2AEFA

Crystal structures of the mthk rck domain in ca2+ bound form
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
224
structure length
221
Chain Sequence
RHVVICGWSESTLECLRELRGSEVFVLAEDENVRKKVLRSGANFVHGDPTRVSDLEKANVRGARAVIVDLESDSETIHCILGIRKIDESVRIIAEAERYENIEQLRMAGADQVISPFVISGRLMSRSIDDGYEAMFVQDVLATRRMVEVPIPEGSKLEGVSVLDADIHDVTGVIIIGVGRGDELIIDPPRDYSFRAGDIILGIGKPEEIERLKNYISALVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport, membrane protein
molecule keywords Calcium-gated potassium channel mthK
publication title Structures of the MthK RCK Domain and the Effect of Ca2+ on Gating Ring Stability
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 73
structure length 221
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02080 TrkA_C TrkA-C domain
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.870 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Voltage-gated potassium channel 2aefA02
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2aefA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2aefA01
3WG9A 5J23A 2VUSA 5F3RA 3NKLA 1BTOA 4E0BA 2Y93A 2J3IA 3TF5A 4AJIA 2X0RA 4BOYA 1LNQA 3RROA 4YDRA 3JD4A 3EY4A 5FEUA 1F8FA 4HKTA 2CDAA 4FFOA 4Q3NA 4XJSA 4DLBA 2CZCA 1PS0A 2Y0CA 3D3WB 2B69A 4WNIA 1G0OA 3NV9A 3IC5A 5G0WA 4O1MA 1CDOA 4BS9A 2I6TA 4Q3BA 1E7YA 2BRUA 3BHIA 3ITDA 1ZO8A 4NJOA 5HBRA 2TMGA 4ILKA 4PIVA 1C3VA 2NQ8A 4XCVA 2Y0DA 4JBHA 2WMDA 3IDSA 3TNLA 4CR7A 2IEBA 2JD0A 3R6DA 2D0IA 1HSOA 3BMNA 3OJ0A 1BRMA 3JD2A 4KDEA 3I1JA 3VVCA 5IF3A 2HUNA 3P7MA 4NFYA 4MDHA 2A9FA 1ZVMA 3ICCA 4GX0A 3ZU4A 5BQFA 3C1TA 3I52A 3OFSA 3E5MA 4RCVA 4B3HA 1F0YA 3AUTA 4QTZA 3M2TA 4GX5A 1W0CA 2VT3A 4WLFA 5CHEA 3ZWVA 5L4NA 3I6IA 4J4BA 1LSJA 3HJAA 1BW9A 1FDVA 3DZIA 2ZATA 4WECA 4MOWA 4DYDA 3IAHA 4JP3A 4J43A 2AQIA 1EMDA 2IDZA 1JVBA 2HKIA 2W2KB 1CERA 3WOHA 4NHEA 4TROA 4Y9DA 5DP2A 4DQUA 1EVZA 4XD2A 4NDNE 3WGIA 3WGQA 1GZ6A 3GVIA 3W4IA 4J49A 1VKOA 1M76A 4N5NA 1C0PA 2EWMA 1ISJA 3HG7A 3V2UA 1ZJYA 2FR8A 1QV7A 3QWHA 5IXYA 4RF4A 1W4ZA 5JMWA 1SNYA 4YJHB 1N7GA 1BXGB 2WD7A 4ALKA 4BNLA 3F5SA 3ADOA 5KIAA 3GVXA 1ONOA 1JKFA 1MX3A 3O38A 3WGGA 1EDOA 4PLYA 1UR5A 4UUMA 3PWKA 1X1EA 3VZRA 2H63A 3PHGA 6LDHA 4QX6A 4ROSA 4ZQHA 3WGZA 2GASA 4IZIA 1Y9AA 3ZZNA 4LVUA 3MZ0A 5DCUA 4JXKA 3RJ5A 1JTVA 4IDEA 2AE2A 3K73O 1R15A 2GD1O 4M86A 1E7WA 3JQ8B 4ONEA 4XYEA 2Y0EA 2VHVA 2PZKA 3P2OA 2PFGA 5C7IO 1BXZA 1NFQA 1LBEA 3AOEA 3RQSA 1PGQA 1XLTA 3UCXA 4M1QA 2JAPA 1DC4A 2P9EA 5I7FA 4Z0TA 4BKUA 1N1GA 1M2WA 5EPOA 3AY7A 4ALNA 4AJOA 4CMBA 1ZK3A 3HSKA 2GDZA 3WIDA 4J9UE 1Y5RA 4FN4A 4BO0A 3FWZA 2E48A 2NU6A 1LDGA 1H2BA 2BFOA 2OO5A 4FBGA 1RPNA 3I4CA 4QFDA 3TZCA 1Y1PA 2OL4A 4Y6SA 4AJLA 1YDWA 3TWOA 4YXFA 4YRBA 3UAGA 4DREA 1YBVA 1JVSA 4ZRNA 1V3UA 4DUPA 4FC6A 1KEWA 1WDLA 4QECA 1K5HA 5KJEA 5L7TA 3HUDA 4LCJA 4IBOA 2NU7A 3FHLA 4IZHA 5JXWA 4D44A 4GVLA 2B36A 2WSBA 2RHRA 3F1KA 2UAGA 1PWZA 1QV6A 2Q4BA 5A9TA 4CM1A 3RUDA 4NG5A 1XSEA 1CJCA 1DIBA 3RU9A 3FPLA 2EV9A 1RM5A 1EDZA 3GGPA 4FIZA 4XQCA 3VH4A 4CQMD 1VSVA 2C20A 4IJKA 4R4JA 4RQTA 4PLPA 2AEJA 1QYWA 1UXKA 4H15A 2VWHA 2OBYA 3SC6A 2G76A 4LRSB 2Y99A 1K6IA 3NDRA 3NYWA 4P22A 3PEFA 1LJ8A 1X7HA 1SEVA 3O8QB 2WYUA 3FPCA 2NUAA 5G4KB 1F8GA 2YW9A 2OMEA 4YWJA 4K28A 1LDNA 4AJEA 3D3EA 1DPGA 3EDMA 1EE2A 4FOSA 4IMRA 2AE1A 3ZWBA 1I24A 3RKRA 1YBMA 3PDUA 2EXXA 3QV1A 1ZK0A 1NFRA 1V3TA 3WIEA 3QQPA 1ID1A 2QX7A 4RGBA 4E2ZA 1HDOA 2X58A 4NQZA 3OJEA 5CDUA 1VPDA 3FSRA 1R66A 3Q6IA 4RQUA 3VHRA 4D3DA 4L4XA 3KEQA 1YBAA 4MVJM 4GPD1 2UUPA 4IS3A 5CDYA 1DDOA 3WTBA 2POQX 2V6BA 2YJZA 1LDMA 1I0ZA 3LQFA 2XAAA 3GGGA 1F14A 3GQVA 4UUNA 2GZ1A 3DZJA 2HO5A 2J3KA 4CMCA 4WLUA 2VWGA 5IDWA 3L77A 3W1VA 4WNCA 3GDGA 4D0RA 2C5EA 2NM0A 4II3A 4FDAA 4GI2A 1T1RA 3KVOA 3AI2A 3L4SO 4CLXA 3B20A 2IZ1A 3T4EA 3BMNB 1O9BA 3CIFA 4FB5A 4EUFA 3BYZA 3FR8A 1GYRA 3DR3A 5BSEA 4J9VA 2DTXA 4FFMA 2AA3A 2NQTA 3ONDA 4RORA 3QWBA 2IZZA 3AOGA 2BKPA 1A9ZA 2C7VA 2DLDA 3I3OA 4BHTA 4FCCA 4ZVVA 2JAHA 4MVJF 1P1HA 5GZ6A 4CLDA 1JA9A 4F6CA 4IXWA 1P1RA 3ONEA 1XQ1A 1JAXA 5A06A 1BW9B 4MO2A 5G0VA 2J3HA 3DFZA 4Y6RA 1I2BA 4XA8A 3MJ4A 2C7GA 4J4HA 5T64A 3DMTA 4R1TA 4D3FA 5A9SA 5CEJA 4XYLA 3ZHZA 2GUGA 3RD5A 1NQTA 3QHAA 3LVFO 3W4JA 2NVUA 1VI2A 1TLTA 4CM9A 2V65A 4CMEC 5CDTA 5ILOA 3C1AA 5EQFA 2CD9A 4BNMA 2C07A 3F3SA 1IPEA 3TOZA 1UP6A 4YVFA 3SXPA 4HX5A 3KZVA 1R12A 1NAHA 3PYXA 5HM8A 4DGSA 2PKQO 3L6DA 2WE7A 1VLLA 1GDHA 3FNHA 4Z0HO 3CE6A 2WD7B 3UOGA 5JAQA 2E6UX 1PX0A 4ZA2A 1LDYA 1A5ZA 3DXFA 4MVJA 3WFIA 4E2YA 4Q3EA 2X6TA 3GC6A 2Z95A 4Q3AA 5BR7A 4JJGA 4J7UA 4IDBA 1ADCA 4UAGA 8LDHA 3RC9A 2DVMA 1H6AA 3EHEA 2ZJ0A 3RUEA 1T2FA 3UFXA 1NTOA 4IS2A 2ZIZA 4U8GA 3ZU5A 2BF7A 3WYBA 2YHUA 2Q49A 4GLLA 1HE4A 3WYEA 3QVSA 4DMMA 3VZQA 3EZYA 5I9NA 1BGVA 5IZCC 1B8VA 1W8DA 2PA3A 4OYRA 4QEDA 3C3XA 4QSMA 4BKRA 2I5PO 4I5FA 3WGOA 1R4NA 3ROMA 3C7DB 4YJFA 1O5IA 1QLJA 4ZQFA 1DEHA 3ZNOA 2E37A 2WYVA 5C7OO 1QSGA 3COSA 1D8AA 1YGYA 3GK3A 4R9RA 2Z5LA 1O0SA 2OP1A 2BKAA 4FGSA 4R41A 2D8AA 3CMCO 4FQ8A 5LDHA 3VKVA 3LT0A 1DSSG 3TZHA 5FWNA 4E32A 5F21A 4AJKA 3VAZA 1U7TA 3WQQA 1Q7CA 4DIBA 4N18A 1QMGA 3O4RA 2ZCUA 1E1LA 2JHGA 2BI8A 1PS9A 3WBBA 1I2ZA 4BNIA 3TN7A 3NDIA 5A04A 2O7QA 5JAIA 2RBEA 4BNXA 2G17A 4ZGWA 2B4RO 4OAQA 4TRNA 2DBVO 1E77A 1PGJA 1RKXA 4Q9NA 4RLSA 3IP3A 1VKNA 1FDTA 1ZK1A 2OORA 3LT2A 3K31A 4B79A 3U4DA 5H83A 2OXIA 1MG0A 4WK6A 5JNLA 3S2EA 4NU5A 4W82A 4MP8A 3AY3A 3L9WA 1GFSA 1HYEA 1U4SA 3JSAA 3ST7A 1EE9A 4QFCA 3KUXA 5JCJD 1P44A 5A02A 5KKCA 1G0NA 4IPTA 1OOEA 4BV9A 3HQ4O 3PHHA 3NT4A 2AG8A 3AK4A 1TT5A 5TQVA 1E1NA 1NVMB 4P8RA 2JJYA 1L7DA 3L4BC 2W2LA 3OEWA 2YDYA 1TI7A 1Y81A 2WE8A 1OFGA 4KQWA 4R16A 5TRTA 5JPIA 4BNFA 1HE5A 2JCYA 3B70A 4BO1A 3ULKA 1LX6A 1P1IA 3C7CB 3LC2O 1YE3A 3JQ9A 3U9LA 3DBLA 1YL5A 3PRJA 3IMFA 4RV9A 3RFVA 4AFNA 3A9WA 4U7WA 4FJ0A 4AJHA 2ZB4A 3HE3A 3GG9A 2W98A 3JCZA 2YV3A 2P68A 4NBTA 1N9GA 3A14A 2VZ8A 2DFVA 3C8MA 4R69A 1YWGO 4BO7A 3EK2A 4W9NA 2CY0A 3R3SA 5THKA 2O4UX 4NK5A 1WZEA 3DOCA 5BSGA 5L51A 3K92A 1FXSA 4DXHA 4EUEA 4XRGA 3AI1A 1R0KA 2IZ0A 4YT4A 1NNUA 1I32A 3PLRA 4AG3A 3IIEA 3GNSA 3PQFA 3Q9UA 4BMNA 1NWCA 3GGOA 2IXAA 4JJFA 1X7GA 3C24A 4D79A 4HBGA 4BL5A 1FMCA 4Z9XA 2EKPA 2X0JA 3BTSA 3V8BA 4R68A 5B4TA 3DZFA 4XRRA 4Q3DA 1YB4A 1PJ2A 3OJLA 1HXHA 4CJXA 1MC4A 3GMDA 1RM3A 3DZKA 3CH6A 3H3FA 3FR7A 4GGOA 4TKMA 2QYSA 2Z1NA 3OECA 4OOEA 3KYBA 3H3JA 1HWYA 5F1OA 2Q3EA 2X0IA 5IN4A 2O3TA 3GAZA 3I9MA 2BKNA 2D2IA 2VYVD 1I10A 3FD8A 3E5RA 1B15A 3GEGA 3TQHA 4E21A 3F4BA 3JQGA 1VCTA 5EERA 5GZ1A 3JQFA 4XB2A 1KY5A 1YKFA 4WUVA 3AFMA 3CZRA 3F5QA 1PTJA 3S2GA 4D42A 5FI5A 4BNKA 4G81A 2GN6A 4R51A 1I30A 1GV1A 2CMDA 3A06A 4NZ9A 4FFPA 2UYYA 4B7XA 1U28A 8ADHA 4KTTE 4YT8A 4MPDA 1U3UA 1IL0A 5A9SB 1JN0A 2I76A 2BD0A 3KEOA 3TL2A 3GFBA 2NVUB 1EZ4A 4OSOA 4TZKA 1PWXA 4BMVA 5DBGA 3G0OA 4PZDA 2HK7A 4JBIA 4ALIA 4D45A 1V0JA 3K96A 5I9LA 2GZ2A 2D59A 3GR6A 3HB4X 2HSDA 2EW8A 4IDFA 3ZU2A 1XWFA 1JWBB 4BGIA 4GLOA 4I9HA 4RPLA 3V2HA 1SMKA 1X15A 4CQLA 3LDHA 1PJQA 1LLDA 2WTBA 2DAPA 1HZJA 3QVTA 4DTIA 3PYLA 3FF4A 2NWQA 5JAZA 5TF4A 1CYDA 1V3VA 2X1HA 2FSSA 4IDGA 1Z82A 3BTVA 4J16A 4NBUA 4BO3A 3GOHA 1QORA 4AVYA 3VZPA 1E7MA 3QW2A 1A4IA 1NWHA 4D0SA 1X0XA 3I23A 3IL2A 1LU9A 2D5AA 3QE3A 1R4NB 3OJFA 1HT0A 4YJFB 4GAEA 2Q4EA 5T6BA 3WNVA 3GHHA 4RPJA 1UZMA 3PJDA 3E48A 4GX1A 1M6WA 2G82A 3OQ6A 1KY4A 1Y9EA 5BNFA 4BV8A 3DBHA 1FF9A 2NACA 1ZEJA 5CAEA 1UAGA 2F00A 4IY1A 3RUCA 1VSUA 4A03A 2VQ3A 2D3TA 1U3WA 2RH8A 2O50A 1IYZA 2GNAA 3KV3O 1TXGA 4J1QA 1CWUA 4ALLA 3RBVA 3QVWA 4WLOA 4AJPA 4LMPA 3VC7A 2XF8A 3KTDA 5IZ4A 1ARZA 5AYVA 3RC2A 1BG6A 2JL1A 3PPIA 1P1KA 3S2FA 2CVOA 5ER9A 2O3RA 5L95A 3DDNA 3H9EO 4BUCA 3ZHBA 2OHXA 4NBRA 1O95A 2CSUA 2PR2A 3ROKA 1HYGA 3TZ6A 1N1EA 5I8WA 3EGOA 1UDCA 1W6UA 4LMRA 4W99A 4M55A 4DPKA 4F45A 1GUFA 2RAFA 4JNKA 1PQUA 2HU2A 4XYBA 3MJSA 1LXCA 1DLJA 2IYPA 2J6IA 4KDFA 1PL7A 4UEJA 4GVXA 4J6FA 1P3DA 1TT5B 3CPSA 4XYGA 3WGHA 1DRWA 1JWAB 4EZBA 3HHPA 1QYXA 4EJMA 3DBLB 1PL6A 3SLGA 1GQQA 1WMAA 4CUJA 1ISFA 1XG5A 3KBOA 4TRJA 4IGEA 1YH3A 1N9GB 4XZ3A 1YQDA 1ADBA 3OHSX 1DIHA 1OC2A 1EK6A 1V9LA 4CL3A 3ZCXA 4U6QA 3JQBC 4BO9A 2J3JA 4WEQA 3SLKA 2QRLA 4MVJE 1H6CA 4WJZA 3I4FA 5AXCA 3DEYX 3AJRA 4TKLA 1H9AA 3WS7A 5KWEA 1R0SA 4DBZA 4JN6B 5G0UA 3LF1A 1U8XX 3ON5A 2VOJA 4D3SA 1X7DA 4XIYA 3N58A 2DKNA 3H8VA 4F46A 2EKLA 4KQXA 4FC7A 5EN4A 1SB8A 2ET6A 4CMKA 5ICMA 2WDZA 3KETA 5U1PA 3A28A 3IUPA 3VPHA 1KYQA 2P9CA 4BIIA 4BNYA 4GX2A 4A0SA 4YT2A 1KVUA 1T4DA 4Z9YA 1DHTA 1GEEA 4ID9A 3A4VA 4URFA 3FI9A 4XR4A 3JQGB 3MOIA 1Q1NA 3HDJA 4O0LA 4WCFC 3WQSB 3TSCA 1S6YA 4BMSA 4XDYA 5HWSA 2DT5A 3JQ6A 5DOVA 3OH8A 4HFMA 4WEOA 1K6JA 2GO1A 2UVDA 3GRKA 1H6DA 1LRLA 5THQA 2B5WA 4M54A 2WEKA 4ZU3A 3VZSA 4E5NA 4RJTA 3E8XA 4CQMA 2PZMA 3KLPX 4NFSA 3SJUA 1GPDG 1OBFO 4TVBA 2VNSA 3R3JA 2C5AA 5JDIA 4ZHSA 5DOZA 1ULSA 2VUTA 4WLEA 3ZNNA 4HUJA 4CUKA 4DC1A 1EBFA 3PLNA 3C7AA 2NV6A 5BNTA 1XHLA 1Y7TA 2YFHA 2RIRA 3F6YA 3IQDB 5JLAA 1PSDA 2P91A 2SCUA 4CQLB 4BB5A 5KVVA 1U5CA 3DHNA 5B12A 1DRUA 1YS4A 1MG5A 1N2SA 3NJ8A 3B1FA 3KYDA 3WLFA 2C29D 1SAYA 3S2IA 3EMKA 5JAMA 2B4QA 3UH1A 1IZ9A 2Y1FA 3L07A 4AJ1A 4BNVA 3LC7O 4G65A 4NU6A 2FHSA 2E49A 1ZK2A 2VHZA 3ZI0A 2XXBA 2IXBA 5K6AA 1Q0QA 4MVJI 5TNXA 3UF0A 1V35A 4H7PA 3WDSA 1E5LA 4BNUA 2VNAA 3GLQA 3WYCA 4J2OA 4BVAA 3EW7A 4XR9A 5JSFA 3I9LA 1GY8A 1ZSVA 4PG7A 3DZBA 5A4DA 4C7JA 1J6UA 2A35A 1U2GA 2B4TO 5FFFA 3OICA 2OUIA 4GMGA 5CPFA 4YAIA 4KP7A 1A7AA 2Z1MA 5KKAA 1LUAA 1SOVA 1SC6A 3DBHB 1GEGA 4IDCA 4E6PA 3D4OA 1PGPA 4O59O 3R1IA 3QVOA 1A4UA 4A5OA 3RUAA 1Y6JA 1R4MA 2DC1A 3UUWA 4BNGA 5G4LA 4J1NA 2C2XA 3PQEA 3DAFA 4L4RA 1Q7BA 2PGJA 1PJSA 1C0KA 3V1YA 4CR6A 4D7AA 2CF6A 1PJ3A 1HE3A 1OMOA 3WMWA 2OZPA 4YAKA 3GMSA 4KUHA 4GBJA 2EW2A 5EESA 4AJNA 3VTFA 2AQKA 2EJWA 1KETA 1MP0A 2EGHA 4GGPA 4RPGA 2G5CA 1LSUA 2HJRA 4QO7A 3EZLA 3MEQA 1OZAA 3LT1A 2VHXA 1YL7A 4YJGA 3L6EA 3WSVA 3VKUA 3DZHA 5L45A 1U2DA 3MWEB 1ISHA 2WM3A 3JD0A 3QWIA 5JC1A 1JLLA 2AMFA 3HFGA 3ANNA 1QYCA 1UJMA 4XQGA 4IQ0A 1B7GO 3DQPA 1LRJA 2H5LA 1QXSA 2EG9A 3GY0A 2DBRA 1AHIA 5CG1A 4J3FA 4UUPA 1XU7A 2QW8A 2YZ7A 1GTMA 1L7EA 4EEXA 3CXRA 2W8ZA 4LCEA 1GPJA 3O26A 4WOKA 5ER6A 4RF5A 4CMJA 5KOIA 1T25A 2R00C 2P9GA 3GHYA 3A1NA 3JD3A 5JDCA 1EQUA 4J91A 1T4BA 2JFGA 3FN4A 3B1JA 4QT0A 2DUUA 1GCUA 4Y6PA 4L4SA 4I5DA 3ANLA 1FDSA 4GWGA 3SC4A 2QHXA 4K6FA 4MINA 2Q45A 1HDZA 1Q2XA 4B4UA 2TMDA 3JV7A 2JD2A 1DB3A 1ZSYA 4P4GA 1P45A 3VPGA 4UVDA 1P77A 1TT7A 4IMPA 5G0SA 4CPDA 2FPGA 3KSZO 1RM4A 3GF4A 3RU7A 1P31A 3FTNA 3H9QA 1E3LA 3QSGA 3AWDA 4IJUA 3BHMA 1KEPA 2XXJA 1UDAA 3PP8A 4FD3A 4INAA 3KXDA 1D3AA 3P19A 3M2PA 1F17A 2PNFA 4MIEA 5ILGA 3T4XA 3GEMA 4PLFA 1BHSA 2HRZA 2PKQP 3H5NA 1CQJA 3DHYA 4YRDA 3H2ZA 1ZCJA 3U0BA 3O03A 4KZPA 1ZEMA 4DIFA 2Q1TA 3NUGA 2D1YA 1H94A 1PS8A 3IJPA 3H4VA 3OEYA 4FFLA 4J0EA 5JW6A 2G0TA 3ROPA 3HNPA 3JD1A 4CLEA 5G0TA 3F9IA 4WCFA 3L6OO 4G2NA 5BNIA 5KJFA 1B16A 2P5UA 3ZW8A 4Y8VA 1E92A 3INTA 1ISGA 1NPYA 3ADPA 1WNTA 1JAYA 1T26A 5JCJA 3WWZA 1IB6A 4GWKA 3DONA 1WAMA 2EIHA 3L0DA 5DCYA 4EW6A 4CM6A 1AGNA 1GV0A 2NVBA 4CQMB 3ETDA 1M75A 3W8EA 3ZWPA 2VUUA 4I1IA 4E13A 4E2XA 3BTUA 3NGLA 4DIOA 2AHRA 1J5PA 3SJ7A 1HYHA 5AOVA 1K6XA 1U9JA 4W7IA 3GPIA 3ETEA 1ORRA 4YBZA 2EEZA 5MDHA 1GZ3A 3D4NA 3ZV4A 4G5HA 3RIHA 2JHFA 3ITKA 1BVUA 3G1TA 4X54A 3SEFA 4HV4A 3RFXA 2NSDA 1UZNA 1BXKA 2ZTVA 3SVTA 1ZJZA 1ZMTA 2BELA 3B1KA 1DAPA 3W6UA 4I9NA 1DXYA 3IS3A 2JCVA 2R6JA 1ZNQO 1JW9B 1AXEA 3H5AA 3KYDB 4O6VA 4W7HA 4YQYA 1WPQA 1ZXLA 2HMSA 3M1AA 4A7PA 3BIOA 3DAGA 4BNWA 5ENDA 1A27A 3GUCA 3SX2A 3FTPA 2IODA 4J90A 1M66A 3RVDA 4YPOA 1JQBA 2QZZA 3WQRA 3DL2A 4RVUA 3QY9A 7MDHA 4FSHA 2VYND 4DMLA 1EVJA 1XCBA 3PWSA 3PIIA 5F1KA 3H7AA 3OBBA 4QO8A 2GR9A 4ND1A 4NMHA 3ZHYA 5F5LA 1A9YA 2ZQZA 2DBQA 3TOXA 3TJRA 4JX8A 3I9OA 3AUAA 4GSLA 5B1YA 2Y1CA 2CDCA 5T67A 1RWBA 4Z3DA 1IHYA 4PVCA 4ZRMA 5TSDA 5BSHA 3GVHA 3U4CA 4UREA 1Y8RA 3P5SA 4TRMA 2VYVA 3WR5A 3TDKA 1CEQA 3MJCA 2I65A 1R4MB 1ZUD1 4J4TA 1PZEA 3DB2A 2UUOA 1EUZA 1KEVA 4XIJA 5COAA 2Y1GA 1U1IA 3GG2A 3ZWNA 1U7HA 5BT9A 3LLVA 2QZ9A 4BGVA 3DMYA 1ZFNA 3S8MA 4DPLA 3JTMA 2YQ4A 1VL6A 1PEDA 2YY7A 3AUUA 3GT0A 4DPMA 4RVSA 4NK4A 4BO5A 3IUSA 4LISA 4NR0A 4Z0PA 1YRLA 1GADO 1GL3A 4C7KA 1GZ4A 2FOIA 4IJVA 1TVEA 2Q1UA 2PK3A 4B4OA 4CV2A 4OL9A 2ZYGA 2BFPA 4Y67A 2JCXA 4Z3KA 3K2EA 1CETA 2Y67A 4UVIA 3KOUA 4XEHA 4K9DA 3UCFA 4R3NA 3MCVA 2E82A 4YJGB 1C1DA 4R1UA 1LQTA 3ZWMA 4ALMA 2PGLA 5HTOA 3UVEA 4B8ZA 5T8KC 4MP3A 1P1FA 3KYCA 2J5RA 3JQAD 4MIYA 3INRA 3C85A 4JQCA 2X5KO 1S7CA 5LCXA 6ADHA 2PKRA 3KRTA 1YXMA 5A05A 3WGYA 3BMQA 3GDOA 4AJJA 1B3BA 1WMBA 3WB9A 4KOAA 4EJ0A 4JK3A 4J7CA 2VN8A 3UICA 4A2CA 2GERA 5U4QA 2HMTA 1DIRA 1DC3A 2ZB7A 4IDAA 1I8TA 1NR7A 1XEAA 3D4PA 5JYDA 4NPCA 4S3MA 2YYYA 4PRLA 3ZWCA 3H9JA 2YV2A 3I83A 5IN5A 3NAQA 4CL8A 1DOHA 3ASVA 3GN2A 5EINA 1I33A 1A71A 2V6FA 3PXXA 4PLGA 2QRJA 4JIGA 9LDBA 1D4FA 1NM5A 3E18A 3R0IA 1OC4A 4OHUA 2UDPA 1LLCA 3FNFA 1ENOA 3RJ9A 3CKYA 1LC0A 2X9VA 1E3WA 5JMPA 1K0UA 2Q1SA 3LZ6A 2B5VA 1K3TA 3S1LA 1T2EA 4L8VA 5AXAA 1J0XO 4JROA 4OSPA 3G79A 3ZWAA 3PTZA 4XKJA 1H93A 1ONPA 3RCBA 3BAZA 3DWFA 4NBWA 5G2OA 2J5QA 2Q1WA 1T24A 2ZB8A 4A27A 1DIGA 3GA0A 2EF1A 4ND5A 1ZMOA 3KHUA 2FSVA 2DTDA 2DU8A 2JD1A 4WCFB 4PGFA 3V5NA 1YONA 2G1UA 3D7LA 3MTJA 3QP9A 1CQIA 3DOJA 3GH3A 3RBXA 1HDYA 1I5RA 4PVDA 5JBIA 3PI7A 2XOXA 4FJ1A 4PCVA 1IE3A 3I9KA 1X14A 3V1UA 1XA0A 1NBOA 5HA5A 3OIGA 3STHA 1NPTO 3I6QA 4TQGA 3RUHA 4CMEA 3I9NA 4HWKA 4KUEA 5CEFA 2A92A 3PJFA 5IDQA 4OH1A 2AEMA 1ISIA 1L1FA 4W4TA 4OGWA 4RF2A 3P2YA 3DO5A 2FR0A 1KVSA 4PRKA 4BO8A 5HRUA 5L7YA 1MUUA 3BMCA 1H6BA 1LLQA 4TVOA 3QJ5A 1EQ2A 1WDKA 3L9XA 4W6ZA 1H9BA 1NQOA 5GY7A 1DJNA 1GUYA 3W4KA 1LTHR 4ZQEA 5K9ZA 3KO8A 5IG2A 2BGMA 3UGKA 1QG6A 4BGEA 3WSWA 1M6HA 3RBZA 2X8LA 4CLRA 4LSMA 4BNNA 1AUPA 2O23A 4I08A 1XU9A 3DTYA 4MKXA 2NADA 3ZNPA 3DBRA 4JLWA 3AUSA 2IYOA 1SO8A 5IZCA 4TWRA 4CMHA 4FJ2A 2FPIA 2QIOA 2ZTLA 3WNQA 4EEZA 4H16A 5KVSA 1U4OA 1E6UA 1P9LA 5ITVA 2DFDA 3ZV3A 4BNHA 3VDRA 3LT4A 5L9AA 5JS6A 3WICA 4RPKA 1C14A 3K2BA 2BHLA 2C2YA 4N5MA 5KVCA 1HRDA 5JC8A 1EVIA 2NNLD 4B3IA 1A72A 1VE9A 1Y8RB 3ENKA 1KC3A 3FCOA 5TJ9A 2VWPA 4ITUA 4R3WA 3AW9A 3T7EA 3U4HA 5AVOA 4E30A 5A5FA 3HDQA 1Z75A 4EBFA 1AN9A 2B35A 4OMUA 2AW5A 1SBYA 2Y1EA 3HWRA 2NU8A 1PGNA 3AOEC 4CM8A 5JCXA 1LEHA 4I9UA 4P38A 1WZIA 5U9CA 1BMDA 4P4LA 2O2SA 3E03A 5HS6A 2V7PA 3PVZA 4WE3A 4RLHA 4IINA 2VWQA 2DPHA 4HFNA 1JKIA 4YR9A 1P0FA 3H5RA 1V8BA 5CFZA 1EFLA 2EKQA 3PGJA 4PLVA 1ISMA 1MXFA 4FS3A 4PLHA 5DBIA 1J4AA 4CM7A 3K6JA 3U09A 3FBTA 5B37A 3BTOA 5CPBA 4J7XA 5ES3A 2FRDA 4ND3A 3PWZA 4L74A 2P5YA 3SBOA 1B0AA 1PL8A 2WJPA 4HY3A 2I66A 1Z7BA 2BH9A 4HNHA 3D5TA 5TX7A 4N54A 1DLIA 3PHLA 3UN1A 1WW8A 3X2EA 3MJTA 1EK5A 4PLTA 5EIOA 4YQZA 1DFHA 3VTZA 4CLOA 1NQ5A 5T8KA 5ICSA 2DTEA 3KYCB 2NU9A 2X9GA 4OIMA 3S55A 3L4BA 1FDUA 3PJEA 3LYLA 3GUYA 4IXTA 4UVEA 3GFGA 3WLEA 3CSDA 4D46A 1E7SA 2ZQYA 3RI3A 5H81A 2OBNA 2Q46A 2VTDA 1D1SA 3HN2A 2VOEA 3BMQB 2VZ9A 2GF2A 4CLHA 1KEUA 5DZSA 1RM0A 2UV8A 1B14A 3HADA 2X9NA 2J8ZA 3DTTA 1DIAA 2VCYA 1KBZA 1O8CA 1PJCA 2I67A 2ZK7A 3F47A 4FPXA 4DLLA 5I7SA 1B3RA 3BHJA 3PQDA 4OQZA 4Q39A 3G49A 3T7CA 4PG8A 3ZV6A 1KERA 4E5KA 1KVQA 4LRTB 5B4VA 3VH1A 4OJNA 3UHAA 1PU2A 4RF3A 1I2CA 5LC1A 1B2LA 1U5AA 1YB1A 2X5JO 3RUFA 2GLXA 2X86A 4MJLA 1I3LA 3ZH2A 3OA0A 4JBGA 5L40A 2C82A 4XGKA 3PIDA 1SZJG 3RKUA 2FZWA 2PWZA 4BB6A 1GD1O 3QWFA 4I5EA 1GQYA 4HFJA 1E3WB 3D0OA 4KWIA 2QQ5A 4R9SA 3Q2IA 2PGDA 5L53A 1QLHA 1T2CA 2P4QA 3JQCA 3H9GA 2O2YA 5TC4A 1TEHA 2Y68A 4XGIA 3E9QA 3GRPA 2PH5A 1ONNA 3VH2A 2W90A 2BKOA 4AJ4A 4J0FA 1XQ6A 2CDBA 3WTCA 1E3EA 4AJ2A 3NJ4A 1MXHA 4E4YA 1EEHA 4PG6A 3OMLA 2E4AA 1DC6A 3NEPX 3DC2A 2HMVA 1VC2A 3IKVA 1ADFA 4YYZA 4HADA 1A7KA 2I99A 1C0LA 3N74A 5DT9A 1ML3A 1R0LA 4I5GA 3JYNA 2D5CA 2JFHA 5L7WA 1F12A 3PHJA 3U4IA 2PY6A 2O3JA 4J2HA 1YO6A 4QXMA 4F3YA 2VRBA 4CM3A 5A03A 2PD6A 2LDXA 4B4WA 1BDMA 1SPXA 4M8SA 1UXGA 1Y8QA 2O3SA 1XIVA 1Z73A 3AM4A 3ZWXA 1LDEA 3EAGA 2H1SA 4FFNA 4UVHA 3PJGA 3CMMA 2FWMX 4FFRA 4TSKA 2CNBA 2X23A 1HETA 1YJQA 4N7RA 4U0JA 1XR3A 1E1MA 3BMCB 1UDBA 3DMTC 1UXJA 2QRKA 3I9JA 5TGDA 3HN7A 2H6EA 3B6ZA 2O3UA 1HKUA 3ETGA 3GEDA 1PJBA 3WGTA 1KIFA 1OI7A 5A3VA 3OETA 2GSDA 4QQRA 1NHGA 1AE1A 5A5EA 4RZHA 4CLRB 1SOWA 3RASA 4O63O 3JQEA 1ZSNA 2J5KA 3FRJA 3DBRB 1EVYA 1ZXBA 2AEFA 1HF3A 2VRCD 3W8FA 4R5HA 1XYGA 4NH4A 3W8DA 1E7RA 3DOOA 4ZN6A 3BMOA 3F46A 1K89A 3Q2KA 1ZIDA 1H5QA 3NRCA 4ZQBA 1E5QA 5L4LA 2FR1A 5EJ2A 1G6KA 2EP7A 1GQ2A 4U5QA 1IUKA 3K5PA 5ITWA 3V1TC 5KCZA 4WLVA 4YA6A 1IOLA 2VTEA 4RVHA 4RDHA 4L73A 2HMWA 5JFOA 5JY1A 5C3MA 3Q9NA 4NJMA 4RPHA 2PD3A 4DWVA 3LU1A 1HSZA 3MJEA 4CM8B 3ZU3A 2GGSA 1VJ1A 5MGBA 2BI7A 1NAIA 1XDWA 2X4GA 3QLJA 4WKGA 1C1XA 3IP1A 5C7LO 3WJAA 2CVQA 4MVJH 2PLAA 3ANMA 3F1LA 4YAJA 3ZDFA 4E33A 2HRBA 2O7SA 3KSUA 1CRWG 7ADHA 1YVEI 4OXNA 4F6LA 4GSKA 1KVRA 1O6ZA 3ORFA 2O48X 1XELA 5IAAA 1YOVA 3K8ZA 4EI2A 4K26A 3OJOA 5DCWA 1E3JA 1ZK4A 4DYVA 4HP8A 3M6IA 2Y05A 4CV1A 1IY8A 3HDHA 4J1SA 1RYDA 1B8PA 3DAPA 4CLOB 1YQXA 1YQGA 4DBVO 4UVGA 1YJ8A 2EJVA 2A4KA 1GYQA 1E1KA 1I36A 2P4HX 3LF2A 3WBFA 3GPDG 4UULA 3E9NA 1ZZEA 5A3JA 1PJLA 2BLLA 1QYDA 4R1SA 2QYTA 4S1VA 3H6KA 4P4NA 4NNJA 1LRKA 2VYNA 4LK3A 1OAAA 1R6DA 4FW8A 2ZJ1A 1U8FO 3RAJA 3UKOA 1VL0A 4K6CA 2YV1A 2GPTA 3AFNA 2PH3A 3U49A 1G1AA 3BZUA 3NGXA 4H3VA 5FF9A 3JQBA 3LSYA 1VL8A 3VH3A 5KNLA 3ZN2A 3ROQA 2NLOA 4JGBA 3BA1A 4XTTA 4B3JA 4EUHA 3JQ9C 1D1TA 2Q2QA 1BSVA 4B4VA 4CR8A 2RCYA 4NIMA 4R5MA 1SB9A 2EERA 4ND4A 1HDCA 3PZRA 1FK8A 3D1LA 4CV0A 2P2SA 4PLCA 4GQAA 1QP8A 4A73A 5IJZA 3FBGA 4XYMA 5AXDA 3VPXA 4E5YA 3E6AA 5EQDA 5COBA 1BWSA 3QA9A 4YS2A 4W9NC 5GMOA 4XQ9A 1N8KA 5CP8A 9LDTA 1B8UA 1NQAO 3OA2A 2XPCA 3ONFA 4EJ6A 4YTEA 4BNJA 3N7UA 1AHHA 2HLPA 1E6EA 1O94A 4IUYA 3WFJA 5IDXA 3FNEA 3ICPA 3M1LA 3H65A 4MVJG 2GZ3A 1ADGA 1GAEO 1DC5A 1MLDA 2IEDA 1E3SA 5A1TA 5AXBA 3GVCA 1PR3A 1PR9A 2CF5A 4PN3A 2BMAA 1UZLA 2X22A 3JXOA 1SCUA 4XWYA 4YEDA 4YRAA 4B7CA 1ENYA 3TL3A 2D4AA 2HDHA 3WMXA 4KMSA 4EYEA 4CMGA 3VPFA 2GYYA 1B26A 5JE8A 2OGUA 1Z45A 3DBVO 4OKNA 1HL3A 4CM5A 3DZGA 3GAFA 4BKPA 4DQXA 3GNTA 1HLPA 2AQ8A 1MA0A 2C59A 3JQAA 3JQFC 4YCAA 2DUWA 4CMIA 3NDJA 4K1LA 1CIVA 2YQ5A 3BXXA 5DULA 1Y8QB 2HMUA 5CDGA 4D43A 3PFWO 1ZW1A 5JO0A 3D64A 1YB5A 3LLSA 4UUOA 2DQ4A 4E12A 4BKQA 2ZYDA 4LW8A 3NX4A 3EYWA 3IOYA 1DHRA 2YDXA 3CUKA 1ZBQA 3AM3A 3VPSA 1JKJA 3LK7A 2X7HA 1K2WA 3QVXA 2A94A 4AICA 1RYEA 2HCTA 4M89A 3GN1A 3AU9A 4Z6KA 4N5LA 5KVQA 3IKTA 1LSOA 3JYOA 1MV8A 1GR0A 4FOOA 1Q0HA 1HDGO 4RVFA 3EUWA 5TLSA 1FJHA 3OQBA 3ZWYA 5LDGA 4D41A 3RC1A 2W4QA 3RFTA 1NXQA 5H82A 1GU7A 3BMOB 1T2AA 4IQGA 3Q1LA 1YDEA 3ZGYA 1PIWA 3CINA 1H2HA 1HDXA 5TT0A 3ZNQA 1HZZA 1ZKMA 3NTRA 5BSFA 4E5PA 5F5NA 4IQ8A 5CDSA 2HK8A 4WPGA 4EITA 1KS9A 2VZ0A 3ENNA 4CM4A 1XGKA 4HNGA 1Z7EA 2EP5A 5TS3A 1WXDA 1QKIA 3KLMX 4R1NA 4CMAA 4CODB 4NJMB 3QRWA 4LVCA 1N7HA 1N5DA 4R01A 3QWAA 3JQ7A 5L4SA 1HTBA 1PGOA 3OM9A 3PK0A 4TRRA 1E3IA 2B37A 1UAYA 3F4LA 3AM5A 3RWBA 3PFFA 1WWKA 4PFJA 3TFQA 4BGUA 1C1XB 5KTKA 5I7EA 4IJWA 4WASA 4GMFA 1UH5A 2ZB3A 3AU8A 5TIIA 3EVNA 1WVGA 1LDBA 2O4CA 2ZTMA 2EHDA 3ZV5A 1VRWA 2Q50A 3HZZA 4EDFA 2C54A 3E82A 4GKVA 1T2DA 4YACA 3K30A 3FNGA 1YOVB 3TPCA 5C5IA 1LLUA 1PQPA 4HFRA 3K9QO 5JY6A 1UP4A 1NR1A 2CVZA 2PTGA 2PV7A 1LSSA 4L0QA 3MWDB 3G17A 1I3NA 3U62A 4YJDA 3MTGA 4XJTA 5KJCA 2ZKLA 4CUZA 4E2WA 2LDBA 4YAGA 4WCDA 2BGKA 4JP2A 4M49A 4XGNA 5KJ6A 3ZWWA 1DO8A 2PZJA 3GZNA 1ULUA 1Y5MA 4R54A 2HK9A 4DC0A 1PZGA 2QG4A 4OM8A 1P33A 1VJ0A 3JYPA 1CF2O 2DM6A 2FMUA 2Y66A 4OOFA 4WOJA 1E0DA 2Q2VA 2YHIA 3I5MA 2R00A 4I8XA 2DPGA 3PDJA 2V6GA 4GKBA 1EUDA 3WWYA 3RC7A 5COQA 3D5QA 3FWNA 1Q0LA 5KJ1A 4CV3A 4OXYA 1PZFA 4CM9D 1F06A 2AXQA 1NFFA 3Q0EA 4GH5A 4O5OA 3UCEA 1UUFA 2R2GA 3NT2A 4MP6A 3WJ7A 1R37A 1IULA 3ZW9A 3PHIA 1DBVO 5B4UA 1EFKA 4RVDA 1NVGA 2CUKA 1WLYA 4PZCA 3TZQA 3HB5X 3PGXA 3HFSA 1HE2A 4YAEA 2NTVA 2OOSA 4IIUA 4MIOA 1I01A 1UXHA 2PD4A 2Q99A 1NX6A 4MVJD 4YB8A 4ALJA 1I3MA 3JYLA 4DA9A 4BQRA 1KOLA 1DFIA 3UW3A 1EUCA 1HEUA 1NPDA 4NFHA 2NTNA 4L76A 3KB6A 2FN7A 4JCOA 5DNAA 3OIFA 1MB4A 3AY6A 4PLZA 4PG4A 4IM7A 5TT1A 1WDMA 1O89A 4Q3CA 2I3GA 3D3WA 2HQ1A 4RL6A 4HXYA 3ASUA 4TZTA 4ND2A 2ZCVA 4L75A 4BNTA 2FZEA 4KTVE 2RHCA 2YUTA 1DAOA 1HLDA 3MJVA 3W6ZA 2IE0A 4BO4A 3GNQA 4Y98A 5IXSA 4MVJP 3GDFA 3JYQA 4IIVA 4E31A 1KC1A 4M87A 2FP4A 1XKQA 5L3ZA 2OP0A 4BKOA 4II2A 3LC1O 3H2SA 1NHWA 1NYTA 1X1TA 5IFLA 1DFGA 3JQAB 3VDQA 5EMHA 4CMIB 4PG5A 3WX0A 1J49A 1JDJA 1HDRA 1NASA 1UP7A 4MKZA 2HAEA 1Q7GA 4U6SA 3PZBA 4DQVA 1U3VA 1Z6ZA 2I9PA 4OO3A 4UEOA 2BFAA 2C0CA 3CTMA 3KM0A 1LA2A 3PYMA 5GZ3A 2WYWA 4RVGA 2JKVA 2W2KA 2CFCA 4RDIA 2BGLA 4L9RA 4KWHA 1P0CA 1W73A 3VOSA 5C37A 1IPFA 5JDIC 4EGFA 2FPPA 1BVRA 1LQUA 1IHXA 3TZKA 4DL9A 3E1KA 3NT5A 3CZMA 2GRAA 1MFPA 1PZHA 2GN9A 2VT2A 4GL4A 4ZJUA 3NTOA 1QRRA 2GCGA 5I9MA 4NI5A 4WLNA 4OXKA 3O9ZA 1ZH8A 3AI3A 4YJHA 1BXGA 2BFMA 2W2LD 1FDWA 2GN4A 3TFOA 2AG5A 1KVTA 3Q3CA 1NVTA 4U0KA 3NTQA 2ZTUA 4ESOA 3E9MA 3GVPA 3ABIA 4LSWA 5AQ1A 5EL0A 1NP3A 3ZHXA 4OQYA 1DJQA 1PQWA 1QR6A 5K6AC 2HJSA 4CM4B 1BDBA 4DRYA 4FGWA 4A26A 5DF1A 3MOGA 1DRVA 1U3TA 2ILTA 4BO6A 3OQ1A 4XX0A 2JFFA 1WP4A 1SEPA 3JQ8A 5CG2A 1V6AA 3V2GA 3JQ7B 1N92A 4UEKA 5HS4A 4AL4A 3DFUA 3DHEA 4MKRA 5JO9A 2IRWA 1ENZA 4TMFA 3JQDA 1JU9A 1TA4A 3U3XA 3X2FA 2B83A 1E7QA 2V6MA 4Z9FA 3VVBA 3TRIA 2OFPA 5ADHA 5T57A 2GN8A 2VHYA 4E3ZA 4ZD6A 1UXIA 2X0NA 3EC7A 5FI3A 3G3EA 3OP4A 2X5OA 4WGGA 3EVTA 3KSDO 4C4OA 1LI4A 3GZ4A 3U5TA 4OKIA 5CEEA 3QIVA 3H9UA 1H0KA 2Y1DA 4QUKA 1C1DB 3C1OA 2NVWA 3OIDA 1GYPA 2EGGA 2O3QA 1X0VA 5I7VA 4KUGA 1GUZA 4IDDA 4RZIA 2PZLA 4BO2A 1PJ4A 4XQEA 1E6WA 3GZNB 4FR5A 5IDYA 1I3KA 2F1KA 3RUIA 2WD8A 1ENPA 2Q2WA 3IJRA 5DDIP 5F1PA 1M67A 1IZ0A 2B0JA 2DBZA 4PZEA 1Z74A 2YFQA 5T5QA 1LC3A 1P74A 2YHIB 4B8WA 4JJIA 5DP1A 4B7UA 5ENVA 4LGVA 2VRCA 1PJTA 4ZQGA 5K0ZA 2H9IA 4DLAA 3Q11A 1MFZA 2FY8A 3INGA 2RH4A 1QYVA 4J1TA 4A10A 4LN1A 1MC5A 5DBFA 2I3AA 2AQHA 1VM6A 2WWRA 4BQPA 1X13A 4BNZA 2Y1OA 5JYEA 3WXBA 5A9RA 4E5MA 1T1SA 1YL6A 2ZYAA 4RO0A 5DN9A 2NTJA 3RSHA 4XDZA 1TB4A 3OF2A 1VJTA 4YT5A 1R16A 3O8QA 5TJHA 3UXYA 1D7OA 4PLWA 5FYDA 5JDCC 1C0IA 5G4KA 4XB1A 1P1JA 3G1UA 1MGOA 1AXGA 2VHWA 4NBVA 4ZICA 5I8ZA 1EBUA 3OSUA 3ZWOA 4DVJA 3HDYA 4IGFA 1GCOA 1RJWA 3CEAA
chains in the Genus database with same CATH superfamily
2AGOA 4EHAA 1HQKA 2PKYX 3GONA 3EY4A 4K9OA 2VG6A 3BWDD 1R7RA 4RQAA 2OQQA 3D3WB 5T14A 4TXLA 2HA7A 4BS9A 3G8TA 2EFJA 1NF2A 2BRUA 4QGAA 2DCUA 5E3QA 4XCVA 1DL5A 3TNLA 4CR7A 3R6DA 4D8VA 2HV9A 3GMTA 3NG1A 2P3QA 3C15C 2HUNA 1THZA 3P7MA 2JFPA 1XVUA 5BMVF 3E5MA 3NBAA 2QDKA 3A2KA 2UUAJ 3AR5A 5CHEA 5DEOA 1FS5A 1UBUS 2E5TA 1ISSA 4YALA 3WOHA 3THPA 1VE1A 1DU4A 3DEIA 3CVXA 2BMEA 3W4IA 1EP3B 3DMRA 4Q01A 4FF3A 5AQEA 3GRYA 4P3YA 1ZGJA 3PL1A 1BCCD 1N7GA 3GFOA 4ZYVA 1JKFA 2R2RA 2AKWB 1OXXK 2H0QA 4ZPBA 3V1KA 2HQFA 4QX6A 1U7ZA 1UVLA 5DHTA 2L0XA 1Y9AA 1P6TA 4JXKA 2BC9A 4CL2A 1Y3CE 4M86A 1Z4LA 2HHXA 2Y0EA 3BRCA 1JFVA 1IR2A 4ENRA 3ZTSA 1PGQA 4I4NA 1XLTA 3UCXA 2FMFA 2Z2YB 3AM1A 4I1OA 3HSKA 5E8JA 2ERYA 1L4GA 3WIDA 1VIOA 4YPCA 3HYTA 1RT5B 4FN4A 1XRMA 4LHWA 2W2VA 3QFWA 3Q3HA 3W9HA 2D06A 1HC7A 5BV8A 2CE7A 1G291 4YXFA 2OPSA 4ZKPA 4P7TA 1EM6A 4AL5A 3V9AA 2WB2A 4M9UA 3HUDA 3IURA 4EPTA 7FD1A 1G21A 1GA4A 4F12A 2FWAA 3I61A 1JHZA 2IYAA 4RKWA 2K2WA 3ZWDA 4EA8A 1JPVA 3GGCA 1EJBA 2QZSA 2BFDA 2C7BA 1HBWA 1QH9A 4XOUA 2YW9A 4YWJA 5K2OA 4DM3A 4OMFG 4WFJA 4DR6J 3UH0A 2WVJA 4IMRA 2AE1A 5TMPA 4H1TA 1XZKA 2B8PA 2WI8A 2EXXA 1E60A 3FFTA 1IG3A 4D0LB 1GPLA 1UFLA 3C6QA 1YBAA 4IEEA 2VBWA 1SKAA 3WTBA 1KRPA 4F1JA 2YZ2A 4Q4DA 1TKDA 1RYRA 1BDJA 1GG2A 4OLAA 4NG4A 1NNDA 4KYUA 1O9BA 4J9VA 4YJ3A 1BN7A 4BFTA 1L9KA 1DKRA 3WNZA 3Q72A 2YO2A 5AE2A 1D6MA 2VDQB 5GZ6A 3TX8A 4KFSA 1H89A 1QIEA 4PUOB 4NNPA 3DMTA 4D3FA 5JROA 4H18A 4DFPA 3R27A 3RIXA 1HNIB 4UCXA 2CPFA 4LZJA 4YCSA 4PC2A 3RS7A 2Y2UA 1VE5A 1FSZA 2R9VA 5HM8A 4I55A 2Q3MA 2EJBA 4C7BA 2EWHA 3MF4A 3Q7IA 1QSSA 3DAOA 2ZPTX 3VDMA 3I82A 3VA7A 4NCJA 3THXB 4KQIA 4ND8A 3ZFVA 7AT1A 2QPTA 4C11A 5MFZA 5ETPA 4OA8A 4PXEA 3QVSA 2QD2A 3L0CA 4U3FG 3BT7A 2BE9A 1H0SA 3NM4A 3QQCD 1NDCA 2R6AA 3S1SA 3L70D 3N87A 1E2DA 5F21A 3DXXA 4L7QA 4URZR 2KL8A 1Q57A 3L1HA 1Q82Q 1E1LA 4ZV9A 1FXWF 3DL4A 4JD5A 1FA9A 2X2OA 3MPVA 1FJCA 4IG9A 2FPKA 2G17A 5LNK6 2MMYA 3PV0A 5K14A 3U3KA 4C6TB 5DB4A 3FOFC 4MX8A 3U4DA 2P65A 2VC1A 5CW1A 2ZNZA 2QROA 1X31C 3PNIA 2QA4S 3S2EA 3JSAA 3ST7A 1TX4B 5A02A 4PO9A 4IFYB 1VRUA 3SXUA 1DELA 4A8OA 4PR3A 2BL4A 3M34A 4ED3A 1RZRA 4MYSA 3MPUB 4WQMA 1ESDA 3KR2A 2EEPA 2OCDA 1OXBB 1R8CA 1TECE 4U7WA 1H4QA 2W98A 4PXCA 4NBTA 3NBFA 3CUSA 2VHCA 1EX9A 4BRYA 2C8KA 4RK7A 1WZEA 3D6HA 4C6SA 3OUYB 3F71A 1M56D 3Q9UA 5J1PA 2BM0A 3GGOA 4NMXB 2ZI5A 4D79A 2R84A 3V8BA 4CJXA 3VSAA 3GMDA 1WULS 3R8CA 1BQNB 1O6FA 5JCPA 3SMZA 1T91A 121PA 1BD6A 1SK9A 3Q7SA 4FSDA 1KY5A 1DAEA 5LB2A 2WJ4A 4AK9A 1UOQA 1SQBJ 2VJMB 4R98A 2VJLA 1IL0A 3EQ8A 1UJNA 3PCTA 1P81A 3EJWA 3G0OA 3WB2A 4UOGA 2GZ2A 2BDUA 1UWVA 4FKMA 4BMZA 1VIAA 5ALYA 2VQEF 3TRDA 5KG5A 3L09A 1SMKA 2WU8A 4L2IB 5D87A 4Q0BB 2GIQA 5JAZA 4ZIVA 1US8B 1RAIB 1K75A 3BXEA 3GOHA 4KDCA 1SUQA 1NWHA 4HJRA 2GILA 3I23A 1KEEB 2OTLS 5HRAA 3VHQA 3GEHA 1Z7YA 3KQQA 1CIJA 2HIQA 4I4LA 2C2KB 3HD7A 1CEZA 5T6BA 4EQZA 4MYDA 1SC4A 4FGUA 5AVZA 1SQPD 5CAEA 4RH1A 4KYVA 1J42A 2J9XB 1VSUA 2AV5A 4A47A 1N2HA 1VGVA 3LKBA 1NTMG 1OYOA 3D8NA 1S1XB 4Z2XA 1HBUA 1P1KA 2JASA 2OAEA 4I19A 3BATA 5L95A 3R7SB 4G0OA 2AW3A 2CSUA 5F0UA 4DV5J 2PSDA 4LOHA 3JZIA 3EICA 2LLZA 4LOIA 4EFDA 2B4KA 4E3WA 4BLOA 1TYCA 2HU2A 1LXCA 2YVUA 4B6GA 1IEXA 3EFOB 4OIFA 3WMFA 4A8MP 3THWB 2QA4P 5K1ZA 2OTCA 3E1RA 2Z2KA 2CMFA 3EM1A 2XVYA 5IZHA 1PL6A 4IX1A 1TO2E 4YQFA 4YFVA 5TQ2B 4B6SA 4K2JA 2AFHB 4EIJA 1EZ1A 2RHWA 1D2NA 1JRLA 1USWA 2QRLA 2XNJA 3DEYX 2O7RA 2FP3A 4B6FA 5MHTA 1C5KA 1B70B 4RHFA 4HMOA 4FIDA 5CCBA 3MUDA 3PGA1 3P9NA 2J9DA 1RKJA 3CHYA 2YVQA 2PBRA 2Q27A 3R9KA 3IVAA 3HEMA 1JLFB 3WV4A 3MT8A 1SKRA 3HSSA 4OVKA 3CXCR 3G5UA 3FI9A 4H54A 3MMBB 1D8YA 2QVAA 1P4GA 4FNOA 2VDHA 1FRNA 2JANA 1SULA 5C46F 4KXXA 4U7UD 4NFSA 1HI1A 1JR2A 3JYTA 2EJUA 4IG3A 3AEQA 2BOAA 1L5UA 2VUTA 2FD2A 3VUFA 5DJUB 3OMWA 1NZAA 2V67A 3DLPX 3UGTA 2QSWA 3F6YA 4X1YA 4UUQA 1YZ3A 3E51A 1AZWA 4EB3A 1VP3A 4M0MA 2ZI6A 1L0ND 1OV6A 1P0MA 4DA7A 3P2JA 1ESMA 3LGMA 5KX5F 1DTWB 2JF0A 4QULA 3I2GA 4O2BA 2WVBA 3AB4B 1W85B 5DS7A 4RW0A 2VNAA 4N03A 5IF9A 2QTVB 1Q83A 3I9LA 1NTZE 2MYPA 4K7QA 1GY8A 1QJHA 3LH5A 1A5SB 5CPFA 1R9GA 3L41A 4ND6A 3MR5A 2OTLP 2Q4DA 1G98A 5KNBH 1ABEA 2HFNA 3RUAA 3ZZMA 5EJGA 3QIDA 3FYDA 1Q7BA 4RESB 4O9BA 4J76A 1VGYA 3ZTOA 2JLRA 3WMWA 4ALZA 1U0FA 2KT3A 2Z56A 1VLHA 4KUHA 4GBJA 1XZ8A 5EESA 4C8KA 1YV9A 4FYYA 3VTFA 2AQKA 4QR0A 2M5YA 5GMKa 3G1WA 1M73E 2IMWP 4F96A 2R8JA 3N2GB 1IKXB 2O8DA 5JQGB 1RHKB 3EN0A 3DOMB 5L45A 3OX1A 5LFAA 3JD0A 4KQEA 1IQTA 5KFGA 3CLHA 4B2YA 1L7EA 1GPJA 1XU4A 5KOIA 1NTZK 3CURA 4QU9A 4LF5B 4ZZ2A 1YULA 5FWAA 1GFIA 3B2EA 2GPYA 2Q45A 1B23P 4Y99B 3O4HA 5D4OA 3T5DA 3NBUA 2ZJ6A 4P75A 4EGCB 4DX8H 3BPSA 3VBEA 1M7HA 4LF5J 3DDIA 1W5EA 1ZZGA 5FORA 3AEUA 2GVDA 3O8CA 4X4OA 3E9RA 2WKPA 2R85A 1FWLA 5FUVA 5C35A 2OECA 1L3IA 2Y8WA 3DKKA 5CIYA 3H1TA 2Q1TA 4OX7A 1NKEA 5ETSA 2D1YA 3HHLB 3L06A 3H4VA 1BDDA 4UT4A 2CMGA 4KXYA 8AT1A 2RF2B 4DRZA 5HMYA 3F6SA 2ZVSA 5DCYA 4EW6A 3PD7A 1ZWLA 3QPUA 2YXBA 4E2XA 3I6MA 2IHVA 2HZAA 1ORRA 4YBZA 4I1SA 3H0EA 1UOPA 4X54A 2NSDA 3I6BA 4KGMA 2OUKA 1Z7WA 3MMXA 3CW9A 5AKXA 3RV3A 3HUSA 1I13A 4FXVA 3QFHA 1F0NA 3R8XA 2PKCA 2IODA 2OUGA 2DXDA 3LLCA 2YTCA 3CD6S 2ZRJA 2HQCA 4WK0B 3P8BB 1CW2B 3AP1A 2ZUWA 1EK0A 4HQNA 5JJKA 3PNYA 3TJRA 4WZ6A 1A2BA 4GSLA 1FEZA 2IHYA 2QJYC 4U00A 2CDCA 4DV0B 2XQFA 3MCUA 4UREA 1IXSB 3RLFA 3GMAA 4BS2A 4YXWA 3ESBA 1Z4MA 2PRJA 1I94F 4BN0A 5EZ5A 2Q6CA 1TAUA 4C21A 1ZFNA 1GK8A 4DUZF 1ECCA 1ORDA 2PT7A 2B7CB 1GADO 5C1IA 4DV0J 4X8LA 3EAFA 2QJ3A 4EFKA 2ZYGA 4KI7A 1RA7A 1T1EA 3JWGA 2MSKA 3PUXA 2IHTA 4R3NA 5KLVJ 3IAS9 3JZFA 1YZUA 4LOLA 2C9LY 5ETNA 2J5RA 3DDOA 3B1ZA 1YTUA 1VFNA 4ZNCA 3VUEA 3E9ZA 1NC1A 4GXTA 4UQTA 1NJ6A 1CZHA 3DLJA 3OX2A 1B3BA 3OTDA 1IQ0A 3ETNA 1G9SA 4Q6BA 1QTRA 2HMTA 3U40A 4M38A 1ECLA 5CHCB 3LP0B 3KAJA 2FPGB 4X4UA 3E18A 2HCRA 3RGGA 2F17A 1KWKA 3BXPA 4BMCA 1W5BA 3OFHA 2WLTA 4Q15A 4L8VA 2WMMA 5A5GA 1RAEA 4XKJA 5AI5A 5LZ2A 1YUMA 4G5GA 1EJ6A 2JD1A 2RU9A 2J6BA 4HXFB 2G1UA 3GH3A 3HN6A 4EYGA 5TARA 1P2DA 1LH0A 4MR9B 4PCVA 3C16C 5JZMA 1T36A 3C3MA 1NVDA 3VX3A 1UQRA 2XUDA 3QE0A 3HHKA 1ULRA 2SECE 1FB5A 4HS9A 2CHFA 3OTWA 1H3EA 1FS4A 4BU0A 2PX2A 4Q16A 4L0MA 4NCNA 1T1GA 5GY7A 1HUQA 3MQ2A 3IAM9 1VFPA 4IMIB 4CH7A 3NTNA 1X5OA 2XGGA 2EVWX 2FQQB 2G83A 2D00A 3OPXA 2H1RA 3MM9B 4FPRA 1OH8A 1H1LA 1Y3FE 1RKQA 2X0EA 5KVSA 1E6UA 1VSBA 3I58A 3KK3B 2ALYB 4FFBB 1UWLA 4C8LA 1BVHA 1JXLA 2R1VB 1KKMA 5AVYA 3VR6D 2ILYA 4O4HB 1U4NA 3T1HJ 3JAWB 2IU3A 2PGAA 4D6TJ 3HP6A 4MQ4A 5AOBA 5U9CA 1YI8A 3FGVA 1SV5A 2VWQA 2QLBB 2Z58B 3IMCA 4ED0A 3WUUA 4MAAA 1YT5A 4YBRA 5ES3A 4QJ3A 4F04B 2H1WA 3ZGOA 1RU2A 2G1KA 2HYDA 4X84A 3PEEA 2F9FA 2QP4A 4PD4H 2B1IA 4E2FB 2LW7A 2WHOA 1DLIA 3FHOA 3X2EA 1YC5A 2MKYA 5JADA 3DRPA 2DXFA 5KNCD 1KC8Q 3R5FA 3MPOA 2JFWA 2WTYA 3TE7A 4BPRA 2EYQA 1OH6A 1FZTA 2DSNA 3BKWA 4ZAYA 4DRXA 3HN2A 2FYUG 4DR7J 1MZPA 2I5JA 3GMGA 3R41A 2KP8A 4FPXA 5B58C 2IUUA 1V39A 3UY4A 1AKVA 4M7RA 1BGXT 4KN9S 4B9TA 1SG9A 1PU2A 4RF3A 2GLXA 4XGKA 2CNOA 3PIDA 2PWZA 1C4OA 2CAJA 1GQYA 1BGWA 3NY0A 1EB9A 3ONVA 4R9SA 2PGDA 4PR6A 2B8EA 1SQXG 2F4NA 2YMMA 5L53A 2VKQA 1IC6A 2O2YA 3Q85A 1DTTA 1NW9B 4IH6A 4LI0A 4H4MA 2DYAA 1JR3A 4Z4CA 4QUJA 3SC2A 3R2JA 1CUIA 4L3NA 4EYHB 2VHTA 3F8WA 3H1JE 2FXIA 4C7OA 1GGEA 3J81Y 1DCMA 1BDMA 1EC5A 2IYNA 1T1IA 1Y8QA 3FHCB 4UVHA 2IT1A 4DOZA 1E8NA 4NL4H 1JEEA 1HETA 3C3BA 3QBJA 4DILA 2WRMA 1P80A 2IH4A 1YZKA 3AB7A 1RXIA 4QQRA 4TMTA 5IYZF 3NALA 4KXQA 1IOZA 4C0KA 2P77A 4QXRA 2HA2A 2L08A 3FEZA 2EKZA 4F3OA 1E5QA 5C31A 4U5QA 1IUKA 1R18A 2BEWB 2VXOA 1LW2A 1FAVA 4PPNA 4RW4B 3WBZA 1JTEA 4DSTA 3R5AA 5ARBA 4W92B 3ZJ5A 4QBKA 3ZU3A 4JOSA 1LV5A 2MZSA 3JAMY 1QRDA 4GM0A 4W63A 3CTPA 4LC0A 3LX8A 1RPZA 4FYXA 2FG7C 4EBDA 3OJOA 1X4AA 2HIYA 2OG1A 2WVGA 4R2LA 4GVBA 2RIPA 3ILLA 3THTA 4N41A 3T9EA 4DUYB 4O8ZA 3PC8C 5DN6A 2R2TA 4EY7A 1I36A 5D85A 1FU1A 3VP8A 2HOQA 2CCKA 3ILHA 1U94A 3HJHA 3L0PA 4S1VA 4YMUA 4MQLA 1U6BA 3NIWA 3WLLA 2RMZA 1R6DA 5EQJB 4KV8B 2KXNB 4MW2A 2ZU0C 1TEZA 4H3VA 3JQBA 3LSYA 4DUYJ 1UC9A 4F4AA 2H5JA 3PD1A 4ZKUA 2P3LA 2VJCA 2Q2QA 2GTHA 3H1LE 3FBCA 2X1GA 3DOFA 4MDFA 3D1LA 4GQAA 3QUQA 1O08A 3E6AA 3PNMA 4J0DA 4K0KF 3D0IE 5EDWA 4AD8A 2MQMA 1NQAO 1HYSA 3PICA 3CF4G 2B5JB 4EJFA 4W7ZA 3CU5A 1RWQA 4LFCJ 2R7TA 2PG3A 3OI7A 4DCOB 3BE5A 2IEDA 5A1TA 4BKMA 2HDOA 5JRJA 3E7PA 1HURA 1SQVK 1OI3A 3U17A 5JBQA 1BQNA 2OGUA 2XCAA 2YN2A 5DWQA 1EDJA 5AXKA 2M2IA 2R68A 3OCZA 5FTWA 4CT5A 5JU6A 3NDJA 4K1LA 5GJWC 2FEAA 4GR5A 5E9QA 4I7FA 2I3BA 3VOAA 1FJKA 2YKQA 4IRDA 1Z26A 1K1EA 4MPRA 4AXJA 1U4BA 2JCSA 1GMUA 3OTGA 2UXCF 3EB9A 5HUJA 1KAGA 3D6NB 4UJ5A 1V6HA 3V8PA 2CJYB 1E6LA 2H08A 3OEED 2YX4A 3FZQA 1F2UA 2QXTA 1H2HA 3W3AA 1W9HA 3CO0S 4X92A 4U7HA 4UHCA 4Q93A 3AILA 2I8EA 2WPSA 5BSMA 3EPHA 4PONA 3DLKA 1QKIA 3FFXA 4EG3A 1Z0SA 1R6VA 3JQ7A 3V4OA 3LSTA 2IH2A 1GDTA 5A62A 4RU2A 3WQHA 4PFJA 3A26A 4OHOA 3HTKB 4LBPA 2FX2A 1YFJA 1FOSF 4HFRA 1NR5A 2CVZA 2ST1A 3U62A 4YJDA 4QU5A 4EJSC 3ANXA 1JXVA 4NV3A 4V0OA 4MA5A 4JJ7A 1QSYA 1G8PA 1WKBA 1NBAA 2DPGA 4I8XA 2Z4TA 1A9XA 1NVXQ 1RW4A 3H6PA 4J0HA 2RH3A 2P90A 3PTLA 1X38A 4CM9D 4FEGA 4GH5A 1QL1A 4E11A 2QRNA 5IVHA 4MP6A 1SZDA 3H98A 2WD9A 3EZNA 3JX9A 3PGXA 3TECE 4FLEA 1IWOA 4D3GA 2IFMA 4IIDA 1P84H 2M3EA 2ZDPA 2HHAA 1LWOA 2GYWA 1Z4PX 4WRRA 1X8YA 3OCWA 4MWTA 4AKEA 5IU6A 1WDMA 2HSGA 3DFKA 3FRHA 4DXAA 3I96A 2FZEA 4UNSA 1UCNA 2DKOA 2B34A 4JLAA 1PDVA 2JGKA 5B6PA 2AOWA 4MVJP 2OV4A 3UR0A 3JYQA 2Z5VA 1ESEA 4RS4A 2H4WA 1NKVA 2YVSA 2BEFA 5IFLA 4P3PA 3CDBA 3ETCA 1IONA 3E9DA 3EGIA 1XTGB 1UP7A 1PAUB 2WJ3A 4RJJA 3PSHA 1FFCA 3OCCA 4B4DA 2VB6A 1Q11A 1IN7A 1JKJB 5JDIC 1AO0A 5HIAA 2R8IA 1BVRA 3TZKA 2ONCA 4GPZA 3CZMA 4XUGB 2C1EA 2KJWA 1QRRA 1AVTA 4WLNA 2HHHB 1JLBB 2MKHA 3EEIA 2W2LD 1FDWA 4WUTA 4A91A 2M5AA 3N4XA 1FRLA 1T9ZA 3OQ2A 2XY7A 4BQEA 3I1YA 3ZTYA 1DJQA 2QB5A 4MFBA 1DRVA 2QPOA 1OT5A 4CO1A 3OQ1A 4XX0A 1ZR4A 4OU4A 5IKEA 4YAWA 2EX0A 4QWWA 1KMIY 4TXNA 4UU1A 3UJ3X 1R3UA 4TV8F 3U3XA 2B83A 3AFOA 5JZ9A 3LDUA 2OFPA 1RTKA 1N6OA 2VHYA 4W5NA 2ZSIA 4HDGA 4Z2YA 1UXIA 3NFYA 2X5OA 3EIXA 3EVTA 2KJQA 3KK2B 1H5UA 1VHFA 4TUYA 2JLFA 3CR8A 1X5SA 1H0KA 1N6RA 2RONA 2JFUA 4P5PA 5LN1A 1BD3A 1I2AA 2ODPA 1PJ4A 2DG2A 1XAHA 4NRUA 3JWHA 3RUIA 4PHFA 5AWFC 2P8IA 3AZOA 1KMHA 3D2LA 4JL5A 4EHJA 3TGUG 3QEBZ 2W2MA 4KO8A 5ENVA 4ZQGA 2HBRA 2NPIA 2VBIA 3CCQS 3INGA 5HJ2A 3BB3A 3OLXA 2APOA 2B82A 5DLGA 3AKCA 5A9RA 4KN6A 2BJEA 5DN9A 1I14A 4JI7F 1UWAA 4PLWA 1J8FA 2DHAA 1C0IA 1DBDA 3DCAA 3DEKA 2QW1A 3WG9A 2PL3A 1CHDA 2P1ZA 4ETMA 3Q1MA 2KE5A 3SICE 3ZDQA 4RU1A 1EWVA 5HILA 4FFOA 4LSNA 4IWYA 2FFDA 2V7TA 4WXHA 3BS4A 3PRVA 1NTZJ 1TUVA 5HBRA 4ZOSA 1ECFA 1G8HA 4JCCA 5F2EA 3RYTC 2DHGA 5KTYA 1N5LA 5DLYA 3OJ0A 1VF5D 1U25A 3EIUA 3LLMA 4K7JA 4ZAZA 3JD2A 4NOHA 4KDEA 2KB0A 3C4QA 4HTFB 3KUHA 4LVNP 1V95A 4B3OA 4GX5A 4G4GA 5H9WA 4Q12A 5EZYA 5JPDA 1WACA 3ODGA 4MJ3A 1KMCA 4KO1S 2KZZA 5KHLB 4OP1A 1PFYA 1PYOA 3PJWA 3VC1A 4QREA 4IOIH 2LQJA 3HA7A 4KRXA 3J7YU 2EWMA 1S10A 1XCLA 1XZFA 4TQAA 5MN4A 4ALKA 3M8YA 4JDUA 4MYCA 3SVZA 2D3WA 3H75A 3OF5A 4KVGA 4URQU 1HE8B 5BN3B 3ITHA 2XA9A 2U1AA 1UJCA 4OQDA 4M8IA 1G6HA 3LUHA 4Z7JA 4YDSA 1YDHA 4Q4HB 2JJ4D 4U5XA 4HWTA 1L3BA 4AFFA 5C4GB 4M1QA 3LL4A 1DC4A 2KSEA 3SEOA 2ORVA 5EPOA 2NRGA 2WZDA 3I01A 2I9KA 5HN0A 2WA2A 2W4PA 2ZSEA 1G7RA 4OJMX 5B7GA 1RYHA 1BMQB 3IVMA 5DYIA 2OL4A 3UATA 4A8SA 1JVSA 3VZDA 1KEWA 4ZIRA 4RK6A 4WV3A 3PR2B 1MVNA 1L0LE 4JBCA 3RUDA 4QUHA 4GO7X 2EQ5A 3GGPA 2C2MB 4RETA 2FX3A 1KO8A 4A6PA 4RTRA 2IYLD 5EGYA 2QYOA 1S4MA 5B3LA 1ZBDA 1LJ8A 2X3YA 3KPEA 2WYUA 2IC3A 1JNRB 3QXCA 1ZJWA 2H89C 2HAFA 4N78D 4K28A 2AN5A 1QBGA 1EGMB 4NMLA 4YHBA 5BR8B 3LVQE 1YK9A 1G1JA 5E2BA 4XW2A 2ZM6B 2VFSA 1V3QE 4MCAA 2G9VA 3QQPA 4QDOA 2DFPA 4M1WA 1XCGB 2VG6B 3FSRA 5KOWA 1YS7A 3EIQA 3K72B 4GPD1 4KPUB 1U0HA 1BZYA 1T3JA 4DWJA 4NZ0A 1KI7A 1X94A 3DO8A 3GQVA 4PHTA 1NQVA 2DCUB 1OZGA 3CLVA 4OM7A 5BR8J 1I6LA 2ZM6J 3KVOA 1FTRA 3NBKA 3ZDRA 2LVBA 5IJWA 2FHOB 1GLVA 2F67A 1QTNA 3K20A 2DTXA 1FBNA 4LYYA 3GYXB 4DA8A 2C7VA 5DRYA 4G01B 2BFNA 2JAHA 3KUKA 3PNQA 1JA9A 3J7AC 5G1OA 4MDEA 3AERA 1C3JA 3T54A 3KZKA 4ZGGA 3M8SA 3EZXA 1NL3A 4IIJA 4JLPA 3RD5A 4GECA 4CLSA 2XZWA 1UETA 5EQFA 3H7HB 4F3KA 3PF8A 3UMVA 5ALLA 1JQ3A 2IRUA 1ZD5A 1QAOA 2HG5D 3REGA 3RF7A 4ETZA 2F3UA 3OX3A 2PRZA 1PHRA 3GJ3A 4JDPA 3JC22 4LR9A 3OFJA 2Z95A 2ZJOA 1ADCA 4KBYA 5H2FE 1ZHOA 4X8HA 3RUEA 4IS2A 1EFTA 3GD5A 3TW4A 1HNNA 3H32A 4CEIA 4MVXA 1VJWA 4BKRA 3EWAA 1CQPA 1ODTC 1O5IA 3KK3A 5KLIB 2BJ3A 2M1ZA 4USHA 3JZAA 3UK6A 3CMCO 1JT2A 4A8HA 4AZ0A 4F4JA 3WA7A 2KHDA 4E32A 2ZT9D 5FWNA 2FK7A 4DV6B 3I1FA 3UYKA 2BM9A 1UPXA 1S7IA 2RMLA 5D86A 2ZAGA 3C45A 2MCFA 2B4RO 2Q6OA 3D1VA 3Q5SA 2OPSB 2Q29A 4RLSA 4HGOA 2XSZA 3C2QA 2LD4A 2FRDC 3D28A 1HR0B 4QQBA 3L4FA 3PA8A 1T3HA 3MS4A 3HBAA 4Q9IA 4DV6J 1G21B 3UJNA 2DR0A 4RA6A 4KREA 4I64A 4BV9A 3JXEA 1GGHA 3QRRA 2FB0A 1YMQA 1RKUA 2BMBA 1TW2A 1RDFA 4UM9D 2BFDB 3RFVA 2DGWA 1HR0J 4Z86A 2RG1A 1U9CA 4LPSA 1CC1S 4E46A 2GCNA 3K92A 1FXSA 4AX4A 5AFSA 4LJAA 3AI1A 1U7UA 4LGCA 2CDNA 3GNSA 3M9XA 5AE1A 4ITSA 4JQOA 4HGQA 1RM3A 3IALA 2CXNA 3PG9A 1JB9A 5TPZA 5LD2C 2GPWA 3I9MA 4YJ3B 2O0JA 4R9NA 1GSAA 3C3JA 4JV5J 1AKRA 3AFMA 4YCNA 1LEOA 1N8RT 4HRVA 4BNKA 1W76A 4R51A 1T9TA 2CMDA 3PW7A 3TI7A 4YT8A 2Q5FA 1VQ9S 3JW8A 4R1MA 4D9NA 1AUXA 2OELA 3OR1A 4DKJA 3EGVA 1MMLA 4JBIA 4RJLA 3JRXA 1Z37A 3VQTA 1RF1A 2D59A 3G2HA 4I55B 1AUQA 4C2TA 4M1SA 4BGIA 4I4BA 2ISCA 4H13B 4IL6X 5IXJA 3AUFA 2ZITA 3MMAA 4ND8B 2ZH9A 7AT1B 4MKVA 4C11B 4L5BA 1AMNA 2VYFA 4RWZA 5LUAA 2DNNA 3KKMA 2A3NA 2BE9B 4QDJA 1YRHA 1I7SB 5LZ4A 2XHWA 1M6WA 3NOQA 1UAGA 3PJ9A 1CCWA 1CJSA 2D62A 2RH8A 3IQIX 2W27A 5B3AA 1RCXB 3MCZA 2QR5A 1IH8A 3N8GA 3N2YA 5K14B 5B30A 1ZI8A 4ID3A 4HH2A 5ER9A 1GDDA 2DT8A 3DDNA 3BH6A 3GJ5A 1ADJA 2EC5A 1FZAA 3G2JA 1TM7E 1OIVA 2WYOA 1GRRA 5TMBA 4IIGA 1BWQA 1VRUB 3H1JJ 2DB3A 2FJXA 4C87A 1Z2LA 3WGKA 3SXUB 1W4RA 4E5UA 4DHEA 3MWYW 5LA6A 2GEJA 5GADI 4BYGA 1NVEA 2CUTA 3PNSA 3SYZA 2O01N 3AVTA 2AUNA 1QGKB 2E76B 2BKXA 4ZYWA 3RARA 4CUJA 3NCTA 2XYRA 3FBWA 4IGEA 4F3QA 1YH3A 2XSJA 1EK6A 2G36A 4BRYB 4NU8X 3D6HB 3I4FA 5KFBA 1R50A 4IOLA 4ZYXA 2W2NP 4JN6B 1U8XX 4DX5A 1XZDA 2DKNA 5H9FK 2FEOA 4KQXA 1ZJJA 3K0JA 1NF3A 2INGX 1YASA 3A28A 4NYJQ 2FGCA 1CVLA 2JGMA 3I5XA 4YT2A 1GK4A 1O94C 4B1FA 2XNDD 1YS1X 4PC7A 4QFBA 3RVLA 3A12A 5DGTA 2AC4A 4LHYA 4NL5A 2Z1DA 2P78A 2PLNA 3GRKA 1N7SD 2IJGX 4E5NA 2C3PA 5I6DA 1JLGA 3S28A 4D8WA 2XUGA 1QK3A 3QO9A 5D3KA 3ZD8A 4KR0A 4BJHB 4DC1A 1NWQA 2IP4A 3C7AA 2HFKA 1JXQA 5CX1A 3OQIA 4MUFA 3IQDB 2F65A 2WABA 3RR8A 1SQVJ 1N2SA 3KYDA 1HWKA 1KFMA 5BSUA 4Y9SA 4ZO6A 2IX3A 4JI1B 4TYNA 1SJQA 1SUQB 1SGWA 3PEHA 3GFTA 2O2IA 2GJKA 2MGZA 4NEQA 2AFHE 3F2IA 3HD7B 3GR1A 5BYJA 4DM4A 1CEEA 1SC4B 2HIGA 4H0FA 2Z1MA 5AVZB 4HEA1 4JI1J 3KR1A 1ZKDA 5CAEB 2AN4A 3QVOA 4KRGA 4BNGA 4HWRA 2P2ZA 1U3DA 2KN4A 4MWGA 4L0DA 3JARA 2E7ZA 1Q14A 1RWVA 1HBUB 1XQYA 5KQGA 2OPHA 1OKKA 4PIMA 2Q5LA 1MP0A 1Y8ZA 3FVVA 1SOUA 1Z0JA 5BSRA 4CT4B 3USSA 1TD1A 1XNRJ 5BYKA 2OXTA 3CWBE 2ZH3A 1GHTA 4P52A 2Y0BA 3ANNA 4QBFA 4B76A 2VP9A 3DQPA 1LRJA 5CG1A 4CF6A 3TVYA 2G9QA 1GTMA 3STWA 2BACA 4J9SA 2IV3A 5IT4A 3CO9A 1IZ7A 4UZEA 1U1QA 2R00C 1TYDE 3WHKA 3N28A 5JDCA 3CZAA 4J91A 4YMHA 4QU7A 3ANLA 5CK4A 2BRLA 5AI8A 4K6FA 1FE4A 1C9KA 1CUZA 2A9QA 2TMDA 2Q21A 4D25A 3HT0A 4OBBA 4UVDA 3SE7A 1FFBA 2VHEA 1NX9A 1T8RA 3QSGA 1KAHA 3RB3A 1ZGAA 2HRZA 3UUFA 2IPMA 3RL0C 4XCXA 3M9NB 2ZH2A 1J5OA 2FUKA 5HL7Q 2A1IA 3I55S 1H94A 1U8YA 4MB0A 4PPYA 4UBKA 5DHPA 1G5IA 4PZYA 7ABPA 4QOFA 1Q0PA 3HR4A 4B6QA 2P58A 3M4NA 2EBHX 4IUFA 3JYTB 2VHGA 3DDUA 3AEQB 4HI0E 1YSJA 4G5HA 1QZXA 4C04A 1VBYA 4X1YB 3ZNUA 2MKKA 4LPKA 3HVRA 3MMNA 4QUEA 4O6VA 4Q8FA 2HQIA 3R6TA 4BY9E 5BW4A 1U6FA 4RLFA 2V8VA 4O2BB 4XX1A 1ZD1A 2BJ9A 1G5QA 3GFYA 3DP9A 3G7UA 1B93A 3G0GA 4A8YA 1ZOTA 4A4DA 1OSDA 4JXZA 2RS2A 3PKMA 2ADBA 3IB3A 1OUMA 1WCIA 3VZIA 2NPSC 2XMTA 3FGOA 1YVRA 1G4UR 2E5WA 4YECA 2Z56B 4EUKA 4QW9A 2Z2MA 1Q5YA 4FYYB 4Z4QA 2FOIA 3USCS 4QOEA 2V7UA 2ZVOB 3JATA 3Q9LA 1C7FA 2O8DB 2V8HA 2GM9A 1V25A 4BXLA 4LF4J 2PGLA 4IFBA 4HAOA 4WYLA 1SH3A 2Q3BA 3LX6A 4ZP1A 3IXQA 3INRA 5HOQA 3F7NA 1JSZA 3G96A 1IUPA 4P3KA 1NN3A 3C4VA 4DR1B 1JE1A 3GDOA 4WZMA 2NGRA 3TFWA 3HXLA 1G8FA 2QFIA 2FSIA 2O67A 5E3JA 5GADl 2X6RA 3F9RA 4JI8F 4IDAA 5HFNA 3CYFA 2RQ4A 2YXEA 2N1BA 4AKSA 2H07A 2N3LA 1J0BA 1AFIA 3FNFA 3N2EA 4QGHA 3T6JA 3AEUB 2GVDB 3Q7RA 4OYMA 2P62A 2DCMA 3LP5A 3G79A 2D0OB 4N8SA 2PNJA 2ZYVX 1DLOA 2IU4A 4KXUA 8AT1B 4RIFA 4GU5A 3C43A 5LQAA 2JJLA 2CQPA 3HCXA 4OXQA 2JOQA 3FCUB 3I55P 1BS2A 2WSFJ 3RK3B 3G6WA 1XA0A 2BQRA 2HFZA 1RGVA 4TQGA 3RUHA 3A1CA 4CH1A 3I9NA 4P32A 4KACA 3HPQA 3MOZA 4N56A 4HGRA 4QM6A 3K70C 3P9QA 1ZIXA 1DJNA 3HUSB 3MPYA 1V5IA 1XT6A 1SVUA 4GZLA 4LSMA 2ZR0A 3OW2R 4OGQD 3L4EA 2Q1YA 1YA4A 2OC9A 1OGYA 3ZKAA 2BEJA 3HCCA 1VC0A 2C2GA 3CSKA 5HHTA 2IBZI 1VQ7P 4UTRA 2VDVE 1M33A 4KQMA 3RAGA 4YUAA 4M5NA 1C0TA 2B35A 1Q4RA 3HWRA 4OJYA 3UA4A 2ZEJA 4Y2QA 2O2SA 2DWQA 4GPIB 4P3OA 3TEFA 2QYHA 1RI1A 3R5SA 1ORTA 1GZ7A 1N5SA 4GBGA 2WJPA 3MD9A 2V0CA 1KORA 2B51A 1FUEA 3GA7A 1KQNA 3TJMA 1F8UA 4CLOA 2FW1A 4E14A 1URQA 2A9KA 3A8TA 3KXIA 1V11A 4QQNA 1UFKA 5DZSA 4LDPA 1TK0A 3E9EA 4TSRA 4XJVA 1V8OA 3OCVA 2O2ZA 4L3KA 4E5KA 4LRTB 2FVPA 4BAUA 1QLNA 5KNDH 1I3LA 5EX0A 3VYWA 1N5TA 1A7UA 1L6IA 2HCFA 4D6TE 3I9FA 2PGIA 2CNKA 1XJQA 1YR8A 2JO1A 4N3NA 5DLEA 4LHZA 1RAEB 1M5SA 3HYNA 5JD5A 2W90A 4UOEA 4J0FA 4P0QB 4KHPF 1DUVG 5HTKA 4KPUA 1WXEA 2ZJSE 1XVTA 3VMMA 1NVUQ 2CK3D 3TD9A 3IQEA 4LZNA 1A7KA 3GCWP 4B3MF 3MT9A 5KHAA 5CD1A 1ML3A 4NMWA 3T0FA 2CFTA 3ADCA 2RJNA 1T36B 1S5LH 5TS2A 2APJA 3TSWA 2GZOA 3HVTA 4M5MA 3AM4A 1NJIT 3T41A 1NJXA 5HYVA 3N05A 3DULA 2XBMA 1XR3A 2C2BA 1UDBA 1XZAA 4MYHA 1KO1A 1UANA 3M1IA 2BGUA 3LIPA 1O51A 1AXRA 3HGTA 1L0LJ 2GYUA 1H1LB 2L9DA 2B20A 3KHTA 2ZWVA 4BLWA 4MO9A 2G1DA 3LP6A 2QJKB 1CUGA 2GUVA 5AVYB 3NLCA 2LV8A 4E08A 2WMOB 1IB0A 4GPBA 4GLJA 4E1AA 3D8UA 2ACMA 4KWCA 1RTHA 4URVR 3OFEA 3OQNA 1CUFA 4U2CA 1SV5B 1RZVA 1NJ2A 3TQTA 4YRQA 1X1AA 2FUG9 4OXNA 2CDRA 2IIPA 3GJQA 3CJ8A 2P4SA 4UOCA 2A67A 4C0OC 2EZ9A 3KEFA 2QTAA 5D7NA 4FEYA 1X3LA 2AN1A 3DRPB 3VV2A 1K0FA 3ESCA 2LBPA 2QWXA 2NO9A 3RU2A 1OFUX 2XCOA 4AN0A 3G02A 3E5HA 2B9XA 1UEVA 1A8HA 4DRXB 4R1SA 2IWRA 2I5JB 3R8FA 1QEXA 1WSDA 3EA5A 1N48A 1VRCA 4IYRA 4LTDA 4QDKA 1ZIPA 3W2IA 2XCRB 1SH7A 4BFXA 1AA1B 2G77B 5DM6Q 4B4VA 4R5MA 1SB9A 2EERA 1HDCA 2CNOB 1QIGA 1E5WA 2CJKA 2FG6C 1QIHA 3QA9A 1NMYA 3V6IA 4KE8A 3BASA 4B71A 3R3VA 5JQWA 1DTTB 4MYTA 1L3UA 2EGUA 3M1LA 1I4DD 2GZ3A 3N3AC 4H4MB 3R7NA 3BPDA 3HYSA 1AOXA 1TM1E 3GX1A 4TM7A 1E5DA 4YUDA 3SC2B 2RGUA 4QG7A 1UZLA 3JXOA 4XWYA 3ZCQA 4YRAA 1QVRA 1PUXA 4C7OB 2YH0A 3OZEA 1YI2S 1HD0A 5CX4A 1NPPA 1XLWA 1PN3A 2I7XA 3IHKA 4K9NA 1VLYA 1Y8QB 4IGKA 5CDGA 1VXOA 4FVMA 1ICIA 1Y6QA 1ULTA 3HD1A 3AU9A 5KNBA 4JLOA 2VK1A 5AMXA 4NPAA 1GZ5A 3ZWYA 5LDGA 3WK6A 1L5GB 1FMJA 2HQSA 1FSPA 1M2FA 3QLVC 3UNGC 4TSFA 2WPDA 1Z28A 1Y7LA 3ZNQA 4MV0A 2XS5A 1YRWA 4FSXA 1RBZA 5TS3A 1P9RA 4HDNA 1LW2B 5AM3A 1U1DA 3QKRA 4OYIA 2XWYA 2PT9A 2FPSA 1L4HA 3TNYA 1RFLA 4F4IA 3HHNB 5TIIA 2QN3A 2EHDA 4FYXB 5DHSA 3EZ2A 3PYDA 4PINA 4YACA 2D41A 1YJAA 5C5IA 1R4AA 1GNRA 1I7PA 5SZHB 1BO6A 4GVBB 1CRQA 5M5BA 2ALJA 2CHEA 3UNXA 1RHJA 2IY7A 5WRFA 4MKFA 1N8NA 2PZJA 3IHWA 4MRNA 1PZGA 4OHMA 2ITAA 3QIPA 4NLUA 3JYPA 2IUYA 3VO9A 1YVPA 4M8KA 4Y2HA 1IUJA 1VHLA 3V00A 3RAEC 4DDMA 5LP6A 3I6ZA 4CV3A 5KJ1A 4DIKA 3SKYA 2H5JB 5AHOA