2AEFA

Crystal structures of the mthk rck domain in ca2+ bound form
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
224
structure length
221
Chain Sequence
RHVVICGWSESTLECLRELRGSEVFVLAEDENVRKKVLRSGANFVHGDPTRVSDLEKANVRGARAVIVDLESDSETIHCILGIRKIDESVRIIAEAERYENIEQLRMAGADQVISPFVISGRLMSRSIDDGYEAMFVQDVLATRRMVEVPIPEGSKLEGVSVLDADIHDVTGVIIIGVGRGDELIIDPPRDYSFRAGDIILGIGKPEEIERLKNYISALVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-gated potassium channel mthK
publication title Structures of the MthK RCK Domain and the Effect of Ca2+ on Gating Ring Stability
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Metal transport, membrane protein
total genus 73
structure length 221
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02080 TrkA_C TrkA-C domain
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.870 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Voltage-gated potassium channel 2aefA02
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2aefA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2aefA01
2J6IA 1DIBA 1TXGA 4NIMA 3WMXA 5DN9A 4BO2A 5JY6A 5GY7A 2C2YA 3EHEA 2XXBA 1XU7A 1DIHA 4PZEA 3MTJA 3JQFC 1HDRA 3BHMA 4Z0PA 3D64A 2JD2A 3ST7A 1QP8A 1HKUA 3E6AA 4EJ6A 2RAFA 4Q3BA 4QO7A 2W98A 3SJ7A 3JD4A 3PTZA 1BVRA 1AHIA 1T24A 3OETA 5F1OA 2BRUA 5H81A 3C24A 4AJKA 3S8MA 5H82A 1I2CA 3ULKA 4F6LA 4L74A 2D1YA 1KEPA 3TZKA 4HNGA 4ZU3A 2HMSA 3C1TA 3UCXA 1DRVA 1HETA 3AUAA 2QW8A 1EQ2A 4UVIA 1N92A 3OJFA 5ENDA 1HRDA 2NM0A 4XKJA 2UDPA 4MVJG 5ILOA 4MVJF 1JDJA 1B3BA 2BI8A 4UAGA 3SC6A 4Z9YA 1PQUA 1RYDA 3TDKA 1PTJA 1KVUA 4ROSA 5GMOA 4DWVA 2AMFA 3GPDG 1H9BA 3DQPA 3GK3A 1HE5A 3ZNNA 2I6TA 5IN5A 4E33A 1WWKA 3IL2A 4XJSA 4W7HA 4YT8A 1ONNA 2QZ9A 3RVDA 4UVDA 4BS9A 1YL7A 1OI7A 1Q7BA 1ZK3A 3GVHA 1QSGA 1E7WA 3DBRB 2EJWA 1QYCA 4DRYA 3EAGA 3BMCB 5L4SA 4D46A 4ZVVA 1Y6JA 4D43A 1PWZA 3FF4A 2Q1UA 4WASA 3LT4A 1ZEMA 2O2YA 5JO0A 4QX6A 1HDGO 2NUAA 2WJPA 2ZYAA 3DMTC 1MB4A 3TOZA 4NDNE 1DPGA 4NU5A 1TLTA 1HYGA 3OIDA 2YUTA 1QMGA 4HY3A 1BDBA 1SNYA 4R51A 1HYEA 2ZATA 1LRLA 2EW2A 3A4VA 4BB6A 4JNKA 3OEYA 5JDCA 3GVPA 4J4TA 4WCFC 4WLUA 1DHTA 4AJIA 3KSZO 3KVOA 5DNAA 1AHHA 3OBBA 4MP6A 4R4JA 5FI5A 1UJMA 8ADHA 2NTNA 4IIUA 4DVJA 3PRJA 4FOOA 4CQLB 5AOVA 1ULSA 4XQEA 1WXDA 3S2IA 1ZBQA 4GH5A 2UYYA 1YVEI 4MVJP 4O0LA 1A4UA 5CDUA 3PYMA 2OBYA 4R9RA 3NT5A 4XRGA 5IZCA 3HQ4O 1YJQA 4QXMA 2AQKA 4J7UA 1YBAA 4ALJA 5A9RA 3VPGA 4FD3A 1HSOA 4RPGA 5ILGA 4XDYA 3RCBA 5CAEA 2ZTVA 3UCFA 1E5QA 1IL0A 4HFNA 4RVGA 4E6PA 3IJRA 2HMWA 4BO0A 3RC9A 1WP4A 5JDIA 5T6BA 4TWRA 4CM8A 2UUOA 1I3MA 4PG8A 4BKOA 5KKCA 5C3MA 1YBVA 1HZZA 1QYWA 4RDHA 3LF2A 3JCZA 3RFXA 1ZK2A 1O5IA 3HUDA 4KQXA 5JYEA 2VUUA 1L1FA 2ZQZA 1NHWA 3DFUA 4GGOA 2P68A 4NBVA 4FR5A 4BO6A 1DEHA 3RBVA 4TZKA 3TRIA 1NYTA 2DTXA 3M1AA 5BNIA 1U3TA 4IUYA 4KTTE 3PDJA 1RYEA 1A7AA 4LISA 1B8PA 3WQRA 1JWAB 1YGYA 3GMSA 1E92A 2EXXA 2JHGA 3CMCO 2H63A 1JKFA 2FPIA 3MJCA 1MV8A 4XIJA 2D5CA 1JWBB 2HSDA 5C7OO 4XYEA 1ISIA 3PDUA 4IJWA 5GZ1A 1A5ZA 3E18A 5L4LA 1HE2A 1C14A 1HL3A 6ADHA 3GNQA 3W4JA 2DC1A 3E5MA 4CM9D 1BXGB 1LC3A 2EERA 3PHHA 3WLFA 4XD2A 1T1SA 4JLWA 3LSYA 2Q1SA 3UW3A 4BO1A 4JQCA 5I8ZA 1H6BA 1YWGO 2C7VA 2XOXA 3ZWOA 5IN4A 1NXQA 4FDAA 1F14A 3D3WB 2Y1GA 1E3SA 1SMKA 2W2KB 4UREA 4HBGA 4CMEA 3LC2O 3UH1A 4P22A 1HWYA 2V6MA 2W2LD 2X8LA 2RHRA 5CEJA 4NJMB 3KRTA 1JVBA 2WM3A 3H65A 5JYDA 1X7GA 2AW5A 5L51A 1E0DA 1U5AA 3AM3A 5KTKA 5DZSA 2O4UX 4Y67A 1UZNA 4A0SA 4XB1A 4K9DA 1IHXA 5DBIA 5L7WA 5EINA 3VHRA 3JXOA 4EITA 3AUSA 4IINA 4CODB 1ZO8A 1MC5A 3K2EA 1ISGA 3PLRA 5CDGA 2C54A 2VNAA 4RVHA 3ZNQA 4CM3A 1LBEA 2GGSA 2P9EA 4NG5A 4LGVA 4WLFA 3G1UA 1C1DB 1QV7A 3VH3A 4F3YA 3DZFA 1IPFA 1O9BA 1Y9AA 3GVIA 5A05A 3WQQA 2DUUA 3E5RA 1QXSA 1ADBA 3BXXA 4E5MA 3ZN2A 3C1OA 4YVFA 2Y05A 5B37A 3FWZA 1PZGA 3RASA 1IULA 3TZHA 3ENNA 3TFOA 1UXJA 3VDQA 2PKQP 4I8XA 1OC4A 4XYGA 3CEAA 4AL4A 3T7CA 2VHVA 1CERA 1IB6A 4RVUA 4S3MA 4B3JA 1LSUA 3QSGA 3JQAB 5CG1A 4EUFA 1QV6A 2GZ1A 2G0TA 3IUSA 3T4EA 4P8RA 4YRBA 3G3EA 2RBEA 4IPTA 4NBWA 3F1LA 3ZWCA 1PJ4A 1ISFA 1MGOA 1LX6A 1KS9A 2LDBA 3E9MA 3MJVA 4YXFA 2HK8A 3GRPA 5I7VA 1P1KA 3BMNB 3GAZA 2C7GA 4HX5A 2VYVA 5AXDA 1LRJA 1XQ1A 4IBOA 4YJFA 3PFWO 2Y1FA 5IJZA 4Q3EA 1VSVA 4M89A 4CLOB 4HFRA 1TA4A 4LCEA 1XR3A 2B83A 2WTBA 3GR6A 2O4CA 1VL8A 3WGIA 4IQGA 2GASA 3EW7A 5FFFA 1B8VA 2OP1A 3EUWA 4E12A 4HUJA 2GZ2A 4EEXA 3VVCA 4CM7A 4Z3KA 4U6SA 1BMDA 2X9NA 4H16A 4BNIA 2J3IA 4ZQBA 3Q9UA 3RU9A 3RIHA 3GDGA 4J3FA 2GN6A 4ZICA 3VH1A 5CG2A 3KYCA 4JJGA 3RJ5A 3EDMA 3PI7A 1C0LA 3MJTA 4M87A 4S1VA 4MO2A 4CMJA 4ZRMA 4B4WA 5JFOA 1GADO 2C59A 4B4VA 5DP1A 4R1TA 3QVWA 4B7XA 5L53A 1TT5B 2VHXA 4CV1A 2WE7A 4J91A 4M1QA 1WZEA 5CDTA 2I3AA 2V65A 2Q46A 1WDLA 4GX0A 4BNUA 3SBOA 1Y8RB 1YXMA 2QRLA 3E1KA 3DWFA 3IKVA 4E2XA 2DBQA 4J0FA 5G4KB 1GUFA 3C85A 3B70A 3AOEC 4RQUA 1LDYA 1PJTA 3CIFA 1CQJA 2YYYA 1E3WB 3AM4A 2GR9A 1EK6A 2VZ8A 5TQVA 1PR9A 2NTVA 2Q4BA 3TNLA 5LCXA 5A9SB 1P1IA 2BKAA 3QV1A 1E3LA 2B36A 1HSZA 1KOLA 4YRAA 2X5OA 4NJMA 3ZWBA 5TT1A 5LDHA 4ZA2A 1XCBA 3LK7A 3WYBA 3OQ6A 1IE3A 5F1KA 3VTFA 3PXXA 3DZIA 5ES3A 1VJ1A 1Y8QA 4KZPA 3WWZA 2QYSA 3COSA 3FN4A 4GVXA 4XGKA 3FR7A 4XGIA 2J5KA 3AY6A 4OM8A 2PGDA 4FB5A 3L9XA 3HSKA 1ZJYA 5AXAA 4AJ1A 4BNXA 4CLDA 4J1TA 5A4DA 5FEUA 1DBVO 3DMYA 3AFNA 3GVCA 3NAQA 1J4AA 3OECA 5G0WA 4D45A 2IEDA 4CQMA 2DM6A 3WICA 1LUAA 2Y68A 3I6QA 3QQPA 3KLPX 4YQYA 3QLJA 3OF2A 3QWHA 4O1MA 5KJFA 1T4BA 3ZW8A 1CJCA 4G2NA 1C1DA 2CVQA 4OSOA 1LLCA 5F5LA 5KVSA 2IYOA 3NYWA 3R3SA 5AYVA 3DZBA 4R54A 4Y6SA 4PLCA 2BFAA 1Z7EA 2GDZA 4O59O 5EERA 3OA2A 2ZB3A 4NJOA 2F1KA 1JAYA 1FF9A 1XDWA 4CMGA 3GFGA 5G0VA 2FZEA 3CPSA 1AE1A 3M6IA 3K30A 1CEQA 3JQAA 4FC6A 1XYGA 1EE9A 1E7YA 3NTQA 3U4DA 3RI3A 3WQSB 4DBZA 2O3JA 4W99A 4JROA 4BMVA 3L4BC 3VZSA 2ZYDA 3CSDA 2WMDA 2NVUB 3JYNA 5K9ZA 4HKTA 3BMNA 3PYLA 4OO3A 4XR9A 2YJZA 1DFIA 1NPDA 1UZMA 5TRTA 2VNSA 5IFLA 4PZCA 3UUWA 3LT0A 1HXHA 3DZKA 3GUCA 4OMUA 4TSKA 3EY4A 4FPXA 4PG4A 3D3EA 4EDFA 1Z7BA 3GUYA 1WW8A 1LDBA 4ALLA 5ADHA 4TROA 3WX0A 1T2CA 4BB5A 5KKAA 1SZJG 1J5PA 1SCUA 4E2YA 4ALNA 3K8ZA 1NAIA 2D8AA 2E6UX 3FBTA 2IXBA 2VZ9A 1P1JA 1OMOA 4JP2A 4DLLA 4EZBA 1EK5A 1KY4A 3ZWXA 1NFFA 2YHIB 1N9GA 1Q2XA 1W0CA 1WMAA 3RUCA 3GQVA 3S2GA 5JS6A 4BNZA 2Y0EA 1PGQA 2ZTLA 1U1IA 1R16A 2NVWA 3ZWPA 5TS3A 4CMAA 2DBVO 2DQ4A 1W4ZA 4YAEA 5MDHA 1N2SA 2Q99A 5T8KA 3AUUA 4WNCA 5KOIA 4FJ2A 1RM3A 4BGEA 4J7XA 1LQUA 1ZFNA 4G5HA 4E32A 3O03A 4LRSB 4FS3A 2J5QA 4IZHA 3WOHA 4ZGWA 3AUTA 1EMDA 1KC1A 4TVBA 4E3ZA 3DOJA 5A5EA 4HNHA 4NR0A 4DLBA 5A9SA 4OJNA 2JD1A 3BAZA 2AE1A 3CMMA 4JBHA 3D4PA 4LRTB 1UZLA 5FWNA 4GL4A 4MIYA 3OJ0A 1ZSYA 4WE3A 2EW8A 3CINA 4PLFA 5AVOA 2JHFA 2DU8A 2QG4A 1G0NA 4B4UA 2H6EA 8LDHA 3ZV4A 2AEFA 1ISJA 1S7CA 1ENPA 4N5LA 3VDRA 1EQUA 2PV7A 4L76A 2NLOA 3GY0A 4PG7A 3BTSA 4AJLA 2YDYA 3OH8A 2VYVD 5AXCA 4OSPA 5L45A 4CUJA 1N5DA 1Q7GA 4BNNA 5C7LO 1I24A 2RHCA 3AU8A 3ON5A 1U3UA 1KERA 3R6DA 4WKGA 5HTOA 4RLSA 3ROQA 5A5FA 2X5KO 1P44A 4RJTA 1RM0A 4A10A 1CWUA 1KEWA 5CEEA 5DOZA 2QIOA 4FJ0A 1ENYA 1T2FA 5BT9A 3H5AA 1NBOA 3DHNA 1ZXLA 1JKIA 3IUPA 3OEWA 1VKOA 1QORA 1ZKMA 2B5WA 4KUEA 4CLRA 3U5TA 4EUHA 1MLDA 1O8CA 1VJTA 4MINA 4YAGA 5JAQA 2OXIA 2CUKA 4Y9DA 4OXYA 2OL4A 1OFGA 1U7HA 2G76A 3PIDA 2X9VA 2ZYGA 4K1LA 3IOYA 4P4LA 1X14A 4D44A 4MP8A 3WGQA 3JD3A 3H2ZA 3PJFA 4AJ4A 4MKZA 2IDZA 4J9VA 1NPYA 2NU7A 2H9IA 4XGNA 3VH4A 4MPDA 1RKXA 5LDGA 4FCCA 1K89A 1ZMTA 4BO3A 3U3XA 2E49A 2QQ5A 3ADPA 1PJ2A 3A06A 1P33A 3F4BA 3LLVA 4R1NA 3IP1A 1YBMA 4J4HA 5I7EA 3EZYA 3AJRA 3UXYA 2P5UA 3O8QA 2CNBA 2BH9A 3ETDA 1XKQA 2NWQA 3GN2A 5JO9A 4AFNA 1PGPA 2PH5A 1T4DA 3HJAA 1DSSG 4XQCA 5EIOA 3NDJA 5JMWA 1VM6A 1Y7TA 1LDGA 1DAOA 2G1UA 3JYQA 1QR6A 1A9YA 5A06A 1PS8A 2DBZA 4KUGA 2HMVA 5A3VA 1GTMA 1LDEA 2VT3A 4CV3A 2B0JA 2YFHA 2UAGA 4CR8A 1D7OA 1N1EA 3N7UA 4PIVA 4B3IA 3ZGYA 4J2OA 4BKQA 2HJRA 1DJQA 4MVJH 4E2ZA 3D1LA 3FI9A 4WCDA 5HRUA 1H2HA 2PD4A 2BFPA 4IXTA 4IQ8A 3C7CB 1DLJA 3KXDA 3W6UA 1Q0QA 5EPOA 5DT9A 4KDEA 2QYTA 4BV8A 3JQ7A 3PFFA 2UVDA 3KO8A 4YR9A 3NGLA 1H2BA 3E82A 4YYZA 4CUZA 4R69A 4K6CA 5KNLA 1B7GO 4JBIA 5G2OA 5DDIP 3U0BA 5A03A 5C5IA 1BW9A 4B79A 3HFGA 1NVGA 4YT2A 5JDCC 4IMRA 4OYRA 1FDTA 3WJ7A 1GPJA 1PZFA 4GMGA 2VQ3A 1I3LA 4TRMA 3DHYA 3JQAD 5DP2A 4YJGA 2CDCA 4YBZA 2QRJA 1RPNA 2VHZA 4II2A 4L73A 1GYPA 1DC6A 1PEDA 1X7DA 2ZIZA 2JFGA 5AQ1A 2HCTA 5BQFA 1ZK0A 3DXFA 1J49A 2BKPA 1XWFA 2B37A 3RUIA 3K92A 2X23A 2R00A 2YQ4A 4DBVO 3HB5X 1LEHA 2VRCD 1U3WA 2CZCA 1TI7A 2FHSA 3AY7A 1YB5A 4B4OA 3ZWVA 2VUSA 3MJEA 3CXRA 5IZCC 1EUZA 5F5NA 1X0VA 2FOIA 2JFFA 3JSAA 4B7UA 4YPOA 2X5JO 4ILKA 1YB4A 3U49A 1I8TA 1WDKA 3F6YA 1DO8A 3GT0A 3OP4A 2OP0A 1H6AA 1EBUA 4UEJA 1LSOA 1TVEA 1UDBA 1CQIA 5JDIC 1SEPA 4R16A 2FR1A 1JTVA 2A92A 4YDRA 4KOAA 5JPIA 2GD1O 2Q2VA 3CKYA 5CFZA 1L7EA 2E4AA 2O23A 2Q50A 2ZK7A 4QQRA 4MIOA 1R4NA 5IDXA 3UF0A 5B4UA 5K6AA 1G1AA 3DBLA 3UHAA 1B0AA 1XSEA 3E8XA 4PZDA 3G17A 1R0KA 3QIVA 1DAPA 2VWQA 1P1RA 4ZQHA 1LA2A 5HM8A 2FMUA 1P77A 4A7PA 2TMDA 1XQ6A 3L6DA 1ZMOA 1P1FA 4K28A 1PL8A 2I66A 5BNTA 1NASA 1GZ6A 4NFYA 3KEQA 2W90A 2RH8A 4IS2A 3CZMA 2XF8A 3LYLA 4W82A 1DDOA 3GOHA 2Y1OA 3LQFA 4DMLA 4EJ0A 3JQ9C 3L4SO 5T64A 5I7FA 3JQ6A 3DB2A 1Y5RA 4BV9A 1P45A 2P2SA 3QHAA 4RL6A 3I52A 3B1JA 2BKOA 4XYMA 5COBA 3BTOA 3HN2A 4E13A 1GFSA 2AA3A 3RC7A 2PZKA 2HK7A 2IE0A 1AXGA 2X9GA 3N58A 3OICA 5TGDA 3SLGA 3I3OA 4I5FA 1A9ZA 4FFPA 3WFJA 2OZPA 3OQ1A 3GPIA 1JVSA 2PZMA 3I1JA 1Y9EA 3I23A 5EQFA 4R3NA 2I65A 4WUVA 2GN4A 4CMEC 1UXHA 1MP0A 1U3VA 2Y67A 1Z74A 3DEYX 4RORA 4E21A 1PJQA 5B4VA 4Y6RA 1C3VA 2CMDA 3BMQA 3L6OO 1UR5A 1SAYA 2EV9A 3W8EA 3WDSA 4CMBA 2AQIA 1HF3A 1X0XA 2DUWA 3O4RA 4PLWA 1EVJA 4XTTA 4NBTA 4Q3AA 1ZXBA 4JXKA 1NVMB 4O63O 1Y1PA 2VZ0A 4QTZA 4EW6A 3E9QA 2GRAA 3MOIA 1YS4A 1M66A 3TL2A 1VL6A 4WOJA 1V35A 4YJFB 2BGMA 4NK4A 1U4SA 3PQEA 3RC1A 1RJWA 4IDAA 2P4QA 4ALMA 4BNYA 1GZ4A 3KSDO 4N54A 1M6HA 4DL9A 5KJ6A 3GHYA 4FGSA 4L4SA 4WGGA 2OFPA 3DZHA 1ZEJA 3WG9A 4ZHSA 3WR5A 5TIIA 2V6BA 4XEHA 4DQUA 3RSHA 4F45A 1H94A 4X54A 2QHXA 1R66A 2ZTUA 1R12A 3OM9A 4RZHA 4MJLA 5I9MA 1CYDA 1YQDA 2WYUA 3STHA 4B7CA 3IC5A 4PLHA 3TPCA 3KYCB 4RF4A 2X1HA 2VHYA 1BHSA 1LSJA 3KSUA 4WLVA 5TLSA 3KBOA 1MFZA 4TKLA 4IIVA 4ZQFA 2D3TA 3FNFA 4BO5A 1I2ZA 1PGJA 2DBRA 3PLNA 1LQTA 2V6GA 3RBZA 1LJ8A 1VI2A 4DC1A 1ENOA 1I32A 4GQAA 4DA9A 4DLAA 4YTEA 2Z1MA 4BNLA 1B3RA 1T26A 2HMUA 2F00A 1CF2O 4UEKA 2E37A 1PJ3A 4CM5A 3QVOA 3AWDA 4TRJA 3HHPA 4GWKA 2Y1EA 3K73O 4ND5A 1C0PA 3NKLA 2I99A 2C20A 3P7MA 3ZV3A 4YT4A 3X2EA 2P4HX 3Q9NA 4FSHA 2WE8A 2NQTA 1K3TA 1BTOA 1NM5A 1Y8QB 4ITUA 1P3DA 3VVBA 1D1TA 3CTMA 3OQBA 1VC2A 1GY8A 4RPHA 4CMCA 5IDWA 2VTEA 4EBFA 1PGNA 3JQ8B 4FIZA 1UDCA 1NHGA 4E2WA 3AK4A 4CLXA 4WNIA 4YAJA 1IOLA 1MX3A 2GN8A 2VWPA 4WOKA 3U4CA 4CQMB 4WEQA 2EF1A 2QX7A 1QRRA 3GA0A 4CJXA 1U2DA 2C82A 3I6IA 4N5NA 1H93A 4IJUA 4RV9A 3TF5A 3EC7A 3WWYA 4D79A 3G0OA 1NQ5A 1PX0A 5KWEA 3T4XA 2ZB4A 1OBFO 3IQDB 2GZ3A 2FP4A 1KEUA 3Q2IA 1VLLA 1XIVA 5ITVA 1GQYA 4ZD6A 1F0YA 3FTPA 3K6JA 4L0QA 1IHYA 4LCJA 4U5QA 1SC6A 3HE3A 1HDCA 3V2GA 4A73A 1DIGA 1GUYA 2OO5A 4NBUA 4MP3A 3ANLA 9LDBA 3JYOA 1FDWA 1MUUA 2GLXA 4I5EA 1GV1A 4H7PA 2GPTA 4BKRA 2POQX 4D41A 4NQZA 1DIRA 1ZSNA 2NACA 2CFCA 3OIGA 4HXYA 3VAZA 3QY9A 1GD1O 1MXFA 3W1VA 4A2CA 4RPJA 2A35A 3GAFA 1JKJA 1LXCA 1MFPA 4CV2A 1B14A 5CEFA 5KJCA 6LDHA 3QRWA 4M86A 4D7AA 3Q11A 1CDOA 4OKIA 3VZRA 2B5VA 4PLZA 2HRBA 3QE3A 4YJDA 2IYPA 3V1YA 1Y81A 3PP8A 2DPGA 1Z45A 4TRNA 4NHEA 4RF2A 3A14A 2FPGA 4RF5A 2GSDA 4E31A 1UXGA 2CDAA 5TJHA 4BNWA 1YKFA 3EZLA 4DXHA 1N9GB 1K2WA 1PQPA 3FRJA 5ER6A 5JY1A 1Z75A 5K0ZA 2CD9A 4ZRNA 2O3UA 3OHSX 5DCWA 4Z0TA 3KOUA 3F1KA 4DQVA 4PG5A 1FJHA 4OL9A 1G6KA 1A71A 3IS3A 7ADHA 4J0EA 3PVZA 3SXPA 2RIRA 4WLNA 2O3RA 2I5PO 1XELA 3DO5A 1MG0A 3SVTA 4UVGA 1FDSA 3VTZA 4AICA 3JQBA 1B26A 5BNFA 1LC0A 1GUZA 5IF3A 4P38A 1HZJA 4OAQA 3C7AA 1DC3A 3DZJA 1SPXA 3D5QA 1PR3A 4DYVA 1R6DA 2CY0A 1AN9A 5EJ2A 2G5CA 3INRA 1YJ8A 4JP3A 3U4HA 1R0SA 5B4TA 2YQ5A 4L9RA 4MDHA 2O7SA 2R6JA 1PJSA 4QECA 3JQ8A 2YV1A 2CVOA 2HAEA 1VPDA 2IZ1A 1X1TA 1U8FO 1HDZA 3KUXA 3R3JA 2Q2QA 4AJHA 5JC1A 3CE6A 2V6FA 1HE4A 1ENZA 3ZHYA 3TQHA 1KETA 4QFCA 3U62A 3K31A 3D4NA 5T8KC 3FNHA 4DGSA 3PJEA 2C5AA 4J1SA 2OBNA 3OJEA 1MXHA 5DBGA 1P1HA 3E9NA 3QVTA 5THQA 4PLTA 5GZ6A 3GZNA 1HT0A 2VWGA 3A1NA 5L7YA 2AEJA 1RWBA 2FPPA 4RPLA 4YACA 4FFMA 2BMAA 5CP8A 3Q2KA 4CLRB 4XA8A 4XX0A 5JLAA 4OKNA 4TQGA 1BXKA 5IG2A 2JL1A 3F9IA 3DAPA 1JW9B 1E7MA 3ZZNA 3DBVO 1ZIDA 1GZ3A 3D4OA 5DF1A 2DFDA 1E7RA 2PKQO 2HK9A 4J43A 1QLHA 3MZ0A 3MTGA 2HKIA 2Z1NA 2WYWA 4IDFA 4LSWA 4E4YA 2Y1DA 4F46A 1DRWA 2PA3A 2SCUA 3I9LA 4OQYA 4BNHA 4BO4A 1H6DA 3RUDA 1O95A 1V8BA 4BL5A 1VCTA 1X1EA 2VWHA 4BGVA 4XWYA 2B35A 3OIFA 3O8QB 5COAA 3WYCA 1D8AA 5ICMA 4GGPA 2EKLA 2WYVA 3RUEA 5JC8A 2E48A 4OHUA 2O7QA 2DVMA 2BGKA 1VSUA 2YZ7A 1GCOA 5CDYA 4W9NA 3KV3O 3ZH2A 5L4NA 3AY3A 1UXIA 1N1GA 4ID9A 3G79A 1T2DA 4ND3A 1YOVB 1GU7A 2FSSA 3WXBA 4R1UA 3LVFO 4IXWA 3I9OA 1ADCA 1FDUA 1CETA 3ZW9A 1GDHA 3HADA 4GX5A 2A94A 1Q1NA 3PWKA 1D1SA 2VUTA 4J1NA 3RUFA 3QWBA 4LVUA 4WJZA 3ICCA 1E3EA 2JAHA 5ENVA 2PR2A 2BKNA 5DCUA 4BKPA 5KJEA 3KM0A 1YB1A 3AOGA 2D59A 3LC7O 4LVCA 4UUNA 3JQ7B 4OOFA 3HDQA 1JQBA 2JD0A 3PWSA 2ZB8A 4D3DA 4PLPA 3R0IA 5ITWA 1GEGA 2IXAA 5L95A 3AM5A 4XDZA 1WPQA 5TJ9A 5COQA 3DOCA 3ZWAA 1BW9B 1I0ZA 2X86A 1NPTO 1R4MA 4XYBA 3VPHA 4YJGB 3AI3A 5G0TA 4MVJE 1LLQA 2VCYA 3L9WA 4CMKA 1WLYA 1V0JA 2FRDA 4DIFA 3I9NA 4CLHA 1LLDA 1QLJA 5H83A 2PNFA 3W6ZA 1LDNA 3GC6A 2J3JA 2ILTA 1KVRA 4P4NA 3ZDFA 1N7HA 3RD5A 2NQ8A 4D0RA 4I1IA 3KYDA 5J23A 1OC2A 1IZ0A 2YV2A 3SX2A 3I9MA 3INGA 1U9JA 4BO7A 1V9LA 1C1XB 2EEZA 5EL0A 4R5MA 3ETGA 2X0IA 3DOOA 4U6QA 2PZLA 4J2HA 3PK0A 5I8WA 3L4BA 3QA9A 1LI4A 4ND2A 1I33A 4GWGA 2HMTA 3P5SA 3L0DA 3INTA 3FSRA 1A27A 2VTDA 4NZ9A 1DLIA 1Z6ZA 2O3TA 1HLPA 3MOGA 4XQGA 4OH1A 4J49A 1R4NB 1I01A 4PVDA 4GSLA 3ASVA 1T1RA 3NT4A 3DBLB 3E48A 2PGLA 3BHIA 3DZGA 1E1KA 1WDMA 4CM4A 4AJ2A 2Z5LA 4EI2A 1VE9A 2YY7A 3ADOA 2PGJA 1TB4A 1E6WA 4QFDA 3GDFA 2R00C 4RGBA 3PJGA 4AJNA 3IMFA 1NAHA 1YE3A 2PFGA 4BO9A 4IJKA 5L40A 4NU6A 1WAMA 3GEMA 5C37A 3IDSA 2XAAA 3ONEA 5IXSA 3HDJA 4GLOA 2I67A 3CZRA 4OOEA 1UP7A 1ZNQO 2E82A 3ZCXA 5KVQA 4DMMA 2OHXA 1A72A 3P2YA 4IGEA 4DYDA 3TN7A 3TJRA 4BNJA 5HS4A 1EEHA 4JN6B 1E7QA 2NU6A 1YOVA 2XPCA 5KJ1A 3GNSA 4AJEA 3UKOA 4G81A 3F3SA 3UCEA 5K6AC 4CQMD 3H2SA 3F4LA 4RZIA 4ALIA 3D7LA 1NQAO 1E77A 1PS9A 2QRKA 3FHLA 2D4AA 4I9NA 4U7WA 4BQRA 3BMQB 4LN1A 2HUNA 4TKMA 4XCVA 1KC3A 1MA0A 1ML3A 1WMBA 2DTEA 3ZU4A 4DPLA 1NTOA 3H5RA 1E3JA 1P9LA 4UVHA 1FMCA 4YA6A 3S1LA 1IY8A 3I4CA 4CMHA 3E03A 3K5PA 5JMPA 5C7IO 5JCXA 2FY8A 2WD7B 2I3GA 3H9GA 1X13A 3UN1A 1HLDA 2GYYA 4Q3CA 3QWFA 3BA1A 4GX1A 4II3A 4E0BA 3ANNA 4Z6KA 2VHWA 2OGUA 4GBJA 3IKTA 1K5HA 3HZZA 3GH3A 3R1IA 4XB2A 1Z73A 2DAPA 2CF5A 2R2GA 3F5QA 3H5NA 4JCOA 3TZQA 3PZRA 1B8UA 4IJVA 3RQSA 3LF1A 1RM4A 4KTVE 1I5RA 4RO0A 1LNQA 3IP3A 4R5HA 3TZCA 3F5SA 4UEOA 1P74A 3DTTA 1E7SA 5T67A 1EFLA 1HYHA 4J1QA 5IZ4A 1XGKA 3EVTA 2J3KA 4OQZA 3HG7A 3H9JA 4YWJA 4LK3A 1DJNA 4BNTA 4M54A 4NMHA 1C1XA 2X0NA 2OUIA 4DC0A 4H15A 4RPKA 2NU9A 2W8ZA 1GYRA 1GPDG 1V6AA 1VJ0A 1Z82A 5THKA 3RKUA 4BGIA 3WBBA 2Z95A 3ONDA 5EMHA 3ZNOA 3VKVA 3QW2A 1WZIA 4XZ3A 4A5OA 2DPHA 2IRWA 2BLLA 2IEBA 2Q1TA 5T5QA 3ZV5A 1QYXA 2GN9A 1YRLA 3EMKA 4KMSA 4HFJA 3C7DB 4HFMA 4HWKA 4BUCA 4DPMA 5A02A 4DPKA 3W8DA 1BGVA 3PEFA 4OXKA 5CDSA 2AG8A 3FNEA 2C0CA 4FFOA 4IQ0A 4RVDA 5FF9A 5BSGA 4WCFB 4ZQEA 1NWCA 2HU2A 1JA9A 3RJ9A 3OJLA 3H4VA 5JSFA 1DRUA 1YL5A 1L7DA 1NQOA 3PHJA 2FWMX 1EZ4A 1M2WA 4GPD1 3ONFA 2Y66A 1JAXA 1FK8A 5MGBA 1DFHA 3ETEA 1MG5A 4FW8A 4CMIA 3L77A 4E5NA 3MEQA 4MKXA 5KIAA 5DCYA 3WLEA 3DL2A 1PU2A 3I4FA 4Y6PA 3VH2A 3A9WA 2EG9A 4KP7A 5TNXA 4YAIA 2Y99A 4D3FA 5TC4A 5JBIA 4J9UE 2GUGA 5JCJA 1SB9A 1QYDA 3H6KA 1S6YA 3BMOB 4IM7A 4IGFA 4CR7A 4D3SA 3HWRA 4MKRA 3AW9A 3HDHA 3KHUA 1SBYA 1X7HA 1K6JA 1Q7CA 2Q49A 4ZJUA 4BNGA 5B12A 1GQ2A 4EUEA 3SC4A 3ZU3A 2EKPA 3D5TA 2FR8A 3DBHB 4AJOA 2DLDA 2WDZA 1UAGA 3DR3A 1IZ9A 1OOEA 1XHLA 5HBRA 3WIDA 2P91A 4RDIA 2VYNA 1VKNA 4IDGA 3BYZA 4UUPA 1PWXA 2I76A 1WVGA 4MOWA 1ZK4A 2Y1CA 2HRZA 3MCVA 4O5OA 4F6CA 3RFTA 2O48X 5IAAA 3WBFA 5I7SA 4R41A 4BMNA 1E1LA 3PGXA 1PJBA 1H9AA 5TT0A 3PYXA 3UVEA 2J3HA 2GO1A 1ISMA 1E1MA 4R3WA 3I9KA 1I30A 3WSVA 1NP3A 3JQFA 3UGKA 3K2BA 4RVSA 2ET6A 2WD7A 3LC1O 3ZHBA 2AG5A 3EK2A 2UUPA 3Q1LA 5F3RA 2GCGA 2XXJA 3V2UA 4E30A 4A27A 4YQZA 2ZB7A 3WGYA 1UDAA 4L8VA 1P31A 4KWIA 3UAGA 4Q39A 1UAYA 3ZNPA 3WGGA 5A04A 1P0CA 2X22A 5BSFA 3B6ZA 3FBGA 3IIEA 4UUMA 1Q0LA 2O3QA 4GSKA 4A26A 1EDZA 5BSHA 4ONEA 2C07A 4GAEA 4R68A 4IDCA 4RQTA 3MWDB 3RWBA 1HEUA 3K9QO 2PLAA 4I5DA 2JKVA 3ANMA 4RLHA 3PPIA 3ASUA 3M2PA 4CM6A 1X15A 5GZ3A 1UH5A 4N7RA 3L6EA 3FNGA 5U9CA 4GVLA 4DQXA 3ZV6A 3NX4A 2J8ZA 3WS7A 4CUKA 1V3TA 1U7TA 1I10A 3ITKA 1T2EA 3LU1A 4BNMA 3RUHA 4JJIA 3O9ZA 4AJJA 3VPXA 1UP6A 2GERA 2HDHA 1ADGA 4Z9XA 4Q3DA 1PQWA 3U9LA 3U4IA 1I3KA 3W4KA 1E3IA 2AE2A 3UOGA 4IMPA 4MVJA 4L75A 4L4XA 3ZHXA 5BSEA 3DMTA 2H1SA 1NX6A 4Y8VA 1FXSA 1PJCA 1M76A 4FOSA 1EVZA 4PN3A 4IDEA 3T7EA 4AG3A 3JQCA 1SOVA 2C5EA 4NNJA 4WCFA 2IODA 3GG9A 2H5LA 3JQ9A 5I9NA 4M8SA 3AI1A 1W8DA 3C3XA 2FN7A 4BNVA 1QKIA 5FYDA 3BHJA 1ZW1A 4PVCA 4QUKA 3H7AA 5F21A 1NFRA 2D5AA 1AXEA 3LLSA 4KWHA 4ESOA 1YQXA 1YH3A 1ZUD1 1EVIA 1K6XA 5U1PA 2NU8A 4XQ9A 1V3VA 3UICA 3WFIA 1HDOA 2IZ0A 2YV3A 4DIBA 3WSWA 2G17A 3BMOA 2EIHA 4W6ZA 2P5YA 3H9EO 4M55A 3DBRA 3H3JA 4CR6A 2RH4A 3ENKA 3V1UA 3BMCA 4E5PA 1ZZEA 4BNFA 2WEKA 4LSMA 1EDOA 3ZWWA 4IS3A 2YW9A 3DBHA 1C0KA 1SOWA 3GEDA 3JQGB 3BZUA 3GGPA 1PSDA 4DTIA 2Y0CA 3GEGA 1LDMA 3ZU5A 2JFHA 3GZNB 3JQBC 4CLEA 1IPEA 4NFHA 4PRLA 4OGWA 4GKVA 1D3AA 3RBXA 1QG6A 2O3SA 2AEMA 4A03A 3RUAA 4DUPA 3V2HA 4FQ8A 1K6IA 2DFVA 3G1TA 1KBZA 5T57A 4BIIA 3LT1A 5CHEA 1F06A 1O94A 1VL0A 3V5NA 2EJVA 4CQLA 4E5YA 4I08A 5CPFA 1GR0A 4W7IA 2B69A 3N74A 1ZJZA 3V8BA 3NV9A 2X0JA 3A28A 3FTNA 5HA5A 1WNTA 2OOSA 3VPSA 4Z0HO 4JIGA 3GG2A 5A3JA 1XU9A 2PD3A 3OSUA 4R1SA 2Y93A 1PGOA 3ZWYA 4FGWA 3WTCA 1SEVA 4I9HA 1A7KA 2Q4EA 4K26A 5A1TA 5I9LA 3SEFA 1PL6A 4G65A 2UV8A 2BI7A 3O26A 1M67A 4TZTA 4QO8A 3ZWNA 1T25A 3GGOA 5G0SA 3WYEA 1F8GA 4J6FA 4DREA 2ZJ1A 3ITDA 4EGFA 3RROA 5JCJD 3NRCA 4GX2A 3ZU2A 3JD1A 4IDDA 1JLLA 4BOYA 3MWEB 2HLPA 3C8MA 1NQTA 3DAGA 2HQ1A 1PJLA 2BELA 2EGHA 3B1KA 3BTUA 2I9PA 2FR0A 3TOXA 1B15A 3OFSA 3V1TC 3D0OA 3GZ4A 2JAPA 4PLVA 2OMEA 3S55A 3O38A 4CV0A 2AQHA 2NTJA 3H9UA 4OIMA 3QP9A 4FJ1A 4UUOA 1F12A 2X6TA 3KLMX 4KDFA 2VYND 3GDOA 3P19A 3KB6A 2CDBA 2VRBA 2BGLA 1H6CA 3FD8A 1KEVA 3NGXA 4R01A 4FFRA 5IDYA 4XRRA 2P9GA 3WGTA 1DXYA 5KCZA 1GV0A 4RCVA 1R4MB 4BVAA 5G0UA 3W8FA 3DONA 1W6UA 3MJSA 4Q3NA 1GEEA 1BXGA 2V7PA 4WECA 3RFVA 3W4IA 1O6ZA 3GVXA 4K6FA 3SJUA 1IYZA 4W9NC 4LMRA 3PQDA 1AUPA 2YDXA 1LLUA 1C0IA 4WLOA 4PG6A 5IXYA 4PRKA 1FDVA 3JYPA 3L07A 3WGOA 5FI3A 4PFJA 4IY1A 1P0FA 3CH6A 4NH4A 3D3WA 3PIIA 2W2KA 3C1AA 1YONA 4UULA 3KYDB 4Z3DA 1VRWA 1EVYA 4YS2A 2LDXA 4PLYA 1BG6A 3EVNA 1R15A 5EESA 3TZ6A 4JK3A 4CL8A 2EKQA 1NR7A 1O89A 2GF2A 3NUGA 3ORFA 4YEDA 1GYQA 1E1NA 1M75A 1ONPA 4BHTA 4BO8A 4JBGA 1F8FA 4U0KA 3NEPX 2BFMA 4MVJM 2PK3A 3ICPA 3IJPA 3JD2A 3JQGA 1KVQA 3NJ4A 5KVCA 2A4KA 2JCYA 2X7HA 1ARZA 3ROPA 2WWRA 5JAIA 3PHGA 1QYVA 3MJ4A 1ZSVA 3KETA 5G4LA 3VZQA 2TMGA 1XA0A 1D4FA 2FSVA 3OJOA 5TX7A 1KIFA 1F17A 1UXKA 3PHLA 1J6UA 2A9FA 3EGOA 3F46A 3JQDA 1ISHA 4HADA 3TFQA 3TSCA 1J0XO 3M2TA 1BRMA 3FCOA 3WIEA 3GGGA 1JN0A 4MVJD 2HO5A 4CM4B 1GQQA 2EHDA 2CVZA 3LT2A 2BFOA 4OXNA 1OAAA 3PGJA 4WPGA 1BXZA 5JNLA 4EJMA 1BDMA 3CUKA 4U8GA 1GAEO 4HV4A 3DAFA 2DTDA 4B8WA 4I5GA 4QT0A 2ZTMA 4E5KA 2FZWA 4LMPA 3TWOA 4J4BA 5ICSA 1B16A 4I9UA 1HDXA 1U2GA 2O50A 3NDRA 1ID1A 2PY6A 4INAA 5B1YA 4P4GA 3DDNA 4YRDA 3WJAA 5L9AA 2C29D 3H3FA 3GNTA 1DC5A 3UFXA 2DT5A 1TT7A 1UUFA 4YB8A 3EYWA 3ZI0A 1PZHA 4PCVA 1HDYA 1DHRA 1R0LA 3BIOA 1A4IA 1H5QA 2CSUA 4LW8A 3KYBA 4TVOA 3Q0EA 3AOEA 2J5RA 2ZCUA 4D42A 1R37A 1YDEA 2EWMA 3QWIA 3KZVA 2VRCA 4RVFA 4BGUA 3U09A 3S2EA 2ZQYA 3VC7A 3I9JA 4CLOA 1DFGA 1KVTA 1SB8A 1I36A 3LDHA 5EQDA 2ZCVA 1K0UA 1I2BA 3AI2A 1N7GA 3QJ5A 1PZEA 3K96A 3WMWA 3ZWMA 1UP4A 4PLGA 3DHEA 2PH3A 3AU9A 1HE3A 1XLTA 5F1PA 4JGBA 1KYQA 4YJHA 3PHIA 2EP5A 3WGHA 3NJ8A 2BF7A 4R9SA 1KVSA 3VPFA 1ADFA 3HFSA 1HTBA 1H0KA 1PIWA 3ROKA 3ROMA 4XIYA 4KQWA 2O2SA 4B8ZA 5TSDA 3PWZA 2PZJA 3AFMA 2Q3EA 4FC7A 3I83A 1TT5A 4MVJI 4XR4A 4WK6A 4BNKA 1NFQA 5DOVA 4O6VA 1DC4A 4NBRA 1NR1A 3NT2A 4J90A 1CIVA 4GI2A 1BSVA 4MIEA 1MC4A 1Y8RA 3NTOA 3JTMA 4JX8A 4J7CA 3SLKA 4GKBA 5G4KA 2NV6A 3OA0A 3QVXA 4CL3A 3Q3CA 1EE2A 3JYLA 1U5CA 1E3WA 2AHRA 3WTBA 1ONOA 1U28A 4NK5A 2X0RA 1Q0HA 3ZHZA 2X4GA 4WLEA 3NTRA 2ZKLA 5L3ZA 1OZAA 2VT2A 5AXBA 5JAMA 4HP8A 2PTGA 2C2XA 4FFLA 3RAJA 2Y0DA 4RF3A 4XYLA 1NNUA 3HNPA 4GLLA 4YT5A 4H3VA 4C7KA 2JCVA 5L7TA 2Q1WA 4XJTA 3LZ6A 4FFNA 4L4RA 2YFQA 2PWZA 3FR8A 3KTDA 3I5MA 4QEDA 4Y98A 2GNAA 3H9QA 3VZPA 1CRWG 3FPLA 3PZBA 5U4QA 5BR7A 3PJDA 2NADA 3GMDA 1DIAA 3IAHA 1ZK1A 5DBFA 1XEAA 4EEZA 3OMLA 2OORA 5EN4A 2NSDA 4Z9FA 4B3HA 3S2FA 1G0OA 3HN7A 2DKNA 4TMFA 4KUHA 4URFA 3GRKA 2NNLD 4YCAA 3WGZA 1EBFA 2WSBA 4WEOA 5DULA 2QZZA 1XG5A 3BTVA 3F47A 2JJYA 3G49A 1YO6A 2AXQA 4QSMA 4IDBA 1E6EA 1B2LA 3RKRA 4CMIB 4C7JA 3FPCA 3GLQA 2W4QA 1BWSA 4NPCA 5KVVA 1DB3A 2B4QA 9LDTA 2B4TO 2Q2WA 4BQPA 1AGNA 4YAKA 1GL3A 3JV7A 3QVSA 3X2FA 3WB9A 4YJHB 1BVUA 3GFBA 1I3NA 3M1LA 1Y5MA 3JD0A 3GF4A 4Q9NA 3DC2A 1GCUA 5IDQA 4JJFA 1ZVMA 2NVUA 3JQEA 2AQ8A 5LC1A 5A9TA 1ZCJA 2RCYA 3ABIA 4NI5A 5ER9A 7MDHA 5JXWA 3VKUA 1DOHA 2PD6A 4NFSA 2NVBA 1SO8A 3KEOA 3P2OA 1YQGA 2EP7A 4D0SA 2VN8A 3TL3A 1EUDA 1E6UA 2PKRA 1U8XX 3B20A 3WNQA 1YDWA 4ND4A 4ZQGA 3H8VA 3WNVA 2HJSA 3VOSA 1ORRA 4BKUA 5HWSA 1RM5A 4AVYA 1T2AA 1IUKA 2D0IA 4ALKA 1LRKA 4CM9A 2IZZA 4U0JA 2B4RO 2Q45A 2ZJ0A 1W73A 2EGGA 4DIOA 2VOJA 3HB4X 4CM1A 4C4OA 2YHIA 3NDIA 1KY5A 1O0SA 4N18A 1PL7A 3QWAA 4FBGA 1LSSA 1ULUA 3RU7A 3HDYA 3PQFA 4UVEA 5HS6A 5JAZA 4ZN6A 3DTYA 4TRRA 5TF4A 1EUCA 1TEHA 1ZH8A 2VOEA 3GN1A 2BHLA 4W4TA 5CPBA 1NVTA 2YHUA 1LTHR 1N8KA 4BMSA 2W2LA 4ND1A 3RC2A 4IZIA 1E5LA 2D2IA 2G82A 4EYEA 3GHHA 1YL6A 2CF6A 3FWNA 4GMFA 4FN4A 1U4OA 1PS0A 2P9CA 4AJPA 1NWHA 4CPDA 3Q6IA 1V3UA 2JCXA 3B1FA 1JU9A 1EFKA 4M49A 4N5MA 4CM8B 5JW6A 4PGFA 5JE8A 2WD8A 1LU9A 2X58A 3DFZA 1M6WA 4J16A 2BD0A
chains in the Genus database with same CATH superfamily
2PHZA 3PR2B 5GY7A 4JQSA 5E8RA 3ZXIA 2ZFUA 5K8JB 2FAXA 1QP8A 1EM8B 4OLOA 1TJ4A 4IICA 4JJ7A 2NS1B 2BRUA 1ZM9A 4F6LA 1M90T 1B4DA 4MJ3A 1ZNYA 1EXNA 5GWXA 2ATEA 4LK2A 2BM8A 3DEKA 3SIRA 2OFGX 2UDPA 3S27A 1KFNA 2CLMB 3ZY4A 1JDJA 3C41J 5SZKB 3QNWA 4EWTA 1KVUA 1HF9A 2FHJD 5B36A 3GPDG 4Q1CA 4JUAA 1RAJA 2VD3A 3IOEA 3VUEA 2X1GA 5FLXU 3GLHB 4EUSA 1FRMA 4F3MA 3KPWA 3SEAA 1ZC4A 2WJPA 2BE2A 2PFFB 1KA9H 1N2XA 3SIPA 3A4VA 1DHTA 5JS8A 1M0EA 4OX9J 3IERA 3JVUA 5EWLA 5FI5A 4CQLB 1RMYA 1ZDMA 5BU5A 2IOYA 2VDMB 1YVEI 1XQWA 2QX9A 2X77A 3GUVA 1HSOA 1ZZNA 3OTEA 2YVAA 4S04A 1HW9A 4ZC8A 1WP4A 5JDIA 1RE3A 3FFIB 1UBHS 4IHKA 1G8FA 1YBVA 1I4OA 4IFTA 5ALYA 1ODCA 4EYSA 1DINA 4PQRA 3CLUC 4FILA 2OSRA 3HUDA 1NLFA 4GGOA 2F64A 2QJOA 1JIKA 5BNIA 3RAXA 5BR8B 5JSQA 2BBWA 2JIBA 3N7NA 1EWRA 3E18A 4XDCA 3VV2B 3E5MA 1P5FA 4JKOA 2R8HA 3BERA 2EERA 4XD2A 1T1SA 3R5JB 2QJTA 4F8EA 3E7XA 4M4SA 3ZWOA 2HH9A 2BTQA 3I0MA 2W2KB 4HNAA 5KG3A 4DG8A 1SQPJ 5HN0A 4QXPA 3CRRA 1IEXA 4PHHA 3WLAA 5DZSA 3F96A 3GLIB 2I7TA 3TQTA 3NHKA 1ISGA 1H9CA 4MCJA 4YHHB 1JQAA 1P5ZB 3CC8A 3OTOF 3BQ1A 4YQEA 3O8NA 1HIYA 1NXTA 1XRJA 1C1DB 5GMEA 4HAXA 4U7FA 4TT8A 4LIRA 4PV1C 4WXEA 4PY2A 4XVRA 3IVGA 3BORA 1GGJA 4EUFA 2G0TA 2QAGA 3E35A 1A0OB 5I45A 4IPTA 4D1YA 4RCZA 2YX4A 1ZI6A 4L6CA 3RSCA 3FRZA 5I7VA 1PBNA 2YHAA 2I6GA 3A4YA 4JT2A 2F8SA 3ZZTA 4MKGA 1D6MA 2GK6A 4I4TA 1VSVA 2WSFH 1VQ7P 2ZH7A 2XCSB 1GCIA 1OX6A 5AO9A 1QGUB 1Z5PA 4N78E 4CH7A 4Z3KA 4LECA 4BNIA 3ZDAA 4O3PA 3CE9A 4E0DA 5CG2A 3CWZA 3VYWA 1E4EA 2PZ8A 3KUUA 4S0ZA 1VI5A 1YTUA 3AJ1A 4Q9JA 4KHPF 1I7SB 3CLSD 3PIOQ 1OW3B 1S9EB 3GD7A 4A8SA 4IUFA 5C1OA 2VB6A 2J0QD 4LZZA 3CIFA 1M1GA 4K8RA 5M5BA 2W43A 4GLBA 2CPHA 2BDUA 1D07A 4MA5A 4RMIA 3QV1A 1UPUA 4G1FA 4DL4A 2NO4A 2YWKA 1D6JA 4NLRA 4K6KA 4DZTA 3WWZA 1PDWA 2J5KA 2RNEA 3ITEA 5ARBA 2B8WA 2HRCA 1YKWA 2NZVG 2WJ4A 2Y68A 5BVHB 1HR0J 1NVWQ 1KU0A 1LLCA 2CV0A 3FUVA 4QW8A 4FI3C 1Z7EA 2JB9A 2XMPA 4ENVA 3LBIA 4N7JA 4WFAQ 2QTWA 4JYPA 3C14C 3DG9A 4DG9A 3FRHA 4P36A 1CEQA 3U4DA 1NTKJ 2BBSA 2JA2A 2O3JA 4FS8A 5KYNA 4UF4A 1J22A 3CNEA 2GKGA 4DSFA 3BC1A 2WHXA 3HVTA 4XR9A 4BMDA 3ND5A 3BGWA 2JGJA 3EY4A 8ATCA 5LIPA 4FYYB 1KMNA 4PTZA 3AV3A 4AUKA 4LJYA 1JLKA 2XZRA 2YWCA 5HRAA 1OA0A 1CZQA 4WN9B 1DQSA 1W0CA 2B87A 4WP3A 1LPMA 3HYRA 1S4EA 4AWXA 4CMAA 4KE9A 10MHA 5MDHA 4M7RA 4DA6A 1R0AB 2HWKA 1FXWA 2WOOA 3QGPA 3O03A 4XJVA 3M8QB 4C05A 1YDFA 2K5UA 5CFRA 3W3AA 7AT1A 4HATA 2HV8A 4ZEOA 1RT5A 4OJNA 1SQ0A 5HZHA 3QPWA 3B5IA 4PLFA 1QUEA 4KAJA 8LDHA 3UJDA 1VFJA 4MV5A 1HNZJ 5AXCA 2VL1A 2HHVA 3BGSA 2B5JA 3F67A 1NQXA 4KQ2A 4KJIA 3ZTQA 4IIJA 1BVYF 2DG2A 2P9QA 1MB2A 1OW7A 2NPSB 4KUEA 1QORA 3T9DA 3L40A 2YQZA 4Y2QA 2CUKA 2X40A 4XYLA 2RGXA 4USWA 1BWEA 4J9VA 4IXMA 1N3YA 3BCCE 2R6CA 5EJ7A 2W2MA 2K2WA 2ZT9D 4JI4J 1R2QA 3IT0A 4FDMA 2AX3A 3AJRA 1JG1A 2W11A 2CNWD 2P5UA 4M0KA 3PJ9A 4OUDA 1PGPA 5A4MS 4KJMA 4EHBA 1PS8A 5FJJA 4CV3A 4CR8A 3EUAA 2W6NA 2QDXA 1C2YA 3VGUA 1DJPA 3PRHA 2HJRA 3T7KA 2LEAA 2PD4A 3AR2A 2X13A 5EPOA 5LXTB 3V5RA 2OO7A 4OHMA 1G8SA 4F7VA 4FD2A 2X2FA 1I3LA 4NXMF 2PN1A 1FEZA 3HXLA 4KQEA 3CLSC 1X74A 3F89A 4EF5A 5IJ0B 4PAAA 4CRJA 1Q81Q 4B74A 4B3MB 2R97A 1J97A 5AXLA 2YICA 1RLUA 3R9IA 2HRTA 3CUWA 3WDOA 2FOIA 3AZQA 1CJMA 4HC4A 1HL7A 1NWQA 1A9OA 2JKZA 2YIVX 4MRVA 1LTGC 3OP4A 4GR4A 2BJDA 3D66A 4XIIA 1RVDA 1OTYA 4P72A 3TZWA 5J9FA 2WPSA 5KG7A 5IDXA 3ZE9A 4RFSA 4F84A 1P17A 4OVKA 3DLJA 3T97B 2WQ6A 2FMUA 4ZI3A 2Q1LA 5A2QU 1PL8A 4HDKA 1V5EA 3MRVA 2IEAA 5JJCA 4EO6A 3Q8LA 1YU9A 4U96A 1NPRA 4E09A 2J5BA 4ROTA 2NVOA 4JT8A 5COBA 4ZZIA 2IE0A 2M32A 2YQ1A 4QGSA 5HLFA 1OGJA 4DC9A 4CMEC 2BP7A 4JR0A 3R9XA 2IFNA 3QUCA 3GA5A 2GXUA 3IAS1 5J1TB 2HA6A 4Z2AA 2CLIB 4WA8A 2DUWA 4AQYF 1GAWA 4QR2A 3SOPA 3L75J 4HYEA 1R4AA 5HKAA 1PUJA 3VO1A 3PJRA 4ALMA 1XEWX 4RIFA 1T0TV 4DL9A 2ZSFA 4EG4A 3WG9A 4K7JA 2N3OA 3DLBA 3FYUB 3AESB 2ZTUA 3OM9A 2FX5A 3PUVA 4BRYB 2IDKA 4DA8A 5KFNA 4JI3J 1T95A 1SQ6A 1LSJA 4FYKA 4TKLA 1TECE 2V2QA 1VI2A 4HT3B 4DSKA 4RKUJ 3LNCA 4DA9A 2D06A 1M2EA 3UB4A 2VP9A 1T26A 1T5BA 3FY4A 3H6PA 1XVUA 1NUQA 2ZQ5A 4TRJA 821PA 5L6MB 4HR2A 2ZR7A 1KEEA 3M9NB 2P4HX 5LQCA 2NQTA 4L5BA 3RVOA 1F51E 4PGMA 2GEKA 4C7QA 2H08A 5IDWA 2DLNA 4LRDA 1NJGA 3FUCA 1EXDA 4YAJA 2J7KA 4BMPB 4WEQA 5A0YA 2QX7A 3KNZA 2LKMA 4WV3A 1C9MA 3DMRA 3K1AB 1NR5A 2PEYA 3OBIA 3OM0A 2ZRNA 3L01A 3FH0A 3ANLA 9LDBA 4G37A 1I5EA 1MUUA 4I5EA 5CD9A 5EWJB 4B82A 4Z4GA 2PXXA 3D1HA 4ISBA 1BGYG 1PJ7A 4UMDA 1YS2X 1G8HA 5KEIA 4WESB 2UVVA 1NLZA 1JFTA 3BSCA 3DYAB 2H29A 3MEDB 2QN6B 2GF9A 1C30B 4TRNA 2HEGA 4E31A 1X5OA 2JIMA 3PVXA 2PCJA 4FINA 3GXBA 1OB2A 1UCFA 5JY1A 3GD5A 5K0ZA 4OATA 4DL0C 1XLVA 1IFNA 1BFUA 3G8SA 5EE1A 1GPWB 4N5HX 1QAYA 3GFQA 4DR3B 1FD8A 1XVAA 4GPBA 4DR4B 4X93A 3QOWA 4UVGA 3HULA 1NM2A 3GIJA 3AJ9A 3TEFA 3LUFA 2IBZD 1PJ6A 3SFEC 2PH7A 1JHQA 5MFZA 3DOUA 1NSKL 2VFSA 2ZZMA 2V63A 1YJ8A 4DJFC 3MQ2A 5I4KA 2R7XA 5CVEA 1QFJA 1SULA 1JFLA 4AIIA 4AJHA 4A1FA 3A9RA 1V5VA 1RU1A 5B7NA 4V1Ak 4UQTA 3HS3A 2Y0BB 1VDZA 2OXFA 1PC5A 3N28A 3BGRB 1J0DA 4E88A 1ZWLA 5H02A 2G2YA 1S8NA 2HQBA 3CMES 5E7OB 5DQHA 1R0CB 1PFUA 2FNAA 1GZ3A 4EQ6B 2PKQO 1E2FA 4BQEA 3FZQA 3MZ0A 2WYWA 2QRHA 2WU3A 1HNVA 3UT6A 2Q27A 4FKBA 5JAUA 2H1OA 2MYPA 4BNHA 1EHYA 1EQ0A 4W5HA 3T1HB 3TZLA 3DVQX 2PUTA 3FF1A 1F60A 5IVHA 4CIDA 4MCHA 5J63A 3EMBA 2A14A 4PYLA 4WT7A 1HLGA 4ND3A 2AMJA 1ZYUA 4IG3B 3ECAA 2C88A 3I4LA 3CS3A 3Q2TC 4G6VB 4Q1EA 5HCIA 3W65A 1OVRA 4BEBA 4F8JA 1LPSA 3ILIA 1R4MA 5CA1B 3N5FA 4DPYA 1T15A 5M2QA 3R9KA 1X70A 3L9WA 2CVEA 1XP5A 2B4AA 2VP4A 2QFJA 3RSGA 2PVSA 2W6ZA 2QW1A 3EULA 1W96A 1LPOA 3UIEA 2XTJP 2WDPA 1VG0B 4ZNCA 4HNTA 3W8GA 4AXXA 3KKKA 5AOAA 1Z6QA 5FYQA 3QPBA 3WB2A 4K3AA 2FWJA 1I33A 3PT9A 1CQIB 3L5KA 1SBCA 4OMFG 2CDQA 1VDMA 4RA9A 4AT1A 3GFYA 4KN5A 2XUJA 4TTQA 1II8B 3D6HA 2PGLA 5MN6A 4OUKX 4CF4A 1UIIA 3L0SA 4JBLA 3C7KA 1T2UA 2VRWA 1XTIA 1E0AA 3D6MA 2R00C 1E9SA 3GV8B 5JSYA 1L0BA 1YE3A 1NT4A 2HVEA 3QMQA 2AN4A 1RKIA 2IYSA 1JHYA 1I1NA 1FB5A 3TSAA 1DBQA 4G84A 1W25A 2O5VA 4AUWA 5SZJA 3OE7A 3WLIA 1T6ZA 1NRJB 1V3SA 2JJQA 4URUR 3VYRB 2RH0A 2ZITA 4TKMA 4RD0A 3S1LA 2AFIB 5JCXA 3LPDA 3VR6A 3WK8A 2BKLA 1IRIA 5DWVA 1XE3A 4DLXA 1UK7A 1D2HA 2AR9A 5KFOA 4AL7A 3K9CA 3UJPA 5IM4F 1Z73A 2OD2A 3LXRA 4M94A 1JBEA 3E2IA 1DRKA 1ADYA 3TM5A 3LY8A 3F5SA 1EDKA 2OPQA 1XZPA 2DECA 3OTDA 5FWAA 4EY7A 4JT4A 3A8EA 3NFRA 1T6BY 1MMLA 1NULA 2VICA 3KJQB 1C1XA 2K8GA 1U9IA 2W8ZA 4GZMA 1GPDG 5FA8A 1VJ0A 1XEWY 4PXAA 3MMBA 3VKVA 1YX2A 1GTL1 5C42B 4A5OA 5C4GB 5BV2P 1H2RS 1YRLA 4R8LA 1NV9A 1GPNA 3C7DB 4HFMA 4MI1A 5IANA 1BGVA 1UWLA 5FF9A 1RXSA 3PVSA 4FFOA 5IHPA 3D4BA 1N2JA 1SUBA 1BN6A 1MAVA 1SS1A 3GDWA 4D2IA 2M88A 3U7JA 3GTYX 4RPCA 4D8XA 4Q1DA 1URQB 2PLNA 4QC2A 5KLVD 1YFJA 4JI8F 2QNRA 4OGQD 2NU8B 4Z1MA 3H1PA 1S2OA 3T06B 3COWA 3TNYA 4AMUA 3HFJA 1SXIA 1XDDA 4N77A 2H4WB 4TWAA 1GHTA 3WLNA 1I6MA 1IRXA 2Q9IA 3UR3C 1CFJA 4OGFA 4NLOA 2Y1CA 1TFYA 1K6EA 3MCVA 4KAFA 4MDFA 2O48X 3ZZOA 5I7SA 2EP8A 3ILLA 4NV1A 3EYZA 1GQRA 1BYUA 4P3NA 1NM5C 4NMMA 5JOQA 1BQ4A 3ZHBA 1AKMA 4M5KA 4X65J 3RV3A 4P98A 4ZCKA 1JIQA 3UV7A 4B46A 2J6TA 5CCHA 4GOKA 2Q9UA 4UUMA 3DOKB 1QFSA 2DWQA 1NVVR 4B6EA 3M0DC 1R3NA 2VF3A 3O7MA 1RADA 4CIWA 1JXMA 5JWRA 4TYPA 4MRMA 1VQ5S 4NBKA 4GP6A 1JLLB 1GPBA 4MI6A 5A3SA 1KAOA 3NX4A 5AI6A 1T2EA 3PYFA 1BDJA 4KSBA 4YGYA 2PT6A 1UP6A 1XXLA 2MHCA 4IFMA 1RTIA 1UPTA 2A10A 2ZJ7A 3U7IA 1MROA 4X60A 5FLXY 4P2MA 1E2IA 1FNCA 4FOSA 5EZYB 5AFSA 2JIOA 3L4KA 4DV6B 2QP4A 2H5LA 4UU8A 5EUHA 1W8DA 1MW7A 5HP1B 2HHWA 3FCHA 3B5JA 2FC8A 1YQXA 2FLNA 4BASA 2IZ0A 2IZOA 2O7NA 2PRKA 2G17A 2EIHA 1K44A 3UK2A 3B6KA 3ULHA 1AYEA 3V1UA 2QD5A 2WNSA 1ZZEA 3BVHA 3EUFA 1RMQA 1Q92A 3FCCA 4HDSA 5HAOA 2KMLA 3RREA 1E9BA 1LDMA 2IBTA 5E3PA 1FFXB 2W2VA 2Q3BA 2A57A 2G9VA 1BGWA 3NBKA 2I62A 4ZI5A 4PYRA 4F26A 3UCUP 5B09A 2NXEA 2DFLA 3AUYA 3N6RA 3H4TA 3C5CA 4KBIA 3ZTYA 2PC6A 3A28A 4P4TA 4HLDA 4URQU 2WKPA 2EFCB 3R9WA 2Y77A 1VGYA 3LPAA 3OSUA 2IV7A 1NIJA 4Q4JA 4S1NA 1PGOA 1FX0A 2XU6A 4KN6A 4DM7A 1BX3A 5EIBD 1XPOA 5J2MB 2ZSBA 4LYJA 4DADA 2Y4OA 3OY2A 3G0DA 2PRJA 3VNAA 3H8JA 1QO9A 1TMGE 2ZRCA 1ODJA 2CA9A 4BC1A 3QE4A 4WFKA 4BOYA 2QL9B 2IEYA 2AKEA 1EXWA 2AJCA 3MGBA 3FZEA 5JNSA 1DWOA 5AHOA 4RSMA 3VC2A 3A2AA 4IWNA 4OK6A 3A9VA 4CT5A 2G0JA 4ARAA 3WNZA 1F2HA 3N2LA 3PB3A 5KFAA 5CLFA 3W4IA 3GJTA 4YB1P 2KLBA 2RU9A 1X4EA 3P0FA 4WLOA 3PV0A 3HDSA 2SBTA 3L95X 2LBPA 3D3WA 5LSAA 1P4SA 4Z3DA 4UHCA 2LDXA 3EVNA 2G70A 3TZ6A 2E0IA 3T3DA 1O89A 3H2KA 2B3TB 1QIMA 4BO8A 1PPJG 2BKXA 1NU1K 2O0LA 3ICPA 1KVQA 3NBPB 4OGQC 3FVVA 4FZJA 1FAVA 4ECXA 4QOSA 2CHVA 3OEHA 3VM6A 4ECRA 4X20A 4NCAA 3FM9A 1LVUA 3FSXA 2HO5A 4H4MB 3O8OA 4ZALA 1BXZA 4UCXA 3GIRA 1GAEO 2H31A 4E5KA 1UOPA 5K3EA 4A15A 3FBBA 1VJDA 4EHDA 2GVZA 4I9UA 2KW5A 3RS2A 2D0DA 4INAA 3E22A 1D2CA 1MV5A 3T9AA 1XWIA 1TCVA 2R6GA 2EAUA 3ER6A 3T1YB 3JTPA 2K87A 1M90Q 2IBZE 3BEGB 2E5YA 2I6XA 5ECYA 4CEHA 2GTPA 2G9NA 3DMDA 2DCMA 4P2XA 1NSTA 1Z4MA 3I28A 3T95A 4FBLA 1PZEA 5CW1A 4CO3A 4GEGA 1XMPA 3AU9A 4K9SA 5PGMA 5T41A 3WGHA 3VAFA 1RU2A 4V1CA 1JIHA 4OXRA 1EXMA 5IV3A 2LR2A 4ZT4A 2G0CA 3VYTB 4ZHRA 3P4XA 1U5CA 3BQNB 1WKVA 1B23P 3PNOA 1C7QA 4N6NA 3BIWA 3OQPA 3E05A 3T15A 1E96A 3IUYA 3T54A 2NR0A 2QIFA 3ENVA 3CN7A 1P9RA 4FFNA 4Z51A 3PDHA 2HM7A 4DSLA 3OY7A 1TL1A 3VZPA 3K2IA 3VR3D 4NZ0A 3LAWA 3HN7A 4Y2YA 2PH1A 1TUWA 1BQNA 1CUGA 2XNDD 2XUPA 3P32A 3HR4A 3PD7A 2XYGA 2X42A 4JDUA 1SQBK 4TL7A 1S10A 2GJ9A 2I3DA 1YFLA 2XVZA 1KORA 1FUEA 1KQSR 1Z13A 4HTIA 3C16B 3BB1A 1PVVA 5F7XA 1JEKA 2A78A 4LS3A 1IM4A 4URGA 4TMTA 1ZVMA 1NKEA 5CNMA 1T4CA 3L70J 1ORHA 3LUGA 3PFIA 2HA2A 4EGSA 1P80A 1S89A 1TKZA 3EIHA 5EIBC 3QPUA 3ZHSA 2QRZA 1LWCA 2QMOA 3L7PA 2YH0A 3C43A 4CTMA 4UVEA 2AU0A 3RWOA 1X8JA 1QPZA 4ZOLB 5HTKA 3LY9A 4EG1A 3QGGA 2DR2A 4EYEA 3IT2A 1DAEA 2FC9A 3GR0A 2G80A 4PGFA 2WD8A 1CC8A 4OAOA 4EG7A 4PNEA 1ZMEC 1NBMD 1O95D 2G8LA 5FBHA 4A0GA 1DIHA 1T9TA 2II6A 2O05A 5A7GA 3E6AA 2RAFA 4Q3BA 2C1EA 3MI7X 3PTZA 4C6HA 5JEEA 5F1OA 5HF5A 2A0KA 1FF2A 2QVLA 3GLTA 5H9FJ 5SYNA 1CZOA 4WNYA 4E2FB 1HETA 2E2WA 2R48A 4B6RA 2IXTA 2XOKA 3OJFA 4AZ0A 3LMKA 4PXBA 4XLZA 3Q6MA 2BI8A 1L0LD 1QSLA 1ILEA 3FQLA 3GHGB 2FE1A 1HNNA 3BD8A 5J1EB 3M5CA 3IL2A 3SQMA 3OTWA 4KN9S 1HARA 4PJ0E 1USUA 4DIEA 3TQFA 3OZRA 1QZZA 1FDAA 4C7BA 4J6EA 5AVUB 1MQ9A 5CCLA 1TTHA 3TB4A 2JBAB 4GP9A 4TYQA 1TLTA 3O82A 2VH5R 4I4LA 1QUVA 4RELA 2DNQA 2FX2A 2H9AA 4WCFC 3FYTA 3V8MA 1ULBA 1SQQK 3FRIA 2WP8J 2V6AA 4LX8A 1GFZA 1NATA 1OX4A 1PVOA 5KFLA 4RW9B 3FZGA 1QQ6A 1YQ3C 1ZBQA 2GBPA 3KQSA 2HGSA 1A4UA 4P1ZA 3JXEA 2JJMA 3LP1B 1HI9A 4MW4A 4ANDA 4A48A 1TRHA 3SYZA 2IYIA 2VPZA 1RT2A 2KB0A 1UDRA 2ZH4A 2GZMA 3TNUA 4CM8A 5BYKA 2RH3A 2LCQA 1LJUA 3TR5A 1KB9H 1UVMA 3CH5A 2FZ4A 2QS9A 4I7ZC 1HRKA 1C1BA 4UEWA 3MM8A 4NA1A 5KLVE 4B3OB 3GONA 3VNUA 1PBUA 3CZAA 3A04A 4B6OA 1TVKA 3WADA 1CP3A 2IHR1 4V03A 4XIJA 1NTZG 3OOHA 2IPPA 3EVCA 5HX7A 1CF4A 4U6PA 4FFSA 2NREA 4LHWA 5A2QY 3WLFA 5JPDA 3CWBJ 1NQUA 5ETKA 2R86A 4PV1B 3O0TA 1F14A 2VEOA 2I1VB 4HBGA 4KVGA 2E74D 5IU6A 4H44D 2IY5B 1JLEB 1NW9B 3E2MA 3S1AA 2HPUA 5KTKA 4DL7A 3V3KA 2IM3A 3WMEA 3QT7A 4RD2A 1UVIA 4Q7LA 3PL1A 4JBYA 4DV2J 3A6LA 1JNMA 3ZZ1A 1PLLA 4YPVA 5MF6A 1T0IA 2AKYA 2M3DA 2C2EA 4WLFA 4QYWA 1RFGE 1W36D 4F3YA 3DZFA 5C7PA 5JI3E 3E5RA 1SHUX 3C6BA 2AW0A 4C8NA 2Y05A 4IEFB 2SKCA 4ND6A 3C6UA 3W5UA 1E79A 3SFZA 4IO9Q 1JCCA 2HG5D 2IPXA 1N6IA 4MH0R 5CG1A 4KO8A 1RC8A 3OZAA 1JNXX 1CDZA 3PUHA 4R2XA 4GOXA 3RUPA 3QVGA 2RGBA 3KKOA 1P1KA 1JSXA 4B6JA 5KYTA 2RGCA 1H1LB 1P7WA 1KS2A 1N9KA 2ZWVA 2R7MA 4TVKA 5DDOC 4IQGA 2OP1A 2HWTA 4HUJA 4U2BA 3N4XA 3HO1A 1F5CA 4BFUA 3EDMA 4UOGA 3ZOZA 4R1TA 1YA6A 4FFDA 3QEMB 1NY5A 4DCSA 5CXXA 5A0TA 1KQGB 2VPIA 4F50A 4TMWA 1Y8RB 2CWXA 1YXMA 3MRSA 2N3LA 1QFMA 2QYOA 3MRTA 4NU0A 5E2BA 2NXCA 3NCTA 4NAHA 5EAIA 1DU4A 2R8KA 2B36A 2VC2B 1JY3P 1WMFA 2MYFA 5K0BA 2ASJA 3SYLA 1U2EA 1G21A 1IE3A 2ZJBA 3DDUA 2KXNB 1MIOA 3V4PB 5KOXA 1Z8FA 1G17A 4RX1A 3L9XA 3E23A 2AOUB 1N6HA 4GF5A 4CQMA 3PRYA 1NNDA 2OTKE 4LFBF 4LSNA 2RB5A 7GPBA 5KNBA 2BFAA 3OA2A 5JVDF 4UBJA 3TBKA 5AVTB 2ERCA 1CY0A 4JC5A 3KDPB 1RAGB 4MO9A 4ITSA 2HHTA 1L7NA 3AEFC 5B7QA 3TRDA 4OZ2A 2FLPA 3K5LA 5DHTA 2IBZI 4GECA 2ZYDA 2P7HA 2HNZA 4UQLA 1PC4A 2VU5A 2G40A 1DAKA 3JYNA 3KJIA 2FPSA 1G2CB 2FW7A 1NH8A 2HNDB 3N2EA 1SVUA 4NLLA 1Z6YA 5F8IA 1ORVA 2XMGA 5AXNA 2YY3A 2DHCA 3NFYA 3HX9A 3U4GA 3VR2D 2HA0A 1SUIA 4LOHA 1TUEA 3KEFA 1NFFA 2QTRA 3SQNA 3V46A 3Q2YA 2JHPA 2DWOA 1EUCB 1VQNS 2PPLA 4ER8A 3T9CA 4LPKA 1YJ5A 2Q9BA 4UNNA 4UB8H 2Q8QA 1XQVA 4FJ2A 5KOIA 4WZQA 4BGEA 1QNFA 3R7SB 3K0BA 2ZJYA 3RT9A 2J5QA 3KQNA 3MMAA 721PA 2OILA 2ISSD 2QUHA 3F7NA 2MYTA 3OIYA 3JQPA 5F51A 4PV7A 1IK7A 4IR7A 2D1RA 1JJCB 1GPMA 3K0AB 5JJIA 4C0AC 1Y00A 4DV4B 2QG4A 3HKBA 4PUOA 1G0NA 1S7CA 1VRQC 4H9GA 4DJAA 1NJ5A 5GM1A 1Y9BA 2MY7A 4L76A 2NLOA 2SXLA 2GUVA 3OH8A 4BX0A 3R3ZA 2HF9A 3BXPA 2I34A 5E7JA 4BNNA 4D4MA 1UIRA 4YI3A 2XB2A 1AKRA 2WB2A 2E74C 3U37A 5AVZA 5IAEA 1OU4A 4ECWA 2WU8A 1D0IA 2VDRB 3FYSA 1BH2A 5M2PA 1ZOIA 1HQCA 1DEEG 4TZ0A 3GLFB 2O01J 5DLYA 2AMYA 4R9UC 1JKIA 3V7WA 1VKOA 4CLRA 1RLJA 1FUKA 2VCEA 1X4HA 5GADU 3IOYA 2EJBA 3WLKX 3WGQA 2BCJQ 3PJFA 2BWJA 1ZIXA 4OYBA 3VMMA 4MPDA 1CJVA 1MKMA 4CLSA 4HLQB 2UUBF 1Q8BA 2C5BA 2RKIA 3A06A 1P33A 1N3LA 3IUBA 4WAUA 2CVFA 2Z09A 3QELB 2IPOA 4YALA 3ETDA 4JI0B 3GN2A 1DSSG 3NDJA 2J08A 3IR7A 1LDGA 4JC4A 2ZE8A 3PW7A 2RUSA 5A3VA 3FXEA 4UE2A 4NASA 1LV8A 1ZMXA 3ISVA 3EPPA 4DR1J 5AW0B 3AOAA 2HG4A 4QSHA 1VQ8P 1W2WB 3KXDA 3OE1A 5E79H 1TKTB 4KDEA 2QYTA 4OJMX 3ZKWA 1KSFX 4QU0A 4CLKA 3NTUA 2L5GB 4B79A 4M5DB 2VHCA 5JDCC 1FDTA 1GPJA 5FV4A 3WGLA 2F43B 3PQCA 2A9PA 3MT8A 4L73A 2IJNA 2H0AA 4JYAF 4DV0J 5AQ1A 2HCTA 3DV0B 2C42A 4FEAA 3VR4D 2B37A 2XO7A 5GP1A 1JQ5A 4QUDA 2VRCD 3BDAA 2VFAA 1TZBA 4LF6J 2Z0GA 1KDPA 2H1YA 5FI1B 2XVYA 3EVDA 2HHXA 2ZROA 2UWJE 2Y8YA 3DEHA 3OCVA 1UWAA 4MROA 4R16A 4M0CA 2VBWA 4XSVA 4KOAA 2CT8A 2E4AA 4ENOA 4MIOA 1YJXA 3TX0A 3DLIA 5D3KA 4Q45A 3E8XA 1Z7YA 5BSTA 1F2TA 2P4SA 4AM8A 1X87A 5G1OA 1E6VB 5JS1A 1IXRC 1W5FA 1ZMOA 2PBFA 2I2AA 8MHTA 3KQGA 5LKAA 1Z34A 5K99A 4G0XA 3BTOA 3U1CA 2QX4A 2BE9A 3IWNC 2PBRA 1GTSA 1ZCZA 1NBME 1XNQB 4LTMA 1QAIA 4RHXA 3QJPA 3ELWA 3AIMA 4HQLA 5G1PA 1TVRA 1ZJWA 2OE2A 4IHJA 3ZUGA 3L6OO 1MT3A 3MR3A 5E3CA 1BCCJ 3K0KA 5CM9C 3C3YA 4XTTA 8OHMA 1ZXBA 4HAWA 3R2JA 4DV5B 1NU4A 4ES2A 1TQ6A 1AKVA 3MM9B 3ZU6A 2W6MA 3DLCA 4GEKA 1VG9B 3DPUA 5CLQA 4FYVA 4DX6A 5CMLA 1L6RA 2E5GA 1L0LE 4H6WA 2L9NA 3A3YA 2B4PA 3NXSA 5CDFA 4JEHA 4L22A 3IC5A 2F7SA 3TPCA 1BMTA 2L2QA 3N0VA 1CU1A 4EYKA 2D13A 4ZQFA 5JHHB 1FFGA 3LWLA 4X41A 2HWWA 5TPZD 3S7TA 2VI5A 4HZGA 1M1YE 2E4XA 1B3RA 2OPPB 3ITHB 3H4IA 4WZAE 2M5AA 4QATA 2MSLA 4AROA 5BWMA 5E33A 1NI4A 1N34F 3TJAA 1YB6A 2WHPB 4RTKA 1II9A 2VG6A 3T0FA 2HFSA 5IT9A 4QBKA 4F4YA 1KXZA 1TL3A 1CJBA 1LY1A 3FGAD 2R0QC 4EATA 3CDUA 1MX3A 3AKZA 3U4CA 4C7XA 2EF1A 1Y3KA 2GPBA 3ZJYA 2LU1A 4HEA9 1PW7A 3EC7A 2RGDA 2R1UA 4AMVA 5KWEA 1ECFA 2I4LA 4XA4A 4KE7A 3ZTOA 4B3BA 3ABVC 4ETMA 2WUWE 2IHYA 4ZD6A 5DM7Q 4PINA 2IRUA 4H1HA 4DJEC 2V34A 1VI6A 4MUFA 3KD3A 5DT2A 5BVGA 2J0SA 3CGIA 4UB6E 4TS9A 4HLUA 1I7NA 2QTMA 4N6GA 1DX7A 1B14A 1U63A 1RA6A 1DAGA 2MQMA 5FLEX 3AECC 4WSOA 4PLZA 2DH7A 4YJDA 2RMKA 2H11A 1PYTA 1HBMB 3A14A 3Q85A 3EZLA 1K2WA 3BO2A 3R20A 4ER7A 4Q82A 1WCV1 4QWDA 1FXUA 3KYIB 4PQGA 5CFNA 1R0RE 2ZPUA 2AYMA 4ZVTB 2XDAA 1FJGB 5K3CA 3UMBA 2CNKA 2HHHJ 4J0EA 1SQXK 1JILA 4G67A 1MG0A 2O0KA 3MWYW 4KYVA 3JSBA 3DAOA 3JWHA 2OBXA 2R8ZA 4ENSA 1Q8KA 1R6DA 4DYVA 1D4ZA 3M6VA 4GIBA 2QB5A 1R0SA 4C5CA 2FFDA 4UNIA 2GFQA 1FE0A 3DHVA 3K0FB 3DKRA 3R9LA 1H0HB 1GT91 3AEUA 3QIPA 3EPGA 4LQLA 4B73A 3TA1A 4MAFA 4EA9A 2E5JA 1NXPA 1Z4NA 1CUJA 3G8TA 2PMKA 2KK7A 3EAFA 1JJAA 2XS2A 5DBGA 2SKDA 2JEYA 3QVTA 4BLVA 3THYA 4GU5A 3AVOA 3PF8A 2AEJA 4L78A 1W94A 1WHYA 4ETWA 3PFHA 2RSLA 1Q44A 1XMOJ 1E7RA 3WL7A 2RB4A 4DR5J 3CRVA 2O8CA 3IS9B 3KKEA 1DCMA 4H27A 2V4ZA 3W5SA 4IH9A 4YRLA 1X1EA 3RK4A 4W5TA 1D8AA 4W4MA 3PV8A 3LQQA 3AT1A 4W9NA 4ZVQB 1VYVA 1UXIA 3O2QB 2A9RA 2NUHA 4HZIA 1HV8A 1I94J 2YMKA 4TGLA 4A9AA 3W1EA 5LOQA 1UZUA 3N6VA 1QH8B 4F2RA 4QG7A 3BSYA 4BKPA 4OB6A 2BFFB 3VYUB 5K3FA 1OLXB 3WWOA 2HY7A 3GFZA 1ZD9A 1VQOP 1YKSA 5KOWA 2NN3C 1XQYA 2XBUA 1KOGA 4BV3A 2HBYB 1EP2B 4LSGA 4ML3A 1FX4A 2QNIA 4HX9A 5AUPB 2KVQE 1G1JA 3AILA 3FZBA 3W8NA 1JLBA 4CLHA 4IILA 1RF0A 3T1NA 4EFMA 2PNFA 5A8RB 4GI5A 1N7HA 1NKTA 3LUCA 1ZN5A 1UC4B 4N0PA 1RFLA 1V9LA 5BN4A 3RE1A 3ETGA 2CQDA 2FZLA 2PZLA 3QA9A 4OHOA 4YUAA 1P7PA 2QUIA 5KQRA 4ARZA 2WAXA 2Y9YA 4CKXA 1HLPA 2PI5A 2PSDA 4RW7A 4XQGA 4J49A 4NPOA 1T1RA 3GZTB 2G9ZA 2JSXA 4D8VA 1WDMA 1RWMB 4JV0A 3IHTA 4OHZA 3GDFA 1D04A 3NBXX 1RP1A 5K9FA 1UPPA 2OTLS 3LXXA 3U61B 4RW4B 1FZCA 2XAAA 4OOEA 4FCTA 5KVQA 3GJRA 2XC9A 2Q9AA 2X1MA 1OLSA 5LQJA 2BEZF 5DNYB 2XECA 2G1PA 3GNSA 4WXWA 3PR4A 4PANA 2ZE2A 5ALEA 2BEWB 2JHEA 1ML3A 5ADUS 3AR6A 3IOCA 3W78A 3I2JA 2F63A 1FRIA 3GO4A 4Z6KA 4F9GA 1R43A 4XB2A 1JSRA 1V7PC 1UWBB 3EGCA 4ZYXA 3J7A1 3MCZA 3IM8A 1U1QA 3V4IB 2H1HA 4ZV7A 3N8KA 2B2XA 3G86A 1E7SA 1F2UA 5FDLA 4PQFA 3EVTA 3LL7A 1WF2A 2ROQA 4EKEA 4BDSA 4Q7MB 3A9TA 1QIIA 1Z17A 3QW2A 2N82B 1YAJA 3A8TA 4KMSA 8AT1A 2C0CA 3HU1A 4G4SO 3GRAA 1YL5A 3UGTA 2X7XA 5IBRA 1B42A 4E07A 3WLEA 1PU2A 2QRNA 1UBNA 3QVMA 4D3FA 2XA1A 3E0QA 3RRXA 2ATCB 5ALDA 3HBAA 4IOKA 5FFNA 4IM7A 3U4MA 4BWNA 4RHTA 1XF1A 1JEDA 2F9MA 3IO3A 1Q7CA 1LFDB 5A7FA 2EBEA 2DNKA 2DLDA 1S4MA 1HTWA 4TPKA 4EYYQ 2GEJA 3QX3A 2X0FA 3A0HH 2JLZA 1YRHA 3ND8A 2IW1A 2HK6A 2B8JA 2YASA 2GO1A 1E1MA 3I9KA 4GZLA 2PJZA 2PA0A 5D3GB 2GV1A 3HVKA 2WVCA 4YK7A 3TNJA 3BM7A 3FMVA 1QD1A 1FZFA 2Y0SD 3OMXA 4WMLA 3R7AA 4R1MA 2CJBA 4Q39A 3GB9A 4ZEXA 4YR0A 4AE5A 4FF4A 2OC9A 3OHBA 4GAEA 3IURA 1WSVA 4FGKA 1NUPA 4JODA 1NUUA 3I1YA 4E70A 3LP0B 2HUPA 4QBHA 4LF5F 2C31A 4G0MA 2J8ZA 3Q3VA 4AJJA 1JFVA 1KQFA 3TGPA 2G8YA 2RGGA 4B02A 3LVBA 1Y4AE 1SFCB 1VC6A 3OD2A 1EAMA 4H54A 4OLBA 4RW0A 4B3SB 4NNJA 1GAJA 4FR2A 4DMCA 1HPZA 1XJCA 4NDZA 3T99A 3E1RA 3DRYA 3I2FA 2NGRA 3CC4P 4C0JA 3L3CA 1ZW1A 3AEQA 4ZVMA 5CXTA 1GCAA 4FN5A 1J8FA 2KTQA 4LJRA 5CCXA 5DX0A 2P5YA 4N8DA 4CR6A 1D2MA 2LD4A 2WEKA 3QHPA 3O44A 4BFCA 3LCMA 1YDGA 4P54A 3ZV7A 4ZJPA 2JFHA 1IPEA 3OUTA 3CW9A 2V3VA 3L71G 4D0GA 4ED8A 5I7OA 3ZNUA 3O2NA 4ZOBA 1KQNA 3GLKA 1TDJA 3WLSA 3G1TA 1FTSA 3WRYA 3T5BA 2XGQA 1UMCA 4D9JA 1V4VA 1MPTA 2ZRDA 1FXDA 2C95A 3OT9A 4PO1A 2Y92A 2PUEA 2O7VA 3SU8A 1E1QD 2N1TA 4Q3KA 2M6RA 2LA4A 9RUBA 4N6OA 5I9LA 4DA7A 3E27A 3O26A 3IUJA 1M67A 4EW1A 4Y9TA 4REOA 2PWPA 3WWCA 3MWEB 1WC5A 3BJYA 4TN2A 3B1KA 4BX3A 5L38A 4MPJA 5H9WA 2QN7A 5LL6P 2E1CA 3VHXB 3Q2OA 3S55A 1FRQA 2JW5A 2C2KB 1P91A 3F41A 4KDFA 2WD9A 4H0FA 4OGQB 4PABA 4KT0C 4X62J 3OVBA 3NP7A 3MJSA 4WECA 5DHRA 2A9KA 2CZVC 2AW3A 1IYZA 2B9WA 1U7XA 5M04A 4EY4A 4JEUA 1FDVA 4TLQA 2OMKA 4Z8XA 4QQKA 5FPHA 1EVYA 4PLYA 4AK9A 4PC7A 3I0SA 3LE8A 2I6WA 4TWBA 4BHTA 1X5PA 4JI6F 3SCJE 2ZXFA 3KKLA 4YJ2A 3BASA 4U0KA 1JXQA 3E8MA 3EARA 2JCYA 2PKWA 1SIWA 4CI0B 5KT4A 5GIOE 3AVXA 3Q24A 4JC0A 4CETA 2FSVA 3WISA 1F17A 3I64A 2YVLA 1L4NA 3I5AA 2R1VA 2OK8A 2ODNA 3HCFA 1JN0A 3PGJA 1RWKA 1QCZA 3DAFA 1WBDA 5TISE 1JQGA 3KC2A 4Z7CA 3H3FA 5TMDA 4FGLA 1DS6A 2CSUA 5B2EA 3DFMA 1U9YA 1U0EA 4O4IB 3QWIA 3S2EA 2ZQYA 4K4SA 4ARVA 2Y9PB 1KMIZ 2N3ZA 3X3HA 3WMWA 3CX5H 3Q8QB 1G9XA 4JGBA 4S0MA 2FEMA 2BF7A 1HNWB 1CYEA 3QG1A 1Q0SA 4HPWA 1NVEA 1CJUA 3BXHA 4IMJB 3JVIA 1VZ2A 4FC7A 5EVJA 3O2IA 1FZGA 1CUYA 3KWMA 4J90A 5I5EA 4F67A 5KBYA 2G0AA 1KHVA 1K8AT