR0A 1NP3A 1OC4A 3JXOA 5G2OA 3I5MA 3B1JA 4TRRA 1NVGA 1C14A 2P5YA 3I9OA 2HQ1A 1UP4A 1VCTA 1ARZA 1Z75A 3MJEA 2FR1A 3BMNA 1ONPA 2JCYA 1Y1PA 2PGDA 5AXAA 1PR3A 4RDIA 3H3FA 2DFVA 2HMSA 2VT3A 3ANNA 1I30A 3Q2KA 3E9NA 4B4UA 3PHHA 4DYDA 4GX0A 1M2WA 3U4HA 4OKIA 4R1NA 4DGSA 4A5OA 3AW9A 2UYYA 3ZHXA 3ABIA 3PDJA 4IZHA 1OBFO 3I9MA 1WAMA 1ZEJA 2J3KA 3KVOA 5AXBA 3JQ9C 4MDHA 3PRJA 5JFOA 1YKFA 2ZTLA 4E5KA 3X2FA 1DEHA 3DBLA 1YE3A 5DP1A 1QR6A 1FDVA 1UDBA 3HDYA 1B8UA 2FWMX 2RHRA 2GZ2A 4XX0A 1PL8A 1PS8A 2ZJ0A 3H3JA 4JJGA 1LU9A 4PLCA 3VVBA 2AQKA 1ISIA 5CDGA 2YV3A 1R15A 3DMYA 4LMRA 3KSDO 2F1KA 2YHIA 1Z7EA 5EERA 2EKQA 4FPXA 4QX6A 5CHEA 4DC0A 3WLFA 4YJGB 1HWYA 3HN7A 1YOVA 1ENOA 4G81A 2EEZA 5TSDA 1PJLA 3O03A 1HEUA 4B4OA 2PKQP 3ICPA 3HDHA 3AM3A 6LDHA 2XOXA 3H4VA 3OJLA 1F14A 4R54A 4GKVA 1P0CA 2H5LA 4N18A 3ZI0A 2G76A 1DIBA 3CTMA 4R1TA 3VKVA 1TA4A 1BG6A 1GQYA 4YB8A 1M75A
chains in the Genus database with same CATH superfamily
3RFFA 4DR5F 3DYVA 4JI4J 2WZ7A 4BNWA 4ZQGA 4LVUA 2HZBA 1N6PA 4R8MA 3NHBA 1EP1B 4XQCA 3OQJA 3P0HA 4UU7A 4K9OA 1GTHA 3FNNA 4K4ZA 3GLIB 3VMZA 1G8FA 2GMJA 1E5DA 1C1HA 2R00C 1VJRA 4B3MJ 3EVGA 2ZREA 1IBCA 3PX0A 3WHLA 5A7GA 1E98A 3CH4B 5DHTA 2C94A 3SJUA 1EAMA 2IRWA 1IEQA 2FMXA 1E3WA 3UXHA 3ZNQA 2HV8A 2OC9A 4KXNA 3U1BA 3I62A 1WUTA 3IB3A 2GBLA 3EGIA 3COZA 2Y4NA 4BB9A 1NR7A 1CJBA 1JEYB 3OZSA 3C15C 1G59A 3Q2YA 1O5JA 4PBSA 2WR8A 4R4LA 4XZ3A 4UCXA 5KFDA 3WBZA 1NBHA 1ZMTA 1NHKL 2E9RX 5F2OA 5K4HA 3LDGA 3HTXA 1Y81A 2BYCA 4ISCA 1EP3B 1Q7YT 2HFSA 4PWWA 1RPTA 3DZHA 4E7PA 4A8PA 3CZQA 2W6BA 1R3UA 1YCHA 4Z0TA 4WF9Q 4TTQA 2O01C 3NFQA 5EFWB 3RRMA 3R09A 2AZTA 4JUFA 4ZT2A 2Z2XA 2GUVA 3IURA 5BORA 3M05A 3ZDAA 4AI6A 3B5NC 1F3OA 1MABA 5EWMB 4CKEB 1STOA 3OF5A 2BFFA 3P45A 4OB8A 2WBMA 5HROA 2K87A 4I2QB 4WP3A 1ZFNA 3OU6A 3G8DA 4GP7A 1U1LA 2W7AA 2EKPA 4M5LA 3PCTA 1CUJA 1LK0A 3Q2IA 1TZCA 2LPMA 2OPQA 4QBTA 1BAPA 1BA3A 2AVNA 3G59A 3I6YA 2DZDA 3IRUA 3I2FA 2O1KA 3I09A 4EKYA 1T9AA 2OORA 4P71A 2XUDA 4DJDC 4QLBA 1R8SA 5FULA 4LQLA 3ESYA 4EHJA 1N33B 3W04A 4OKNA 1A9RA 2F1JA 5HOQA 2C7OA 1IN7A 3CIFA 5THXA 5F9LA 3ROQA 3MM6A 2A4MA 2IWHA 3N2NA 2HO5A 3D54D 3SIPA 1Z5PA 3ABRB 3F41A 2FJ0A 1TVEA 3QMMA 3UCGA 1DLOB 4HG2A 2PVSA 1KE2A 4GW3A 4G1QA 3V8QA 1QP0A 3WY9A 3HVTB 1HNVA 1DB3A 3W4KA 2ZCVA 3DFMA 3FKSD 2ZSBA 4JLNA 4Q4HA 4EB6B 1KEZA 5BYKA 3IAS1 4PM4A 1ULRA 3W64A 1FY2A 5JCZA 1NM2A 1RT3A 2BMEA 4FNAA 1HI1A 3X1DA 5LBIA 1K86A 1BHJA 3DXZA 1JHQA 1QPBA 2YKQA 1KWGA 1MAUA 3V48A 1K2VN 2ZUAA 2HS3A 1DOHA 2VPZB 1BGWA 3SS8A 1PTJA 2BSQA 2EARA 1VI7A 5CCHA 2LD4A 3O31A 4HEHA 2QP3A 4J43A 2D0PB 5LN1A 2CMKA 4CO4A 1Q7LB 1KK2A 1F48A 4XWGA 4YEAA 3KK1B 4GLOA 3SZ2A 4MW4A 4R7GA 5AW9A 3PTLA 4Q1FA 3STUA 3IAM6 1I3OB 3F98A 2HRRA 3ENZA 4YRPA 2VJMB 2CFTA 2PI5A 2PX2A 4C6RA 3F6CA 1JB1A 2CVOA 1M6WA 1MQ8B 3ZXXA 2VASA 5BXQC 2XUIA 4P74A 1Z8HA 1B0VA 3SWFA 4WOJA 4JQCA 1ML3A 1G60A 4C5CA 1VFNA 1XZNA 3ZCXA 4XDYA 3NVMB 3JQAD 1XPUA 1DIOB 1WZ2A 3KKKA 3IALA 3KR0A 3IVRA 5JNWA 1TM2A 3KKMA 2FSHA 2YY3A 5FOTA 4F4HA 3WGKA 3NGTA 5E1MA 4CH7A 2A86A 3JVVA 1E1NA 2DKOB 3CW8X 3OECA 4ZVPA 1ICEB 4DSKA 3KB6A 1DZ3A 4E0BA 3NBXX 2G2ZA 1S2MA 2CJXB 2QMWA 4WCFC 2ZH2A 4DV5F 1H42A 1U7WA 2BT4A 1IUNA 4DLNA 1K68A 4NKRA 1O3YA 2WHQA 1UZHA 5BVGB 4OCZA 5CIQA 3IA7A 3W34A 1Q83A 2RN0A 2APJA 1W36D 4RADA 3FZBA 3QXJA 1W5EA 1EJ2A 3DZIA 4DU7A 2QTLA 4WDRA 4YECA 1LXCA 3H5UA 1FQJA 3OP4A 4I1LA 2VZ0A 1KDVA 3ZXIA 4BWYA 3WMFA 1W94A 2RRNA 5JXWA 3VYRB 1ACLA 3GV0A 2Q9CA 3RSHA 1S8AA 4B82A 5F1PA 4KCGA 2NYAA 3L82B 3ZZTA 3P9SA 4IICA 1ENPA 2PMFA 2R8BA 2QP4A 4FD3A 3TAXA 3PICA 3TL3A 4BN0A 5BN3A 1PJQA 3I6ZA 4OQEA 2I22A 5DW3A 3E1SA 3RJMA 4ANFA 3P5BP 3CINA 2VC1A 4QIHA 1IBMJ 4HUQA 2B5VA 4ZVKA 1P1RA 4WNAA 4ZJYA 1H2BA 3O8NA 4J4BA 3SDEB 4D6TJ 2COUA 5CVVA 2BE9A 2B0GA 3K5WA 1RHRA 1NLUA 2JGJA 4I1IA 3X3HA 3VGVA 3U9SA 3LE8A 5L7TA 3RRNA 1EWTA 3HN2A 2WRZA 2EG1A 2XB4A 2OTKE 2PLFA 1ODTC 4BNLA 4DXHA 1KOHA 2MKHA 4RYLA 2FZGA 3VPCA 4UHEA 3GV7B 2VDIA 4MRRA 4HDOB 1QGAA 1E5QA 3QVUA 1RHUA 3FVQA 2AG8A 4NFHA 4BWVA 5EQDA 1ZXGA 1NYLA 4D97A 3NP7A 1Y5NA 1JR6A 1VCIA 2DNQA 4TU7A 1TU0A 4FW9A 2JOQA 1IQUA 1EWVA 4K9RA 1OCEA 1THTA 4LOKA 2YY5A 4NR0A 1BRMA 3PBKA 1VIXA 4YDSA 1XFDA 5TLSA 4DOMA 5TARA 1JLBA 2P9CA 1AV7A 1JDPA 2C2YA 4EOGA 1AUSL 5J1TB 4LR8A 3PO5A 2HX1A 3EEIA 4BNMA 3BBCA 1R0YA 5GINE 4DA7A 4HAOA 3ZDCA 4O0IA 3AEGC 2XUKA 1QYDA 5EXDA 2E87A 4DV7F 1DKNA 3L7MA 3F56A 1S7GA 3Q7QA 4KPUA 2M3EA 4RF3A 3R9XA 2H7CA 3S7RA 3USCS 3HZRA 3ZS8A 1U90A 4BMNA 1KBQA 4YFYA 4BFLA 1JB0J 4Y28C 2XPCA 4I50A 1XCBA 4I9NA 4R01A 2XGSA 1IOLA 2JFZA 5JADA 3A3NA 3HWX1 5IKOA 1JKJB 4ZTZB 3GTYX 1ZKMA 4INJA 1QZ3A 1RPZA 1KVUA 3DNMA 1M5SA 2XEDA 4DLTA 2ZTVA 3H1KD 3DKKA 3R5SA 2FPUA 5IRCD 3FNQA 1HDGO 3KWJA 3ITHB 4PRLA 1QZTA 2HA4A 4BZZA 5C8YF 4NL5A 5AP9A 2JFGA 1L5UA 4I46A 3D5QA 3QT7A 1SCKA 2FEAA 1MDFA 3RUCA 2HAEA 3GCGA 1HUCA 2WTNA 3K6RA 3QMWA 3IIIA 1IMOA 4X7RA 4TY8A 2WSMA 2YQ0A 4A8HA 4ZOBA 3BRVB 2JHCA 4L27A 4F2HA 5FAKA 4C97A 4FINA 4I5EA 3LP1B 2PA8D 4A0SA 3WTCA 4RPFA 1I32A 5K0CA 4Y1RA 3CTPA 4OH7A 3OZDA 5JNVA 3M2VA 2IZOA 3H2ZA 5CTJA 2PL5A 2OPRB 2P6NA 1GAXA 4EJSC 4OK3A 1IWOA 1P4AA 1T6YA 2I71A 3L0YA 2V9CA 1IPHA 5IHXA 3PUWA 1QAJA 3WLPA 3ND7A 3OVMA 4UU1A 2B8PA 4DSEA 2WYWA 3Q7TA 3Q22A 4ROSA 3UD4P 2HODA 4DS5A 2Y99A 2PUJA 5P21A 5I3CA 1E1QD 1DIPA 1N6IA 1SIWA 4LF4J 1X0FA 4J75A 4AKHA 4DV7B 3NANA 4WXYB 3ZW7A 1N32J 3KO8A 4YV2A 2BJ1A 4F91B 2HRZA 2YQ3A 5BQOA 1N1GA 1X22A 5IM0A 2ZSUA 2W27A 1IY2A 4F6LA 4ZI2A 5DDQC 2GLUA 3EVEA 4MMOA 2IU4A 2DGQA 1USKA 4JYAJ 2DPGA 4AY4A 3NGMA 5DRYA 2DJIA 1XMXA 1G66A 1FZGA 3Q8QB 3IS9B 4R8UB 4LBIA 3T52A 3NALA 1JR4A 1NVDA 5ALVA 1DAMA 2GN0A 5AO9A 3V1NA 3EGNA 3E7WA 2KLUA 1QJCA 3KJIA 2WAAA 1YBFA 4GVLA 3NWEA 1A72A 2X1MA 3IR7A 4MITA 4RVNA 1C3JA 3EXEB 4LYGA 3PD0A 3EW9A 1NF9A 4RV5A 1WSWA 4B6OA 3V7UA 4YMVA 2JA1A 5JLAA 5IVIA 4E6PA 2KQUA 3TUIC 3DWFA 3MJSA 4WJKB 3BQ1A 4UUOA 3BN7A 1DTSA 2DIVA 2DBYA 1HPLA 2XCQA 2HK2A 1ISFA 2FXVA 1WRGA 4LFBJ 3S6JA 1MVNA 3AF0A 3ETHA 5IEJA 4Q05A 3W2HA 1TLFA 4IDCA 3FWZA 1V9LA 1GUBA 4DR3F 2HF9A 4MRMB 3Q87B 3URKA 3PGXA 5KQLA 4B3HA 2O2CA 2WW8A 2XMAA 4MJ7A 1OXBB 4OAQA 1K5GA 4Q3CA 1ZNQO 1AUOA 3CLSC 3AJEA 1VLMA 1H0KA 3EVFA 2RDMA 5EMLA 1NSAA 4N47A 3FMIA 3IT2A 5BV0A 5LR6A 1IVSA 1FJ2A 1S5LH 3AZQA 4BQFA 1B26A 5F8JA 1V7CA 1CUYA 1OX4A 4GKKF 1NTOA 4WK1A 4R2MA 2PMZD 2XZDB 4IOKA 1AB8A 4NCNA 2AK3A 2HPVA 1CE8B 1UDCA 2QY9A 4TN5A 3UWOA 3PQEA 1X31C 1OXKB 3A0BE 3Q8VA 2M88A 3I31A 3ZVRA 5A7HA 1SQVD 2GBFA 2OTCA 4IXWA 3BPSP 3HSGA 1NCLA 4KTVE 2KHCA 1Q84A 1PR2A 1ZU4A 2MLZA 2QZJA 4LWQA 1HHSA 2XB8A 4DQLA 4YRZA 4HDNA 2DTJA 4OUDB 2I6QA 1GU5A 1ZJ5A 1MKMA 1DAHA 1XNQF 2AEFA 3Q7SA 4URQU 4XARA 1WHWA 3EB9A 4HLCA 121PA 4UKDA 3WGOA 2Q1YA 2V7GA 4MS4B 4KB7A 1NVTA 4DQQA 1ODFA 1O6CA 3WBKA 2Z04A 1TM1E 2C0WA 5EIOA 1RAEA 1Q7RA 2QD4A 3E5MA 3WGYA 1PDOA 1JO5A 4AWXA 2PQ6A 4DR6F 1WHYA 1V11B 5KNCA 1VQ8P 5TT0A 1JILA 3GRRA 5CYMB 2FP4B 1SCUA 1YMVA 5EJFA 3CRZA 1IIBA 1L3VA 2N3ZA 3MM9A 1RQ7A 1IKWA 1C3LA 3PV8A 4N65A 4IKPA 4V0RA 2L41A 5I47A 2O66A 4A8TA 2OEKA 4PX5A 1WSRA 5IASA 4FOLA 1AKNA 1ZN2A 4K6HA 5J1SB 3WGJA 2HXSA 4DR3B 1LSJA 5TJHA 3OPMA 4OHMA 4A10A 1EEXB 5D6OA 3H1LJ 5FR1A 3A8IA 4LZZA 1U1EA 2XQCA 4A1OA 1F1BA 4TSFD 4V02A 3PQ6A 4Y2CA 1YCFA 5HI7A 4ABTA 2GAHC 2WZ1A 2XULA 2CXNA 4MVYA 4MS3B 1A5TA 1GFSA 1TFYA 3LUYA 3DHVA 1R4MB 3AIKA 4EWLA 2K2PA 4E30A 1X9MA 2FOLA 5KKCA 3T5GA 1YL6A 3RR2A 2EXUA 4BCBA 4O02B 3HXTA 3IBGA 5CLFA 3A6FA 3NHZA 1XQXA 1TX4B 2C28A 4USIA 5FEUA 4CN9A 1AZSC 4LVNP 2VYFA 1DX4A 1I51A 2IVYA 1XRQA 4ZCRA 1R8CA 1QZUA 2OKGA 1QGKB 2PD3A 4DC1A 2R6ZA 2Y71A 3E01B 5B57C 4M0UA 2XB2D 3ESCA 4C0LA 2C99A 1YASA 4ZITA 5JVGQ 1NU1K 1MZ9A 1W85B 3C3XA 4OQXA 2PFSA 3O1HB 2FPSA 4L4ZA 4X54A 1LQ2A 2D5IA 2PKWA 1XNQB 2F1RA 5C5JA 1TMOA 2H1YA 4G6VB 3D43A 2MSCB 1UPTA 3FZGA 4F8JA 5HUJA 1NH8A 1IBKF 2O54A 3P0RA 4Q1AA 3AEUB 3C3CA 4ICLB 1R5OA 1ELOA 4MVCA 2CDRA 1V9SA 3IEIA 2J6CA 5DSTA 3NBZC 4BMCA 2ATCA 2YVLA 4AL5A 2RH4A 4XI9A 5H1SV 1Y3BE 4JT2A 1T2FA 2AT1A 4CTMA 3S1AB 1IQ0A 4NEHB 5C8XA 1AF4A 1CQXA 5AK5A 1SMKA 4DR6B 1GZVA 1H2EA 1VKRA 1SCDA 3CJ8A 5CITA 1E64A 2Q66A 4I9GA 3T5AA 1Q19A 2EW9A 2XXAB 1BGYG 4V0KA 5C52B 2RGAA 1HEYA 4FFNA 1A04A 4RKWA 1E58A 2BZGA 2P58A 1YWGO 4OL9A 4GPTA 5C51B 4YRJA 3QEJA 3LS2A 4Y34A 3OA0A 1TP7A 1A8QA 1EGQA 2XBUA 2V03A 4GRDA 1QB8A 3N3BC 5ED4A 1YAHA 5HQ3A 2W83A 1SOWA 2XD4A 5JWOA 2QRKA 2QX8A 2N3OA 4WFNQ 4CM0A 4J5OA 2W2MA 4MAFA 3LGAA 1W75A 3L75D 4YRDA 4OYHA 3VSBA 5DNVA 5FLXA 2JHPA 1MG0A 3O3OB 3ZIAD 4F86A 2LQ5A 4UDYX 2CZ9A 2PYDA 2I03A 3N7NA 2UV8G 5M34A 4BKRA 3BATA 4MZDA 5CBOA 4ID8A 1BQEA 3DE6X 1SGWA 5F5NA 5KFIA 2WPQA 5L3RA 4RJ2A 3OJXA 1WCIA 3FLAA 3C85A 1EDLA 2Y6UA 1JT2A 4BQSA 3A28A 3IR9A 1GU1A 1E0JA 3IWNC 4P58A 2E5HA 1MX5A 2EZ4A 4EFKA 4A6EA 2XNKA 4HADA 1FYVA 1ESCA 3S8YA 4I64A 3LUKA 5JISA 4NYJQ 5E1DA 2IYXA 4QPZA 4D0SA 2QZSA 5JVHQ 3JATA 4C5BA 3BBLA 2PR2A 2VD3A 1FQKA 5JEEA 4EQ6B 5F1KA 3H5IA 3G4SP 4TS3A 4ZO9A 1QOZA 1UFOA 3E5HA 4DE5A 1N5SA 4HNUA 4OQNA 2CJYB 4M1QA 4O1IA 1KTQA 5K8UA 3LP0B 4TSRA 1PBAA 2VP9A 4AMZA 1D1UA 2B51A 5FWXA 1XU7A 1S3GA 3C7TA 3ICLA 3SJBA 1NPYA 3WG9A 1AZWA 2QQEA 1QTMA 3ZQUA 2PZ8A 4OEHA 1F51E 4ZVUA 3VI4B 4F3QA 4RX6A 3GONA 1GRVA 4EUNA 1TF7A 3JVIA 1L5MA 3DYAB 4IQ8A 4NCAA 1E6VA 3DZCA 2EZTA 1TE2A 2IE0A 2VYCA 1K27A 1CRPA 4FFBA 1ORWA 2GJ8A 4DJ5X 1W73A 2AYYA 3TGUD 3WL8A 4LNUA 1JKMA 2HWUA 1PNRA 1Y5LA 5E3RA 1NDQA 2IZ7A 3D3EA 1U2PA 4R3WA 3V00A 3GPBA 4FFPA 1FYXA 3U3KA 2V1UA 2G5CA 4OLFA 1GK6A 2VWQA 3FYTA 4KWIA 5TMBA 5FBLB 1NC1A 1RYFA 1ECGA 4BFSA 1EKSA 4AJOA 1XPJA 1RDRA 3HBFA 2B6AB 4J3JA 2G1HA 3WLHA 3SE7A 2QL9B 1MMDA 3KRTA 4YN3A 2J5KA 3EWIA 2PX5A 4BPRA 2H65A 2D1FA 3MWKA 2ESRA 1LOUA 4NFSA 3TJMA 1RAIB 1KZYC 4Z9XA 3TQTA 2CQCA 2O2DA 2ACKA 5FUWA 3T99A 2AQHA 3E3OA 4YR3A 2G08A 1RMQA 4EHKA 3RJZA 3SF0A 1DVRA 4RR5A 4RD0A 3ZDBA 5E6SA 1KKMA 3CMCO 3Q83A 1XFAA 3UYKA 4F4DA 1NJ5A 3IOYA 4GP6A 4RJVA 1G1AA 4IOAQ 2Q99A 3SF8B 3WQBA 2CPXA 3WGVA 4X3CA 3V4RA 3GJSB 2ZPTX 3AVOA 3B48A 4HH1A 4L7VA 2XNDA 4DUZJ 5BRAA 3VU1A 3PWSA 1N2SA 3Q3HA 5ESXA 1BDBA 3JZFA 2NPSD 4YDDB 2JBWA 4D4MA 4MSUA 1T9ZA 3SVZA 4LE2A 1VL1A 2NCKL 3C3AA 1O6FA 4OQQA 1K6JA 4ZEVA 3GRCA 1EDKA 3H1JE 2YJGA 3EN0A 4NLDA 3ZWXA 2CNLB 2WU1A 3NXZA 3O91A 3WUUA 3E9EA 2HQOA 2NO6A 1XD8A 1VPDA 3N2GB 2GHWA 1VXOA 4FQ8A 4JL5A 1TKZA 2IYNA 1U24A 2PSZA 3HZEA 2RAUA 2G7MC 1GL2A 1OY8A 4E88A 1XCJA 2EQ5A 1EQ2A 3TR6A 4G4JA 1XOIA 5B4UA 4CT5A 2QVAA 1EUYA 1ZAVA 5IJWA 1RT5A 5FR2A 1WJGA 4JI8J 2BZSA 3H7IA 2M1ZA 2XE6A 1DTWA 4KAIA 4P31A 1U28C 4X41A 3R7SA 3SX2A 4XK8C 3KQWA 1NATA 2GBIA 5JUMA 1CIPA 4QQFA 3DRSA 4HI0E 2ZROA 1V1JA 1PZFA 3ZBUA 1EIZA 5FPPA 3PJ9A 4BZXA 1NV8A 4FFVA 2FWIA 4JJ4A 2LKDA 1FDRA 4XLTA 3N28A 3OLCX 3VYSB 2P5YA 1UP4A 2CYYA 4QULA 5IC6A 4U00A 4U3JA 3TKAA 1I30A 1HTLC 4QEKA 2HD4A 2DH7A 1DTQA 3U4HA 2MJUA 1WTBA 1WAMA 1JTEA 4B9SA 3CZCA 1D9FA 1YKFA 2ZTLA 2QFJA 1IBLF 5DP1A 3R6LA 3S81A 3TQQA 2FWPA 1FDVA 4X44A 1UF9A 1B8UA 3D0IE 2WJ3A 2RD5C 3H3JA 1AO0A 4PYIA 1L3SA 2F1KA 1NO4A 1QO7A 4QRHA 3W63A 3LOQA 4L1KA 4ILLA 2R3VA 5B66E 1FAVA 2DNNA 1URQA 4GKVA 1P0CA 3QPVA 2ONKA 3VKVA 1BG6A 1K05A 4UTGA 5IWCA 3EZ2A 4QU6A 2J9FB 3DRXA 2J3IA 4PQUA 3ZW8A 1XZDA 4NA1A 1AS0A 1GGVA 2PUFA 1EK6A 3NQ41 4O4JF 3U4DA 2YKPA 1RB0A 3ONDA 4FYYB 4ES6A 3LUDA 1Q77A 1RABB 2RGNA 3QWBA 3P8CD 2J45A 2OCLA 4B32A 4ED4A 3O7WA 2PL1A 2YXEA 4QASA 2WD7B 2VICA 3L4BC 1BCRB 1G20E 1PLJA 1M5OC 1V48A 4ZT4A 5JQGF 4ZT3A 4DJBA 4G0NA 1IN5A 3BQ9A 3OOHA 2JFOA 3JVDA 1GNSA 5F7OA 4UBJA 1LDMA 2GD0A 3UK6A 1Y4ZB 1KN7A 5A9SA 4B84A 1UEUA 1ZGGA 4F8EA 4N8EA 2B4QA 2XS7A 1BXRB 2H07A 3B6MA 3R5HA 3W5HA 3BTSA 3KHTA 5KC9A 2XWJI 5FUMA 2LWIA 3EISA 3MWBA 5DN6A 5AJWA 4Y18A 2BTOA 2HRTA 4BNDB 4IIVA 4Y3UA 4AECA 1E8NA 4PLZA 1RE3A 5LNK1 1MO6A 1W48A 1SI9A 1N92A 1RE1A 1FDNA 5FAXA 3DTVD 3ORQA 1FS4A 5G3YA 3HXMA 2XUHA 3BA6A 3K57A 1IK7A 2MZJA 5HXAA 1IBLB 3RVKA 4HEJA 3HXLA 4ER7A 4L73A 2VYVD 4NMXB 1Y7IA 1ZX1A 3PB3A 3E7XA 3W5DA 3WGQA 4Y1FA 4RZ3A 3DB1A 3ZE1B 1RT1A 3PXBA 4I4TA 2P2SA 3QUQA 4LJ9A 2RUSA 3EXIA 3MEDA 1OQAA 5LQNA 5DBFA 1KILE 3HKBB 3JSYA 4ND2A 1MXHA 1SJ3P 3WNVA 1UPBA 3HSJA 1KRXA 3CZPA 3V2NA 1NK8A 1XTZA 4KPGA 2RKBA 5DU2A 1CUCA 2JEJA 1Z56A 3TD2A 4BBPA 2FFBA 3Q8KA 4YI5A 4E1VA 1EJBA 1H38A 1L6IA 1N5RA 1AMOA 2QIPA 4ZOQI 5BSGA 3BCHA 5BQFA 3NGXA 3VX3A 2EVZA 4OI1A 3Q5GA 2ZIAA 4ZK7M 5ALPA 3VVTA 4OJMX 3KLFA 2FJAB 3AR3A 5JMWA 3K5BA 2H92A 1L0NJ 4XPCA 1M1YE 1QVWA 1Q2UA 2MZTA 3A9RA 5AI9A 1SVSA 4X94A 4F50A 3L7YA 3TQSA 2JP3A 1M7GA 2GXSA 2G0TA 2QV7A 4OX9F 3W6NA 3I0MA 3SYMA 2Q46A 2Y66A 3IBFB 4ND3A 2QJKB 1FFHA 4JEMA 1BYIA 2IFNA 2Y1EA 1MP0A 2J58A 2JAPA 2NO9A 3OM0A 4MGKR 3ANSA 2WIAA 4QXRA 2FMUA 3HO6A 3GOQA 1DNPA 1RC0A 1VC2A 1SC1A 2POKA 3W6OA 1MDBA 4OBEA 1ZV8A 4Z37A 3K0BA 1HT0A 1LLCA 2D5LA 4PSVA 3KSMA 4N5NA 1J23A 4JOSA 1YC5A 4YBRA 3TA0A 2Z8YM 2YH2A 1YR1A 2QTNA 3HVUA 1FJPA 4IEEA 2WWFA 3M8QB 4G5YA 1U57A 4LF7F 1KMIZ 1UFRA 3W77A 4HQOA 1XAIA 4WZBA 5D2CA 4C6TB 1MWZA 3OQ1A 2B1QA 3IUSA 1NUSA 2J5RA 1H2FA 1O94C 3ENNA 3IKTA 3W9SA 1MOPA 5EVCA 1LV7A 2CJPA 3A9CA 1KEUA 8RUCA 3AEQA 3W5AA 1G19A 2BTQB 3HSYA 1ECBA 1W88A 5AK6A 2H3EB 4EPWA 4ZPAA 2O20A 1NX9A 3PYDA 6ADHA 2YZ2A 3BMNB 1R6YA 5A0FA 4A8JC 1E6YB 4USUA 1S4QA 4IH9A 4CM3A 2EKNA 1L4KA 3AJ1A 2IBZE 4CYUA 4JI0J 3OBBA 2QMYA 4DWWA 1OF1A 4JLUA 3K05A 1RLIA 3WZLA 2ZUGA 2IGBA 1KA9H 4S1WA 3FPAA 1G17A 1E0SA 2O8CA 5J1NA 1NB2A 4A8OA 1KMIY 4NK5A 4UMDA 5D8HB 4MP8A 5LZ9A 4PQAA 2O0JA 1T6ZA 1GIAA 2G5GX 5H4GA 2FW8A 1C7ZA 2YWXA 3PR2B 4IF6A 4JELA 1JKHA 3GJQA 1QYCA 4F12A 3WVNA 3KUDA 3OFJA 4H27A 5ISMA 1ODSA 4LDQA 5MFZA 2V1XA 1P33A 4OX9B 1ILEA 5CA0B 1Z88A 1Y9AA 2B8JA 4G85A 3HXKA 1BVRA 4Z1MH 3ZR4B 5KQMA 1P31A 2QLFA 2YWCA 4H18A 4R7TA 2BCCG 2IYYA 1B8VA 1COWD 3VOPA 1FPMA 1Y8RA 3J7A1 1FLVA 1N78A 3ZVNA 1FUIA 4H1VA 3BJYA 3M6XA 5JDIA 1S9KE 3DR3A 4BUJA 1G6KA 3TFOA 1E69A 1EGAA 3GGDA 4W1SA 5JCOA 1X19A 3A6EA 3LVRE 2DRBA 1WSDA 2FJEB 4C6AA 1RAAB 3ZQKA 1HNWF 2FG7C 5FO0A 2MZSA 4CM9D 2QRPA 2X4LA 2E2WA 1ISRA 2OYHA 3H1HD 1LK7A 3HB4X 3HZHA 1SQVK 2Z95A 4OQDA 4LF7B 4JBLA 1FNSA 4FIZA 3QNMA 3OHPA 1SPXA 3UK0A 4X65F 3A14A 1T1JA 3PUHA 1C9NA 1ABFA 4JJEA 2IXFA 5BWBA 1FKOA 3MCUA 2ZH9A 3DW3X 2F40A 3H2KA 1EB0A 3BK1A 2R47A 2P9EA 3NHWA 2XNCA 2RAQA 2I55A 3OJCA 4NLSA 4ZU3A 1JX4A 1M1NB 2QL6A 2RE8A 1TUWA 3SBDA 3MMPA 4A6PA 2UZ0A 1G8KA 2PZEA 2EHDA 3QH4A 5CNKA 2RS8A 1BH2A 2ORVA 4PCAA 3TOVA 1P27B 3W2VB 4IFYB 4NATA 2KYZA 4M5DA 1WUHS 3DFFA 3ZWWA 3RW7A 5K5EA 4WFZA 4XYLA 3QG5A 1I1OA 1EB8A 3CDBA 4NECA 4JGIA 4A0QA 3MAAC 5JHGB 3WTBA 4RVHA 3CJ0A 1KB9I 2HJ9A 3FAKA 1W87A 5BNWA 2JJ2A 2R8YA 1M3SA 1AJEA 3FD8A 3ZJ4A 1J97A 1FFYA 4GI7A 1ADGA 2XOKA 1FTRA 4XIUA 4F46A 4RAQA 1QX8A 1TTTA 3RBAA 4AL6A 3D1OA 3Q0IA 1LJ8A 4L15A 4NX2A 4M7WA 2C5EA 3IRXA 5ITHA 3G6KA 1RF0C 1YI0A 3W1VA 4JV1A 3OR1B 2MSNA 4CWBA 1JVSA 1VPTA 2QRVB 5DSXA 2QR3A 3HE3A 2P6UA 3V7FA 1K4YA 2JL1A 2FB0A 1R9MA 1HQYE 1NMQA 1XEXB 2H85A 4ARZA 3DOKB 3CUTA 5ITVA 1I4LD 1LRKA 1ZCBA 3CDAA 4HD8A 2JGDB 3T97B 1ORRA 3K15A 5HQTA 4Q9NA 3VR6D 1HNWB 1LLQA 4UQGA 1XDUA 3MT9A 4QSMA 5KLVG 1V8DA 1VISA 1K6IA 4X4SA 1KYTA 3BS4A 2OMLA 1A9XB 4RPLA 2QUHA 4MDFA 3LXUX 1UJMA 2Q3JA 2YJ4A 4C8NA 1RZUA 3N0TA 5I4KA 1CUAA 3QI7A 4G0ZA 3TIIA 2OKCA 5LQKA 4JVNA 1E2UA 5F64A 4DADA 2W58A 4RAOA 1Z7GA 4MVJI 4PZAA 1LPSA 1GUZA 1Y47A 2CC2A 3ZLBA 2R7WA 4DL4A 3RAPR 1EXDA 1NLYA 1NN0A 4KO4S 4HLUA 5LSRA 3DQPA 1N5DA 3MJDA 4Q3OA 3T35A 4K6KA 2WAMA 5HWSA 4DQXA 3VPSA 4CZ2A 3QEBZ 2F67A 5H1YA 4DJEC 5J40A 1WNFA 1U0LA 4JEUA 2VYQA 4HL9A 2XTJP 1XAHA 1GSIA 4O5OA 4KYVA 4GOJA 1RI3A 4ATNA 4C4YA 1RT7B 3DRRB 4J2HA 4ZP8A 2XGJA 1DAFA 3ASZA 2ZD1B 2P3LA 5I7EA 1Q0QA 4Y65A 4EY4A 4HB3A 1YJ8A 2ACWA 1MX9A 5FA8A 4HWGA 3T1TA 1FCJA 3G5AA 5IUJC 1PFUA 1UODA 1J33A 5KAFH 1HMYA 4G56A 1KOFA 4ME6A 3DI6A 2HHHF 1DX7A 4PYRA 3SK0A 4TXLA 2VRBA 2IY7A 3LAKA 1A50B 5KNDA 2PLNA 2ZB2A 3QYYA 4BGDA 2CJFA 4LXGA 2XI3A 1HYGA 5B36A 3HY4A 2JLZA 2Z83A 1TK3A 2J7KA 5DNWA 3DM9B 2C4MA 5T41A 2VYNA 3UJHA 1PCXA 4TKMA 3EFFK 3NWGA 3JY6A 3SSUA 4JFRA 1YD7A 4JZYA 4UC0A 3ZZNA 4H0CA 4A91A 1TCAA 2ASYA 2SECE 1WNEA 2ZXEA 1KONA 2OUGA 3C48A 3GUCA 4DV3J 1CS4B 4Z4CA 2F00A 1YB2A 4ODIA 2HVIA 3A9SA 3AIMA 1XK8A 4D79A 4TM7A 2PA0A 3QLHB 3ILXA 1SCBA 4P33A 3N6NA 5J1EA 3P4UA 1P29A 1T03A 1XMQF 1D0VA 2V59A 2HQDA 4N7MA 1A1VA 2OCKA 2WPDA 1OLSA 2RMZA 3TAMB 1KMMA 5DNYB 1IZZA 1NJIQ 3SI7A 4DJAA 1UBNA 3W90A 4RS3A 5G1NA 5KKZB 4YLEA 4GRAA 1XZMA 4H59A 4EG0A 4OX7A 3C6QA 4BMOB 3TANA 1ABEA 2CUTA 3D8RA 4WXEA 1WG1A 4GUDA 4PZYA 3WYDA 1KAQA 5SV2A 1CR1A 4Y9DA 3B5IA 1NMYA 4G09A 4R7ZA 3QNWA 4Z4FA 3ZCUA 1KI7A 1UBSB 1S6UA 3ISNC 1WI8A 1G1MA 3CCQS 1P3DA 1PL5A 4WU2A 4X5OA 2JWDA 1PX0A 5GAHI 2EKZA 2RI0A 1KU0A 3KDSE 3RYHB 4HNRA 5FBQB 1ZHHA 3SSRA 1T11A 1FVHA 4QYXA 1TTHB 1N54B 5D6GA 2G63A 4FN5A 3C6TB 1ZM9A 1BQ4A 5EKDA 3AWIA 4A7PA 3M8RA 1IU9A 2HHHB 1GSHA 3CRW1 2UWJE 5AVRA 3NS7A 3KEFA 4HP8A 5IM4F 2PUCA 1F2UA 4QFMA 3OPYA 1FJGJ 2NU9A 3LHSA 1OFCX 4MIWA 1WKLA 3UDEA 2D5AA 2G1JA 4D6TE 3HGQA 2BW0A 5LMNF 1L5LA 1N86A 4OIFA 4NG5A 2F64A 3MK31 4JLOA 1QVFR 4QG3A 2HDWA 3FWPA 2CPJA 1C9YA 1HTWA 4O3NA 1HDEA 1O95D 1CJVB 1S1CX 1EETB 1P9LA 3LT0A 4Q12A 1JNXX 1ODJA 2ALJA 1B15A 5IK2D 1QFJA 3PFCA 2W8BB 3X1WA 1RF1A 1MZPA 3N2KA 1RW4A 4PAAA 3WLMA 1QO0A 1JB9A 1T0HB 5AK0A 2FFDA 4PD4D 4GVXA 3DKPA 1NSQA 2ADOA 4E5UA 1X0VA 1OWMA 2JLVA 3TD9A 2ZIFA 4TMFA 3QRRA 2HBQA 1TD1A 1KYIA 5TEVA 3FMWA 1ZICA 2QL5A 2N4DA 4DCNA 3ZHSA 1KK0A 5DDIP 2ZE6A 1OVRA 3EZNA 4JQZA 2LQBA 1G9SA 1KYWA 4MUFA 1EFRA 4DV6B 4J29A 1IR2A 4WN3A 3A2NA 1VDHA 2VKQA 3ES9A 3U7HB 1P5HA 1A77A 4JJAA 4A8YA 5DDPC 3HKEB 2ZRFA 2YKMB 3KLEB 1FLDA 1HMVB 1NNEA 2J6BA 5KHAA 4F3NA 2GRUA 2J9CA 5LJLA 4ES3A 2BN4A 1EVYA 1G20B 4JC5A 2Y9YA 3E7FA 3IEKA 2MGZB 2VPPA 1BYUA 4NBRA 5C1IA 3U27A 1BN6A 4UUQA 4MPRA 3IT3A 4PV1B 4LRSB 2FJXA 1CJUC 3L1IA 2NO5A 3ND5A 4E5MA 4OYWA 1DMSA 3PYFA 1ISJA 4GVBB 5JC1A 1Y80A 3ST7A 3ONNA 8ATCA 3GA7A 3DXYA 1VJGA 2YV1A 1BD3A 4M1KA 2GEVA 2BEZF 5JS8A 3JCUE 4X1YB 1P7WA 5IXUA 4JASB 3RVDA 4JYZA 4XASA 5LMNB 1TEVA 2P4UA 1US8B 4GP9A 3L4FA 3DC7A 1C1BB 1LT9C 1CUZA 1N33F 3DMJA 3RF6A 1VPVA 1TJYA 4G25A 4ZKPA 5KFPA 4IOCQ 1Z4PX 2WTXA 1UP1A 1IK4A 2RHJA 3HUEA 4ZOAA 3GWGA 4F93B 2C3OA 2QL7B 4Y2SA 3KYQA 2FPPB 2NVWA 4OAPA 1NZDA 3QFHA 1R8BA 3KYJB 4PQEA 1U6BA 3V80A 2ZZTA 1I4WA 1N7SB 1KILB 4C6SA 4M98A 2J87A 3ADCA 3KB1A 3MLEA 2M6RA 2V58A 3QA9A 1ZIXA 1XBWA 1L5ZA 4HYTB 5B1HA 2W9BB 3BQNB 1BXNA 4HKTA 1C1XA 2X7IA 2Z56B 4S1VA 1HPZA 1UETA 3OM1A 3ULKA 1RAHB 4IG0B 1GPKA 4F4ZA 3KTAA 2HHAA 1M7BA 4ELUA 1WP4A 3A1TA 2AEMA 3E05A 4RWWA 5J5CA 1P91A 1IH8A 2X58A 4QYSA 4BVLA 4PR6A 3QWOC 5TF4A 3I6IA 2JJ4D 3PC3A 2FPOA 3VMXA 3S2ZA 5EL0A 3O8WA 3ROZA 2IELA 1J6UA 1OXMA 4KI0A 4JLMA 2V6IA 3DV9A 2AW3A 2WUGA 2QT1A 1HBMB 4ALMA 4OV6A 5KOJB 1L8LA 2A1UA 2D7DA 3H5RA 1MN7A 4F72A 4IFVA 1XDZA 5A06A 1JXQA 2TMYA 1AHIA 5KFRA 3CUSA 4QIWD 4N3AA 2J9GA 2LA4A 2DNHA 1S1CA 1S7CA 5C39A 3VR5D 5HKOA 4M9SA 1K89A 4Y99C 2J4DA 4DCTA 3WLTA 2N7YA 3PNIA 3MINB 1GWNA 4XDZA 1SFCA 1SQPJ 4HJGH 2B89A 3P1JA 4EB3A 2OGSA 1P2VA 2W6MA 3PHCA 1WUUA 2K1AA 4EG1A 1SD2A 3KLBA 2ZQ5A 2GN8A 4DT1A 5JY6A 3KPUA 4Q02A 5CJPA 4YXWH 4NJOA 4AVYA 1QYIA 4Z3DA 5B0GA 1E9EA 2QNBA 4PKDB 4UB8H 3PJRA 4OZJA 4UBIA 1NJWA 2KKHA 3VJKA 1PD0A 1X92A 2O3JA 1F9EA 3P8ZA 2SBTA 5IVHA 4OJ1A 3NIBA 2HU5A 1H74A 1FEZA 3HN6A 3H8SA 4NQRA 4ENSA 1LI4A 4RHFA 4RF2A 3KHHA 5DHPA 4M54A 5APQA 1NDLA 4NYPA 1T4CA 4IRCA 3DMFA 4NOJA 4YT5A 3H42B 3LIIA 3AE3C 2P2CA 1QDLB 4HGRA 4MYRA 1QE3A 3AJ8A 3QEKA 3ZHQA 1N8RQ 3KSZO 3VR2D 3AESB 2JBHA 2P91A 2RQ4A 1WT6A 1L7XA 5ALHA 2JVIA 2RGXA 2BM1A 1CUIA 3FDXA 4BMPB 2XXJA 1NPTO 1UAGA 5GAGU 3VKFA 3CX5E 2X8AA 1E60A 2LCQA 3MFYA 3AI7A 4D4GA 2XU6A 1VA5A 1N52B 5IJ0A 3P2JA 1UEIA 1J07A 4CDNA 4UUBA 3K0AB 1WSVA 4YVFA 4PBRA 1I1GA 2JFHA 1I5OB 3KZCA 1WKVA 2QMUB 1MOQA 3DJYA 2QWXA 5I3UB 2JJMA 3CR7A 3AEKA 4GXNA 3RADC 2X9VA 1K97A 4OHKA 3UUGA 3MCNA 5E2IA 5K0EA 4PN3A 2AKEA 1AK9A 1JBEA 1RBZA 5F9HA 3QGMA 3TQEA 3D0QA 4V1CI 3D3WA 5KWJA 4CG1A 1SC4A 3UR0A 2Q4DA 1OX5A 4BX9A 2OT3B 4CGYA 4NYIR 3SNHA 1CZUA 3L8GA 1XEWX 4YHHJ 3CJ3A 1OAKA 1QIJA 4KDFA 4PPYA 1V6CA 3N59A 1D2NA 1Q81Q 1AKQA 4M8NE 3T34A 4UTVA 4L6CA 4MV9A 4OXRA 2MEWA 3RK2C 3C45A 2VJAA 2KSQA 2BM8A 1PFIA 3EVWA 4DHWA 1Y3IA 3C6UB 2Q5QA 3AB7A 5EJAA 5FP0A 2HFED 3MLAA 2VTKA 3BL8A 4FS3A 1RE4C 4BEBA 3TRFA 2WPNA 4ZEOA 3N2EA 3GDFA 3R97A 5HO4A 3Q9SA 3SR3A 4F04A 5GJCA 5A8RA 1H85A 2CDCA 1KQGB 4NEZA 2P5TB 2ETXA