2AEFA

Crystal structures of the mthk rck domain in ca2+ bound form
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
224
structure length
221
Chain Sequence
RHVVICGWSESTLECLRELRGSEVFVLAEDENVRKKVLRSGANFVHGDPTRVSDLEKANVRGARAVIVDLESDSETIHCILGIRKIDESVRIIAEAERYENIEQLRMAGADQVISPFVISGRLMSRSIDDGYEAMFVQDVLATRRMVEVPIPEGSKLEGVSVLDADIHDVTGVIIIGVGRGDELIIDPPRDYSFRAGDIILGIGKPEEIERLKNYISALVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the MthK RCK Domain and the Effect of Ca2+ on Gating Ring Stability
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Metal transport, membrane protein
molecule keywords Calcium-gated potassium channel mthK
total genus 73
structure length 221
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02080 TrkA_C TrkA-C domain
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.870 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Voltage-gated potassium channel 2aefA02
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2aefA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2aefA01
3JQ7A 4DIBA 3DAGA 2H63A 4UAGA 3UAGA 4YAKA 1B16A 2X0IA 1U3VA 4WLNA 4PLCA 3GH3A 5U1PA 4YRAA 3VOSA 1PZFA 1P0FA 1UZNA 3QQPA 5DULA 1TT5B 4P4LA 1CRWG 4PLHA 3F3SA 3WGIA 1QV7A 3U09A 4W99A 1Y8QA 1P1IA 1HE5A 3INRA 2DUWA 2OO5A 5JDCC 4GKVA 4GX5A 2HK7A 2Q4BA 4CQLA 4GMFA 3FCOA 2P2SA 4IY1A 4BNYA 2RH8A 4EDFA 1FDUA 4PLZA 4XTTA 1E3JA 3PTZA 4BNTA 3RAJA 1MLDA 4E5MA 3TOXA 1E3IA 2W4QA 1SPXA 3RUHA 1OMOA 4NDNE 5JLAA 4KWHA 4B4UA 4RF4A 3TZQA 3H2ZA 4NMHA 4W4TA 3HB4X 1ZK2A 1FJHA 5LDGA 1BMDA 2W98A 3ANNA 3FSRA 5I9NA 3K96A 2J3KA 3ZV5A 4R01A 4BQRA 3PWKA 1XDWA 1I36A 2OZPA 2C7VA 3DB2A 4GBJA 4I9UA 1QP8A 3SLKA 4IQ0A 2X4GA 3MJSA 4D45A 1G0OA 1TB4A 3F9IA 2ZB7A 1AUPA 1M67A 3GGGA 3BMCB 4Z9XA 5JO0A 5ITVA 4FFPA 1XYGA 4RQUA 1ZSNA 3A06A 1PSDA 3GN1A 4D0RA 5L45A 5GMOA 1XR3A 1KC3A 2YQ5A 1I01A 4R3WA 2JD2A 4LMRA 1ML3A 4LGVA 1DEHA 1F06A 1N8KA 1OOEA 2C2XA 4R5HA 3WGGA 4TKLA 4OOFA 4BNGA 1PR9A 2BKNA 2O7SA 1H6AA 5DCUA 3DC2A 2YJZA 1AN9A 5JMPA 1JAYA 2JHGA 3LVFO 4WJZA 1BRMA 2DM6A 1KC1A 4IS3A 5L40A 1Y8RA 6LDHA 3DBLA 4BNIA 3L0DA 1DC3A 1UP4A 3DQPA 4I5EA 3DONA 2AXQA 4Q3NA 4XQ9A 2PZMA 3JQFC 2HSDA 3LT1A 1ENZA 2G17A 1QSGA 1ZXBA 4NQZA 1IZ0A 1NP3A 1MUUA 4HX5A 2Z5LA 5KVSA 5JS6A 1YJQA 3K8ZA 4PLWA 4CM9A 4ZICA 4RVSA 4YJHA 4BKRA 3BIOA 3I23A 2JKVA 1WW8A 3NYWA 1I3KA 5JXWA 4BGIA 3H2SA 3ZWAA 3CE6A 4D44A 4BNJA 4XCVA 2IRWA 4IDDA 1N92A 3WNVA 4CV3A 2JL1A 4H16A 4RL6A 4XA8A 3TDKA 2EKQA 1P31A 3HNPA 1IUKA 4Z9YA 3WQRA 2YHIB 3ZV4A 3ZCXA 1YBAA 3GHHA 3H3FA 1UAYA 1LEHA 4UUOA 1ZIDA 4R5MA 4WLFA 3H9EO 4KP7A 2WM3A 2CMDA 2EEZA 4DYDA 1E3LA 1QORA 1UP7A 3C85A 4DQUA 4WKGA 4L8VA 2EG9A 1IB6A 2DU8A 4BKOA 1WDKA 1EVIA 3H9QA 3GA0A 3W4IA 3ZHYA 5COBA 2CDCA 3ZWMA 2EW2A 1I2CA 1M75A 3GT0A 1R0SA 2DVMA 4A5OA 4E13A 2FZEA 3D64A 4TKMA 4ND4A 3JQ7B 3LT2A 4YDRA 4CPDA 3MWDB 3Q3CA 3JQGA 3D4NA 4AJ1A 4MIEA 4CMIB 2ZJ1A 4RJTA 3DR3A 4OYRA 1UH5A 1NFRA 4FFRA 5JW6A 3KOUA 3JQ9A 3D4PA 2HJSA 2VCYA 3E9MA 3ETDA 1ARZA 2WE8A 4ZRNA 4F6LA 1BXGA 1HEUA 1WWKA 1YQGA 2NQTA 1I33A 4OOEA 3OECA 1VL8A 5C3MA 2Q49A 1P9LA 1Q2XA 3E82A 1R4NB 2WYUA 3MJ4A 4CR6A 1ZMOA 5EPOA 1WP4A 4FC6A 2VQ3A 4U8GA 5CPFA 3FR8A 4DGSA 4JP3A 1GZ3A 2O50A 1BDMA 4UVIA 1EBUA 1GV0A 1PIWA 4RPJA 1B0AA 2E6UX 2I99A 4L4XA 4ZA2A 3ETGA 3Q9NA 3IUSA 1ADFA 2Y05A 4OKNA 4RDHA 4N5NA 1VC2A 2G82A 1ZZEA 2VWPA 3CUKA 1BXKA 5IJZA 3ADOA 2ZATA 4E31A 1GPDG 3KRTA 4UUMA 1C0IA 4NFHA 2VUTA 3A4VA 2J8ZA 4RPHA 4MKXA 4XYEA 5A9TA 4YT8A 5DBGA 4CLXA 3PDUA 3BMNB 4CMGA 5C7OO 5B4TA 1T2CA 4IUYA 3FHLA 4YJFA 2RAFA 3W4KA 2CVQA 2O48X 5K6AA 5F1OA 2I5PO 2GUGA 4R9RA 1YKFA 5I8WA 4YAGA 1GDHA 4A03A 3OQ1A 5FF9A 5KJCA 2P68A 1Y9EA 3ENNA 4L4SA 3JD3A 3SLGA 1SAYA 3PEFA 3MOGA 1YVEI 4RZIA 3K5PA 4KQXA 4BNLA 1S6YA 4E2ZA 4NZ9A 3SJ7A 2YHUA 5EMHA 1Z7EA 3FNFA 4EEZA 2VHXA 5CDTA 2ZTVA 5G0WA 4D46A 4CMHA 3GFBA 5BSGA 3P7MA 5T67A 3L6DA 3OQBA 1OBFO 1WXDA 4R3NA 3ICCA 5A04A 4EJ0A 2O2SA 3R3JA 5EQDA 5AYVA 4E30A 2AQHA 1CF2O 1TA4A 4PN3A 4WECA 3ZU3A 3C7DB 1VLLA 4G81A 3ZNPA 2OHXA 4D7AA 4R4JA 2BRUA 3U9LA 3UKOA 3KB6A 3W4JA 3ABIA 3I9OA 3OHSX 3S2IA 2I66A 3EZYA 3WGQA 3UCXA 1TXGA 2X5OA 3I9KA 4J0FA 2YDYA 5AXCA 4PCVA 4A2CA 4HADA 5G0SA 5JBIA 7MDHA 1ONPA 4A73A 3PYMA 4J7CA 3W1VA 3D5TA 2PKQO 2DBVO 1LDBA 2EW8A 3O8QB 1PGPA 1QG6A 2I67A 3AJRA 3F4BA 1XQ6A 4XGKA 3X2EA 3IJPA 1K2WA 3N74A 4MKZA 3DZHA 5FYDA 5A9RA 1QYDA 3UGKA 2HMUA 1YWGO 4YQYA 2X5JO 4ZQGA 4UEKA 3ZWXA 3IKVA 5L7TA 2EHDA 3VH1A 4BMNA 4OAQA 2IZ0A 3AM5A 5L53A 1HKUA 2VZ8A 1U3UA 1G6KA 1HYGA 4QXMA 3WGHA 4TSKA 4GX2A 4DXHA 4ZRMA 5JE8A 4XIYA 1NNUA 5A02A 1WAMA 4EUFA 2ZQYA 4BL5A 3S2EA 1F17A 5IXYA 3FWZA 4BVAA 2ZB8A 2V65A 5BR7A 4OSOA 3RSHA 1LJ8A 1E7WA 3FNHA 4YJGA 3FPCA 1MXFA 4O63O 1LC3A 4ALKA 3IIEA 4CM8A 3CEAA 4PLFA 5DBFA 4KUGA 1MG0A 4IMPA 1EFKA 1EDOA 3RC2A 2IDZA 4WUVA 4PG5A 3KM0A 3H4VA 3E5MA 1P45A 2I65A 5EQFA 2BKAA 1X7DA 3EVTA 1ISHA 5JCXA 3JV7A 1Y81A 4YT4A 3DXFA 3WS7A 5A9SA 4BB6A 4JGBA 4FQ8A 4S1VA 1E3EA 2PD3A 2PV7A 1DJNA 3T7CA 1H2HA 4ILKA 3G49A 4C4OA 1D1SA 1N5DA 3RFVA 4FJ0A 4DPMA 1N1GA 1NTOA 2PA3A 3JYOA 4UVEA 1E7RA 3HDQA 3AY3A 1KY4A 3LDHA 3NEPX 5IDWA 1A27A 1KVUA 5B37A 3CIFA 3JQGB 2RHCA 4IPTA 5JYDA 1W8DA 4J2HA 2B69A 3EUWA 5DF1A 1DIAA 3P2YA 4NHEA 2GNAA 2QYSA 2ZCUA 2BELA 4OSPA 2VYVD 3F5QA 3VPFA 3H8VA 3PLNA 3GG9A 1ENOA 3L77A 1E7QA 1ONNA 3HE3A 1A7KA 3ONEA 4ITUA 4EEXA 1EVZA 4YPOA 5CHEA 5BSFA 1ISGA 3ZZNA 4E2YA 4JQCA 4WCDA 3RASA 4AJHA 2HO5A 3OA2A 2NLOA 2ILTA 1F0YA 1ZCJA 3BTVA 3IS3A 1NFQA 3ZW9A 2XAAA 1NPDA 3DTYA 1U3WA 1U5CA 5JC1A 3VPGA 2BGMA 2HMWA 2WTBA 3NGXA 1DBVO 1U8FO 3DBRB 1HWYA 3O03A 3OF2A 2D2IA 3TOZA 2G0TA 1O0SA 2D5AA 3DAFA 4L9RA 1UDAA 4ZVVA 5IG2A 1GTMA 1V0JA 2UVDA 3R1IA 4BUCA 3R3SA 4FD3A 3PDJA 4CLDA 2O3UA 3ZU5A 2VYND 4XB2A 2B5WA 1E5QA 3UW3A 2JAPA 5T8KC 2A9FA 4RPLA 3WFIA 5A5EA 1PGNA 2VT2A 2J5KA 3HFSA 5A05A 2X22A 3WWYA 4O6VA 2VOJA 2Y1CA 3KYDB 5KWEA 2CY0A 1K6XA 2BI7A 1ZNQO 2Z95A 3PPIA 4NU5A 4XZ3A 4WGGA 3ZNOA 3STHA 4EUHA 2CDAA 4XIJA 1F8FA 1R16A 1DB3A 2QZ9A 1YH3A 1KVSA 4J4HA 5A5FA 4J7UA 4TZTA 2PH5A 5L9AA 1Z75A 4KUHA 1MB4A 2JD0A 4OJNA 1GD1O 1KY5A 3ASUA 2X9NA 4B7XA 3VTZA 5U9CA 2GGSA 4GGPA 3JQFA 1IPEA 1QKIA 2X9VA 5FFFA 3LK7A 3TL3A 2PLAA 5L4LA 1LA2A 2OBNA 4M1QA 1PGOA 1MFPA 1ZVMA 1YS4A 4Y6RA 1V3TA 1DPGA 1GQQA 3B6ZA 3RWBA 4D0SA 1BG6A 2W2KB 3VDRA 1SOVA 2AA3A 4B8ZA 2ZQZA 3TL2A 5JYEA 4HFJA 1X15A 3BTSA 4F46A 4RO0A 5CDGA 4AJJA 3NDRA 3EC7A 3HDJA 1YDEA 1BSVA 3RJ5A 2X8LA 5TX7A 4YAEA 1U3TA 3BHJA 2PH3A 1O6ZA 3INTA 4GX1A 3UVEA 2X9GA 4HWKA 2R00A 5L7YA 3TZKA 1UP6A 4N18A 4HUJA 1D4FA 1GY8A 3A14A 5TF4A 3AI3A 5DDIP 2X86A 2X0JA 5I7FA 3M1LA 1NQ5A 1RPNA 5KKAA 4BO5A 4CM8B 4WLOA 4WOKA 3D1LA 4PG7A 5HBRA 4Q9NA 5H82A 1JA9A 1P1KA 1NYTA 5KIAA 3HUDA 4IDEA 3CKYA 5AXDA 3GEGA 4NPCA 3KLPX 4NI5A 5KJ6A 3PJEA 2YZ7A 3DL2A 4IM7A 4WEOA 3RUCA 1YBMA 4KDEA 2PD6A 4BNFA 3ZU4A 1ZK3A 3JXOA 1E6WA 3DOJA 1DFIA 1NVGA 4M86A 4QUKA 3E6AA 4JCOA 2DBRA 2YV1A 4NU6A 4N54A 4XDZA 3SBOA 3KLMX 2X58A 1U5AA 3RVDA 3CINA 1EE9A 2O3SA 1EBFA 4ID9A 4EGFA 3MCVA 1D1TA 3GG2A 3GMDA 2PK3A 4IGEA 4JBIA 1NQAO 3RUDA 4CL3A 2OORA 1A72A 4P22A 4R9SA 3W8DA 1C1XA 3VKVA 2QZZA 2FOIA 1WMBA 3VPXA 1MA0A 1YL5A 5LCXA 3CZRA 1N7GA 3MJVA 4Z9FA 1IOLA 1JKJA 1K5HA 5IZCA 1L1FA 4PVCA 4AJKA 1EVJA 3Q2IA 1RM3A 4PZCA 4BNUA 2V6MA 4BNVA 3I5MA 1N1EA 5G0TA 3VVCA 3ZWWA 3BTOA 2BF7A 2ZCVA 2NSDA 4YAJA 2DC1A 4WPGA 1DIRA 5JSFA 4BMVA 1PGJA 2VWGA 3JQBC 5TS3A 4GX0A 1R4MA 4IQ8A 1NXQA 1WMAA 3ZV6A 4I5GA 3RFXA 8LDHA 4EZBA 1ZEMA 3WLEA 1GFSA 2POQX 3DZBA 2PKRA 3C3XA 1FMCA 1RYDA 3OA0A 3OEWA 2DQ4A 3GDOA 2YV3A 2IZZA 3MWEB 3R6DA 4FJ1A 3VAZA 4JK3A 1ONOA 1E7SA 4UEOA 2NVUB 2E4AA 2D4AA 3LLVA 5JC8A 4XGNA 3JSAA 3IC5A 2ZTMA 5JAIA 3AK4A 5LDHA 4RQTA 1XGKA 1IPFA 4AJEA 1LSUA 5ER6A 3PFFA 4G5HA 1Z45A 3FI9A 1E3WA 2X7HA 4IDAA 2VWHA 3VZQA 1PS9A 5KJEA 2D5CA 1UXGA 4U6SA 3WNQA 4ALJA 1V9LA 2NWQA 1PQWA 2BD0A 4DWVA 3HN2A 5B1YA 1JWAB 3WOHA 1YB1A 2NV6A 1ZFNA 1PTJA 1GPJA 2HMTA 3U49A 5KVCA 4JBHA 1PWXA 4BGVA 3AOEA 2OMEA 3PJGA 2NTVA 2G5CA 4LCJA 5A3JA 1DO8A 2DAPA 3AU8A 3UH1A 1IHXA 1QYCA 4Q39A 5G4KB 4EJMA 2PZLA 1SOWA 5THKA 1EDZA 3WMWA 3EW7A 4IDBA 2VZ0A 3ONFA 1PJSA 3WFJA 5CG1A 3NJ4A 4CLRA 2WD7A 4WEQA 3OP4A 2PGLA 5MGBA 1N7HA 3D3EA 1NAIA 1F12A 2YQ4A 4TVOA 2VHZA 4CQMD 3ZW8A 4XEHA 2O4UX 2X6TA 2Y0DA 1E77A 4PLPA 1CQIA 1QMGA 3UOGA 3ROMA 2PR2A 1ZO8A 4M55A 2EJWA 3EZLA 2BH9A 2XXBA 1DJQA 1NHGA 1X13A 3Q2KA 5DNAA 5LC1A 3I9LA 1BW9A 1PJ2A 1H2BA 3KXDA 2ZTUA 1B8PA 3ZWCA 4CR8A 3DFUA 4DVJA 2CVOA 1R66A 2UUOA 1GYQA 9LDTA 3LU1A 1HZJA 4BNHA 5EN4A 3WJAA 2Y93A 1UUFA 1K6JA 3GUCA 3IL2A 4BGUA 5TJ9A 1DLIA 1ZJYA 3H5RA 4BQPA 3NV9A 1Z6ZA 4BOYA 9LDBA 1BXGB 4MP6A 4YWJA 3P19A 2CVZA 3AU9A 1CYDA 3QHAA 5T64A 1ULSA 1I10A 3LSYA 1SC6A 1KIFA 2E48A 1BVRA 4GMGA 3FNEA 3V5NA 1OFGA 1HDGO 4IJWA 1U28A 2I9PA 2HK8A 2PKQP 1YL7A 2JFHA 4MVJE 4JIGA 2VHWA 3E9NA 1C1XB 1UJMA 4A0SA 3K73O 4IMRA 2C0CA 5IXSA 4JXKA 4BO2A 4DA9A 5TT0A 4A27A 4YCAA 4FOOA 3AW9A 3PYXA 4OKIA 3HG7A 4J4BA 3GF4A 3DMYA 3WMXA 1H0KA 3OEYA 3GVCA 1X0VA 3F5SA 4WCFC 4CLOA 4E32A 4RZHA 1GV1A 1VSVA 3AUUA 3IOYA 4FGWA 4K6FA 4XR9A 3ENKA 4AJNA 2Y0EA 4E2XA 4BO4A 1SBYA 1QLJA 1ADGA 5DCYA 4II3A 3MZ0A 4E2WA 2GN9A 3MOIA 1AE1A 3NDIA 1C0LA 3L4BC 3EAGA 4ZQHA 4AJ2A 4DBVO 4ZQEA 4RPKA 3RU9A 4E21A 1DC6A 1YXMA 1VPDA 3LC7O 1YB4A 1KVQA 4TROA 4J90A 1ZJZA 4OXKA 3ST7A 3HDYA 3TRIA 3JQ8A 1H94A 4IIUA 4J9UE 2OUIA 3DFZA 3PHHA 3PI7A 2R2GA 4Y67A 3BMCA 2FPPA 3L6EA 4CMEC 3A1NA 1JQBA 2BGLA 3LLSA 1LLUA 4DIFA 3DMTC 3GPIA 1ZUD1 3O9ZA 4QFDA 1C0KA 3WTBA 2DPHA 4RLSA 2E37A 3U3XA 4JJFA 2EKPA 4CLHA 4NFYA 2Y1GA 2GLXA 3PZRA 5U4QA 3K6JA 4HFMA 3DZJA 4A10A 1ISMA 4Y8VA 4GWKA 5KNLA 3QVWA 1W0CA 3WGOA 3OIDA 2WD7B 4K6CA 1T2DA 3E48A 4CQMA 4DLBA 1NVTA 2C07A 2PNFA 3OJEA 4E5YA 3EVNA 4R69A 4JLWA 4PG6A 1JKFA 3ITKA 1XCBA 3PQFA 5TGDA 2ZYAA 2IYOA 1HF3A 4YRDA 2GDZA 2PY6A 3GUYA 1IYZA 1DRWA 4AG3A 2J3IA 3FPLA 3FF4A 2AG8A 1XA0A 3TZCA 3JQ6A 2EJVA 3WBBA 3KYCA 1E7YA 4XQCA 4K28A 2HDHA 2NADA 4M8SA 5HRUA 1UZLA 1GYPA 1LQTA 4MKRA 1ZXLA 4GGOA 3RC9A 3VKUA 3FTPA 1E5LA 4B79A 4Q3BA 3E1KA 4TMFA 5IFLA 3ASVA 1E6EA 3FWNA 1QYXA 2EERA 3DZFA 1TT7A 4DIOA 1CJCA 2VYNA 3I52A 3ZHXA 4R1TA 4DQXA 1B15A 2P9GA 1K0UA 3JQAD 5IAAA 3G1UA 4Y6SA 4CMAA 4JNKA 3DDNA 4IZHA 5L4NA 1JKIA 4WCFB 4BNWA 2HKIA 4W9NA 4XYLA 1HE3A 2DPGA 1E3WB 2EF1A 2TMGA 3DMTA 3WGZA 1L7EA 1LSJA 4O59O 3KZVA 3ULKA 1GQYA 4BGEA 2DBZA 4HFRA 3U62A 2AEMA 2GO1A 2NVWA 3DAPA 2BKPA 1EQ2A 5TT1A 3GNTA 2FPIA 4ND3A 3I9NA 3ZV3A 4J1TA 1EQUA 1SB8A 3AOGA 3HFGA 4HY3A 4D79A 2OGUA 1P1JA 3NRCA 5BT9A 3HB5X 4XRGA 3AFNA 4DPLA 2JCXA 1VL6A 2RBEA 5CEFA 4IIVA 4YS2A 2VN8A 3ADPA 3H5AA 4TZKA 1HDCA 1O9BA 3JD0A 2F1KA 3GVHA 4TWRA 3UFXA 1BGVA 3WR5A 2WEKA 4E0BA 5HS6A 1P74A 4L4RA 4NIMA 1GUZA 3OMLA 1J6UA 4GLOA 1XQ1A 3KO8A 4GQAA 2Q1WA 1V35A 4CLRB 2CD9A 2VRCA 3PQDA 3NUGA 3SC6A 3VPHA 3F46A 3GZNB 1PJ3A 4NJMA 1JTVA 4D41A 2AHRA 2VOEA 3ROQA 3BXXA 4AJ4A 4URFA 5I7SA 4Z0PA 1CERA 3JQ8B 4BNZA 1M66A 4BHTA 5I7EA 4U0KA 4PIVA 1SB9A 5ENVA 2AEFA 3QVXA 5G0VA 3RQSA 1FK8A 1V6AA 3WTCA 3IQDB 5GZ6A 1R37A 1R0LA 1Z82A 1MX3A 1JVSA 4YACA 1K89A 4TRMA 3C1OA 4JROA 3JQAA 3K31A 5EJ2A 4TVBA 4PRKA 1LNQA 1LLDA 2GYYA 1Y6JA 2ZKLA 3DBVO 3K9QO 4CV1A 4YTEA 2NTNA 3V2GA 4IBOA 2Y68A 1HDXA 3WSWA 1C0PA 3SC4A 2PZJA 2EGGA 3HHPA 3OM9A 4XX0A 4WLUA 1GZ6A 1Y5MA 4AL4A 4HKTA 3QRWA 4RORA 2JAHA 1YL6A 5JMWA 2C82A 1E6UA 3F6YA 2F00A 1LLCA 1T26A 3GGPA 4JJIA 4GPD1 3A28A 3GAFA 3NGLA 2IZ1A 2O3QA 1UDCA 1TI7A 4ESOA 4RDIA 2Y1DA 5C7IO 4DC1A 3QSGA 1BVUA 4QTZA 4K1LA 4OQZA 4CUJA 4E33A 4CUZA 1SO8A 3WIEA 2Q50A 2UAGA 5ES3A 4WNCA 2HJRA 2Z1NA 1OAAA 1U7TA 2OBYA 3UXYA 4IJUA 4KTTE 3GQVA 1VM6A 2YYYA 4GKBA 1VCTA 2WD8A 1IY8A 3Q6IA 1DIBA 4OMUA 3GVIA 2LDXA 1I2BA 5T5QA 1XKQA 1VJ0A 3ZWPA 3PWZA 4FGSA 1ZSVA 2FRDA 2Q1SA 3IP1A 3N58A 4ROSA 2Q3EA 5BNIA 2QRLA 3SXPA 3JQ9C 1R12A 1T25A 3FRJA 3GK3A 3OFSA 4NBWA 3ICPA 1D3AA 4NJOA 1ULUA 1VE9A 3ZU2A 3QVOA 3GPDG 2ZB3A 2NM0A 1DFGA 2CDBA 4H15A 4Y6PA 3KETA 2OXIA 5CEJA 3NTOA 4ZQBA 4I9HA 4XQEA 2BMAA 4BKQA 2PZKA 5JDIA 2VTDA 4AJOA 2FR8A 2GN8A 5G4LA 1I0ZA 3EK2A 3ZH2A 4GAEA 3O26A 3TSCA 2ZJ0A 2XXJA 4QO7A 1V8BA 4BV9A 4GH5A 3AY6A 4J16A 8ADHA 5JAMA 3I9JA 3ON5A 2W2KA 4XR4A 1LRKA 5EIOA 2AE1A 3RUAA 2FPGA 4B3IA 5BNTA 3UUWA 2DTDA 4FFOA 1K3TA 4IINA 1PJCA 4D42A 1YO6A 3I4FA 2UDPA 3I3OA 3MJEA 1OC2A 1PJTA 5JO9A 5BQFA 1NWHA 1VSUA 4DTIA 5IZ4A 2BFMA 1DC4A 3DHEA 3DHNA 4F3YA 1DOHA 5FWNA 3QVSA 1I5RA 1D7OA 2WSBA 1SMKA 2W90A 1OZAA 1Q0HA 2OP1A 3ZI0A 1F14A 4J9VA 1C1DA 1HLPA 3K92A 3OJ0A 3UCEA 4CODB 4PG8A 2NU9A 4G2NA 2IEDA 4BO6A 2G76A 1U2DA 2W2LD 4OHUA 2DT5A 2BGKA 4IXTA 2GD1O 3ZN2A 2DTEA 3H65A 4LISA 4ZN6A 4FN4A 1JLLA 4XRRA 4RVDA 5C7LO 1BHSA 2CF6A 3GAZA 2QRJA 4WNIA 1PQUA 4ALMA 2D0IA 3K30A 3NT5A 1HSOA 1KOLA 1R0KA 1I30A 3QLJA 3ROPA 1BXZA 2WE7A 5EL0A 3IKTA 2GN6A 4FFLA 3RROA 1P1FA 2X23A 3F47A 3VC7A 2Q99A 1WNTA 1EFLA 2B36A 2JCVA 4II2A 3OICA 3GVXA 3VDQA 3WX0A 5CDUA 4YYZA 3C7CB 3ROKA 1IL0A 1YJ8A 2VWQA 5A9SB 4IGFA 5BNFA 3OIFA 4ND1A 2AW5A 1KEVA 3ETEA 4FJ2A 2ZK7A 4MINA 2HK9A 4QX6A 4HP8A 3QY9A 3B20A 3E5RA 3GEDA 1DSSG 1JVBA 3U5TA 3DBHA 2NUAA 3ONDA 4XYBA 2RIRA 3PZBA 5AOVA 2QRKA 1A4UA 2GERA 3U4IA 1LC0A 4MIOA 4YEDA 3ZWNA 1LUAA 4LSMA 2G1UA 3OSUA 2NU7A 4M54A 4Q3EA 1V3UA 4OXNA 1TLTA 3OH8A 4NFSA 2HMSA 3ZNNA 5AXAA 4E6PA 2QW8A 3FBTA 1KEPA 1MGOA 2P5UA 2IEBA 5JAZA 1I3LA 2GR9A 4OXYA 2FHSA 4W9NC 5TSDA 3WIDA 5ILOA 5JPIA 4Z3DA 1B14A 2XF8A 1U4OA 2IE0A 4TRJA 5DP2A 2QQ5A 4YXFA 1A9YA 2BFOA 3GEMA 1GQ2A 3BMOB 4KZPA 3VH3A 4B4VA 1ZK0A 3ZHZA 1LDNA 1M2WA 2J5RA 2YW9A 2XPCA 4U5QA 5CG2A 5IDQA 3GZNA 3JD4A 4PFJA 3JTMA 1QR6A 1DRVA 2I6TA 1ISFA 4MP8A 2AE2A 1I8TA 3UF0A 1YQXA 3AI1A 4O5OA 3L4BA 4BO7A 3C24A 5C5IA 2HUNA 5CEEA 2VT3A 2EGHA 4BO0A 3HWRA 2YY7A 4B7UA 1T4BA 3MEQA 2VTEA 3HJAA 1C14A 2GCGA 4PLVA 5TRTA 4EYEA 1Q1NA 1HDYA 1SZJG 4PZEA 4YAIA 5JDCA 3VVBA 2D59A 2CSUA 3GDGA 3WJ7A 1SNYA 3EY4A 1KEWA 4AJPA 1T1SA 1G0NA 2B37A 5G2OA 3JYNA 4I9NA 5TIIA 4TQGA 3KHUA 3QE3A 3P2OA 3S55A 1NPYA 2B4RO 4DREA 3OQ6A 1CIVA 4BO9A 1JDJA 1EUDA 2ZTLA 2Q2WA 3JD2A 3G1TA 2C2YA 1GAEO 4P38A 3IMFA 2NTJA 3MJTA 2EWMA 3UCFA 1LSSA 1GEEA 1H6DA 1A5ZA 2UUPA 4CM3A 4YRBA 1ZH8A 4TRNA 2BFAA 1FDSA 1WZEA 4B7CA 4GL4A 2CNBA 3CTMA 5B4UA 3RUIA 1TVEA 3AM4A 3B1JA 1QLHA 5KCZA 2O4CA 1YBVA 5JCJD 4EBFA 1R15A 2H9IA 2V6BA 2YFHA 4PRLA 1LLQA 1K6IA 3DOOA 2X0NA 4L75A 3O4RA 3B1KA 1Q0QA 4LVUA 3O38A 3H9UA 3E03A 3RKUA 1AXEA 4MP3A 5CFZA 1B8UA 3G79A 3PHGA 4QFCA 1QXSA 1DRUA 4ZJUA 5KOIA 4J91A 5JAQA 4OO3A 3IAHA 5TLSA 2C5EA 1LQUA 1UR5A 1WZIA 1PU2A 2OFPA 3B1FA 5IF3A 4IJVA 1GUYA 1HYHA 4R51A 1P33A 2H1SA 2I76A 1Z74A 2W2LA 4GSKA 4IS2A 4BNXA 3GFGA 5KKCA 4PLYA 2C5AA 3GLQA 1NX6A 2SCUA 3CZMA 2HAEA 1NBOA 2AEJA 2RCYA 4OQYA 1IULA 3ZWYA 4CUKA 3EMKA 4I1IA 5IN5A 3H3JA 1B26A 4JP2A 3GRKA 4S3MA 3JCZA 3VHRA 3D3WA 2QHXA 4J6FA 3JQBA 1U8XX 3DWFA 2VUUA 2J3HA 1E0DA 2Z1MA 1LX6A 3KTDA 3PLRA 3T4XA 3TQHA 5C37A 3QW2A 3K2EA 5DBIA 3D4OA 4E3ZA 1PS0A 3VZPA 5A03A 2EIHA 3GN2A 4R16A 3QWFA 1V3VA 3QJ5A 4LK3A 2H5LA 3FBGA 3T4EA 4P4NA 1U2GA 4RF2A 2PTGA 3PVZA 2P4HX 3SX2A 1DIHA 1SCUA 3EYWA 4NJMB 4YQZA 2FP4A 5HTOA 4AJLA 2NVBA 3M2TA 5DP1A 5I8ZA 3WQQA 1GCOA 1W4ZA 1QV6A 1GCUA 2P91A 3M6IA 1NFFA 3PWSA 3M2PA 3LZ6A 4CM7A 1H6BA 1A7AA 1LI4A 4BS9A 1I3MA 1KYQA 1PZGA 4CJXA 3MTJA 4JJGA 1X1EA 4RVUA 4WLVA 3FTNA 5CPBA 1EMDA 4CR7A 5DT9A 1GADO 1O8CA 1MV8A 3DZKA 5AXBA 4DQVA 2VUSA 1QRRA 4U0JA 5JFOA 3F1KA 5JY1A 4Y98A 1PL6A 4C7KA 1SEPA 3QWAA 2A94A 4NNJA 4YBZA 4XYGA 4A26A 2D3TA 5ENDA 4L74A 2GN4A 4F6CA 4E4YA 1DIGA 1LDYA 1T4DA 3H9GA 4KWIA 1NAHA 5DCWA 3OETA 3PYLA 4L76A 3QWIA 3RC1A 4J4TA 5F5NA 1VKNA 5ITWA 1MXHA 5DZSA 3V2UA 1T24A 2QIOA 2C20A 3QIVA 3C8MA 4KMSA 1JW9B 3VH4A 3Q9UA 3MJCA 1PL8A 3HADA 1UXKA 4MVJG 4BNMA 5ER9A 1M6WA 3HZZA 4FFMA 3TF5A 3IDSA 1NR7A 4FCCA 1Y8QB 1PJLA 3KBOA 1FXSA 2V7PA 1XELA 4B3HA 4NBVA 2Y67A 3JD1A 4RCVA 1J5PA 4FIZA 2P5YA 1UZMA 3NDJA 4N5LA 2A4KA 3FN4A 5DOZA 5H83A 1Y1PA 2GZ3A 3V1YA 4J3FA 2FR1A 4B3JA 4Z6KA 3JQCA 1EVYA 1GYRA 3L9XA 2R00C 1QYVA 4FW8A 3WWZA 4CLEA 4M87A 1JU9A 1YGYA 3JQDA 2X5KO 3WICA 3PHJA 4ZU3A 2BLLA 1A4IA 1T2FA 4R68A 4W6ZA 3RU7A 2Q45A 3H9JA 5HA5A 1O94A 3U0BA 3KYCB 4KOAA 1ID1A 1KVTA 3BMOA 1X14A 2O23A 3H6KA 2NU6A 2PGDA 5F1KA 4H3VA 1A9ZA 1CEQA 4I5FA 4R1SA 5CDYA 5K6AC 2P9EA 1CQJA 2NNLD 4J0EA 4K9DA 5A3VA 5K9ZA 2HLPA 4XDYA 2PWZA 3PIDA 2VNAA 2IODA 4KQWA 1RM0A 5HWSA 3CMCO 3RKRA 1KVRA 2C54A 3P5SA 1E1MA 4P8RA 4BO1A 1ADBA 1ENYA 1KBZA 4ZHSA 3K2BA 3ZGYA 2B0JA 4A7PA 3W8EA 3AY7A 1KS9A 1ISJA 1MC4A 1C3VA 2D8AA 3KSUA 3NTRA 4I5DA 5DOVA 4I8XA 4IDGA 2BKOA 2EV9A 3D5QA 2W8ZA 2OOSA 1U9JA 4CMBA 1NPTO 4B4WA 2A35A 2Q1UA 1X7HA 1HTBA 3QV1A 1GEGA 5IZCC 5MDHA 2JHFA 2FSSA 4M49A 1C1DB 2LDBA 1NWCA 1ZBQA 1CETA 5ADHA 1MP0A 3Q11A 1VJ1A 1I32A 1Q7CA 3KV3O 4AJIA 3S2GA 5I9MA 2EXXA 1XIVA 4WLEA 2CUKA 4YJHB 2Y0CA 1GL3A 1YDWA 1H6CA 3E9QA 6ADHA 4YT5A 4HBGA 1W6UA 4XB1A 4J7XA 2V6GA 4R54A 2NU8A 4LSWA 4ZD6A 2IYPA 3GC6A 4INAA 1DLJA 1PGQA 4OM8A 1OI7A 2PGJA 4HXYA 3F1LA 2FWMX 4FC7A 5L3ZA 3INGA 4NK4A 1YONA 1ENPA 2VRBA 4Z0TA 3AFMA 4RLHA 4CM4B 4MVJH 2J5QA 1HETA 1MFZA 3TNLA 1PEDA 3I6QA 3KEQA 4CM1A 1T1RA 4Z0HO 1PJBA 2GSDA 2H6EA 3B70A 3W6UA 3RUEA 1UXHA 1HLDA 1NR1A 2QX7A 5JCJA 1P1RA 4LW8A 2WWRA 2B35A 2BHLA 3RUFA 1RWBA 2GASA 3CXRA 3TZHA 1J49A 3RFTA 1L7DA 5F3RA 2YDXA 1ZKMA 4LMPA 3G0OA 2WYWA 2VYVA 1NQOA 1YQDA 4D43A 2HQ1A 3D3WB 1GR0A 2JFGA 4YJFB 4CMIA 3GMSA 1X7GA 1XU7A 3NT4A 1EZ4A 4MDHA 4QQRA 3AUSA 2WDZA 4HNHA 4QEDA 4CM6A 4Z3KA 1XEAA 3JYQA 5F21A 3VZSA 3FD8A 4MJLA 2HCTA 2O3RA 3GNSA 1LDGA 4NBRA 2A92A 3WXBA 5B4VA 1UDBA 3IUPA 1EUCA 1JWBB 1OC4A 2CZCA 4M89A 1PQPA 3LC2O 1ZEJA 1ZW1A 1VKOA 4BNNA 1LXCA 4J1NA 1G1AA 1LRJA 4LVCA 2AQKA 4YR9A 1O5IA 4MIYA 3PHIA 3SJUA 1B8VA 1HZZA 5JNLA 1E3SA 3BZUA 4IZIA 5L95A 3GHYA 4QSMA 1BDBA 1P1HA 3NAQA 3QA9A 3FR7A 4FR5A 1ZK1A 3V1TC 4JX8A 4FPXA 4O1MA 1I24A 4U6QA 1AXGA 3PJFA 3LC1O 3OJOA 2PD4A 4LRSB 3TPCA 1R6DA 1HL3A 3BHIA 5ILGA 1PJQA 3OIGA 4FDAA 1B3RA 1XU9A 2QYTA 3NJ8A 5EESA 4EUEA 3H5NA 5FEUA 2DFVA 3F4LA 4RVHA 3TFQA 1Y5RA 2DTXA 4MVJP 1UAGA 2Y99A 1YOVA 1CWUA 4ND5A 4YA6A 4CMCA 3I4CA 4GVXA 5BSEA 1DXYA 1WPQA 5F1PA 2WJPA 1DAPA 1HSZA 1Q0LA 3LT0A 3OJFA 1E1NA 3PP8A 3O8QA 1TEHA 1X1TA 2FMUA 1LBEA 1FF9A 4J1SA 4W7IA 4DYVA 4K26A 3I83A 4D3FA 3EDMA 2XOXA 3S2FA 3NX4A 4RF3A 3H7AA 5ICSA 1AHHA 1NM5A 1CDOA 2FN7A 4WK6A 2CF5A 3ZWBA 1ZMTA 1JN0A 3DZGA 4DUPA 3A9WA 1E7MA 3TFOA 3ORFA 3ANMA 4PGFA 4XD2A 3KYBA 1AHIA 3PQEA 3LYLA 4IDFA 4IXWA 3G3EA 1U4SA 4J2OA 5EINA 4QO8A 5TQVA 1H9AA 1D8AA 3WQSB 4CM4A 2B83A 4AVYA 4UULA 4MVJA 2HU2A 5G0UA 4JN6B 5T8KA 4WCFA 1E1KA 3T7EA 4YB8A 1JAXA 3KUXA 4WE3A 5AVOA 3WDSA 4GVLA 1NQTA 4EI2A 1O95A 2AQ8A 4CMJA 1ZSYA 2P4QA 2Q1TA 4D3SA 5I7VA 4ONEA 2GF2A 1PS8A 5COAA 3RBXA 1KERA 3I9MA 4UUPA 3VPSA 1VI2A 3QP9A 3CPSA 2NQ8A 4PLTA 2C7GA 3ZNQA 1T2AA 2EP5A 3E18A 1FDVA 3RBZA 1UXIA 4LN1A 1ZK4A 2AMFA 5GZ3A 1ISIA 1DDOA 1HDZA 3S1LA 3C1AA 1H5QA 1EEHA 3C7AA 3KVOA 2FY8A 4PG4A 1YB5A 2OP0A 4BV8A 1VJTA 4Y9DA 3GRPA 3CSDA 5TJHA 2Q4EA 3KEOA 1T2EA 1BW9B 3IP3A 2O3TA 4CV0A 4OL9A 4UVHA 2GPTA 3KSZO 2NVUA 3RC7A 2VNSA 3PIIA 4HV4A 2OL4A 2JD1A 5EERA 1IHYA 3NT2A 4NG5A 4EITA 1VL0A 3ZWVA 5TNXA 3JQAB 3I6IA 3BAZA 4NR0A 5CP8A 1Y7TA 2J3JA 3RCBA 1B2LA 2ET6A 4J1QA 4F45A 5JDIC 5F5LA 1H9BA 3WB9A 1F8GA 2R6JA 3QVTA 3L07A 4Q3AA 5GY7A 3D0OA 1HT0A 1S7CA 3ZDFA 3DZIA 4YVFA 2ZB4A 4LCEA 3SEFA 3HN7A 1PZEA 3OBBA 1H93A 1MC5A 4XYMA 3VH2A 5TC4A 2AQIA 1HXHA 1O89A 3R0IA 2HRZA 3LF1A 5L4SA 4OH1A 4DPKA 4CMKA 3JYLA 2YFQA 2DFDA 2WMDA 5G4KA 4J49A 1YRLA 4X54A 3AUAA 5A06A 4CLOB 5ICMA 4JBGA 2X0RA 3RIHA 2EP7A 3AI2A 2JFFA 4C7JA 1LTHR 2O2YA 4CL8A 3GDFA 1XWFA 5BSHA 1WDLA 3KSDO 1YOVB 5L51A 4U7WA 1GZ4A 3SVTA 1DAOA 1E1LA 3L6OO 1IE3A 4BNKA 3RD5A 2PFGA 3Q1LA 3VZRA 3RI3A 4DLAA 4RVGA 3CH6A 4G65A 4WOJA 5A1TA 4YT2A 2Y66A 4DL9A 1LRLA 2DLDA 2C59A 1U7HA 3DHYA 4XGIA 1HDOA 3EGOA 4DMLA 1Q7GA 2ZIZA 4ALLA 3BHMA 5A4DA 1DHTA 2BFPA 5IN4A 1Z7BA 1HE4A 3PGXA 3BMQB 4NH4A 4TRRA 4GWGA 4CMEA 2DUUA 3M1AA 1RKXA 1HYEA 5L7WA 3BYZA 1HDRA 3IJRA 3NKLA 5KTKA 1QYWA 5H81A 3BTUA 3LT4A 2BI8A 4BO3A 2GRAA 3DBRA 2GZ1A 1DC5A 3WGYA 5T6BA 3LF2A 3FNGA 3TWOA 1TT5A 3UHAA 2DBQA 2YHIA 4D3DA 3JQEA 3Q0EA 4GSLA 1EUZA 4Q3DA 1PR3A 2I3GA 3PRJA 4KTVE 4RVFA 2TMDA 1KETA 1Q7BA 2FZWA 3PFWO 1N9GB 3GY0A 4LRTB 4FS3A 3ZHBA 3C1TA 4KUEA 5COQA 1UXJA 3KYDA 4XJTA 1PZHA 1P77A 3G17A 3MTGA 2HMVA 4R1UA 4RGBA 3V2HA 1PJ4A 1YE3A 5FI3A 4IQGA 4WASA 3TZ6A 3PXXA 3W8FA 2O7QA 4OGWA 2RHRA 4E5KA 1LSOA 4DRYA 1LDEA 5FI5A 3AOEC 3U4DA 4YJGB 3WSVA 2JCYA 2Y1OA 3CMMA 4FOSA 3PGJA 1I2ZA 1DHRA 3AWDA 2FSVA 5KJ1A 2VHVA 2B4QA 3TN7A 2D1YA 4PLGA 3WLFA 4DMMA 4YJDA 2Q2QA 2E82A 4FBGA 3AUTA 3L4SO 1X0XA 4OIMA 3UN1A 4KDFA 2Q46A 5IDXA 1HE2A 4BIIA 5I9LA 4NBTA 3L9WA 4ALIA 1EK6A 4MVJI 4MVJD 2QG4A 1M76A 1WDMA 3HDHA 5IDYA 5B12A 4H7PA 4ALNA 1RYEA 4GI2A 1J4AA 3S8MA 1NVMB 3GR6A 3DEYX 1BWSA 4J43A 1XHLA 3E8XA 4L0QA 4B8WA 2RH4A 4L73A 2Y1EA 4UREA 2HRBA 3GOHA 2V6FA 3DBLB 2YV2A 1FDWA 3DBHB 4P4GA 5CAEA 2NACA 4CQMB 4NBUA 1XG5A 3GZ4A 3HQ4O 3N7UA 3QWBA 4DC0A 2CFCA 3BMNA 2AG5A 4RV9A 4N5MA 1PX0A 4ZGWA 1U1IA 1I3NA 2ZYGA 3PJDA 3COSA 4RPGA 3WGTA 3DO5A 4MVJM 2O3JA 1W73A 4UVDA 2IXBA 4CQLB 1MG5A 2UYYA 1FDTA 3PHLA 1SEVA 4W82A 5T57A 5AQ1A 4BMSA 4MPDA 2X1HA 1P0CA 3BA1A 2VRCD 4AFNA 1XSEA 2YUTA 1EK5A 4HFNA 3WBFA 5HM8A 4NK5A 1Y9AA 3WYCA 4EJ6A 3UICA 1GUFA 2EKLA 4Q3CA 5JY6A 4GLLA 1ADCA 1Z73A 3GVPA 1GU7A 4FFNA 2GZ2A 4XJSA 4I08A 2UV8A 3PK0A 4CV2A 3ITDA 5DN9A 5HS4A 3EHEA 3RBVA 4BKPA 1EE2A 3U4HA 1IZ9A 4EW6A 2Q2VA 4O0LA 1J0XO 2C29D 4UUNA 3OJLA 4AICA 4R41A 2B5VA 3WYBA 2WYVA 3WYEA 3TJRA 3X2FA 3BMQA 2B4TO 4QT0A 1A71A 4UEJA 1P3DA 1AGNA 2VZ9A 2P9CA 3U4CA 2J6IA 2ZYDA 4MO2A 3GNQA 1NASA 3V1UA 4FSHA 2Y1FA 3QWHA 3LQFA 2E49A 3JYPA 1M6HA 1PL7A 3HSKA 1R4MB 3DTTA 4CM5A 5J23A 1LU9A 1KEUA 3ZWOA 3GGOA 4R1NA 3VTFA 5K0ZA 1RM4A 1DFHA 4QECA 1ORRA 2I3AA 3W6ZA 1R4NA 3NTQA 4BB5A 4IJKA 1Y8RB 1RJWA 7ADHA 1N2SA 1WVGA 1XLTA 2DKNA 4PZDA 3WG9A 1N9GA 4RF5A 1BTOA 4B4OA 4MOWA 2VHYA 4DLLA 1WLYA 1LDMA 4UVGA 1VRWA 1NHWA 5GZ1A 1B3BA 3D7LA 4ND2A 3V8BA 4ZQFA 1PWZA 3ANLA 1RM5A 4N7RA 4E12A 4BKUA 4E5PA 5KVVA 3I1JA 4MVJF 1B7GO 4PVDA 4FB5A 3AM3A 5KJFA 4W7HA 5CDSA 4XQGA 2JJYA 3DOCA 4DBZA 5KVQA 4CM9D 1E92A 4XWYA 5THQA 4E5NA 4XKJA 4HNGA 3RJ9A 4BO8A 1P44A 4IDCA 2FR0A 2IXAA 1HRDA
chains in the Genus database with same CATH superfamily
1U0SY 4YP7A 3QAUA 2Z2YB 1KORA 1ZOOA 1DQZA 1SU6A 2CYCA 3I32A 4DNFA 2HGLA 2RIPA 3WGIA 3NS6A 3E05A 1HE5A 2ZZNA 4M0DA 3M4ZA 4NCHA 1WTFA 1KP6A 5KWSA 1DY3A 1W5FA 2GBPA 5JZBA 2WLTA 3ANNA 4QZVA 3K96A 4MPTA 5TF0A 3OLAA 3DJYA 2I1LA 3T9CA 5G40A 5B2FA 2JGDB 2BW7A 4UHCA 5A2QY 2O59A 1R88A 4XM0A 4DUYB 3CLRC 4JXXA 3PCTA 4X92A 4R3WA 2YQZA 1M34B 3ZXWA 4EENA 4OQLA 3FCUB 1YJWP 5IM5A 3CXHH 2FLWA 4B2YA 1BN7A 4TNOA 1T9XA 3HHKA 3ZHOA 1IFPA 3BO2A 3ZVRA 1QSGA 4USWA 5CNIA 1NTZK 3E8SA 2QDXA 2ZKTA 1WW8A 5H70A 2BEJA 4NBKA 1E9AA 4UOHA 1H0RA 4ECEA 4D44A 1O9GA 4CCHA 4XLLA 2HWHA 4YJ2F 3L1KA 3LNTA 1FTSA 4IJ6A 5K8OA 3VA7A 3D0KA 5ALPA 3V6KA 3IHLA 4JP5A 3NJRA 4M36A 1N6QA 3H3FA 1ZIDA 3WLNA 4DCPA 1JJVA 4JDUA 1YBHA 2J7UA 4WKGA 2XHZA 4MIBA 4F2SA 1MQ9A 4RA9B 3EGEA 1L4AD 5D7NA 4OFWA 2P1ZA 4C0AC 4RGYA 2C5LA 4AJ1A 4WD3A 2HRRA 4EW2A 3ESYA 2H07A 4QXOA 3D6NB 1FYXA 4G1BA 1RWPA 1Q1AA 3GJ4A 3QVGA 2Z8YM 4R1QA 4R6WA 5KJ7D 1R0BG 5KNCH 4QT4A 3KPJA 4DM7A 5C3MA 2BEWA 1A9XB 2VDLB 3EGXB 4LQLA 1JLGB 1HI9A 3MEGA 3TZXA 3MUTP 2QAIA 3HCBA 3CUWA 4UBKA 5KPJA 4A8SA 1L5ZA 1JAIA 1DD4A 4D82A 3EICA 5JZOA 2Y3IA 1YIAA 2G82A 4NCIA 3D81A 4C05A 1EGAA 5DTQA 3SYZA 4XYEA 1O6BA 4JLAA 4WADA 1O94C 3D6FB 1XQWA 3FBCA 3G7UA 5C1PA 2CPJA 1T2CA 4XPCA 1L3UA 2YYAA 1J2YA 4NYMR 4GP6A 4QDOA 1YKFA 4RW6A 1YZ3A 4WNAA 2HBYA 1DBIA 3JX9A 5FF9A 2ZULA 3ZTOA 1X74A 3V1KA 4H27A 4IOMA 1VLHA 1KRHA 4E2ZA 4YUWA 4ZPDA 4KLZA 4XPIB 2XA9A 5LDDC 3P7MA 1OFHA 2ZUVA 3LS2A 2ANBA 2GARA 1NTMD 5GTHE 2V98A 2L2QA 2BGNA 4LBPA 1S2LA 3C7DB 1T0TV 2VV5A 1PR5A 4P71A 4FN5A 1ILWA 2BRUA 5JZ9A 3U9LA 3FY4A 1XX6A 1GXSB 1BQNB 5KT6A 3J80U 1U2QA 5HKLA 4X4UA 2R751 4I2QA 2ZWAA 4OI4A 3PYMA 2W2OP 1Q5VA 1KK0A 5I9BA 2I67A 1YZLA 4CI9A 2OMLA 3NHJA 3IJPA 4MGYR 4HH3C 3N74A 4Y2MA 5FYDA 3H3XA 2LXNA 3H2VE 3T97B 2QZ4A 3TVZA 4ZQGA 5KYUA 5B1EA 5I3UB 3DV9A 2OXEA 3EGXA 2V3CC 1UZDA 2JP3A 3DLLQ 4O4RA 3ODPA 4QC2A 1JIJA 1W4CA 1OX6A 1V4NA 3UM9A 1TM3E 2WP0A 4MR9B 3FEZA 4LHZA 2ZB8A 2V65A 3GB0A 3SK0A 2ASJA 1J99A 5EJ4A 1LC3A 1K7XB 3IIEA 4RA6A 2DNZA 1BY9A 3KM0A 2VPWB 2OPPB 4MW6A 3T7SA 1X7DA 4WNAB 4TYMA 3GJZA 2JAUA 3R5GA 2VT7A 2DULA 4JJ8A 2J7WA 2O0HA 2A9VA 3TVKA 1RADA 2G7MC 2GBLC 3LDHA 4EHAA 1CPYA 3FUTA 5KQMA 3I9V1 5B3KA 1ZC4A 3MAAA 1Z63A 3MUDA 1BCRB 1T3LA 1BVYF 1YTUA 3BCCE 4KAJA 3MUFA 5GAHU 4NX9A 3PCXA 3DE3X 1VYAA 1A7KA 3VX4A 1AUXA 4YPOA 4YCLA 2VKRA 1SQXG 4BY9E 5D0GA 4AJHA 3LBAA 4CO4A 1ZCJA 3PDHA 1TTPB 2HMWA 2K87A 1DKMA 3OF2A 1O0SA 3CUVA 3WL3A 1VF5D 2GHVC 1OAKA 3CN7A 4D8TA 4MW0A 2Y1XA 3UWMA 2G0CA 5A5EA 4DBLC 2GQ0A 1JX4A 3AUFA 4HQ0A 3B2EA 3BDVA 3MPWA 3VR4D 4RTSA 5A5FA 2QV6A 3TA2A 4C2MA 1WMEA 4IKAA 5U9CA 4IIGA 5IUNC 3Q8LA 3LK7A 1CNEA 2CZ4A 3MN1A 3RWBA 2P8IA 3N6NA 1JR2A 2AFRA 1DTEA 1NC1A 3EWSA 3SEOA 4WPAA 3LOQA 1CVJA 4O2RA 1EWYA 2IVZA 1X2EA 2FYUG 4C7VA 1IBMJ 4HWKA 4NI2B 4ANEA 1WQ4A 1LWXA 4QEZA 4EVIA 1D0VA 4FHFA 4TYQA 1SR8A 5KYXA 4LF9J 2RE8A 1JU3A 3UK2A 3AX6A 2OKGA 3K9NA 1P1KA 2H2IA 3RREA 4R8MA 1A8IA 1GTG1 3KLPX 4KGVB 3HS3A 4M5HA 2AH5A 1IKXA 5SZHB 2QNBA 4GG1A 5C8YB 1WC3A 3PPVA 1NBEA 5MN5A 5CYJA 1JNMA 3Q0AA 5IW8A 5APXA 1M1JB 1V1RA 4PAGA 4O4JB 3LUYA 2QZZA 1WUUA 2NYVA 5AVZA 1RVDA 1YL5A 4F60A 4M37A 4D9GA 5DJUB 2GDJA 3W1YC 3IA7A 3T1TA 2EQ5A 4P2MA 2X1LA 5D3MA 4N3GA 4LOAA 4ZC8A 5GVRA 3B13B 3WLEA 2PKRA 3IBCB 2IZZA 3R6DA 3KR9A 3A1DA 3AK4A 2B87A 1QDEA 4DPXA 4B71A 3O1LA 1HRKA 3O92A 3NP9A 2YPZA 3JYTB 4PSAA 3SSQA 4U7JA 3LUPA 1DZIA 1S7HA 2CJPA 3QIPB 3F6SA 4X6YA 3Q1KA 1XNRF 1E4EB 1QYCA 3PKJA 2FFJA 2O0MA 4MUEA 3WFJA 1QE3A 3WK5A 4B3MB 5MGBA 2CZ9A 1DRZA 4PSUA 1DKOA 1XTJA 4HNSA 1CLFA 1MD9A 3TJ8A 2XXBA 4ES1A 1JPUA 4N65A 2VPXA 1EM8B 2K3RA 3DFUA 4RANA 1UUFA 2HS0A 4AYTA 4ILLA 1L5YA 2KB2A 2NU8B 5DYTA 2HCRA 2CL5A 1VIYA 1F2TA 1Z8DA 1I7DA 1BXGB 1ITPA 1G20E 4FDTA 3AUJB 3CWZA 1FZFA 5D3MB 4CM0A 1STOA 1NVKA 1SKWA 2GZHA 5LZ8A 1C1XB 3UQSA 5J2MA 3H6GA 4PCQA 1NW8A 3QXSA 3THTA 3HVAA 4L8YA 2RSLA 1RHRA 4J4BA 1EE1A 3GVCA 3DLIA 4IFVA 4I8IA 2ZRKA 1XDUA 3L1HA 4PPGA 2KXPB 3LHSA 3C14B 3AJ8A 3AR9A 2WIFA 3S8SA 3IAAA 2QNRA 2ID8A 2OBMA 2RB5A 5JBNA 2XYGB 1KI9A 4KIUA 2OHGA 1H94A 2P9BA 3DTNA 1SG6A 1PYGA 4CMEC 4ZT2A 3A6GA 2QE7H 1T9BA 4RLSA 2B6AB 1VXRA 4GWKA 3T3DA 1KI3A 1HQUB 3CCCA 2C07A 3KLGB 2GVDC 3OJEA 3GCDA 2IBZE 5K1ZA 4B0PA 2B51A 2FWIA 1M5UA 1PD1A 2L48A 4WZBB 2YNGB 3QFSA 3FF4A 4N0EA 2XGMA 2I78A 1T9VA 3CA8A 3DS8A 4M8SA 1I1NA 2I2DA 4LFBJ 3UMBA 1GYPA 3JZMA 5FJJA 1QU2A 2XOEA 3UJ7A 3FVTA 1Y1TA 3LDAA 3SC2A 4DNXA 2OCXA 4XUEA 2R0QC 4UHKA 4BVFA 2I3BA 1KKMA 4BUJA 5KQSA 5FNVB 1L7EA 2B4KA 4FHGA 3I76A 3CCVS 4Q8FA 4EJFA 2UYOA 5HAOA 3MOJB 1WF6A 2R7LA 3HXOA 1N88A 3EXEB 1IKVB 3H1JJ 3C8UA 4HEHA 2BDEA 1EQUA 1SB8A 5BT9A 1P1JA 4BMCA 1ZH2A 5FQOA 4Q1AA 2PCLA 3SZRA 3WLSA 4KKOA 2ZE5A 5KG5A 1N2DC 4ZOBA 1EX6A 3O93A 3HRIA 4DR2J 1GUZA 2XLBA 4GQAA 4N6GA 1RTKA 2JX2A 3PRVA 1K9MT 1CS0A 1GGEA 4BNZA 2RARA 4PZZA 4RESA 1OGYA 3IQDB 3CJTA 3MM9B 4QTYA 3C1OA 1GXTA 1GG8A 4K2JA 1UDXA 2RAQA 2HHPA 4BFXA 4Q48A 1WU8A 4UNRA 1N5VA 4GOKA 4XX0A 4JUIA 1WZCA 4AL4A 1VMDA 1YL6A 2YMYA 1KSHA 1V7ZA 1SQPG 3VHQA 4C14A 4Y99C 2PIIA 4U9IS 5EP4A 1FUKA 2K7ZA 3W3AD 1L0ND 1X7VA 3R0QA 2XVZA 2CK3H 2I7DA 2GPWA 3LIEA 1RQLA 3NH9A 2BACA 1KTQA 3ET6B 4RW7B 2HREA 1U6BA 5ESWA 3FOFC 1VM6A 4GKBA 1VCTA 1MQ8B 4DL4A 3B5NA 2LDXA 1XKQA 3VMMA 2MYUA 2V4MA 1RJDA 3WNBA 5KG4A 5BNIA 4JI8F 2HY7A 2ADFA 1XZFA 3RK2B 4UNQA 4BZXA 1KI7A 3DNMA 3N2EA 3PNKA 3QITA 2XXJA 3HVWA 2KHCA 4C2UA 2XTMA 4B82A 1PJCA 3PS9A 1PJTA 5JO9A 5BQFA 5L3SA 1Q7YT 5LUBA 4Y28J 2MY7A 2NUUG 4Q0BA 5CBOA 5DASA 2DW3A 2EX1A 3T1QA 3GFSA 2DTEA 4QD3A 4XRRA 5C7LO 3GAZA 1QM9A 4YFUA 2RFLA 2J85A 5EL0A 1FS0E 1PKUA 1C50A 4EI8A 2EFHB 3DCNA 1YI8A 2FVYA 4M46A 2E76C 1QTNB 2JCVA 3O3NB 4MKYA 3GJ8A 3NKFA 3ROKA 4JI5F 4A92A 3KOXA 2C1EB 5BNFA 1DV1A 3ETEA 3H4MA 4CLLA 1KH2A 2AF4C 3OOYA 5J63A 4G01B 2LXCB 1YZFA 3OH8A 3IF4A 1URRA 3TSYA 2NZ2A 5ILOA 3H1HE 3O74A 4S0MA 4ZCTA 3GEMA 4KZPA 3ZHZA 2WVHA 4LYHA 1MO3A 3DKIA 1AK2A 1B64A 5BRNA 2XCIA 5EIBC 3BD7A 5EXXA 3ZTYA 1IN4A 1NU1E 4LYGA 4O5OA 2EFNA 1LV5A 2WNSA 1S8OA 5D78A 3KPVA 1K63A 1DT5A 4B3CA 5JZVA 1WC5A 2GCGA 5TRTA 2BQ3A 1SZJG 4RWXA 1S3SA 4QTUB 1TVCA 3NMAA 3RL0D 3IM9A 1XEZA 4LWPA 3KDPB 2QTFA 4BE4A 4JQZA 5C42A 3P8CE 2M1ZA 1SQ5A 4RC9A 5DK4A 1MHTA 5B4UA 1Q1EA 1DXQA 2E1RA 5E3HA 1NHVA 1Z16A 1FJXA 1E63A 3GRCA 1K6IA 3DOOA 2AJDA 3FCWA 3TFWA 2OCIA 4D9FA 3GLMA 4IJVA 2J0VA 4DLYA 4ES2A 4AN4A 5KFHA 1LNSA 1NHLA 1U0GA 3JCZA 3KQQA 2I1KA 1RQNA 3IE2A 5F9MA 2JIZD 1QZZA 1VRUB 3I0NA 2Z2KA 3VZPA 1L7NA 4BQOA 4BYGA 1XLUA 4R8SA 4A0GA 2EVWX 1U8EA 4AQYB 4KR3A 4ECXA 3PF8A 2P4HX 5B66E 3EIQA 2A06D 4NJMB 4YQZA 4GHWA 2SECE 4G9EA 1LFAA 2GA8A 3KB2A 3O90A 4JOCA 2QRZA 4PEVA 4OJTA 3UAVA 4BKMA 5CBKA 1QX3A 1LI5A 1UK9A 1VPLA 4MRAA 3L72E 4GICA 1W75A 1GADO 4JT4A 4Q9KA 5K51A 5JFOA 1XU4A 3NL0A 4C7KA 2P6RA 4IR9A 2D3TA 4Q19A 4G8JA 2R1VA 2GX8A 4PD4H 3KEMA 4G0ZA 3ZZZA 4PYKA 1YRAA 5AR1A 2J4DA 5GADI 4FFMA 1JG3A 1OW8A 1LWFB 2ZVIA 3ZWDA 3KQOA 1FOSE 2BJDA 5J5AA 4B3HA 4OV6A 4I6JA 4C3LA 1ADYA 2A4KA 2WFLA 3QVVA 3L8DA 3QLHB 4YRRA 5AK0A 4WN9A 5LYJA 3OSNA 4EOGA 1T0BA 3N4XA 1I4TD 3LPLA 1Q44A 4B6GA 4UU1A 3KYCB 4AFFA 1KVTA 3H6KA 3D6TB 3FDZA 4ZVMA 5HJEA 4YP1A 4G86A 4Q7AA 2R1TA 1WDDA 5HWSA 1R8CA 3M8PA 3CT6A 4GVBA 3V6LA 4A7PA 4CT5A 3UFCX 2FGCA 2VFRA 3U3MA 4B85A 4F6RA 4YWHA 3CC8A 3WU2H 4H7FA 1NPTO 4Y0VA 4RNHA 5A8RA 1HTBA 3PPWA 1G2CB 2LDBA 4P9NA 1P81A 5DYWA 4LMBA 3RJMA 1T9ZA 2CK3A 5B1DA 4C8KA 6AT1A 3TQQA 1ZU5A 2IYPA 1DLJA 1SK9A 4LYDA 2PUCA 4DR3F 1YONA 3OPKA 2HNAA 2WM8A 1HETA 2OA0A 4JJZA 1FA9A 1QAQA 3W6UA 3IIKA 5KFQA 4EAAA 2NIPA 3TX8A 3RUFA 3VX3A 2V5VA 4Z7NB 4FPRA 1B4DA 1CP2A 1W5EA 4O3RA 3H0KA 2ABWA 4C7XA 5B1SA 2AYYA 5BUSA 3GMSA 1V11A 3ENVA 4IHKA 1TADA 4IRUB 5HX7A 2IP2A 4NBRA 1Z4NA 4X93A 3TSAA 2UUCB 3TOCA 4UHEA 5E9JA 4MV8A 5ERXA 1T9GS 4YR9A 1GPKA 1LT1A 1BDBA 1DZ5A 2ZJRQ 3D28A 1HGXA 3I37X 5BYAA 1AXGA 1RZUA 2BHTA 1KO5A 1JLFA 4JVLA 1NTZJ 4F6RB 3P0JA 4GOOD 4GVXA 5AUPB 1N5JA 3PGLA 1DWQA 4LXTA 1X77A 3OJFA 1NAFA 2W6PA 2FPKA 3LPYA 3CD7A 1HR0B 1NUSA 3R24A 4FNHA 3HF5A 2J3LA 4U8VA 2QK4A 1SQVD 1PAEX 3EFGA 1S72S 1KP9A 2OP5A 4WWIA 4H4OA 3KYBA 4BEWA 1X4EA 2BKEA 4YV0A 2XZDB 1NLZA 3SSUA 4P92A 3QEAZ 4HLUA 5KLIC 5HGXA 4RMJA 5FRDA 2JFNA 2ZRFA 3FDXA 4XVHA 3A1CA 2GQCA 3EVMA 3RBXA 4H1TA 4KQIA 2FQ1A 1SQQK 3MCOA 4P5PA 1VI2A 1U8TA 5AP9A 1SG0A 5CA1F 3DHXA 3AODA 3B7PA 1VF5B 9ATCB 1SJ1A 1M6NA 1JDSA 5FLXA 2KZZA 4ZI2A 2O3TA 4MV4A 3U27A 2JI4A 5F9NA 3C8HA 4AO6A 2G5PA 2VNSA 1GQRA 4RL4A 4XIIA 2OTLS 4NR0A 5E0KB 2CLOB 2QL7B 4JI1B 3B71A 1HT0A 5EHXA 4OZLA 4LCEA 1G2PA 2OJ3A 2QJYB 4RW6B 5DN6D 1O95C 4BMXA 2MR6A 1NYLA 1O89A 1WOMA 3EA4A 4QLOA 2YVLA 3QJJA 3LCUA 3ND8A 2OSRA 3ZCPA 5FJ4A 1Q14A 5JANA 3CH6A 3SX0A 1N6IA 1RQGA 3NTXA 1KI1A 2Y66A 1DAEA 2QJPB 4PHCA 1DHTA 1AYEA 2A9OA 3C5HA 1IJEB 3V6HA 1URPA 5E8JA 4QG3A 2WAMA 3NFQA 1JZQA 2FZVA 3N53A 2PYZA 1ZQ9A 2AJBA 4A8MP 3U37A 4Z7CA 2DWUA 1MBZA 2BEZF 3CUNA 4QASA 4JR2A 2B25A 2UUWA 4EWTA 1C7QA 1TYZA 5HVHA 3F4KA 1EJ6A 2PKXA 1RUSA 1DC7A 3N87A 3W8FA 4LTMA 1A1SA 1TKBA 4DJJA 3LYUA 4X1KA 3QATA 1E64A 4WFNQ 2IBTA 2RGNA 2WJGA 2D1YA 1O1YA 1KO4A 1NP7A 4NNOA 4YJDA 2E82A 3P45B 3S2SA 3R5JB 3OT1A 2O8CB 3HKCB 3ZX5A 4ZDJA 1GL2B 4IDKA 2JC1A 1Z36A 3SJZA 4OHCA 1MEJA 1VQNS 1QP7A 1Y5IB 1CF9A 1BWSA 1P17A 3EB9A 1XHLA 2Y9MB 2H08A 1RF1A 3E8XA 1WMFA 2HIHA 2MDAA 1TQLA 1MB2A 3H2YA 3V3KA 1TYEB 5TQ0B 4DUYJ 5EYPB 3M30A 3F2IA 3T3GA 2HGMA 1V6SA 1CY0A 3TEFA 3WGTA 2YXLA 4MVJM 2RH3A 1AY0A 4NMMA 5IYZA 2Z2IA 1MHPA 1KI6B 4L8LA 2Q4TA 1FDTA 3REGA 1S6QB 1NXSA 1QC5A 5AQ1A 3JQJA 2CZGA 4DS3A 5HM8A 4ZVQA 3JSVC 4WCEQ 3J7TA 2V3VA 5I4CA 5KSPA 2H5IA 3EHEA 2OO4A 2E5YA 3MAGA 2Q2VA 3N9IA 2P9CA 4ARCA 3IUBA 5AT1B 2XO7A 1AK9A 3QWHA 5L9XA 4HDGA 5ETKA 2BEVA 1YJWS 4UU8A 3KZOA 1N0IA 3DVLA 2E74B 4HDRA 3W77A 1KEUA 1Y9ZA 4NOKA 1UEUA 1RHZB 3I1IA 4IW3B 3ZBTA 3KZKA 1W36B 1GTJ1 2CWDA 4RF5A 3W5BA 3FOCA 3L73D 3MDFA 4D5EA 3UO0A 3UDCA 2V7TA 2QN1A 2AMYA 1AURA 5KFEA 3DRSB 1YTLA 5KVQA 5THQA 1T3OA 5CVEA 1X7WA 2C03A 3VO1A 3VTAA 1J07A 2R1VB 2I80A 5ALRA 1LWCB 4UAGA 2M8HA 4PNEA 2DHQA 1HVVA 1HNXF 1RSCA 4OGQD 4P7BA 4KIFA 2VNKA 3D1JA 4BPBA 5H4GA 3U48A 2W70A 4JF7A 1SQGA 2NCKL 1N33F 1AV1A 4BNYA 2RH8A 1FDIA 4QJIA 1CD5A 2QTHA 1MLDA 4J03A 4F9EA 1OMOA 3SQXA 1YK9A 2DH6A 2HIYA 4NA1A 5KUTA 1P2GA 4X3PA 1HA3A 5JSQA 2DECA 4PPZA 4FZJA 2MSNA 2IBMA 2OG2A 3SLKA 3K2IA 5BR1A 1E6MA 5FUQA 4ETWA 3MQFA 1TB4A 1M67A 1M90T 1I51A 2W7OA 2CFIA 1YB6A 4LMRA 1A6LA 1KY3A 4Y2IA 2YIJA 4X3CA 3W62A 5EXDA 1XJ0A 3L02A 4QIHA 2BBEA 1WCYA 3UCGA 4I19A 3LVFO 1BUXA 4ED8A 1Y8RA 1NI3A 3AVYA 4ZOAA 4YO7A 5BSTA 5HBMB 1KMCA 3KAQA 4GOMD 1XKLA 1ZXBA 3F5HA 4FMCF 1NP3A 1K8RA 3DL0A 2C7QA 4MJXA 1PO7A 4FHCA 2CXXA 3RS9A 3E7WA 2SPZA 4CTJA 4H0CA 4BQNA 3OX1A 3QEKA 3PTWA 4ICIA 4G63A 3WNVA 4CV3A 1K7YA 4NLUA 2N1TB 1RKVA 4XA8A 3PX4A 3L7MA 4QBHA 5EE9A 4YB1P 4DADA 1JMYA 1Y4ZB 1CEYA 3M0DC 5EHHA 3RAFC 3GA0A 1R6TA 1JSCA 3QKRB 1AQLA 3ZS9A 4QOJA 2RK3A 2CUZA 4O0MA 3ZBPA 5BORA 3PE6A 4DJAA 1RXYA 4MW7A 1NFRA 5ELMA 2A06G 2IDMA 2D00A 2GLTA 3DNCA 3GXOA 1DAFA 4F6LA 5HOQA 3NONA 1N36J 1EGVB 1KDVA 4A6PA 5GM1A 5EZQA 2NP6A 4MUBA 4KVZA 2VCHA 3FR8A 2BA9A 1GPH1 3EWKA 3PKIA 2EL9A 4FNGA 4LZJA 5JFGA 3W5ZA 2BCJQ 4JC4A 1BYIA 1NTKG 4L4XA 5LP6B 3Q9NA 4G5FA 4QYWA 2N9UA 4O4JA 3T9FA 2IUTA 4DLWA 4M7RA 2VYQA 5J40A 2LQ9A 3QBEA 4YXWA 4AX4A 2BF4A 1S3JA 3CXHE 2J0SA 1E9VA 2M0GB 1EZVG 2KHZA 3AESA 3DYBA 3OR1A 3OQ1A 1IHOA 3S2ZA 4IF4A 4N49A 2P78A 3NHZA 3K5PA 4UB8E 2JSXA 2C92A 1SWVA 1L6RA 2C77A 1D9DA 1P4GA 5TMPA 3PX7A 2M7SA 2F1RA 3R3VA 4YRCA 1OD6A 3A13A 2A6PA 4CWAA 4IIFA 1QIHA 2IVFA 2O2SA 4LVNP 5AYVA 1KE1A 3SWWA 4BFZA 5CQGA 5C53B 3NW9A 4W7ZA 1JNRB 4L57A 3S2IA 3VOPA 5AW9A 2YJ3A 2W6OA 1QVAA 2H1HA 5AXCA 3ZHTA 2PL5A 2HT1A 1YITP 2OG1A 2PT0A 3CXUA 2UXBB 3N0WA 2PKQO 2DBVO 2QU7A 2EW8A 3O8QB 2QVGA 1QG6A 3AJRA 3RQIA 5AHXA 2KJWA 1FRLA 2OEKA 5TR9A 3WV5A 1GMVA 1YT5A 1QYDA 3KFWX 2VNIA 4EFNA 2V1XA 3HU2A 3L70E 3QLVA 3WGHA 4H7DA 3IT1A 1HQYE 1NNDA 5A02A 1D9XA 5ICCA 4CHGA 1REGX 2CG8A 2FLNA 3NGDA 4CN9A 2LXFA 4J0IA 4D96A 1E7WA 1UVKA 3FPCA 4YEAA 3KWLA 2DQKA 1LVGA 1EXVA 2N3OA 1PNOA 1M73E 1GZ5A 3UBMA 4YRZA 2CQGA 1J70A 2F4NA 2JBHA 2RGWA 4B3SJ 3TI7A 5JQGB 2YV4A 2V63A 3H2KA 1NTOA 4D5GA 1PJ5A 1KY4A 1N2ZA 2PX0A 5G1PA 1V9SA 3NLCA 5IFMA 2WUGA 2DPYA 3UEOA 4H3KB 3P2YA 2QQEA 2E9ZA 1TZCA 4OSPA 2R97A 3CRRA 5CJ4A 3GG9A 3QPIA 4KBFA 2V8VA 4WZAE 1K1QA 2E43A 3OFKA 2QL9B 3H8YA 1RP1A 5K8LA 4RH1A 1J25A 4WZZA 4ZQIA 3OTCA 3QO9B 1MSWD 3L18A 3U4AA 2YKPA 3BBBA 3BSFA 3O5AA 5DYYA 4LSNB 1NPDA 5DO2A 3VBCA 3SPXA 3OQJA 3NEKA 1HWYA 1UMKA 4Y6QA 5K3FB 5B0GA 5IG2A 1B1AA 1L7PA 4YAUA 1QB7A 5BVHB 4QUBA 1CVRA 3ANYB 2PCJA 2A9FA 1TK3A 3KLGA 3UWTA 1H8AA 1K6XA 4NU5A 2F1HA 1KYXA 2AR7A 2CDAA 1RE4A 1SD2A 3R5DA 4J7UA 4KIAA 1C30A 2PT5A 4PWYA 3RGIA 5F52A 5M2RA 5I3UA 1UWLA 5H2FH 3B6ZA 1NK7A 4PHTA 3WX8A 2ZQZA 3OT1B 2QM8A 5D0EA 3G68A 4PV1D 4U3FD 4EB8A 1RAOA 2X9GA 4ENQA 1UP6A 3AI3A 1SUEA 2X86A 1ZNWA 5CNJA 3CF4A 4BO5A 3BN4A 4RA6B 4PG7A 3Q7TA 5HBRA 3UIAA 3KK1A 2G72A 5AW2B 3Q3GE 4AYCA 4M9UA 4JB0A 1N6HA 1T35A 2A1BA 4L5YA 2ZUFA 1POWA 3N39C 1ZK3A 4WBXC 1G8SA 3V81A 1AK1A 4N5SA 3KLMX 1PUIA 1RXUA 1MRSA 1UBSB 2YJ6A 3MCVA 1MMNA 1H23A 5KYKA 1C9JA 3T0FA 4O2BA 1BEEA 1V5FA 3EMTA 3VKVA 1YKWA 2VC0A 2W25A 5JOQA 3MCWA 2ZH9A 1JIVA 1TVMA 2ESRA 2WFAA 4FCVA 4AJKA 4ER5A 1GR1A 3CCQP 3QUTA 4I6YA 3MOZA 3UCUP 4F96A 4QYTA 3WLHA 4U7HA 1SVNA 4CFZA 5LSLA 4UFOA 3RL0C 1YRTA 4UMEA 4WFIA 2JA2A 4A6EA 1Y8AA 1H69A 4I56A 5EP2A 5JYBA 4IIJB 4U6PA 1EP3B 1WC1A 5JC8A 4XGNA 3G96A 4URWR 4LC1A 4M5JA 3HPRA 4N76A 1VKHA 4BTVA 1DXHA 3F2VA 4PHHA 5JALA 4RW9A 1RXOB 4DV1B 3USES 3J7YU 2EFCB 4FYHA 2P27A 2R65A 1URQB 5DRTA 2QA4P 1IHXA 1P39A 2J6HA 3K0BA 5HMXA 1P2FA 1PT5A 5ALUA 4CLRA 3QHQA 4BWJA 1NAIA 1WBDA 1N7JA 3IAS6 3OEEA 3A4YA 2VSXA 3DMFA 4J7AA 2K7JA 4MQEA 3CDAA 2HVHA 2O8DA 1U0TA 1RT6B 2UUOA 1TJ5A 3MS4A 3PUKA 5H7XA 3P2EA 4Q21A 3V7UA 1NULA 4WFYA 3IMCA 2CB9A 3WA6A 1TD9A 1QGOA 2GM3A 2C3UA 2BJ9A 2HU5A 3H1JE 3EBOA 2EBFX 2YNIB 4P86A 3QYYA 2FLLA 3JZDA 4BP3A 4B6RA 5K5EA 4WOCA 4R2LA 5TY0A 4PCAA 5B58C 3HE4A 3OESA 2C78A 2XGGA 1IMJA 1TPZA 3GF4A 4JI7B 3G4SS 5LMNF 4JS0A 4RZHA 5MF6A 4TXMA 4XEUA 5HBMA 4NLRA 3CNQP 1CJUB 2WHPB 2QTZA 3AR7A 4ZT6A 3NASA 4B43A 4F5EA 3NNNA 2XGOA 3C6YA 4R2WA 4ZQEA 4O3NA 1P9YA 3THXA 1KQ3A 4ILMA 1ZNXA 4KFBB 2AK3A 1BE8A 3OO0A 3M81A 2V2VA 3MG9A 1L7OA 4GU5A 5EIEA 1CY7A 1PDOA 3A3NB 2Q4DA 1O58A 5IK2A 3P8ZA 2XWSA 4KXMA 4CCAA 2O52A 2DNYA 4CLHA 1XQVA 3K6JA 1M1KQ 4K6CA 4XW2A 4P4SA 3AZPA 4RKRA 2ONYA 3AJDA 3FRZA 3L5OA 1ZIOA 4WXPA 1DLOA 4RK0A 3FPLA 4UATA 1M1HA 1VQ4S 4Y18A 2Q5CA 1RE3A 2JI9A 1C7IA 4NCGA 3X0DA 1EXNA 2GZRA 3BS4A 2B94A 3VAYA 3AE1C 3RC9A 3E1KA 1E6EA 2GQ2A 1CJCA 2EYUA 3DKVA 5EJ9A 1V5EA 4QG7A 1D2AA 2V8PA 4XYLA 1Q0RA 3Q12A 4KWEA 4BJ5A 1TEVA 3RIGA 4NLDA 4U95A 5AW3A 2ZRIA 1IQZA 2B1RA 4C0SA 1E2PA 3R3TA 3MM7B 2Y3YA 4G0UA 1S1WB 3HFGA 2W2VA 4XFDA 5CEFA 2J6CA 3O8WA 1MO6A 1BGVA 1P9NA 1LJLA 4E0BA 4JI4B 5HS6A 2YIUC 5FBVB 2CDRA 5A1JA 1ZIYA 3LT5A 1PJ3A 4NJMA 3OOEA 4BLUA 5C0OE 4PF1A 2B0CA 5KS2A 3GLIB 1MX3A 4YACA 2LQJA 4E5UA 4JMPA 2Z43A 1UFLA 4IBOA 3TBFA 2EDCA 4TYNA 1RI5A 3OM9A 4YMHA 1IG3A 3QRWA 4OX9F 1C8LA 1EFCA 1EZ1A 2A2CA 3L7OA 2AHOB 4ZVLA 3G6YA 1L5VA 2ILZA 2RONA 2MZ1A 1J0CA 2V7BA 4ZVKA 2H5JB 2HV8A 3TM4A 4H4MA 2I4NA 2WRZA 4C4AA 4XVQA 1QE1A 4QUIA 5B6IA 1KFSA 3KUDA 2NYRA 1GZDA 1T5TA 3OZEA 1HD0A 1I2BA 1W0JA 1YJRA 2HWUA 3FW1A 1GZ7A 4HUTA 1P7PA 2FRDA 1GCIA 2JK1A 5IM4A 3JQMA 2VBZA 3PB3A 2GJKA 2IY8A 2QQFA 1CUXA 2JGAA 3ZBUA 4E15A 2FJAB 3KETA 2BMAA 3THYB 2VTDA 3OZSA 4GAEA 5BWCA 1J39A 3T9AA 1LZKA 1JY3O 4XR4A 5FWYA 4X90A 5DG8A 1XZGA 3CE9A 1N5OX 2RKWA 3P9IA 3WDLA 5BN3A 1SD5A 4Y2AA 3WC4A 2AI1A 3ERCA 3OCUA 2QGFA 2WSBA 2W90A 1S1CA 3TQ1A 5AXKA 1QWOA 4K2AA 3CNNA 1R8XA 4TV8F 2LXBA 3H65A 3OP1A 4LISA 1ETUA 5F2NA 4OQNA 5B66H 1CLUA 2OT3B 2ZI3A 3RHTA 3EJ6A 3HY4A 5J2QB 3RROA 4M3LA 3QSYB 1J1DC 1NXTA 4HWRA 1XMOF 1D2CA 3KJFA 1P3JA 5A9SB 3STUA 1USIA 2HK9A 3JVIA 3X1YA 3RVSA 1P60A 2HHSA 3R7LA 5AD1A 3DBHA 3LK6A 3PZBA 4PBTA 4ZKAA 4RKEA 1PQ4A 3OO1A 5AM3A 4M54A 3P0RA 3T7AA 1KE2A 3KYIB 1V5VA 1GGHA 4ZVPA 1BCRA 2FHSA 5A7GA 2WHEA 4YB6A 1O97C 3GW6A 1EDBA 5CG2A 5IDQA 2ZRNA 2ZC3A 5B53A 5BN1A 1YZYA 1X80A 3ELYA 2Y1WA 1SM4A 1Q1NA 5I45A 3T6JA 3BWBA 4WKPA 2PMHA 3W5AA 3GLIE 2QYGA 1MO4A 5EWEA 1UAWA 2JIBA 3H40A 1GA4A 1KRXA 2WRMA 5FOUA 2FZCB 1E1QA 4TKZA 5JH7F 1FRXA 2XCTB 4W63A 2D5IA 2YX1A 3DWGA 1W30A 2DXIA 2O01N 2PVCA 5CFZA 4E0DA 3A9VA 5H02A 3MXTA 1WI8A 3A7DA 3GPAA 3U1TA 1R74A 4HI2A 3GLKA 4U67Q 3C45A 3BQMB 1YJNP 2H1SA 2QX0A 1Z74A 3MT0A 3EQ9A 4I4BA 2SCUA 2XWQA 2C5GA 2IQIA 3QOFA 4WKRA 1H73A 2Y1RI 3DB1A 3ICEA 1E2BA 4M9CA 4CTMA 5LNK6 2VJPA 3W7AA 3JQBA 1D6SA 2HHAA 3DWFA 4RIHA 4MPRA 1UCNA 1Q1GA 3QW2A 3MTEA 1PKXA 4Q7QA 1WTBA 4U8YA 2EIHA 3GN2A 1R5OA 3WU2E 4F3KA 3T4EA 4P4NA 1U2GA 4C03A 2PTGA 2RJ3A 2ZZKA 3DLEA 5LA6A 3B1VA 2FFBA 4GQBA 4C3ZA 4LF7B 3WQQA 1W4ZA 2IU4A 5C8YA 4FKXA 1W25A 3G2LA 3NYQA 3RVNA 4J0HA 4C2BA 5C2JB 1JKHA 3FWHA 4DXLA 4ZMBA 1EQAA 5AJZA 2FMKA 3BO4A 1PV4A 3E01B 5T4EA 5E6UB 1WTAA 1RTHB 4RTKA 4YBZA 3UT0A 3WMGA 1PR2A 1RHUB 5SZKB 2YMQA 1DKQA 2ECFA 4M9XA 1GNTA 4L76A 5K45A 3BYPA 2D3UA 2QIOA 2P6TA 1IQPA 1S2MA 1F60A 5EGSA 3O83A 3Q9UA 1Z2NX 1UXKA 2GQQA 4EZ6A 3N8HA 3AR2A 2RHBA 2QMEA 1K8AQ 2JJ2D 1VF5C 4RCVA 1CY1A 4Y1EA 1TW3A 2J6TA 5KSZA 4Z6KA 4V0QA 1GMWD 1J8MF 3OL6A 3JCUH 1E20A 1JHXA 3BE5A 2E5FA 1WXEA 3D66A 3EZ2A 3JQDA 3O5TB 4LWZA 1J42A 4B81A 3H9JA 2MKJA 3PO4A 1H22A 3RAGA 4D9KA 2R6HA 3ZDMA 5HMYA 2O23A 2VPYB 3KSAC 3NAIA 4RNNA 3GLFE 3UB2A 4KGXA 3PIDA 3C87A 1JY3N 1RKIA 2C54A 4IFMA 1X4FA 4BO1A 3PNVA 5TVGA 2W4DA 1Z68A 5M3BA 1KS9A 3DCYA 2R5WA 2ZRLA 2EXUA 3D59A 1DJPA 4HK4A 5E4JA 2O8VA 4OHKA 3ZD9A 4CLKA 1L5KA 2AVNA 2L82A 5IZCC 3BGVA 3Q11A 3PW2A 1CF4A 3EA5A 3S2GA 3CRZA 3IXLA 1K0FA 4WUTA 1XZQA 2V0GA 2Y8YA 4B40A 4AG5A 4DIMA 1KAGA 4YDDB 2VA8A 4BWMA 2KNCA 4FKBA 4GKGA 5DS7A 4BWVA 3CH4B 3PW7A 1U2DC 1QPGA 1OI7A 3GLGA 5LIPA 4Z49A 4X1OA 3DYAB 4Z0TA 5FUYA 3EXHA 1PILA 4CN8A 3I1FA 1YRYE 3I6QA 1RU2A 4FF4A 2QZPA 1T1RA 4Z0HO 5K8VA 4KFSA 1AROP 1S9EA 3MJRA 5FUBA 1NR1A 2FDXA 1RP5A 4FE3A 1XMJA 2VA3A 2WILA 1JR3E 4C3KA 5F3RA 3G0OA 1IFXA 2VYVA 2YVKA 2H4FA 1J22A 4MCIA 4LJAA 4PTLA 5EYPA 5I9IA 3SCZA 2IPNA 1C9DB 3VNQA 3U6BA 2O3RA 3VU3A 3HYRA 3RS7A 1JWBB 1UPCA 4XE5B 2HYDA 1LPBB 3FHOA 4BNNA 1RTDA 1Q1KA 1C3EA 3A4TA 2G88A 3D5MA 4PYMA 5JNLA 4RY9A 4IZIA 3WZMA 1GKLA 1QAMA 4DANA 1BA3A 4IILA 2IPPA 5EFZA 4I4IA 4UBLA 1RXIA 5C9ZA 4AWAA 1EQ0A 5EESA 2WTYA 5FD8A 2WWWA 1MW8X 5ALTA 1YJ9P 1NUTA 1W9MA 3DM9B 1P8GA 1Y9OA 1B4SA 1Q5YA 1H2EA 4HXEB 1HSZA 4JI0F 4X8OA 3HJFA 1EGQA 2HA4A 2O1XA 4R1OA 4AULA 1JDNA 4J1SA 4JT9A 2PSZA 3IVRA 3AVOA 1AF7A 3FFIB 3PCRB 1SVSA 2ORYA 5GONF 1D9AA 2FPLA 1AHIA 3LANA 2BFWA 2XC9A 5EINA 1H9AA 3D6VA 4L2IB 4OGGA 2QW1A 1LPNA 4DSKA 3G9QA 4Y2VA 4AMVA 1VP9A 4OJQA 2C9LY 4BPRA 1MORA 3UDVA 4P0PB 2NZJA 3SD7A 4LN1A 3RBZA 4Y2JA 5H9EJ 4DEXA 4LSLB 4TWBA 1GQFA 2H1VA 1VJTA 3VXKA 1Q7TA 3RH0A 1EDIA 4UTRA 3KEOA 4ZFNA 3LTOA 3SMZA 3TQSA 4RHFA 1G1XA 4QPCA 3RVRA 3I39X 1J0DA 2VK1A 3RC7A 2M9MA 4HV4A 1Q53A 2C4NA 3JQAB 3BAZA 2XB2A 1N8RT 1ANKA 5F5LA 3MM8B 3QVTA 4Q3AA 4DR1J 1P6QA 5A62A 3A0HH 4CIWA 1PZEA 4PCLA 1NF8A 2YOHA 2EZUA 3C6MA 5JNRA 4H4CA 3CJRA 3P2KA 1SHLA 4LSZB 1YRLA 1E4OA 1OE0A 4X54A 4DHEA 3VR6H 2QE7A 5DHUA 3H1AA 1DBWA 2QT7A 2AN5A 5FOXA 2LKZA 4P0QB 2GIQA 2EPIA 3D8UA 4L8GA 1DL5A 2LEAA 1A9RA 1FJEB 1NMEA 1JR6A 2QORA 1P72A 5KFTA