2AEFA

Crystal structures of the mthk rck domain in ca2+ bound form
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
224
structure length
221
Chain Sequence
RHVVICGWSESTLECLRELRGSEVFVLAEDENVRKKVLRSGANFVHGDPTRVSDLEKANVRGARAVIVDLESDSETIHCILGIRKIDESVRIIAEAERYENIEQLRMAGADQVISPFVISGRLMSRSIDDGYEAMFVQDVLATRRMVEVPIPEGSKLEGVSVLDADIHDVTGVIIIGVGRGDELIIDPPRDYSFRAGDIILGIGKPEEIERLKNYISALVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-gated potassium channel mthK
publication title Structures of the MthK RCK Domain and the Effect of Ca2+ on Gating Ring Stability
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Metal transport, membrane protein
total genus 73
structure length 221
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02080 TrkA_C TrkA-C domain
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.870 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Voltage-gated potassium channel 2aefA02
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2aefA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2aefA01
4NG5A 3BHIA 4E21A 4I9HA 3DOCA 2W2KB 2B36A 3LT2A 4OYRA 3EZYA 3ZGYA 3PZRA 2B37A 3G49A 3O03A 3IKTA 2P9GA 3GPIA 3KOUA 5KJ6A 3IJRA 2AEJA 1I0ZA 1QYVA 3RUDA 4TKMA 4E31A 4D0RA 1VSUA 5IXSA 3EC7A 1X7DA 5EQDA 1Y8QB 5L9AA 5EPOA 3KEOA 4WOJA 3IAHA 4XRGA 4WE3A 4A0SA 1A9YA 4NPCA 4B4OA 1NVTA 4B3JA 2C7VA 2WSBA 2DLDA 3RQSA 1LLDA 5U1PA 4BNGA 1D4FA 1ZK2A 4MO2A 3EK2A 3ROQA 4L9RA 4C4OA 4XJSA 2W4QA 2DKNA 1Y9EA 2O3RA 3A9WA 4RF4A 3T4XA 1Y8QA 2GUGA 1UR5A 2Y0DA 2BELA 1FDWA 4OGWA 1L7EA 2ZYDA 4CL8A 1WLYA 1ZMOA 4IDDA 5G0UA 1JWBB 1T26A 1N9GA 3U49A 1LI4A 1DHTA 5ES3A 5TJ9A 1HF3A 3ZWVA 3GT0A 4IS3A 1OI7A 4ZRNA 1XCBA 2JCXA 1W6UA 4YYZA 4FFNA 2J5RA 5BSFA 1YB5A 1YDEA 1G1AA 1AXEA 2WTBA 3RWBA 4NZ9A 4R16A 2HMUA 3MEQA 1FK8A 2NVBA 1VE9A 1U7TA 4D0SA 3BMQB 1NYTA 4II2A 4FOSA 4CMHA 3UHAA 1LLQA 4NIMA 3ROPA 1S7CA 4IJVA 1Z75A 5CG2A 3BMNB 2D2IA 3D4PA 1N7HA 1SC6A 1TT5B 3GPDG 4FPXA 1C0IA 2I6TA 4DGSA 4DXHA 4RVFA 3TDKA 2EG9A 4XQ9A 1QLJA 5CDSA 3DMYA 2LDBA 3NGLA 3AFNA 1NASA 4QECA 5J23A 3BMQA 3FSRA 3QQPA 3S1LA 1T24A 1U8XX 1ZJZA 2WD7B 4YR9A 1VJ1A 1U2DA 1A9ZA 1PL8A 3BMNA 1X0XA 1TT5A 4RVSA 1JQBA 5TT1A 3WSVA 4PLFA 1LC0A 4OO3A 4D3FA 1M67A 2RAFA 1PGNA 3DFZA 4J1TA 1MLDA 4CV2A 2J3KA 3OJEA 1O5IA 1YB1A 2C2XA 2PGJA 4CQLB 4WOKA 3U4HA 1NHWA 7ADHA 4EZBA 3CE6A 2Y1OA 1UP7A 3KSZO 1RM0A 4GMGA 5L7YA 4OQYA 4CQMA 4PIVA 1RM5A 2XOXA 2NV6A 1O8CA 1B2LA 2I5PO 2WDZA 4A5OA 5JAIA 4ZN6A 5A06A 4R41A 2X5OA 4PG7A 3U3XA 5K9ZA 4LCEA 2A35A 3OH8A 3ZWMA 2FN7A 1MFZA 4IDGA 4D43A 3DB2A 2RBEA 3V2GA 4WKGA 3GHYA 1NAIA 4HXYA 2H63A 5A1TA 3D5QA 3HHPA 3Q2KA 1VLLA 3ANNA 4Q3EA 1E6UA 3BTUA 5FI3A 3I1JA 4J7CA 3L4BC 4NFHA 3AY7A 4J7XA 1Y7TA 1EE2A 4JJGA 3CZRA 4DLBA 4RO0A 3RBZA 3K31A 3C1AA 3ZHBA 1PJTA 5F5NA 1N1GA 3UF0A 1IPFA 1AXGA 3D4NA 2E37A 2DBRA 2RHCA 1UAYA 3U4DA 4S1VA 4EDFA 5JFOA 2Y0CA 1KEVA 3GZNA 4BGVA 4OKNA 5B37A 2X5KO 2X9GA 4BVAA 1GFSA 3DAFA 4UVEA 2HSDA 5A3VA 3ULKA 4DQXA 3H3FA 5L7WA 3DONA 4DUPA 2HRBA 4WCDA 2DPHA 4GVXA 4W7IA 4BIIA 4CMEC 3RUEA 3ZU4A 5ER9A 3ZI0A 4RVUA 3ENKA 3OF2A 5I7VA 3BA1A 3ZWNA 1HWYA 3R1IA 2X7HA 1Q0LA 2Y68A 2ZK7A 4CV3A 1NWCA 1WPQA 1GUZA 1E1NA 4Y9DA 3PLNA 2NACA 2D3TA 4GGOA 2BGMA 1IOLA 1PSDA 2V6GA 3RFXA 2CDBA 5HS6A 5ITWA 4D42A 5DP2A 3RASA 5A03A 1PJCA 3PLRA 5A9TA 2ZATA 4EUHA 2VYVD 2F1KA 3GVXA 3ROMA 3A4VA 5BNIA 3T4EA 3L6EA 3ASVA 4MDHA 2Y93A 1NFRA 5I8WA 4DMMA 2CVQA 3D5TA 2GO1A 2E49A 5BR7A 3B1JA 5ENDA 4WUVA 3UOGA 4I5FA 3ENNA 4K6CA 2ZCVA 4AJ1A 3DQPA 2YQ4A 1E0DA 4PN3A 3NX4A 1K5HA 3HSKA 1O6ZA 4IMPA 3WGTA 8LDHA 3F3SA 3WQRA 3ZWPA 3L77A 3SJUA 3PVZA 2DFVA 3INTA 2YDXA 1HDXA 2VUUA 4NMHA 2UAGA 3JD1A 3OFSA 4JXKA 5LDHA 1H2BA 4Z9YA 1EVIA 1YS4A 2JL1A 5IDQA 1UDAA 4A03A 1GQYA 1PJQA 3VPFA 4R68A 4D44A 1DFIA 2GN6A 3SEFA 1WP4A 1HETA 1E3SA 3VC7A 4KUHA 3IQDB 2FR8A 3KVOA 4XTTA 4YAEA 1T2DA 4A27A 1T4BA 4I1IA 1JVBA 3E5MA 4UAGA 3IUSA 4RPKA 4ALLA 2ZB4A 4ZGWA 1V8BA 4KZPA 5C7IO 1JKFA 1HT0A 1SOWA 3L4BA 1YKFA 3NT4A 3WJAA 4FC7A 1YGYA 2BFOA 4INAA 3FTPA 1UZNA 3VPSA 3RSHA 3NUGA 7MDHA 2HK8A 4BNJA 1OC2A 2D0IA 1O89A 1GTMA 1HLDA 1HZJA 3E48A 1HE4A 5FI5A 3LC2O 2AW5A 2Q50A 1PTJA 1DC3A 2BKPA 1K3TA 1PS0A 3BAZA 2QZ9A 3TZHA 2NM0A 1QV7A 4MP3A 4BV9A 4RVHA 1Y1PA 5CPFA 1NX6A 1ZSVA 5JYEA 5H83A 3OM9A 1C0LA 3ADOA 2IDZA 4PLYA 2C5EA 2HMSA 3M1AA 1GQ2A 2OZPA 2Q2VA 3A14A 3CIFA 3JD0A 5ILGA 4H15A 4CMEA 4BNWA 4P8RA 4HP8A 4YJDA 1IYZA 2NTJA 1GEGA 1LSUA 4D45A 3QVWA 2P68A 5TSDA 2QZZA 1M6WA 2DU8A 3QWHA 4QSMA 4BL5A 3WTBA 1B0AA 3NGXA 1I8TA 3PTZA 2ZYAA 2VRCD 5TRTA 4GX2A 3CSDA 1ENYA 3GNSA 3R0IA 4RV9A 2D59A 5AXDA 1LLCA 3WNVA 3DAPA 4DWVA 2Q4BA 4CLRB 4AJOA 4IIUA 2ZTVA 3FBGA 1T2EA 4I9NA 3MJTA 4M89A 3TL2A 1WZEA 1SEPA 2W8ZA 2X4GA 3DZBA 4MVJD 2WE7A 3WG9A 3FCOA 1MX3A 2OL4A 1QYDA 2QW8A 2AQIA 4O5OA 3TZ6A 3W6ZA 3OETA 1LDYA 3H5NA 3HADA 3UGKA 2GERA 4QO8A 3GNQA 2C5AA 1EUZA 2WWRA 2FOIA 1VL6A 1DHRA 2CVOA 4CLRA 1LQUA 2JAHA 5TS3A 3WNQA 4E5MA 2VNSA 4F6LA 5AVOA 1PWXA 5GY7A 3H5AA 2HKIA 5IN5A 1WMBA 1ID1A 4S3MA 1MB4A 2FRDA 4YDRA 5KJEA 4CL3A 3WTCA 5TNXA 3GLQA 2IXBA 2FZWA 2J8ZA 4PRLA 2DBZA 4YAKA 3TPCA 2J3HA 1ZMTA 1U8FO 4J3FA 2QG4A 4NFSA 3PHIA 3NV9A 5TJHA 4XQCA 1PR3A 3I4CA 2BF7A 4UVGA 1H6DA 2WE8A 1BSVA 1U9JA 5HBRA 2CVZA 4BKQA 5I7FA 4OJNA 4DQUA 1YJQA 3I4FA 2X86A 4PLZA 4GAEA 3EDMA 2Z1NA 2GZ2A 1VC2A 2GR9A 2Y1GA 3K6JA 4JP3A 5TT0A 1H9AA 3OJOA 3ITDA 4O59O 2JAPA 2SCUA 5EMHA 3GAZA 2QQ5A 3JYNA 3JD3A 1LBEA 3PPIA 4RDIA 3RROA 3B6ZA 1DPGA 1GUFA 1M2WA 5IF3A 4BGIA 1RWBA 1E7WA 4CMGA 2ILTA 4CR7A 1R4NB 4CM4B 3GVPA 4Y67A 3G1UA 4M49A 2EW8A 2NVWA 4EJ0A 3H8VA 4EUEA 4U6SA 1RJWA 3HZZA 4B8ZA 3COSA 2FHSA 4L74A 2EV9A 3NAQA 4BNUA 2CFCA 3C7CB 3GC6A 3HB4X 4PLCA 4E6PA 1I24A 5C3MA 4ND1A 1DRWA 3SVTA 1R4NA 4PLHA 3KEQA 4RCVA 1EBFA 1QORA 3HN7A 1SCUA 1UDCA 4NI5A 5GZ6A 1GEEA 1FXSA 5T8KC 4TVBA 4R1TA 3VH3A 3B1KA 4GLLA 4DQVA 4FIZA 4E12A 1BMDA 1IHYA 4Z3KA 4B7CA 1PJ2A 2JCYA 1DFHA 4RZHA 2HU2A 4YPOA 3CINA 5ICMA 1HTBA 3VPGA 2ZTLA 3FF4A 4CM8B 3ON5A 3FPLA 1D1SA 5U4QA 4YRBA 4XWYA 5IZCC 4TVOA 2C2YA 2YW9A 3LVFO 4IDBA 3RFVA 4J1QA 1R4MB 4GGPA 2Y99A 5COQA 4BNNA 4RF5A 2OO5A 1WNTA 3PJDA 3INGA 3AY3A 4CM8A 3O9ZA 1KY5A 4LRSB 3PHLA 3U4IA 5DOZA 5KOIA 1ZXLA 3W8DA 1E3EA 3FNFA 3ONDA 1R4MA 1KS9A 2I3GA 4ID9A 3Q1LA 4KP7A 4J49A 4LVUA 1AN9A 2PKQP 4DRYA 4MKZA 1IHXA 1SMKA 2PLAA 4J9UE 3VAZA 4TRJA 4CODB 1E3LA 1DC6A 3HNPA 3H9QA 3BTOA 4GVLA 3OA0A 1GYRA 4OKIA 1IZ0A 2JJYA 1GYPA 3D7LA 5C7LO 4R1NA 1BDBA 5F1KA 4ZA2A 5TF4A 3DWFA 1HKUA 3HDJA 4N7RA 2GN4A 4Q3BA 2W2LD 1QRRA 2BRUA 5CFZA 3HE3A 4YACA 2V6MA 2X0RA 5KWEA 3VVBA 1IZ9A 1O9BA 3MOIA 2UYYA 1CEQA 1R15A 4TROA 4WJZA 4BHTA 5F3RA 2AG5A 1HDRA 4B3HA 1HE3A 4K1LA 4UEJA 3PIIA 2IYOA 2NVUB 1KIFA 3GEDA 4DVJA 5B1YA 3LSYA 4TRRA 5I7EA 4MP8A 1D3AA 2EGGA 2X8LA 4YEDA 1LSSA 4BKUA 2R2GA 4RL6A 5IDYA 2DPGA 5ITVA 5IJZA 4PVDA 1Q0QA 4TKLA 3MJ4A 2QYTA 4G2NA 2NVUA 4L4SA 1KETA 1Y8RA 3WX0A 3F9IA 5H81A 1H6AA 3GA0A 4R69A 4ESOA 4FB5A 3DMTC 3HN2A 2WM3A 3PQEA 4HFMA 3WBBA 3DBRB 3OIDA 1JVSA 3G0OA 3LT4A 1CQJA 3TZKA 4IBOA 2O2SA 1QKIA 2XAAA 4BGEA 2BFMA 3WICA 2Q2QA 1HZZA 4HV4A 2YJZA 4XR9A 1H6BA 1XEAA 3VZPA 4L8VA 2ZTUA 5DBFA 3DBRA 4UUOA 3CKYA 3WGZA 5FEUA 3NT5A 2W90A 4C7JA 4CLEA 1MA0A 4EITA 4DIBA 4QO7A 1ZK0A 1GAEO 3AK4A 2XXJA 2CUKA 3AOEC 3WFIA 5IZCA 4GH5A 3DHNA 3PDUA 4BB6A 3DZHA 2FZEA 1WVGA 5T67A 1DDOA 1PR9A 1W4ZA 1R0KA 2AA3A 3DDNA 1J5PA 4YJGB 5DDIP 4LSWA 4BNXA 3HJAA 3DZGA 3EAGA 1ZO8A 2YHIB 4CMAA 1H6CA 2EWMA 3NEPX 3DBLB 3S2GA 2NU7A 3QSGA 3ZZNA 4DIFA 1W8DA 3FWNA 5G4KB 3PI7A 1ADFA 3ANLA 4YJGA 1ZEMA 2ZB3A 4A73A 3QWFA 4TZTA 3L6DA 2YHIA 3GDOA 5GZ3A 1PZGA 5MGBA 2V7PA 3R3JA 3KZVA 1PGPA 3DBLA 1AUPA 1X7GA 2EW2A 1NQOA 3I9KA 3Q2IA 4NH4A 4WGGA 1G0NA 1A72A 4M87A 3NJ4A 3HUDA 3W8FA 4GPD1 4BO6A 4BO7A 2VHXA 1M6HA 5TIIA 1EFKA 1OC4A 3MCVA 1GCUA 5JBIA 3LYLA 2Z5LA 3SXPA 3EYWA 3G3EA 3Q6IA 4LVCA 1E7QA 3DZIA 1YL5A 1JU9A 1UZMA 3ZV3A 1GUYA 2VYND 3GK3A 1O95A 1B8VA 4B7XA 4D46A 3AJRA 1A7AA 2HMTA 2J3JA 2PH5A 3RAJA 2O7QA 1CJCA 3L6OO 3CUKA 4P4NA 1MG5A 4ZRMA 4E4YA 3ADPA 4BOYA 4PG4A 2NQ8A 3ETGA 3VH4A 4N5MA 4ITUA 3DXFA 1C1DA 4GLOA 2FPGA 4JP2A 4R1UA 4Z6KA 4ND2A 4F45A 2HQ1A 3KLMX 3RJ9A 2B0JA 4CUKA 2NU6A 1TEHA 3MJVA 5C37A 4MVJF 1P33A 2VWGA 4N18A 2Q46A 3DMTA 3ZV6A 3STHA 5AXAA 4HY3A 4J4HA 1GY8A 1I3NA 4U6QA 2OXIA 1N9GB 2DVMA 4ALKA 3H6KA 4KQXA 4ILKA 4BS9A 1MP0A 2DM6A 1PJ3A 4WLOA 4Z0PA 1UXGA 4PLGA 1WMAA 2E6UX 3OEWA 2UUPA 3ZHZA 1A4UA 1SEVA 1XR3A 4UUPA 3SC4A 2X0JA 4QT0A 1P1RA 4OXKA 4W99A 2VHZA 2PTGA 1J6UA 4CJXA 2O3TA 3N7UA 2TMDA 3TQHA 3BXXA 1GV1A 2HMWA 5BSGA 4LCJA 1EQUA 1WXDA 3GMSA 1M76A 1UH5A 3C24A 3ZNNA 4YAJA 4PGFA 3TNLA 1NFFA 5KVSA 4AG3A 1KERA 1SPXA 3ONEA 2ZTMA 1V0JA 5GZ1A 4BKOA 2WYWA 5FWNA 2X58A 5B4VA 3U5TA 5IG2A 3OIGA 1DEHA 2X23A 3WJ7A 2IEBA 1KY4A 4IQ0A 1ORRA 1NFQA 4UEKA 3EVNA 3ZHXA 2R00A 4R3NA 1PQWA 2BHLA 1I2BA 2VWHA 4RGBA 1BRMA 3JQ9C 3QWIA 4KQWA 2VYVA 3KTDA 4NBUA 4AJPA 4B4UA 4WASA 1KEUA 3GVCA 5BNFA 4E2WA 3RUAA 4FJ2A 2VTDA 4RLHA 3T7EA 3AU9A 5KJ1A 5JXWA 1I2ZA 1I3MA 2VZ8A 2P4HX 3DFUA 1NPTO 3I83A 4JGBA 4L76A 4M1QA 4CM7A 4CQMB 2D8AA 4IINA 1IPEA 4BO2A 4E5PA 4OL9A 1BVUA 5AXCA 4G5HA 2PKQO 3LC7O 2V6FA 4P4LA 4W82A 3SX2A 1HE2A 2EGHA 3DEYX 4J16A 3ZU2A 1U4SA 3IIEA 4BO4A 3GDGA 3UFXA 1E6WA 1PQUA 1Z82A 2HK9A 3GDFA 3PYMA 5CP8A 5DOVA 1MUUA 2Y1EA 4JBHA 3TF5A 3E9MA 3MJEA 1FDVA 2Q1SA 1KC1A 4GMFA 1ARZA 3NKLA 3C8MA 1PGQA 3ZWOA 4XKJA 3HWRA 3UCXA 1QYCA 3X2FA 2A94A 4J1SA 4PLTA 4WPGA 1BW9B 3VH1A 3C1TA 3K9QO 3JQDA 4JJIA 4J4TA 5A04A 3BZUA 3LK7A 3E18A 4A2CA 1V9LA 4AJEA 2JD1A 3DHYA 1Z6ZA 2P91A 1GPDG 3AM4A 3WGIA 4U8GA 5KVCA 1ZK4A 2GYYA 1Q0HA 4IS2A 4MVJG 3PEFA 2X1HA 3IMFA 1BW9A 1YQDA 2VN8A 3M1LA 4NU5A 4TQGA 3SLGA 2DTDA 4XCVA 1YO6A 4ZD6A 4Y8VA 2A92A 1L7DA 1MXFA 3I9LA 3GHHA 3GZNB 1F06A 2NQTA 1ULSA 2OORA 1B14A 3I3OA 1ONNA 1TT7A 3OIFA 4R5MA 3AM5A 1C14A 1YWGO 5K6AC 1AHIA 4R5HA 1YL7A 4FW8A 4OAQA 1DIRA 4DL9A 4GL4A 4HNGA 1XYGA 1LRKA 3RC1A 3JD2A 3W1VA 3CH6A 2OBYA 1PJBA 1U5AA 3WWZA 4E0BA 4AJIA 2B5WA 3ZV5A 3AOGA 1NR1A 3PWSA 2X0IA 1ZVMA 3PYXA 3PDJA 1PX0A 1DSSG 4NFYA 4QEDA 5A3JA 1K6IA 5IDXA 1DAPA 2Q2WA 3ZWWA 3RUIA 1DIGA 3O4RA 4ZICA 1AHHA 1I32A 3JYOA 4W9NC 3OJLA 3CTMA 3V5NA 3JQBC 1X1TA 2VRCA 2OFPA 4H7PA 1EQ2A 2Y1DA 2YQ5A 1B8PA 4UREA 1MG0A 1Y6JA 5BT9A 3VZQA 4KOAA 4A26A 1CF2O 3JQ9A 4RJTA 4PZCA 3KLPX 4GSLA 2HAEA 1AE1A 1E6EA 2EKLA 3B70A 3GFGA 5F21A 5JO9A 3S55A 1U3VA 1K2WA 1OMOA 4MVJA 3RKUA 3R3SA 2J6IA 3D3WB 2EEZA 4HFNA 4B3IA 4DBVO 1X7HA 3V2HA 4IIVA 4AJHA 4D79A 1JW9B 4ONEA 4PZDA 4WK6A 4AICA 1M66A 4LRTB 3GH3A 3KYBA 2PWZA 3PQFA 1R12A 3QP9A 1DO8A 1M75A 3RUHA 4JNKA 1CERA 2OHXA 3D3WA 4KMSA 1H2HA 1LU9A 1XU7A 2NNLD 1XQ1A 5CDGA 1B3RA 5CEFA 2NUAA 2FMUA 1NXQA 4YJFA 4IJUA 3F1KA 4TWRA 5KVVA 4BNFA 1QG6A 3UH1A 3I6QA 1LDNA 1E3IA 3CEAA 1TI7A 1ZK1A 2FR1A 3PRJA 3AFMA 1GYQA 3PK0A 4BUCA 5HM8A 3FRJA 3GFBA 1RPNA 2O4UX 2EF1A 3L0DA 3H65A 1P1IA 3ICCA 3N58A 4XX0A 4WNIA 4IZHA 3VTFA 3RBVA 2RCYA 1WDKA 4W6ZA 1U3WA 3WB9A 2I3AA 2QHXA 3VHRA 3FR8A 1Q7GA 3OHSX 3U09A 4KWHA 5IAAA 4EEZA 2YZ7A 3RCBA 1KC3A 3Q0EA 4XB2A 4XQGA 3RC2A 4BNVA 1VPDA 4Q3DA 3CXRA 3NYWA 1GCOA 2GN9A 2PZLA 5JY6A 2GZ3A 2OP1A 5L51A 3C7DB 3JTMA 3U0BA 1ISMA 1E7SA 1HXHA 2O48X 3G79A 2UVDA 2RIRA 4BO8A 3BHJA 3V1YA 2Q49A 4A10A 2B5VA 5T5QA 1DC5A 2GF2A 1PJLA 3D4OA 2VTEA 5TQVA 3AM3A 4RDHA 3RKRA 5L4SA 4IXTA 3DZJA 4XYLA 2VHVA 4PLVA 5G0WA 3GR6A 4FFPA 2GN8A 3CPSA 2AQKA 1UP6A 2PZMA 1T1RA 4IDCA 4IM7A 1SBYA 4BMSA 1X0VA 4DPMA 4DA9A 4R3WA 3WGHA 4CMIB 3LDHA 3GEGA 4WCFC 5LDGA 2JCVA 4FCCA 4IQGA 4ZQHA 4FJ1A 4G81A 4W9NA 3AY6A 3QJ5A 3JQBA 1GQQA 1GU7A 3QVSA 1D1TA 1EE9A 4NR0A 5DCWA 3WQSB 4CMIA 4MVJI 2YV1A 4HKTA 2CF6A 4YBZA 3W4KA 5F1PA 4YS2A 4CM9D 1Z73A 1R6DA 5ADHA 3I9MA 4ZHSA 2EJWA 4HNHA 5I9LA 1YVEI 1OZAA 3INRA 1QMGA 1LSJA 2YFHA 4PRKA 2PD6A 2P4QA 4B8WA 1ISJA 4OQZA 3DOOA 1T2CA 1KYQA 4ZJUA 1X15A 2VT3A 4IPTA 3QV1A 3FNEA 1KVRA 2I99A 3GRKA 5JMPA 3UICA 3F5SA 3ONFA 2QRJA 4ZVVA 4WLVA 4DC0A 4QXMA 1MXHA 4YA6A 4R1SA 5IDWA 1P77A 2H9IA 4J4BA 4CUZA 4O6VA 1ULUA 3OICA 1J0XO 1JAXA 1DXYA 1U2GA 3Q11A 3GG2A 4MIOA 1JLLA 1JAYA 3KRTA 1HYHA 2E4AA 1UP4A 3KBOA 3B1FA 5JE8A 2HO5A 4BO5A 4JBGA 2I65A 5H82A 1U28A 3PFWO 1KVSA 1EVYA 1P74A 3PHJA 2W2LA 1R66A 3L4SO 4JK3A 3HQ4O 1I33A 4E33A 3ZDFA 3H4VA 3HDHA 5AOVA 1HEUA 4MKRA 1F17A 2JFFA 5KVQA 2IE0A 4K9DA 2HRZA 4LMPA 4E5NA 1CRWG 4IJWA 4IGFA 4NJOA 3U9LA 5CPBA 1VJTA 1JKIA 1Z45A 2Q4EA 3P5SA 4NNJA 1P3DA 4Z9XA 1T4DA 2NLOA 4W7HA 5L4LA 1ZBQA 4PCVA 3AUSA 3RI3A 1BHSA 1ZZEA 3LC1O 4CMKA 1CYDA 1YOVB 3JQ8B 5EQFA 5B4UA 3WXBA 3G17A 2ZB7A 1ML3A 4G65A 1P0CA 1VI2A 1B16A 4BO1A 3IJPA 1DRVA 1QV6A 4BKPA 1RYEA 3PFFA 2DUUA 5DT9A 5JLAA 4CLDA 4M55A 4OM8A 3I52A 3OQ1A 3LT0A 4JX8A 4NJMA 9LDBA 1YOVA 3JQ8A 4RQTA 4TSKA 4LGVA 4MINA 2Y67A 5FF9A 3WYEA 5JSFA 3GUCA 3VZRA 2I66A 4KWIA 4WCFA 4YT8A 1X1EA 2BI8A 1DOHA 1JWAB 1VL0A 4BQPA 5HWSA 1LEHA 5DBGA 2GSDA 1LDEA 4DIOA 5BNTA 1DC4A 4J91A 4Z0HO 3H9JA 1U3TA 1BDMA 2G82A 1NPDA 5TC4A 3K96A 3UAGA 3WYBA 3IOYA 2EIHA 4BMVA 3KYDB 4DTIA 1ISHA 4R01A 4YQZA 1BXKA 3R6DA 5FFFA 3ZNQA 4FSHA 5K0ZA 1DIAA 1PL6A 5JO0A 3WGQA 4FDAA 3MWDB 4JJFA 2O3UA 2XF8A 3N74A 4OOEA 4DYDA 2GNAA 1DLIA 3H3JA 2W98A 3KYDA 2DBVO 4RPLA 3VDRA 3JSAA 1G0OA 1EDZA 2FPPA 4RVGA 4I08A 4Q3AA 4IZIA 5KNLA 2NU9A 1Q2XA 4YRDA 1IY8A 1I01A 3WR5A 5TLSA 3W4IA 5A05A 2VOJA 2JD2A 5JW6A 3LT1A 3EUWA 3ZW8A 5CHEA 5HA5A 1YBAA 2XPCA 1VRWA 4D3DA 4CLOB 4KTTE 3K73O 1PWZA 5EIOA 4OMUA 1PS8A 3BMCB 3KM0A 1E1LA 3LQFA 3HFGA 5GMOA 1P1KA 3FNGA 3ZH2A 1ENZA 2IXAA 1I36A 1XSEA 2AE1A 2C20A 3JQEA 2P5UA 3QE3A 3ZWBA 3IKVA 5KTKA 3GUYA 3EW7A 3S2FA 1EBUA 1YQXA 2HJSA 5AQ1A 4CLOA 4YB8A 2P9EA 1OAAA 3BMCA 2JHFA 4BB5A 2VYNA 3VKVA 1EMDA 3SLKA 2UV8A 4I5GA 2BI7A 1F14A 1NQ5A 2VZ0A 3B20A 5JDIC 1Y5RA 3H7AA 2CDAA 1VKNA 1DB3A 2Z95A 3GG9A 3JQ6A 3DTYA 1K0UA 4MOWA 3WIDA 5A5EA 1KEPA 1PGOA 1XHLA 1FDUA 2JD0A 4EUFA 3PQDA 1LNQA 4YRAA 1FMCA 1K6JA 1Y8RB 4RPJA 1J4AA 3X2EA 2YY7A 2CY0A 4IDAA 1VL8A 4BNKA 1B3BA 1EK6A 4DLLA 1GADO 2VWPA 5L40A 3DAGA 4M86A 3AW9A 2O23A 3WDSA 3GVHA 2FR0A 2PD4A 1X13A 2DT5A 2G17A 3P19A 4ND4A 4N5LA 4YT4A 1HDYA 3S8MA 2PZJA 3QA9A 4BNIA 5C7OO 2IZ0A 4YAIA 4FOOA 3WGGA 4XGNA 2Y05A 5G0VA 3WGYA 4BKRA 3GAFA 4L4RA 3VH2A 1MFPA 3UW3A 2POQX 3GGOA 3DC2A 3HDYA 3AU8A 4K26A 4YQYA 1IUKA 2O3SA 5A9RA 4Q3CA 4GI2A 1KEWA 5JDCC 1NQTA 5T8KA 3KB6A 3BTSA 4XJTA 5T6BA 5HRUA 2UDPA 4FFOA 1L1FA 2CZCA 1ISGA 1SAYA 3KSUA 5G2OA 3D3EA 3JQAD 2E82A 4KDEA 1UJMA 3PJEA 4PVCA 5ILOA 2VWQA 3WBFA 4HADA 1F12A 4IY1A 1QXSA 1VCTA 1T2FA 1U7HA 2H6EA 3U4CA 3QY9A 4E5KA 1VM6A 4I5EA 4IDFA 1BWSA 3FD8A 4M8SA 3F4BA 3IS3A 4O63O 3H2SA 4O1MA 3WLFA 2D5AA 1ONOA 1HE5A 2GPTA 4U5QA 3ZN2A 4ND5A 2PK3A 3F47A 2FP4A 3WOHA 4XYBA 4NK4A 4AFNA 1YXMA 2ZJ1A 3ASUA 2DBQA 1Y5MA 2I9PA 1TA4A 3RU7A 4CV1A 3ROKA 4FGWA 4WLUA 1T25A 3FPCA 3PJFA 3LLSA 5IZ4A 2AEFA 2PH3A 3MZ0A 1PZEA 1YJ8A 1H94A 5THQA 4UVIA 4FR5A 4BGUA 4P4GA 4GWGA 4B4WA 2HLPA 5DZSA 1RM4A 2ZYGA 4II3A 5EJ2A 3BTVA 2IEDA 4K28A 3BYZA 3ETDA 1ZXBA 2PZKA 1VKOA 3DOJA 3MJSA 3KSDO 4R4JA 2OMEA 2WYVA 4U0KA 4DYVA 1QYWA 2ZCUA 4E32A 2FPIA 3QVTA 1DJQA 3QIVA 4EJMA 1GPJA 1ZW1A 4IMRA 1FF9A 3VOSA 3ST7A 4IDEA 5JDIA 1G6KA 4B79A 1UUFA 4TZKA 4NDNE 4ALIA 1GR0A 5LC1A 3HFSA 4EGFA 5KJFA 2O4CA 3V1TC 3MTGA 1UXIA 4GX0A 1C1DB 3TOXA 4MIEA 1V3UA 3Q9UA 3JYQA 3DBVO 3TZQA 5JCJD 2ZQYA 2IRWA 4D41A 2WMDA 1NVGA 1RYDA 3PWZA 1IL0A 2CF5A 4H16A 4EYEA 1E5QA 3ZNPA 1EFLA 4N54A 5G4LA 5L53A 2UUOA 5EESA 2FY8A 5COBA 1LQTA 3OA2A 4CPDA 2BKAA 1Y9AA 3NRCA 4X54A 2GGSA 4J7UA 1ZNQO 1TVEA 3K30A 4MIYA 5ENVA 3QW2A 2DAPA 3GEMA 1OOEA 1B15A 3AUAA 1LX6A 4CMJA 4J90A 1P45A 3K2BA 2D4AA 1ZJYA 3JXOA 4Y6PA 1DBVO 3VPXA 2OUIA 1TXGA 1SB9A 3MTJA 2GRAA 4J43A 4YT5A 4Z0TA 1YONA 1CWUA 2PNFA 4Z9FA 4ZQBA 1ZCJA 2G5CA 5JDCA 1D7OA 3KO8A 3VTZA 1YBVA 3D0OA 3WFJA 6ADHA 4WLFA 1E3WB 2W2KA 4R54A 3ZWAA 4E5YA 2X9VA 4QTZA 4ALJA 4Q3NA 5JC1A 3CMMA 3E9NA 1GL3A 3RVDA 1NNUA 4E2YA 3V1UA 4BMNA 3ZU3A 3NTRA 1N8KA 1MV8A 3AOEA 2VUSA 1DIHA 3BIOA 2R6JA 4L73A 4AJ4A 1E3WA 1GDHA 2TMGA 4PLWA 3TL3A 2IODA 1JKJA 1SNYA 3FTNA 2B4RO 4ND3A 5CDYA 3ITKA 3OBBA 4F6CA 4C7KA 1E1MA 3OMLA 3PHHA 4ROSA 4PG5A 2X6TA 1B26A 3PJGA 4BNMA 2A9FA 1LRLA 1KVUA 1UXKA 2DTEA 4BNTA 1Y81A 5AYVA 3DZFA 4DPLA 2G0TA 4FGSA 2EJVA 5HTOA 4Q39A 3NDIA 3M2PA 4KUGA 4EW6A 4WLEA 3C7AA 1JDJA 3GOHA 2J5QA 3JQFC 4TRNA 3GY0A 1XA0A 4OHUA 4UUMA 3VKUA 4WNCA 3ZCXA 5I7SA 2YHUA 3FI9A 5JNLA 1DAOA 2JFHA 2VQ3A 4MP6A 1A4IA 4IJKA 2BGKA 3BMOB 2BFPA 4OXNA 5DF1A 2Y1CA 3GNTA 1JTVA 1HDGO 5IN4A 4BNZA 2Q1UA 1PU2A 3I6IA 2JFGA 4CLHA 5JC8A 2H1SA 3DBHB 2RHRA 3DHEA 3ZHYA 4IQ8A 3GF4A 1SB8A 2BH9A 3FHLA 2WD7A 1PIWA 3FWZA 3PWKA 4ALMA 1XKQA 3BMOA 3AI2A 3KXDA 1N7GA 2Y1FA 4BQRA 3K8ZA 4Y6RA 3AUUA 2GDZA 3SBOA 3OP4A 3PHGA 2ZQZA 4ZQEA 4NU6A 5HS4A 4RF3A 1R37A 3DBHA 2Y66A 3SC6A 3RC9A 4PG8A 1SOVA 4XZ3A 3K2EA 2EKQA 4CQLA 3O26A 1H93A 5G0SA 2DC1A 1YBMA 4JROA 5EERA 5CG1A 5A02A 5JYDA 4QFDA 1CETA 1CIVA 2PY6A 4ZQGA 3ZWXA 2B83A 5DBIA 3F5QA 1E7YA 3QWBA 5L4NA 3O38A 2VNAA 3UKOA 4DBZA 2P5YA 1E92A 1GZ6A 2I76A 3L07A 1BXGB 2EHDA 3EGOA 3IUPA 3ZW9A 2RH8A 1NQAO 1H5QA 3GN2A 3QLJA 4GKBA 4AJJA 1DRUA 4XGIA 1P9LA 3IC5A 3QVXA 5A4DA 1ADBA 3EMKA 5JS6A 3TZCA 2WYUA 1V3VA 4CR6A 3PGXA 2BGLA 1NAHA 3P7MA 1IE3A 1WW8A 4J2OA 4OIMA 4E13A 1BXGA 1TLTA 4QFCA 1NTOA 3OQBA 4A7PA 4JQCA 3JQGB 4CM9A 1LXCA 4XYMA 2OBNA 1GZ3A 1Q7CA 4YJHB 1RKXA 1R0LA 2ZKLA 3ICPA 1YRLA 4KTVE 1TB4A 1LLUA 5JMWA 4URFA 1BGVA 2F00A 2YV3A 3ZWYA 2FSSA 2PGDA 1JA9A 3W8EA 1P1FA 3JQGA 1NVMB 1O0SA 1XU9A 2LDXA 1B8UA 1DIBA 3U62A 1ZFNA 4YJHA 2OOSA 1BVRA 3JCZA 1I2CA 4Y98A 4YJFB 3NDRA 1EEHA 2BD0A 3MJCA 4XYGA 2HJRA 3ABIA 5DP1A 3JQFA 2VT2A 5IXYA 5ER6A 4HFJA 3P2OA 3VZSA 4M54A 2DUWA 4P38A 2H5LA 2VHWA 4HFRA 1ENOA 5TGDA 2QIOA 3IL2A 2OGUA 2X0NA 1HSZA 2PV7A 2VZ9A 1PQPA 5JAQA 1R0SA 2Q3EA 4CLXA 1B7GO 1F8GA 1HDOA 1XQ6A 4FFMA 1LA2A 1IULA 2WEKA 3WGOA 2AXQA 3UN1A 4BNLA 4AJLA 1CQIA 1OBFO 4AL4A 3LU1A 3TFOA 1PEDA 1XGKA 2XXBA 3IDSA 4P22A 4DREA 1F8FA 3GVIA 4PLPA 2J5KA 1N5DA 4RPGA 5DCYA 2EP7A 3QWAA 3G1TA 3IP3A 4UULA 1DJNA 4E2ZA 4RLSA 5A9SB 1BTOA 4I8XA 2NWQA 5F1OA 4MJLA 1Z7BA 3UUWA 5JAMA 2B35A 2CSUA 3ETEA 3WMWA 4EBFA 4CQMD 3PIDA 3UCFA 3NJ8A 3E03A 4Y6SA 4OXYA 4XYEA 4UVHA 5CEEA 1FDTA 1QLHA 2OP0A 3H9GA 2BKNA 1N2SA 2AG8A 2HDHA 5A9SA 1ADGA 2HUNA 5KCZA 1KBZA 1LC3A 1NP3A 3E1KA 3BHMA 5K6AA 3W6UA 2EERA 4IUYA 3HDQA 3Q9NA 4YCAA 4TRMA 3OEYA 3NTOA 3AI1A 1W0CA 1V6AA 1I5RA 4J0FA 3PXXA 1ZK3A 2IYPA 2YDYA 3F6YA 5EINA 3OQ6A 2C29D 2GASA 4DPKA 4MKXA 1ZIDA 4PG6A 3VDQA 4GQAA 5THKA 5JCXA 1I3LA 4YXFA 3AUTA 1P1HA 1E7RA 1PZHA 2Z1MA 3WSWA 1R16A 1A27A 3FNHA 3TFQA 5BQFA 4DC1A 3FN4A 5G0TA 1FJHA 1LDMA 3W4JA 3D1LA 4CM5A 4FS3A 4NBRA 1ISIA 1V35A 2GLXA 1FDSA 5TX7A 2AHRA 1YB4A 3JV7A 2GD1O 4YVFA 1W73A 1MGOA 5T57A 1PL7A 3DZKA 2B69A 3GRPA 3NTQA 4LMRA 2Q45A 2C82A 1LDGA 5MDHA 1UAGA 1NWHA 1WZIA 4BO0A 5EL0A 3C85A 4W4TA 3DL2A 3KV3O 1C1XB 1UZLA 1EVJA 3VVCA 1CDOA 4QX6A 4D3SA 3AWDA 5KKCA 1QYXA 1WDMA 4NHEA 1BXZA 4NBWA 4UEOA 3GMDA 9LDTA 4NQZA 1ZSYA 4E3ZA 2JKVA 4YWJA 2E48A 3TOZA 4B4VA 5JPIA 1C1XA 2O7SA 3KUXA 3RUFA 2YV2A 4OSOA 1OFGA 1Q7BA 3UCEA 1ZUD1 5KIAA 3V8BA 1NR7A 3UXYA 1AGNA 3DO5A 4JN6B 1A71A 1MC5A 3P2YA 3F46A 4O0LA 5DCUA 2CMDA 3M6IA 3K92A 2C59A 4XB1A 2CDCA 3H9UA 4FFRA 4N5NA 1E7MA 3RBXA 1C3VA 4MPDA 2A4KA 3F4LA 3FR7A 4QUKA 1UXJA 1QR6A 1U4OA 1NHGA 4CMCA 4GKVA 4I9UA 2DTXA 2IZ1A 3LZ6A 1LTHR 1E3JA 3A28A 2FWMX 4FC6A 2NTVA 4B7UA 4D7AA 3I9JA 3I9OA 3EY4A 3OECA 4NJMB 3RFTA 2BLLA 1HSOA 4H3VA 4HUJA 1K89A 3RC7A 1JN0A 2DFDA 3MWEB 2YFQA 4RF2A 1HYGA 4WCFB 1P31A 3H9EO 4ZQFA 2AE2A 3WWYA 2G76A 3JQAB 1KOLA 3I23A 4XA8A 1J49A 1GZ4A 2Y0EA 4HX5A 4BNYA 4BV8A 3OJFA 4J0EA 4LSMA 1UXHA 3C1OA 5IFLA 3EVTA 4GX1A 4CM3A 3M2TA 4YAGA 2Q1WA 1XWFA 5BSEA 2D1YA 2HCTA 1HLPA 3JQAA 4GX5A 3NDJA 2YUTA 1PGJA 3L9WA 2CD9A 4BNHA 3H5RA 4PFJA 5L7TA 3I5MA 1NBOA 3Q3CA 2EXXA 4OOFA 1N1EA 1X14A 3IP1A 1SZJG 1XIVA 1DFGA 3PGJA 4HBGA 8ADHA 2BKOA 1HDZA 3K5PA 2X5JO 4RQUA 2PKRA 4WEOA 2BFAA 1HRDA 4XIJA 3NT2A 5CEJA 2B4TO 1Z7EA 4CM4A 3DTTA 3JYPA 4EJ6A 4MVJE 1EZ4A 4ALNA 4CMBA 1KVTA 5U9CA 5I9MA 3L9XA 4L0QA 3KHUA 1E77A 1T2AA 1GV0A 1LSOA 4Z3DA 1U1IA 4AJ2A 2O3QA 1D8AA 1ENPA 4RPHA 4MVJM 2EKPA 1XG5A 4L4XA 4FFLA 2AQ8A 2G1UA 2WJPA 4J6FA 5F5LA 1E5LA 5C5IA 5T64A 3E9QA 3GGGA 2C54A 1PZFA 4YT2A 3E5RA 4GSKA 1U5CA 3JQ7B 2PD3A 4LN1A 2ZB8A 5KJCA 1ZEJA 1VSVA 4K6FA 5A5FA 4KUEA 1A7KA 5DN9A 3JQCA 1GD1O 1QSGA 3E82A 5LCXA 2RH4A 3I9NA 1ZSNA 4GBJA 1ADCA 2QYSA 4FQ8A 4DMLA 3TWOA 2QRLA 4IGEA 1EUDA 4WEQA 1QP8A 2PFGA 3JQ7A 4FJ0A 2NADA 3ZWCA 3JD4A 3ANMA 3PZBA 2HMVA 2D5CA 1LRJA 2O50A 3A1NA 4XQEA 4WLNA 3E8XA 3S2IA 5ICSA 1EDOA 4AJKA 2V6BA 4NBTA 2B4QA 5JCJA 1P44A 1ZKMA 4U0JA 1IB6A 3MOGA 3T7CA 4DLAA 2P9CA 2EP5A 5L3ZA 5CDTA 1I10A 3ZNOA 2QRKA 3RU9A 3HG7A 5L95A 1DLJA 2CNBA 3TSCA 4AVYA 3C3XA 2DQ4A 4NBVA 2GZ1A 2IZZA 4XGKA 5JY1A 2C07A 5COAA 2J3IA 3WLEA 4CR8A 4F3YA 4JLWA 2NU8A 1P1JA 4HWKA 4XR4A 4E30A 3AI3A 1C0KA 2C7GA 1KVQA 1PJ4A 2HK7A 4FN4A 4QQRA 3RUCA 4J1NA 3ZU5A 1V3TA 4CV0A 1EUCA 3FBTA 4JIGA 2PA3A 2WD8A 4BO3A 3ZV4A 4EEXA 5KKAA 3LF1A 1I3KA 2GCGA 4FBGA 1HYEA 5B4TA 4RVDA 5EN4A 3CZMA 2VHYA 3KYCB 4RZIA 1T1SA 2ZIZA 4UVDA 6LDHA 3RIHA 1HDCA 3E6AA 1MC4A 3H2ZA 3S2EA 3A06A 5B12A 2O3JA 3ORFA 3WMXA 5JAZA 3V2UA 2O2YA 4XDZA 3QVOA 2VCYA 1XLTA 3TN7A 5BSHA 3KYCA 3TRIA 3PP8A 1EK5A 4IXWA 1E1KA 1YDWA 4JBIA 4YTEA 1U3UA 2NTNA 2ZJ0A 3LF2A 1XDWA 1WAMA 1PJSA 1H9BA 2QX7A 4WECA 4Q9NA 3OSUA 4EI2A 2AEMA 2X9NA 2C0CA 4R51A 2Q99A 4PZEA 1NM5A 4JCOA 3F1LA 3PYLA 1YQGA 5DNAA 1ISFA 1YE3A 1Q1NA 1NPYA 4E2XA 1VJ0A 1ONPA 1S6YA 1ZH8A 4XRRA 4XEHA 2V65A 5CAEA 4R9RA 3GZ4A 1F0YA 4CUJA 5AXBA 5DULA 3VPHA 2VUTA 1WWKA 3RD5A 4LW8A 1I30A 2AQHA 1RM3A 4AJNA 4L75A 1P0FA 3JYLA 2BMAA 2PGLA 3UVEA 1EVZA 4F46A 1BG6A 1UDBA 3TJRA 2NSDA 3O8QB 1C0PA 2P2SA 3SJ7A 2VRBA 4BO9A 3QHAA 5CDUA 1XELA 4ZU3A 4TMFA 4CM1A 1H0KA 3CMCO 2AMFA 4LISA 4U7WA 1A5ZA 3RJ5A 4MVJP 2R00C 3LLVA 4UUNA 1LUAA 1SO8A 2I67A 4XD2A 4J2HA 4GWKA 3O8QA 1YH3A 1LDBA 1O94A 3HB5X 4R9SA 3WYCA 2ET6A 2PR2A 5I9NA 1YL6A 1WDLA 5FYDA 4XDYA 3D64A 4LK3A 2X22A 4I5DA 4J9VA 3WS7A 5G4KA 1Z74A 4FD3A 3WQQA 2YYYA 3OJ0A 4RORA 3WIEA 5L45A 5I8ZA 3DR3A 3EZLA 1LJ8A 2Q1TA 4KDFA 3GGPA 3GN1A 3KETA 4MVJH 4NK5A 4XIYA 4OH1A 3EHEA 2FSVA 2JHGA 4CM6A 2VOEA 1K6XA 1PS9A 3QRWA 4OSPA 1N92A 3GQVA 1HL3A
chains in the Genus database with same CATH superfamily
3BHIA 1J0DA 5A3SA 4UFNA 5HN0A 2D3OR 3KOUA 3RUDA 1YJAA 4EYYQ 2QV0A 3KVRA 1L7AA 5EPOA 5DNDA 3WHKA 2HQSA 1C4CA 1CV2A 4B3JA 1YFLA 2W4QA 4HRVA 4JVSB 2D5IA 5K0JA 4MAFA 4MRMA 2DFPA 3D0KA 1PBTA 1UBCA 4ECQA 3SS9X 3TLGA 1LI4A 4MCJA 3DL4A 1AMNA 2KI7B 1AK2A 3BSYA 1ZN9A 2FZ5A 3NGSA 2RRAA 1RHZB 4R40A 2ZE8A 1HMVA 1GA6A 3MM6A 3I2KA 4IJVA 5JZOA 3D4PA 3M6MD 1SCNE 1T3NA 1UJCA 4RVFA 2RHSB 1KR5A 2A1BA 3SQLA 1XE3A 1DV2A 5CT5A 1V43A 3JB9k 1QDEA 2C4VA 2P7IA 4KGDA 3WSVA 2UXCB 5IT0A 4RDCA 2CIMA 3AEKB 3FOFC 5I5EA 3CWBE 5IJWA 3IUNA 5ALWA 2UUAJ 1JE1A 4QYTA 1WSRA 2QV7A 2CNOA 2JFPA 5BRAA 4OGQC 1CJUB 2BGIA 4IDKB 1NHWA 3IUBA 4AY4A 3G7UA 1IUPA 4UAVA 3TGUG 4IDHA 3DLGB 3DWEX 2OPQA 2I5PO 1PDWA 2B82A 3NHPA 2A1TR 3Q3HA 1FC0A 4DDWA 5LQMA 3GH1A 1DKRA 3V2GA 3GHYA 4LUCA 1FT8A 3E9ZA 4JMLA 1JNYA 2WTYA 4CBVA 1VDFA 2Q5CA 2ZH7A 3C8HA 1GZLA 1X79B 5KFQA 5E2AA 3I1JA 3L4BC 3M2RA 5KDDA 3AY7A 4RTOA 2A57A 5BO5A 2FB0A 1VA4A 2W7PA 5EWMB 4WQMA 4X6YA 1CHNA 3NH6A 3GFFA 2QN1A 1TU4A 3OCUA 3P0HA 1NTKE 2IUUA 4BIIA 4CMEC 1WC5A 3MMAA 4RVUA 3GP9A 5I7VA 2PGAA 3GL9A 3T6BA 1EIYB 5AVJA 2RG7A 3ENZA 4GGOA 1GAXA 3QXCA 1IOLA 2REQA 1MEJA 4XDGA 4YAOA 5HS6A 3KLHB 5B7GA 3LOPA 4UE3S 1JT9A 1E6CA 2CL5A 3R7NB 2HPCA 2ZYTX 3ROMA 4C2BA 1IK6A 3IOCA 4FNGA 2EC0A 4UDNA 4X41A 3JASA 1YC2A 2GGPB 4R8UB 3FZQA 2LDIA 2QPTA 2O1WA 3G2PA 3AV0B 3E7WA 3PX6A 1ODJA 4WY4B 4YPFA 1YS4A 4DF3A 1ECFA 4B3FX 3IUJA 2RRBA 2WDPA 4YR0A 4QIFA 4FK8A 4PFSA 3IQDB 4C4ZA 3CXHI 2KFNA 4ES6A 3LWNA 5KC9A 1T2DA 4I1IA 1H2VZ 2UUBF 3IUSA 2B9BA 4MUHA 4KZPA 1KZ4A 2RJZA 3ILOA 1RLIA 5B36A 5DO2A 5HP4A 3C41J 5AVQB 3T5GA 1CZUA 4ED7A 1N6QA 2HK3A 4BRUA 2KWIA 3LC2O 2E76C 3RRNA 2ZBFA 5E4JA 3BVHA 3C8YA 4MP3A 4BV9A 5CPFA 1ZSVA 3T1AA 3OQOA 3T9CA 5INTA 3CX5I 2Q2VA 3SZOA 4KXWA 1N4AA 3E81A 2LP4A 4B3DA 4D45A 3TX2A 4BL5A 3OTWA 3PTZA 1R5NA 2X8JA 3WNVA 5AO9A 3MF5A 2V9WA 1JFTA 1SEPA 3DZBA 4UM9B 1P9YA 2OO5C 1LDYA 3BR8A 3T1TA 2Y3YA 5ULLA 1HEYA 3W5DA 3NOOA 3NKYA 3EB9A 5DNYB 1VJDA 1MB4A 1U9CA 1K0FA 3V3TA 4J9QA 2WAAA 1JOCA 2FZWA 3GROA 4WXEA 1L4UA 5B1HA 5FA8A 2W27A 3IBYA 2HQCA 2KTQA 4MGZR 1BSVA 1MZPA 3T1HB 2V55B 1YJQA 1IY1A 2GR9A 4MPJA 1QPGA 1KDPA 3QO9B 3LQ2A 2PO5A 4FMBB 1D9DA 3FWKA 1FJGB 5F98A 1SQ5A 2GJ8A 1F6BA 4B9TA 4EKYA 5FD8A 1OASA 2QJOA 1NJ8A 1NF8A 5I3PA 3RAEC 3BB1A 2B7CA 4TVBA 3V8PA 4GLLA 1G21B 2CGEA 4C08A 1S6PA 1X92A 4I7FB 1MIHA 5A2QY 1DFHA 3FF4A 1RSCA 1MU2B 2FZGB 1Y5IA 1L8XA 1MJFA 4LV8B 3RWMB 4QYRA 4U3FE 2AWNA 5IBPA 4O1IA 3INGA 4DNOA 4JKOA 3KLIA 1XMQJ 1U31A 1VPWA 5CURA 1K0TA 3THXB 2AG6A 5F2EA 3RIXA 4DU8A 2COKA 3WWOA 2XLKA 2Q8NA 2YYSA 4IUCS 1FBMA 2QP9X 1PYSB 1HQYE 1DQZA 1VF5D 1OTXA 5DEIA 3VVBA 4LHEA 2IEGA 2FLNA 3D0RA 4BHTA 4MS3A 2OFFA 1W75A 4UEJA 5LLSA 2IYOA 3THTA 1KIFA 3GEDA 4GQBA 4CKBB 3IBCB 3MB8A 5LSAA 1L4MA 1KZ6A 2PGIA 2NVUA 2HGMA 2C92A 3L7UA 4HTFA 2ON6A 3BXFA 4CIBA 1YQTA 2VT7A 4KN6A 4X7PA 2WWTA 3U61B 4YMTA 4R8SA 3EGXA 3ZLUA 4H54A 1FSZA 2MQQA 4Q1FA 3BV8A 2A0UA 3ABVC 1IKXA 1FDBA 3IELA 3FNIA 2G4VA 2NU7B 3R8XA 3PDUA 3DZHA 1XEZA 5T67A 2PM8A 3FSXA 2Q6OA 1PR9A 1RLUA 5DDIP 4LSWA 2AI2A 1WQ4A 1IBMB 1BCSA 3DBLB 4TXJA 1ZR4A 4KH0B 3GPAA 3DKKA 1OS5A 1SWWA 1E3DA 1LCIA 2VKQA 3W8FA 1SUWA 3UNGC 1M90T 3RIGA 2W25A 3NBKA 3LYLA 2QN6A 3G3EA 3Q6IA 1K3FA 3MUFA 4CRJA 1UZMA 4ITRC 2VYND 3HCCA 2RT3A 3AJRA 3A58B 4JZYA 2QW0X 3CUKA 1IR0A 3ADPA 2P2CA 4C22A 1HG1A 2NQ8A 4C11B 1T3LA 1WF0A 4HAYA 4N6OA 3KLMX 3X1DA 4KAIA 3CCSS 4MVJF 3NCRA 5KU7A 3HCXA 1WY5A 3T1YF 3OL7A 3K89A 4F5DA 5C8VA 4ALKA 4TKUB 4ILKA 4WFXA 3OHBA 2FEPA 5L6MB 3KSRA 2XSJB 4AZTA 4BFVA 3UWSA 1OH5A 5KFAA 4RKRA 2DFNA 1FRZA 1GV1A 3C6TB 3ONNA 1Z22A 2J9EA 4CO2A 1J90A 4C1BA 3PWTA 1NFFA 2PGXA 1RQVA 4DSKA 2ZTMA 1OY8A 2CCKA 4L1KA 1NUHA 4TZ6A 1NVBA 1YBUA 3OZGA 4LDJA 2X23A 3DT8A 3SC3A 1BQNA 1J0AA 1ZRSA 4XD7A 4QQNA 1A9XA 2VEDA 2ZR7A 2BKVA 3HFVA 2ODPA 4TT8A 1KI8A 5FTJA 4F2RA 4W82A 1VG1A 4OZ5A 2CWDA 1D5WA 4N40A 4R4LA 4C46A 1PQUA 3UGJA 3V6LA 1VCOA 2Q1SA 2I3ZA 3KZ1E 5CFMA 3QKIA 3NKVA 2UZ1A 5JAOA 3C1TA 3QVMA 2W9CA 1UIMA 4QDJA 2HNYB 5KTRA 2EARA 3OPNA 1BW9A 3H98A 1SJRA 1YQDA 5BPHA 3GRZA 4FIDA 3MPYA 3GPCA 5CT8A 2VH1A 4YRPA 4KRGA 4IGIA 1SXJC 1YQUA 3GFOA 3JD2A 5CYOA 3F4KA 3L8ZA 4KLZA 2XWQA 3DM9B 3ZV5A 1ZVMA 2QR2A 4NFYA 5HCIA 5IDXA 4DJJA 4U02A 2OFPA 3UATA 1N78A 1EQ2A 3K58A 2BW7A 4QNNA 4O4JB 4PCLA 1RZRD 3GP5A 3GFGA 1UDRA 1UT6A 3TTTA 1OMOA 5IVIA 1W9MA 5BU8B 4CLFA 2WVDA 4DADA 4EYOA 1U48A 4ONEA 3A4LA 1QPZA 4WNAA 3LP1B 3PQFA 1Q78A 1DOZA 1NXTA 4G0ZA 3TE6A 1YR1A 2NUAA 3HK2A 4KIWA 1OPZA 3CRW1 4C06A 1YA6A 1KO4A 3H0CA 1LWUA 1XALA 3FDZA 2WUWE 3ICCA 4PTLA 5HAOA 5CUQA 2D1CA 4PD4I 1J33A 2AJ2A 3Q0EA 2C8KA 5KLIC 3PTAA 3NHZA 3NYWA 2MSWA 1JKHA 1EFCA 2PZLA 5DQHA 2O8CB 1ISMA 4KJXA 4LRQA 2NZ8A 4OQMA 3A3YB 3BHJA 3IXMA 2GF2A 1O4VA 4RSHA 3IFMA 1HR0J 3LP2A 3HKBB 4ZVSB 1P6XA 3KX2A 4N12A 3V7FA 1NBME 5DTRA 2AQKA 1QQTA 2ZT6A 4YR7A 2HXSA 1LWEB 2AFIA 4WB4A 3BSFA 3OVMA 3SZMA 2F8MA 1D1TA 2IUYA 3B2EA 4KXUA 1SHTX 1NNLA 4ZHSA 2EJWA 4LF1A 2R2RA 5GTIE 5CT9A 1J8QA 3R0JA 1Z2OX 1GLGA 3QV1A 4KR9A 2ZXUA 3DGVA 4IFVB 2ZRGA 1AD2A 4C4TA 3EGNA 4TN5A 1NSTA 1HYHA 3VGSA 2W9BA 3RNOA 3OP1A 3C4QA 4LC1A 5DX1A 3QU9A 2H59A 3DU6A 3AJ8A 2H89C 4ECRA 2EHJA 3Q72A 1NU4A 2Y9ZA 5KBYA 2SCUB 3KOOA 4LZAA 4HDKA 4G84A 2V9PA 2NXUA 1AO3A 2J6UA 2XOKD 1NAQA 4NNJA 3USES 1UT8A 4PCVA 3U7RA 3ZTTA 3JQ8B 4BRSA 4Z2XA 3E5NA 4FYVB 1SQSA 4IG9A 1VSTA 2JLYA 2Z30B 2X3YA 3OQ1A 4LGVA 2PUBA 2FK7A 2JI7A 4KWIA 4FMCB 4GI5A 2QG9A 3O4FA 2FWJA 5LJ5Y 5LOVB 1NPDA 3WYBA 1NTMK 3TZLA 1BXKA 5SUHA 2V2KA 1VPCA 3UT6A 3BKUA 2PAFA 2ISCA 4HLUC 5A0YB 4O8ZA 3KYLA 1S1XB 4JJFA 1NH4A 1Z4QA 2FVYA 1I2DA 1DLIA 4P2MA 4N76A 3JW8A 4NICA 1RF0A 4N77A 2OZLA 2YX1A 5T41A 5HGXA 2CFIA 2A59A 2IFTA 1GFIA 2QJKC 4HQFA 4U7JA 3ITHB 1PWZA 1V8ZA 4CG2A 3KM0A 4C0WA 1H2ZA 1YZGA 2VP2A 2Y8EA 5AKYA 5F78A 1LKZA 3B7GA 2B6HA 3ZH2A 1NIJA 1F5SA 1YQXA 4OVNF 2ACWA 5DB4A 2EWHA 2C2WA 4N0DA 5EJ8A 3F9CA 1N7SC 4C7NB 3NHRA 3SLKA 1CBKA 2XNHA 1S1CX 2Z95A 1AKEA 1JG7A 2FK8A 3MT8A 5AQEA 3WNDA 2NG1A 2CY0A 4BQOA 4DLLA 5L40A 1R74A 5KTBA 1X13A 5DBEX 1TF7A 3V33A 4K0KF 2PZJA 3JWIA 2C3PA 3GZ7A 4DCPB 4MV0A 3VH2A 1U0RA 2R7XA 1IN8A 4CTNA 2EYUA 3FTFA 2JJ8A 3CD7A 4V0ME 3EDRA 2MSCB 1ICEB 5LSRA 1TCBA 3KSUA 1S2OA 3JQAD 3SZLA 5LZ4A 5EHNA 2I1VB 2E1PA 3CSUA 2FYUE 2D2FA 1F12A 2PMCA 1T2FA 3EFOA 5KQMA 4LX0A 1PHPA 4IV5A 1E2NA 4U5QA 4MB0A 5KAPA 4MULA 1P0QA 2FP4A 1FP4A 2DFTA 1HK7A 1SUBA 2BRLA 2Z08A 3LLSA 1YJ8A 2DCUB 3LALA 1H94A 2X4DA 4DCKA 4GWGA 2Z57B 1U26A 2ZYGA 1PR2A 1WTCA 3ZE6A 3TB6A 7YASA 2ZCUA 2FPIA 4M7RA 2K8GA 2GZRA 4J75A 5I3QA 1IJKA 1Y6RA 5K8VA 2M1XA 2MQLA 4EGFA 2KRRA 1EU1A 2EXUA 1TLFA 2V7WA 3TOXA 4KFRA 3UJCA 4D41A 3CX5H 3ZDMA 2ZR8A 13PKA 5BN5A 3OCWA 1E5QA 3RTCA 1EFLA 3L7MA 4Y2RA 4PYOA 1EB8A 5IEJA 3K30A 1HYBA 2DAPA 2I7TA 3AUAA 1KH2A 3G8AA 4JYMA 4E88A 1RE4C 3E2MA 1MC8A 2YC2C 1ZCJA 1IJDB 2CDRA 3COYA 3R5KA 4GD3Q 4HX2A 3H5YA 1TVKB 4C4YA 5EJEA 4RUAA 4BMNA 3L70D 3PB3A 1QCYA 2YMLA 5DN6A 2E0IA 4NOHA 4IXDA 1MWQA 2IODA 1SNYA 4FP9A 3R7DA 2QX6A 1FZGA 1N0WA 3DOKB 1UMBA 4DUZF 2F4NA 3VR3A 2WHPA 1RYNA 2HHJA 2FLKA 3OEEA 3PE6A 4Q39A 4G26A 2XITA 4EFLA 3GOHA 5I7SA 2VA3A 3K8OE 2MYNA 5BSUA 4H4CA 1TVRA 3W8RA 4D2IA 1E5TA 4H6VA 4OV1A 2C9CA 4NWIA 5K8NA 1S76D 3B5NB 3HMQA 2RHRA 5GMDA 4IQ8A 3GF4A 3RS9A 2QTBA 1GPAA 1WMDA 4D98A 4JI5B 1XVTA 1A8UA 2X40A 2PRIA 3AUUA 4FNIA 3LH2S 4IKEA 3AEKA 3IEPA 1E9AA 4ETIA 4GSYA 4IZ6A 4B3RB 1U6IA 1CJUA 2FVXA 4IDKA 4AZ0B 4WI1A 3G2KA 1H1TA 3COPA 4Z99A 1XR7A 5AVRB 3UAYA 2ZJSE 1BA2A 1BN6A 1GZ6A 1U1PA 2NO7A 4Q5IA 5CXSA 2LQBA 2UZ4A 4F04B 1H5QA 4QREA 3TZCA 1V3VA 2HDOA 4URGA 1YDHA 4OIMA 2QSWA 3MM9A 2FMIA 4JLUA 3CX3A 2GS8A 1R0AA 4QWAA 4ZJZA 3FG9A 3QIDA 4N5SA 4M7OA 4B75A 2XGSA 5I6DA 2N3ZA 3HJBA 5AE2A 3EDQB 4LSZB 3LPLA 5ALNA 4B35A 4N1AA 2OPSB 4PFQA 2BD0A 2QZSA 2PKXA 3V2NA 2W6MA 4GMXA 4OYPA 2WJAA 5ER6A 4B2LA 5TGDA 2VC2B 3IL2A 3MGCA 4F1KA 3T52A 4JF7A 1LA2A 4W5WA 2JGAA 3LU1A 3HJVA 3HULA 1F8FA 3BPSP 1X4EA 1PZXA 1ZMEC 3ZPXA 4JI0J 4L8YA 3STXA 3ETEA 4WYWA 3H2YA 2WA1A 3G82C 4TKTA 4M1SA 4OXYA 1KY3A 5EA2A 3ZY6A 4WY4A 1KBZA 4RKYA 1K05A 4MEAA 4TLMB 4ENTA 1V6AA 2GJ2A 1E4EB 5EINA 3KALA 5GVQA 4YXFA 1NVOA 5B0CA 2Q4OA 2P1DA 2W1BA 1TUGA 5C5EA 2HGZA 2XB8A 5AVQA 4YVFA 2ZYHA 1PL7A 1XQ9A 1LDGA 2RJ3A 1YMQA 4OEHA 1TZ2A 5IVHA 3IP5A 2KB0A 1ZTTA 3AZQA 1C1XB 3B85A 3G59A 4H4EA 1QYXA 1VQNS 4H0CA 1QE3A 3AVYA 4E3ZA 1WI8A 1DARA 2YV2A 2XS7A 2AGQA 3FTCA 4BJ5A 5FX2A 1Q7BA 4X62F 3L43A 4NJEA 2OYHB 1U6KA 2L17A 1VQMP 4IW3B 1MC5A 3GLSA 3CVWA 2QSYA 2A4KA 1IXYA 5CFLA 1KBQA 1QR6A 1UKYA 3ZQ4A 5BV2P 1YJXA 2W22A 3RRGA 3BQ1A 2VDPB 2UXDB 3MGKA 4WN3A 1WULS 2UYGA 4NJMB 3RKSA 1Z08A 3TQEA 4Q00A 3T1VA 1AGRA 4M5HA 3RK0A 1HYGA 2I2YA 5KTNA 1OAKA 3OI7A 3LPYA 1U99A 2EEYA 3J7ZT 1T6YA 1GL2D 5EZYF 1QE5A 1XZLA 3O8LA 2I1RA 2D1YA 3GBPA 3SR4A 1EVEA 1M1GA 1PGJA 2KI5A 2PX5A 1J2JB 2CD9A 2BGRA 1ZUNA 3QO9A 4Y99C 1PT5A 1XLTC 2AMYA 3WHPA 3R9IA 1U0GA 3K5PA 1FDMA 1KYOD 2M3EA 3AHFA 3TGPA 2XH8A 3RW7A 4EJ6A 4CMBA 1D2RA 5BVHB 1U1IA 3PDCA 4PNZA 4DMCA 4P53A 3GD5A 5DWQA 2V45A 2E9SA 1T1IA 1RSZA 4WD3A 3IPXA 4EWLA 5CJJA 3OM8A 4HZUB 2QTFA 5HMWA 3HVKA 4EYKA 3RIEA 3R9WA 3VKWA 4EEYA 1G17A 1ZSNA 3IAOA 2O3DA 1RLOA 3GRYA 3GV8B 1QP8A 1RA6A 4FJ0A 4V3CA 1MU2A 1RH5B 1FDRA 4ZZ3A 3ANMA 4RHXA 2GD0A 3DF9A 4ZV7A 4GC7A 1M2KA 1NA5A 4KXFB 3IUMA 1SKUB 1P84D 3N2NA 2HFED 2AN4A 4EMBA 5I3ZA 4CLTA 2P9CA 1SM4A 3O9MA 4IFEA 4AVYA 4NBLA 5JY1A 4P3YA 3F49S 4M5DA 1TTQB 3CMES 1X86B 3THXA 1KJWA 2VTVA 4JEUA 2CFTA 4EPTA 2E75D 2QD2A 4BZXA 4OYWA 3D6MB 3A8TA 1TR0A 3SHOA 4N3YB 2IYAA 1RT4A 3PC7A 4F9EA 3L36A 1TM2A 3E6AA 1QVGO 2G0AA 5JAZA 3H1KD 3BF7A 3KKLA 4KN5A 5ALFA 2O06A 1ODKA 3IBCA 1KGSA 2XRZA 4AX8A 1U3UA 2P62A 2BE7D 3R5CA 2WD9A 1MMLA 4CNYA 4KIJA 4IG0A 5DI3B 2FYNC 1ISFA 2VPIA 3P9XA 4QG7A 1N34J 4PD4H 4FFSA 2ASVA 3TVKA 5DBHX 4AKEA 3BYRA 2AQHA 4S04A 4JXZA 3JYLA 4ZI5A 3L40A 2CNWA 2JZCA 3WMM0 4GIBA 2BOPA 2Y6UA 1XELA 4U7WA 4TT3H 3CCJP 2K7KA 1LUAA 2H1RA 3OW2O 2Q6VA 3UK6A 4J2HA 1AKTA 4NX9A 4UDXX 4F4KA 4UNPA 4H1HA 2G1HA 3UG7A 1H8AA 2SECE 1XZKA 5B3JA 1D0VA 1QAMA 4KGVB 5A7HA 4I5DA 4KH0A 4OI2A 3V4IB 3BFXA 3LY8A 1V47A 5I8ZA 1TTPB 4JLSA 2AF4C 3GGPA 2PCJA 3UUFA 4NK5A 2Z43A 3VJRA 4P3OA 4RW4A 4ZC1A 4D96A 4ZI7A 1BU8A 1Z5VA 4N5HX 5BMOA 5B6IA 5KFOA 4S1NA 4D4JA 3G0HA 3JWEA 1FUUA 2AEJA 4LEIA 4RSRA 4WGFA 1F51E 1TO1E 5C53B 1AKUA 4UUWA 2QUKA 1JKJB 4DFDA 1WB9A 3S1AB 1A4XA 2YKNA 4OGWA 4DCTA 2ZYDA 4YRMA 3SQMA 4AW9A 2WK4A 4NZ0A 5AE1A 1EX9A 3MM6B 2JH9A 5NULA 2R4FA 5BSFA 1YDEA 4KQ6A 3V3KA 2C4UA 1XRPA 3RWBA 4KO8A 4U7UD 2ZVDA 4TMWA 1VG9B 4K9LA 4NIMA 5FBHA 3C6TA 4CTMA 1MO4A 4FPXA 1HLGA 4HQ0A 1NASA 3QQPA 3S1LA 4MW7A 2AUMA 1QEXA 1PL8A 2N7YA 2CNOB 1JQBA 4P4UA 2CBXA 3K1ZA 4XWTA 4EJSB 3UYLA 3IEIA 4GPEA 2PX4A 2C4NA 1YB1A 4X7BA 2ZUFA 3HVRA 2Y1OA 2H48A 3DGPA 4OQYA 2HHTA 2H0QA 2GBFA 3HJUA 4PG7A 2WJGA 3RANA 3PJXA 2H5EA 1K0VA 3H2JA 2RBEA 3M2RB 3IAS9 1L9XA 1NB7A 4I4TB 3PHTA 4AQYF 1XIQA 4DV6F 2EX0A 4NS4A 4OK3A 3RQIA 4NDAA 4MR7B 3A2LA 2JLFA 3AF5A 4RK7A 1NLFA 3IAS1 1T36A 1WMSA 2FW9A 1RRPA 1C8LA 1QG2A 4PZ0A 4ABTA 1GNSA 3G9RA 2CFRA 4NLUA 4RZQA 1RKBA 3G2HA 1WJGA 4N01A 5JFOA 3L73J 3D1QA 1FTSA 1N2CA 1RIFA 2NPSB 3BO4A 5JU6A 2GJ4A 1PFUA 1XT6A 2REQB 4G4IA 2OBXA 3QE4A 3ZU4A 2FYZA 5ECYA 1SUAA 1HWYA 2CUYA 1U7JA 1W5BA 3IAXA 2BC9A 2Y68A 1MPTA 1XX6A 3NFRA 2HPCB 4I3GA 1U1MA 2AFHA 1GQOA 3PIOQ 1QVGR 1L3SA 2R5BA 2E1RA 2IDMA 4K9KA 3JASB 3J80U 5KJ7C 4D9JA 1SXIA 2WF9A 3RK2B 3ASVA 4XIIA 3M1IA 2FVPA 4AJ9A 3P9NA 2CT8A 1BEUB 1S2EA 2Z2LA 3M6XA 2MYFA 3F3SA 3VDNB 3DXBA 2YDXA 1QFXA 4EFAC 1HDXA 3A2KA 4PBTA 4EG1A 1XZEA 3LP1A 3HJNA 1FESA 4FFBA 3S29A 2AOTB 4ZLLA 2H1HA 4BHQA 3ZS8A 2W2OA 2CNKA 1V8BA 1I7NA 2CCGA 3NT4A 4TU7A 2IXFA 3LQKA 3OW2R 4FSDA 4AG5A 1ZOIA 4DJ5X 3NUGA 4QOIA 3UV6A 2A0FB 1QHGA 1WSAA 5CM8B 1E1CA 1HE4A 1ZN7A 2XVYA 5KYYA 1TD1A 121PA 4YRGA 4D81A 5JR3A 4MUGA 2W0MA 4IKOA 2G3YA 2AMCB 3AONB 3A3YA 3M9WA 4JV5B 1F7VA 2ZRPA 5EHIA 2GAAA 1P4GA 1CC1S 3KPUA 4F5EA 1OFHA 3R1LA 2C7RA 5CH3A 4PF1A 4C97A 3NGXA 2X1BA 1E58A 4KBFA 1LWEA 3FOAA 3QX3A 3QUSA 1T2EA 1X4HA 3LZCA 1GRNA 1FFAA 4EY8A 4U1RA 2OHOA 2GERA 2C8VA 2PDAA 2ORVA 4HH4A 5DKFA 2LCFA 3U60B 2OTKE 2CXHA 5HILA 5FTLA 2JAHA 1YVRA 2XWSA 5GY7A 4LS3A 3IEUA 4TV9F 5IN5A 2UZIR 2O1SA 4I8IA 2Q4DA 2YZ2A 1QKKA 1JMTA 3VYRB 1QVAA 2P6MA 2BF4A 1VC2A 3PDHA 2SCUA 4GLBA 3AVWA 3JD3A 1LBEA 5IC6B 2ZQ5A 2HSEB 4RDIA 1M2WA 2FHMA 1SK8A 1L3VA 3L7YA 3ELBA 3G1UA 4I2QB 4MYRA 4QU7A 4O08A 2XBPA 2XMMA 5FWDA 3R5GA 4E6PA 3DRYA 5C3MA 4IFMA 5AVWB 4WXRA 1EBFA 1X3SA 4NRDA 3C43A 3FGZA 2WHEA 4UU8A 4C05A 4TQUS 1Y5IB 4FIZA 4DQVA 5CD4A 3KAQA 4TYPA 3NC1C 4GG1A 4JUAA 5BYBA 4B34A 2MOKA 3H5UA 5LOVA 5SZKB 5CLFA 3ZBUA 4PN7A 4JNCA 1LPNA 3HSGA 3PNYA 3DDOA 4BNNA 1O54A 3M0EA 2JEGA 4JQOA 3N2YA 2L19A 4FT4A 2O8DB 1S1XA 4NZPA 2YWDA 4CU2A 4DV7B 3NHFA 4QQKA 3Q1LA 1AN9A 4MLPA 2PKQP 2YWHA 4J9UE 2Z4RA 4WT7A 3G5TA 2E4XA 5FDLA 3RU3A 1DD4A 3TOVA 1EX7A 4ZA2A 3ITHA 2HRRA 2SBTA 2XUPA 3B52X 3DAOA 4WJZA 2V68A 2NVUB 3IPLA 5KG2A 4C7NA 1GXSB 3TW0A 4HTFB 2NXJA 4PVDA 4C78A 4HHJA 4G2NA 3F9IA 3GA0A 3ANXA 3DMTC 4HFMA 3EGXB 4C76A 1A1SA 1JV2B 2JL9A 1T9DA 2HXYA 4BGEA 2IHNA 3WICA 3WLOA 3S1KA 2ZT9D 4DNPA 1IKXB 3RVSA 4I66A 5IUNC 4UUXA 1IBLJ 4DCPA 4WDRA 1ZHFA 1W5EA 1SR8A 4DMZA 1GN8A 1W85A 1L7XA 2E2WA 3RRKA 5AVTA 3WRXC 1LOUA 5IWAF 3ZVNA 1I2AA 4DQRA 4LBZA 4ZI2A 1RT1B 1BCSB 1ICEA 3AOEC 3X43A 1B7YB 1CEEA 3L73G 4JI1B 4BB6A 2HA5A 3THSA 1R0KA 1J5PA 3W0LB 2Z8XA 1XP5A 4B3MJ 2XNRA 2F63A 4LR9A 3NDPA 3FWNA 1W8DA 2IXEA 2A5YB 2OCAA 1HBUA 2Q3BA 3IAAA 4ZVGA 1QZ3A 1JJFA 5GZ3A 2QN6B 4IEEA 4JR1A 4WKOA 4PHHA 2ST1A 1F8XA 3P97A 5JEDA 2FLWA 3MCVA 4OJ1A 3EVOA 3QK7A 1AGXA 4OJGA 3P2KA 4DSIA 3NNSA 2BXJA 5F7JA 3NHYA 3AZOA 1T3TA 1H2FA 3VTIA 4ND2A 2O0MA 1GMVA 2GM5A 3V46A 3AR2A 1TRKA 4L78A 3AILA 1I3NA 2DVMA 3H83A 2L69A 3ZUPA 1HRKA 3NAHA 5EOVA 4RD0A 3MFIA 5DYTA 3ILIA 1IZ8A 1JR2A 2C84A 4P7BA 1OTYA 1SU4A 3KKMA 4Z4GA 3JAMA 3ZZ0A 1V8OA 2XGMA 3N0XA 3PR4A 1WXDA 3C24A 3ZNNA 3H1IE 1RCOB 1BQNB 1SKMA 1FQJA 5KFVA 3VZIA 2YIJA 4FUQA 1RABB 2QTGA 2WYWA 2QFJA 1A9XB 4KN9S 4CM2A 2IEBA 3NBZC 4UEKA 4ILLA 1HX7A 4XSVA 4KQWA 3THRA 2H54B 5FUWA 4ALZA 3LBFA 2JIOA 1Z13A 3ICEA 1BE3D 1KYOH 3QI2A 1ULAA 1L0NJ 4IINA 5LDDC 4Q3LA 2C0XA 5IBCA 5IAOA 3TNUA 4NEQA 5KCMA 4K7QA 3ZU2A 3N6XA 2NUTA 1E6WA 3ZGZA 4RTKA 1FDVA 3KJNB 3NHWA 1KEEA 4MQLA 3HVTB 2WJ4A 2W9CB 1FE4A 4RGYA 1CUXA 3X2FA 4HL9A 2PL3A 1BW9B 5IKXA 2DPLA 4AUEA 5JJLA 2JAXA 3MD0A 4I69A 1XDDA 4YCDA 1E0KA 1OKKA 1YDMA 2GYYA 1TKAA 2FUEA 4K4UA 4IS2A 3VZDA 1P2FA 1ZM7A 2IYWA 5FPQA 3LLMA 5DGXA 1KJQA 1SKYB 1WVMA 2RI0A 1LNSA 1IN4A 4L22A 5LP1A 5K6AC 3USSA 1XYGA 3PFCA 1AJYA 4GOEA 1L5MA 4DV5F 4HKQA 4NMLA 1USUA 1S57A 1JQEA 3N2KA 4N5DA 4Q16A 4IIDA 1PIXA 4F04A 4H4KC 1QQ6A 1ZCAA 1SBIA 1PK7A 2J4DA 3DTNA 1NVVQ 1RR6A 2AKWB 3ZZOA 1R3UA 4FXWA 4JOUA 3R3SA 1O58A 4BLQA 1N5TA 2ZB2A 2N75A 4Y18A 4K6HA 2LIPA 4LSZA 3FDZB 2RB4A 1UDXA 3CTRA 4DMKA 1VL1A 5CHCB 2XCOA 2OPSA 1LPOA 1NNDA 3MF4A 3TW6A 2FJDB 3KJVA 4BUCA 2ZWOA 3GFBA 2OBFA 2EF1A 4LJ8A 1QTIA 1I4TD 4PC6A 1JKHB 5EIAA 3GT4A 4REMA 2XJ4A 5KOJA 4CI9A 1U0EA 1JEAA 4HF7A 3RG8A 4QR2A 1Y8ZA 4AN4A 5CB8A 3LP2B 1AZSA 2XYPB 3UAWA 1ZP6A 4UY8T 1S1CA 2O48X 2E9RX 4DR4B 1M2NA 2JAUA 1TK5A 4Y7CA 1RKUA 2AFIB 2H4ZA 2AF3C 3M6VA 5JJ5A 3PKYA 4K2JA 3Q3IA 3IV9A 1WSBA 2BEKA 1V9OA 1E4EA 1XVAA 3PA6A 3R27A 4GYKA 2C9MA 1XN1A 3I9MA 5JS7A 3TRFA 4CHTA 3DKRA 1NJGA 3FMBA 4DLEA 2GYVA 3IQWA 3IQFA 3KSAC 1WV0A 4IPTA 2W9BB 4ARCA 4A48A 1DX9A 2C57A 5ICCA 3EZ2A 3F97A 4BAUA 2M8DB 3KRTA 4H4OA 3BJMA 3HU2A 4X7RA 4BO5A 4HDKB 3HXQA 2I65A 3PFWO 4NCGB 4GKAA 1P74A 1Z12A 2B4YA 1RKVA 4O2RA 4WKPA 5D51S 4NYOA 2P6NA 3Q8QB 1VQPP 2AX3A 1TZCA 2AN1A 4NI2A 4YJ2F 3ZVKA 3FMPB 3P5SA 4PC1A 4NXNF 2NLOA 4W7HA 3X2SA 5EQFA 1Y7LA 5HF5A 4XARA 1ZPWX 1QV6A 2QG9B 4BKPA 3MWGA 1B0TA 4NJMA 2BASA 5IKOA 2NOAA 3ODGA 2INGX 4G1UC 1T03A 3P8ZA 1LTAC 3NRJA 2J0EA 3CLUC 1M0WA 2FCRA 1VIOA 3WRWA 5IAEA 3UAGA 2XUIA 2FVSA 2QTHA 5JNUA 3U1TA 2OZLB 1M1KQ 2QTZA 2AYXA 3ZW7A 4RPLA 3JSAA 5JMNA 3CG0A 4E5SA 1G60A 3ML1A 4IZIA 3W2VA 5EGNA 2IV3A 4DR1B 3CU5A 1PBUA 2IW1A 5CHEA 2RKWA 1G8KA 4AZVA 2XPCA 3K0CC 3NVDA 4E03A 3K73O 3LOUA 2CLMB 2P7JA 1DOAA 3GV0A 2H65A 1KK3A 2BEVA 3N8HA 2DHDA 3H18A 2OGSA 1QHYA 1PFIA 4F8JA 1L0NG 5U4XA 1U7OA 1UK8A 1LPBB 5JXJA 3OFGA 3LXMA 3QKSA 4HB2A 1FDUA 1LNQA 3BCUA 2G71A 1DJPA 1XA3A 3P19A 4JR0A 2HHWA 4YT4A 3W79A 3OQMA 5JI3E 4QPCA 3EDRB 1S1TB 2IPMA 1MFPA 2AJBA 5AXNA 2BI4A 1IUKA 1VBFA 4CIOA 3ID6C 2P6OA 3UKDA 5T8KA 1XMOF 4ZVQB 1Z0FA 5JPDA 5KX5F 4NEHB 4N3GA 4JGIA 2L08A 4N4AA 3ESDA 5CDFA 3OZEA 5ILOA 2PX6A 1W1IA 5D15A 2DB3A 2DNLA 2FP4B 5KOHA 3RFFA 1FP4B 3QY9A 4IDFA 1BWSA 4R3UC 5HGJA 4OAOA 3L5KA 3Q8WA 3ZN2A 2GBLA 2HRUA 4WLUA 2PZEA 3PJFA 4LF9J 1CRLA 4QUJA 2PH3A 3MZ0A 3UB2A 5IZ4A 1TKTB 4LG1A 4A0RA 5DI3A 1TA9A 2FPIB 2E43A 4M53A 2F3TA 1PKXA 2IDEA 4YMVA 4K28A 3BYZA 2PZKA 1KTVA 4WZZA 5I42A 2DXFA 1O4WA 2E5HA 2JP3A 1EJBA 4QUDA 1VB3A 1I1HA 2KIKA 1Y8CA 3RYTC 1TGVA 1VISA 1YQEA 2UUTA 4O0IA 3O5TB 1WXWA 4POAA 3C70A 2OXEA 3TQTA 3H59A 1MLAA 5K4GA 2XVZA 1BS2A 1NV8A 2PLNA 5COBA 4DZDA 2MDAA 3NMRA 2V7XA 4CPDA 3NRCA 1FNSA 4KGVA 2CDRB 1G4CA 1H0TA 3NASA 1HQEA 4F3KA 3A9UA 4MUYA 1PT6A 1YQ4C 1MPXA 1T9XA 2ZWIA 2VYQA 3ZUGA 5ESRA 1FE6A 4L4UA 4ALJA 5JC1A 3JYTA 3E9NA 3RVDA 1S8AA 4E2YA 1HI0P 2ERXA 1MG7A 2J85A 3ZU3A 1L7OA 3PLAE 1UMBB 1ICIA 1JKJA 3S1AA 1DKPA 2WHPB 4N65A 3S0JA 2ZUUA 1DBSA 4G0YA 1Q12A 1Q7LB 2A45I 3W9SA 4PG5A 5L1LA 4HGZA 2HAIA 3I6ZA 3A2NA 4Z2YA 3M2PA 1TVRB 4YXWD 4XVQA 4TRNA 2C04A 4OHUA 4ERDA 3DDSA 1DAOA 4PXSA 1C7FA 1XNRF 1A4IA 5IANA 4Q4LA 2W0SA 4FF2A 4EGCB 3MK31 3OMWA 3DHEA 1ZH0A 2F8HA 4L08A 4LRBA 1WSDA 4EJSA 3FA2A 4C7OA 4I64A 2ZQZA 3H17A 4NU6A 1I7QB 1EDKA 3OOYA 1QO7A 2I54A 4K6MA 1LQ2A 1Z7GA 5LBIA 3O8NA 5GJVC 4HL6A 4MITA 5DBIA 3NW9A 1RPZA 5AR1A 2XQJA 3MM9B 3ZW9A 4HXGA 2V7VA 2CXEA 3TMKA 1R0AB 1MA3A 2GESA 3FM9A 3HO8A 3PGXA 4I4TA 1NAHA 4CF3A 1YQHA 3KL4A 4JQCA 4HG2A 4MR7A 4RL4A 3MTAA 4QBIA 1SQXD 3ICPA 2WNIA 3M6WA 4YUYA 2Y9MB 5F8LA 2XA2A 3PFIA 1O5TA 2GAGC 3W8EA 2BBEA 1POWA 3CW2C 1K92A 1DIBA 1ZFNA 3KQOA 1OU0A 1G8SA 4B6PA 1G7CB 1TEXA 1PNTA 2WSFC 5LQDA 2NPSA 5DP1A 1M5PC 8OHMA 4BWGA 2VSOA 5LB2A 2RHOA 3RRBA 4OWFA 1GU4A 1F8GA 1DH3A 1UFKA 1LZKA 2WPNA 1W2GA 2KDOA 2XXBA 3A1DA 2QIFA 1HQCA 3CVXA 5K51A 2C9BA 4GWLA 3GFTA 3DLLQ 1EHWA 5M2QA 4EU0A 4M1YA 1WUJS 1WELA 5JRDS 2P2DA 5CEEA 2BGWA 2Z2JA 3H9GA 2HDHA 3A4IA 3QGIA 2IM2A 2ZBIA 1Y47A 1K9MQ 3JCUH 2DFKB 3Q9NA 3HD7C 3QMMA 3AI1A 3HI4A 4J0FA 5HRUA 3I39X 1TUGB 4RTSA 2GASA 1ZD8A 2AOTA 5GMEA 3MWBA 2IA6A 2JW5A 4URQU 4MI3A 4QZVA 2XUFA 4R83A 3N5FA 4NBRA 4L3OA 2BHSA 4DR2J 2A0FA 1VHWA 5A6SA 3DTVD 3RYFA 1STOA 2WAQD 1N9KA 4P82A 3ZD7A 2D0DA 4RW8B 2PUTA 3COVA 1GZVA 3GX1A 4NJEB 4UHFA 4NBWA 4KHPB 4MEJA 2BZSA 3CX5D 4OAPA 2X8BA 1SD2A 1SBZA 5BR4A 2I1QA 2ID4A 2Q7CA 4MZDA 5DXAA 1OGYA 3JSBA 3LDGA 4D9FA 4MJ3A 1IG3A 4GC6A 4FFRA 3AYXB 4WIQA 4HT7A 4RWEA 1SVDA 4V0SA 1OAOC 3LQYA 4OGQD 1K73Q 2D13A 1KOGA 3OPMA 3N7AA 3UFCX 4MEBA 2UUCJ 4WCFB 2AE2A 4DPTA 4QDZA 2O1KA 4X2BA 1ZUNB 3GYBA 1KYIA 4JYAJ 4KLAA 2QNIA 1WV1A 2QN8A 4EKDA 2KB2A 3HABA 1TKRA 5ETOA 1ULHA 1BC5A 1X14A 1SZJG 3LA0A 4GVBA 4HDMB 5IC6A 1UFWA 1HDZA 2HSEA 1IKYA 1KGDA 1XI2A 3K5MA 1PV1A 5DTIA 2J0SA 1EZVE 4I2QA 4JP8A 3D66A 1M90Q 4KWEA 1K5PA 1X1AA 1K9MT 2G04A 3GCWP 5AVWA 1BWRA 4J94A 3UJPA 1CRQA 3USCS 1ZEJA 1PEKE 3BGFA 3JQCA 3GLFE 4OPMA 5K0FA 4DMLA 3ZEIA 4C07A 2QRLA 4BRZA 2PFGA 3HVUA 4RU9A 3F2VA 3JD4A