2AEFA

Crystal structures of the mthk rck domain in ca2+ bound form
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
224
structure length
221
Chain Sequence
RHVVICGWSESTLECLRELRGSEVFVLAEDENVRKKVLRSGANFVHGDPTRVSDLEKANVRGARAVIVDLESDSETIHCILGIRKIDESVRIIAEAERYENIEQLRMAGADQVISPFVISGRLMSRSIDDGYEAMFVQDVLATRRMVEVPIPEGSKLEGVSVLDADIHDVTGVIIIGVGRGDELIIDPPRDYSFRAGDIILGIGKPEEIERLKNYISALVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the MthK RCK Domain and the Effect of Ca2+ on Gating Ring Stability
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Metal transport, membrane protein
molecule keywords Calcium-gated potassium channel mthK
total genus 73
structure length 221
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02080 TrkA_C TrkA-C domain
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.870 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Voltage-gated potassium channel 2aefA02
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2aefA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2aefA01
1WMAA 1YDEA 3JTMA 1KVTA 2EHDA 2DBVO 4XGKA 3P2OA 3AI1A 1JQBA 5A9SA 1HYGA 1LSSA 5BNTA 2X86A 2LDXA 1VE9A 3D1LA 3QLJA 4FGSA 1T2CA 2I76A 5G0VA 1PU2A 1QV6A 4ONEA 4CL8A 4MOWA 3KSZO 2YQ5A 3VZQA 2ZCVA 4BO2A 3L9XA 3INRA 1VI2A 2C82A 3L07A 2YV3A 4ZRMA 1B0AA 3MOGA 4Q3AA 2A92A 1ENZA 3E48A 4D79A 3DHEA 3ZDFA 3WYCA 1NAIA 2B35A 3WBBA 5CPBA 1RJWA 3FHLA 3HFSA 4I5GA 3O03A 4P4GA 3KEQA 2FPIA 4CUZA 5L4NA 2EP5A 2NTVA 3KRTA 4BO4A 2CDCA 1HDRA 4ND2A 3E03A 2DBQA 1EVIA 1UXKA 2C59A 4OAQA 3D5TA 3OHSX 4PG5A 4TZKA 1IYZA 2C20A 3AY7A 5THKA 3VVCA 3H2ZA 4DVJA 2PNFA 2EEZA 3PDUA 3D4NA 4I5FA 2EIHA 4NH4A 4J43A 3GLQA 2VNSA 5I9MA 5ILOA 2Q49A 4U6SA 5L9AA 1Y8RA 1ZXLA 4NK5A 5BR7A 1R15A 4CV0A 4YAKA 4CLOB 4I08A 1ISGA 3GG2A 4M54A 4BIIA 3GG9A 5FI5A 1I32A 2EKPA 4PIVA 1ZUD1 2XPCA 4J3FA 4MPDA 5K9ZA 2Y67A 4CR8A 3U4IA 4E2ZA 4JJFA 4YJHB 4II2A 1PJQA 4FS3A 1Z73A 1WXDA 2HRZA 1I0ZA 2W90A 2X58A 4MKXA 4HV4A 1PS9A 3GN1A 5DP1A 1ONPA 1QKIA 1AHIA 1IZ9A 2A94A 2PFGA 3JSAA 5A5EA 1U2GA 5TLSA 2ZTUA 1AXEA 3L0DA 3L77A 1I2CA 4R5MA 1QMGA 2X7HA 3GRKA 3RD5A 3U9LA 3VHRA 1KC1A 3JD2A 3OECA 5G4KB 3ZZNA 5T67A 4YT4A 1G6KA 2P5YA 3NT5A 3H65A 3ZNOA 2AHRA 3RASA 5JDIA 1XWFA 4R41A 2VYVA 4IDFA 4JBHA 4LSWA 2W2KB 4MVJD 2YHUA 2HLPA 3PEFA 2P9CA 2VTEA 4CM6A 4FCCA 2W2LA 3GNQA 1M66A 3QWIA 5LCXA 5HBRA 2NVUB 4D3DA 3Q11A 2BKAA 5A5FA 1YVEI 1GZ4A 1O5IA 3I6QA 3AUSA 3RFXA 5DP2A 4BV8A 3HZZA 1LI4A 4GWGA 4WJZA 4D44A 3FNFA 4TRRA 4UVGA 1L1FA 5JAZA 3LSYA 2WM3A 4FJ0A 4PLFA 3HJAA 4GLOA 3A9WA 5JO0A 1E3WB 3AUUA 2ZTVA 4DLAA 3BYZA 2QHXA 2FPGA 3JQDA 2X5OA 4D43A 1CF2O 5JDCA 5JBIA 1KVRA 4J0EA 4D0RA 1MB4A 3AUTA 2VZ9A 3KV3O 4JP2A 3GDFA 3FCOA 5H81A 5T8KC 4BKRA 2FY8A 1PSDA 3DZGA 4ID9A 1QP8A 2X6TA 1K5HA 4CM9D 3GMSA 1LQTA 2Q45A 4JP3A 3WYBA 4GI2A 3JQAB 1U5CA 1PR3A 1CQJA 2C5AA 4E30A 2EKLA 3DZHA 3ZWWA 4EEZA 3FBTA 1HXHA 1R0LA 1Q0QA 2JCYA 1PX0A 4MVJH 1HYHA 3QA9A 2O3TA 1N92A 1V35A 4WK6A 4CQMD 3EVNA 2DC1A 1SMKA 3CMMA 3ENNA 3GH3A 1K6IA 3RUAA 4DLBA 2WTBA 2BLLA 4OQZA 4IPTA 3VPHA 5JY1A 1PJLA 4XDZA 5DDIP 3DAFA 4IIVA 5FWNA 4LW8A 3JYNA 2OORA 1XIVA 1N9GB 1X13A 3WFIA 3I9JA 3IJPA 5AXBA 5ER9A 5ENDA 1N8KA 1DFIA 4WCFC 1F8FA 4MP6A 1VKNA 4OIMA 4Z3DA 2GNAA 1TT7A 1VJTA 5HA5A 4OO3A 2YDXA 1DSSG 1WZEA 2EWMA 2O23A 1YJQA 3BTUA 3IS3A 3QWFA 2JAHA 2Q4EA 3C1AA 4DQUA 1JKJA 1Y7TA 5T64A 1CEQA 3I4FA 2YUTA 1PJ3A 3RU9A 1GR0A 5G4LA 3KSDO 4AICA 1SO8A 4UVEA 4IJKA 4PVCA 3ZI0A 1I3LA 4RGBA 4NJMA 1B3BA 3S2GA 1T24A 5C7OO 4JIGA 1NPTO 2JL1A 4OXYA 3QV1A 5I9NA 3JCZA 3STHA 1LRKA 1VSUA 3FWZA 4NMHA 3S2IA 4ZICA 5DCYA 5JCJD 4YJFB 1I2BA 4RF2A 3WQRA 1MC4A 1OI7A 1QLJA 1HF3A 2WD7A 4N5LA 1ZK4A 4CM7A 1RM5A 2I66A 3E8XA 2GN4A 5KVSA 4LMPA 3OFSA 3D3WB 1WNTA 4CM4A 4CM9A 4A03A 5G0SA 2D1YA 3WBFA 1IPFA 4HY3A 1V3UA 3UICA 1U3WA 1J0XO 2AQIA 1XG5A 4XKJA 4YBZA 2BFPA 3L9WA 5F3RA 3ANLA 4A27A 4EJ0A 2GLXA 1ORRA 3K8ZA 5HM8A 3N58A 4GWKA 4TRJA 1EDOA 4R69A 1K6XA 1YBMA 2JFGA 2X4GA 2G1UA 4FC6A 1TB4A 4C7JA 3BXXA 4ZU3A 4KWHA 1UAGA 1Q7BA 3WICA 4G65A 1Y6JA 2PH3A 3DHNA 3PP8A 2WWRA 3AOGA 4WLNA 3RWBA 4CMBA 4WCFB 3FR8A 3ROKA 4DYVA 1XA0A 3IMFA 1UP6A 3H5NA 4GX5A 5BSEA 3QQPA 1Y9AA 5F1PA 3UHAA 5FI3A 3HDQA 4PLHA 3VH4A 5JAMA 5BNFA 2Y0DA 3ASVA 3GGPA 1QYDA 3ZU2A 2DPGA 3EZLA 1YBAA 5A3JA 4CLXA 4HWKA 3ADPA 2VT2A 3F3SA 1ZSYA 3RVDA 2Q1UA 2ZATA 1Z45A 1HE2A 2X9GA 3UUWA 4AJ1A 1YBVA 1YOVB 1K0UA 4XWYA 1GCOA 3B20A 2ET6A 4BNNA 3K30A 3EVTA 5U4QA 3AFMA 3DO5A 1I2ZA 2IXBA 2ZCUA 3PGJA 1GPDG 1OMOA 1ZK1A 3K2EA 4DQXA 1Q2XA 1R4NB 3OJOA 2PGJA 4BNUA 4J7XA 3JQFA 2GASA 4IDCA 3G79A 4KP7A 1OOEA 5DOVA 1BVUA 2HKIA 3D5QA 4OHUA 4B4UA 5CG1A 3TFOA 1X7HA 4U0KA 1X14A 3AY6A 3SJ7A 4I9NA 3RC2A 1HZZA 1DRVA 2O3JA 3L6DA 3S2FA 3OQ1A 3NDRA 4Z3KA 2PD6A 4NHEA 4OGWA 4PG7A 1E3EA 4OH1A 1HDXA 4E12A 3M1AA 1L7DA 4RL6A 3IL2A 1LSOA 2P5UA 3R6DA 2BKNA 4O0LA 3W6UA 3C24A 4I9HA 1YJ8A 3LT0A 3UGKA 3ZN2A 2EGGA 3PHIA 1HWYA 1P77A 1ZEJA 1ZXBA 3BTSA 3PHGA 2CD9A 4GX0A 4BNVA 5EPOA 5JC8A 3PLRA 4CMEA 3F5SA 2C7GA 1R0KA 1UZLA 3NTOA 2J3JA 2OP0A 3NX4A 3ORFA 4RJTA 5KCZA 3F4BA 3U4DA 3I9OA 4K26A 2IEDA 4KQWA 4UAGA 5LDHA 4BVAA 3MTGA 4OXKA 4YT8A 1Y81A 2DKNA 3GVXA 3WGGA 5ICMA 4FB5A 3VVBA 1JKIA 2GDZA 3R3JA 3WB9A 4IJUA 4E32A 1M67A 4JXKA 3NKLA 1FF9A 1EUCA 4WASA 1V0JA 3JD0A 4KUHA 1KY5A 1U4SA 1CDOA 3HWRA 3PZRA 4PG4A 3KB6A 3GEDA 3MJTA 3RUHA 3AJRA 5ENVA 4BNZA 5L3ZA 5BSHA 4L76A 1RWBA 2PZJA 1NHWA 1XKQA 4IIUA 5B12A 1BMDA 2PH5A 1C0IA 3LLSA 4DPLA 2JFHA 5MGBA 4CR7A 2HMVA 1QRRA 4BKUA 4EUHA 3DEYX 1DAPA 5IFLA 4ZJUA 4TRMA 4QQRA 1I36A 4MKRA 3VC7A 4AJJA 2QG4A 4BMVA 3GPDG 5BSGA 1D8AA 1E7YA 3BMNB 2BHLA 2D59A 3SVTA 3T4XA 4YQYA 2AW5A 3AU9A 1UAYA 2VRCD 4YA6A 5B37A 5JMPA 5TX7A 2TMDA 4EEXA 5K6AC 4IBOA 4ZQFA 3IAHA 4JBGA 3H5AA 1DIHA 2DBRA 3GAZA 5L4SA 4FPXA 3AOEA 3GAFA 2WYWA 1Q7CA 3I4CA 1W6UA 4ALMA 2BKPA 2IRWA 2OHXA 2BGKA 1E5LA 4A5OA 2P4QA 5BQFA 5KJ6A 7MDHA 4WEQA 4XQGA 4TVOA 1IL0A 2FPPA 4PG8A 5C37A 5IZCC 4L0QA 4PLVA 2JCXA 4GX1A 1MP0A 2Y1GA 1GYQA 5DBGA 4Y6RA 1DRUA 4RVUA 3WGTA 1SCUA 3GVCA 5TF4A 3D4PA 4AJEA 4E5PA 3H3JA 1O95A 1UJMA 1ZW1A 4BUCA 1E92A 1KERA 1NFFA 2HUNA 3GZNA 3OBBA 4JCOA 1DIGA 1MG5A 3UF0A 3W8FA 3FPLA 3HN2A 1LXCA 1KEUA 4P8RA 1OBFO 4DPMA 2NVUA 2BMAA 4J1TA 1O6ZA 1U3VA 1R6DA 2H6EA 2DTXA 2FZEA 3I9KA 1OAAA 3RUEA 1DLJA 3WGHA 1PIWA 4YT5A 3AK4A 1AE1A 3ZWVA 3U49A 5IF3A 2B69A 4KTVE 4XA8A 3M2PA 3PGXA 5JDIC 1F17A 2H9IA 3F46A 1GU7A 3RQSA 3HHPA 2Q46A 5JMWA 3CZMA 3FTNA 2BKOA 1KEPA 4KOAA 2BFAA 5G2OA 1RM4A 1SEPA 5BT9A 3IKTA 3I23A 4J2OA 4WCFA 5DN9A 2AE2A 1P0CA 1ZJYA 1ZSVA 4RPKA 4R01A 1GFSA 1EE9A 3H9GA 4CQMB 3GA0A 3DTYA 4YYZA 4K9DA 2R2GA 5EQDA 3JQ8A 3QVOA 3CKYA 4QO7A 1ONOA 1ISJA 3GY0A 5FF9A 4YAIA 4FBGA 4RPHA 2J5RA 3P2YA 4PLCA 1PR9A 2VWQA 1LJ8A 3RI3A 5JDCC 2QYTA 4AJHA 2Y1OA 3B1JA 4J49A 2QW8A 1HDCA 3GEMA 5I8ZA 4XDYA 5DOZA 5C5IA 2JCVA 3CUKA 3O4RA 1XQ1A 4Q39A 4PLPA 3TL3A 5JCXA 3I52A 5L7YA 1I33A 2VUUA 2X22A 4U7WA 3ZU5A 4E6PA 2IYPA 1GTMA 2TMGA 3IC5A 3KZVA 4IDGA 3DC2A 1QG6A 2YDYA 4II3A 1Z7EA 4M86A 4AFNA 4CMAA 1LDEA 2OXIA 1I10A 4EGFA 1E7SA 1VLLA 3F9IA 4MDHA 1YL6A 2AMFA 3ONEA 3PJFA 2CF5A 5A9TA 4CODB 5I9LA 2X0JA 3DMYA 3WSVA 4FFOA 4RVDA 3HNPA 3L6OO 2AQHA 4D0SA 4YB8A 4NBWA 3QVWA 2X0RA 4QEDA 4WCDA 4CMGA 4BMSA 3MEQA 2ILTA 1TEHA 3WJAA 1JU9A 1NWHA 3DAPA 5K0ZA 4FFLA 4CMIA 4JX8A 3NV9A 3DZBA 3GRPA 5ES3A 4BS9A 1RPNA 2RAFA 4KUEA 5IXYA 1EFKA 4UUOA 4ZQGA 4B4VA 1VM6A 1FDVA 1FK8A 3RROA 4F45A 2E49A 3W8EA 3V2GA 1F14A 4ALKA 4U5QA 1D1TA 4OSOA 1R4MA 2J5QA 5COQA 2A4KA 3OIDA 3OJLA 4RF3A 4BB6A 4RPGA 5HTOA 3QVSA 3V1TC 4BB5A 4W9NA 3ZH2A 2C54A 1E3JA 3PYLA 3B6ZA 1DIBA 2QRJA 1DPGA 1SB9A 2C2XA 3FNHA 1E1KA 3UCEA 4JROA 3PK0A 5FYDA 1BSVA 3JD3A 2NLOA 5KVVA 3GGOA 3CE6A 2GF2A 4E4YA 4DBVO 3ANMA 3FWNA 3PFFA 1HZJA 4FN4A 4NBTA 5TGDA 2BGLA 3SEFA 1CERA 3LVFO 4RLHA 2DUUA 3JQGA 3IUPA 3O8QA 4O5OA 3BMCB 1EEHA 4W7HA 2Y66A 1H6BA 2OFPA 2G5CA 2JD0A 2NU6A 4XYMA 1PJTA 2B5WA 2VN8A 4KUGA 1O0SA 3K9QO 3RBZA 3CH6A 1OZAA 1TVEA 2Q4BA 4DMMA 1ENYA 3WOHA 3T4EA 4Y8VA 3TDKA 1LTHR 3K96A 5DULA 4Z6KA 3PYXA 3PZBA 1LUAA 2BFMA 2Q50A 5I7VA 2I99A 5C3MA 3LDHA 2JD2A 2YHIB 5ILGA 3ONFA 2EGHA 4AJNA 4URFA 1NQOA 3V2HA 2PA3A 2O3SA 4CV2A 4YT2A 3RJ9A 2BF7A 3ADOA 3WNQA 4E2YA 3ZCXA 2VWGA 2W4QA 1J4AA 1PWXA 1VCTA 4MKZA 4NK4A 1UXGA 4A73A 4BKOA 1E3WA 1AUPA 4L9RA 4DC0A 5CDYA 2OGUA 4HXYA 4Z0PA 5JE8A 4CLEA 4NFSA 2E4AA 1G1AA 3ETGA 1Q0HA 4W82A 5A06A 5BNIA 1F8GA 1MLDA 4HUJA 4PFJA 2GN6A 1E3LA 4QFDA 1E7RA 3WFJA 2UUPA 4MP3A 4NJMB 4OQYA 3E9NA 1MXFA 1GYRA 1YQGA 5HS6A 1N7GA 4B3JA 1LRLA 1UDCA 3E5MA 2NUAA 4TQGA 4A0SA 5B4TA 2ZB3A 4OKIA 2DLDA 4EJ6A 3WGYA 4PZCA 1WLYA 2G17A 4BQPA 3JD4A 4DMLA 5L40A 3ULKA 1R66A 1E6UA 2DT5A 2VHYA 3P5SA 4XB2A 2GR9A 1YWGO 2Q2WA 2FRDA 2QRKA 4E33A 3H6KA 3EMKA 3OMLA 5A03A 3ANNA 2WMDA 5EMHA 3OIGA 2DUWA 1PEDA 4Z0HO 3K31A 3H8VA 4CMHA 1C14A 3V8BA 1LU9A 4GGPA 4ITUA 1QXSA 5H82A 4XYLA 1U2DA 1UZMA 3Q9UA 2UUOA 1RM3A 2QYSA 4LGVA 4PLYA 4Y67A 1LSUA 4WE3A 4PRKA 1ZH8A 5IZCA 2NTNA 5F1KA 1AXGA 2HMTA 4YVFA 3D4OA 4B7XA 1KVSA 1E3IA 3D7LA 3QVTA 2AEMA 2HU2A 3BAZA 5JW6A 2V7PA 2CVZA 1Z82A 3UW3A 2A35A 3JQAA 5LDGA 2UYYA 3PHLA 4FR5A 1EZ4A 3QJ5A 3UKOA 2ZJ1A 3ABIA 1B8UA 3HDJA 3TPCA 5IXSA 3EC7A 1ISHA 4BGVA 1Q0LA 3WXBA 4ESOA 3NRCA 1JAYA 4OXNA 3WYEA 2BRUA 2Y1DA 3MOIA 1H2HA 3X2FA 4C4OA 3OSUA 1ZBQA 1HRDA 4OMUA 4ROSA 5GZ6A 4AJOA 2WE7A 4HNHA 3E9MA 3A28A 3C7CB 4RF5A 5K6AA 2JHFA 4YRDA 3K6JA 2P68A 5KVQA 2Y1FA 2PZMA 3KYBA 4E3ZA 5EERA 3UN1A 1ISFA 1P1JA 2Z5LA 3KOUA 4BNIA 5GY7A 5C7IO 5I7SA 5G0WA 3U5TA 2EW8A 3KLMX 1A5ZA 4HFRA 1YONA 3ROMA 8ADHA 9LDTA 2VHZA 3DMTA 3IKVA 3PIDA 5AQ1A 3IJRA 4R1SA 2C29D 3TZ6A 3TF5A 1QSGA 1Y8QB 5DNAA 3RKUA 3VTZA 4DL9A 2PK3A 1LSJA 1NVGA 4DC1A 4LCEA 2WEKA 3QIVA 2E48A 3TWOA 4A2CA 1MA0A 2AG8A 2I67A 3BMOB 3KM0A 4B3HA 1FDWA 4N7RA 1Q1NA 4IS2A 4OYRA 4R51A 3GFBA 4DWVA 1Y5MA 2A9FA 4Q3DA 1E6EA 1TI7A 4BO0A 4O6VA 1A72A 1GV1A 1H6AA 1TXGA 3BTVA 5KWEA 3KVOA 1U1IA 3Q1LA 4AL4A 1ADBA 4MJLA 3WWYA 1IB6A 3BHJA 3FNGA 4TSKA 4EW6A 2NU7A 4EUEA 2YJZA 3LK7A 5GMOA 1M6HA 3K2BA 2VUTA 4RDHA 4IY1A 2GCGA 2I5PO 2W98A 3U62A 2DBZA 5B4VA 3ZHXA 1QYCA 4FDAA 3ZU3A 3VOSA 3GVPA 2P91A 1B26A 4CJXA 3E9QA 3LZ6A 1DOHA 1U8XX 3GUCA 3V1UA 4J7UA 1Z6ZA 1ZSNA 5IDYA 1H6CA 4WLFA 2HSDA 3SLKA 4J2HA 1EUDA 5KNLA 4XCVA 1B8VA 3G49A 3UCFA 5A04A 1UXIA 1M6WA 2J5KA 3U09A 3OF2A 1U5AA 2C0CA 4O59O 4Z0TA 2DAPA 1PGJA 1JLLA 3QHAA 3G3EA 4LK3A 2AEFA 1PQWA 3JQBA 3TJRA 3AWDA 4DYDA 3OJ0A 4YXFA 1R37A 1NWCA 3GUYA 1NNUA 3V5NA 1E7MA 2DPHA 2PY6A 3BIOA 3JQEA 4NBVA 3DBLB 4MIOA 1UR5A 4YEDA 3W4IA 1QV7A 4RVGA 3WMWA 5BSFA 1GZ3A 1ZK0A 4CQMA 3GFGA 4HNGA 1J6UA 3JQ9C 2BFOA 4DGSA 4FW8A 1V3TA 3EAGA 4KDEA 1P0FA 1C0LA 4PLTA 4UVDA 4M89A 2ZQYA 3HDYA 2H1SA 2UVDA 3OM9A 3DDNA 1UXHA 1BDMA 3H9QA 1I8TA 4JJIA 4OJNA 1F06A 1LLQA 1NPYA 2JJYA 2R00C 3CMCO 1NFQA 1GQ2A 5EJ2A 3RC7A 2C2YA 4NJOA 4YWJA 3D64A 2E6UX 1DHRA 4G81A 3GVIA 3OETA 2DU8A 2BI8A 2C7VA 2EJVA 5DF1A 3NTRA 3ZU4A 1GCUA 1WVGA 3L4SO 3LLVA 5COBA 2ZQZA 2B36A 3K73O 3WLFA 4CM8B 3FI9A 1BW9B 2X5JO 3AI3A 3FRJA 1I3KA 3ASUA 4FIZA 4FFRA 5CPFA 1Q7GA 5TJHA 1PQUA 2C07A 3BTOA 2XAAA 3B70A 3CXRA 3KEOA 3FR7A 1DIAA 2EW2A 1PL8A 5TC4A 4IDAA 3JQ9A 3D3EA 4EUFA 4RCVA 5ITVA 3KETA 3ZWOA 2D2IA 4FFPA 3TOXA 3VH3A 1RYDA 1VJ1A 3H4VA 2ZYGA 3RC9A 4ZQEA 1C3VA 3O38A 1GAEO 2RCYA 3W6ZA 1H9BA 5TSDA 3V2UA 5HWSA 3ENKA 2VWPA 4YACA 1SPXA 1GEGA 1NAHA 3C7AA 1PGQA 2Z95A 3LF2A 3WLEA 2VHVA 4J9VA 3EY4A 4YAEA 1W0CA 3U4HA 3VPFA 4YJGB 5L7TA 4AJLA 4A7PA 1NTOA 1OC4A 4BO7A 1P33A 3MJ4A 3TL2A 4PN3A 4ND3A 3RBXA 2ZIZA 3HB4X 4FSHA 2G76A 1DIRA 2PKQO 4TVBA 1DHTA 1P45A 2IYOA 1ZK2A 4IJVA 3GNSA 3BHMA 1OFGA 3JYOA 4J6FA 3W4JA 3RIHA 4RLSA 1SNYA 4OL9A 4UUPA 4FOSA 3QWHA 4RDIA 3L6EA 3WIEA 2IZZA 5A9SB 3DZFA 3ZWBA 1HDZA 4EDFA 5KJCA 2QZZA 1T4BA 2D4AA 2QZ9A 4N18A 3A1NA 2G82A 2FR0A 4Z9XA 2VOJA 2AQKA 3JQ6A 3Q0EA 5F5NA 1QYXA 1R4MB 4GLLA 1U4OA 4DQVA 3SLGA 1O9BA 4EBFA 1ML3A 2R00A 5ADHA 1X15A 3DWFA 2B37A 4JBIA 3A4VA 2VYNA 3COSA 3F1LA 3SC6A 4KZPA 3CPSA 4IQGA 5IDXA 4ALJA 2O2YA 5CDSA 4RVFA 4BNJA 5TT0A 5CG2A 3QRWA 1P31A 1T2EA 5TJ9A 5ICSA 2JFFA 4R3NA 1FDTA 3SBOA 1ZO8A 4XJTA 2VQ3A 4IUYA 3PFWO 3ZNQA 1N2SA 2FR1A 4W7IA 4XTTA 4UUMA 4MVJF 4DUPA 4EI2A 4H7PA 3D0OA 5CDTA 3OQ6A 2X9VA 3E5RA 1VSVA 5T8KA 1LBEA 4PZDA 3E1KA 1IULA 3AI2A 4BOYA 2VYVD 3UCXA 4CMIB 1AHHA 3Q2IA 1HL3A 5L53A 3ETDA 5AXCA 3NEPX 3DOCA 5L95A 4D7AA 1SZJG 1MUUA 2DM6A 2PR2A 3RUDA 2HJRA 4GKVA 4TZTA 5EQFA 3FPCA 2GGSA 4E5KA 2G0TA 5IDWA 2FHSA 2HRBA 1E77A 2VT3A 1K3TA 2X23A 3DZJA 3UFXA 4F6LA 3IP1A 5JY6A 1J49A 5KJ1A 1A9ZA 1JW9B 2FOIA 3KUXA 4L4SA 2YHIA 4E0BA 3ZWMA 4E5NA 2HK8A 1GPJA 4JLWA 5A9RA 3KTDA 3AY3A 4L73A 4GPD1 4QFCA 3G0OA 1YGYA 4JJGA 4CLRB 5IJZA 3IP3A 2DQ4A 1LDMA 4QECA 1ID1A 3S1LA 2AEJA 2FZWA 3ZV3A 3ZWYA 4BO9A 3A06A 3DFUA 4YTEA 3EK2A 3TZQA 2EG9A 2ZTLA 3EGOA 4R1UA 5CEJA 3GF4A 3ZW9A 3ZNNA 1VPDA 3DOJA 1U8FO 1WDLA 4J1QA 4BO1A 2NV6A 4A10A 4TKMA 4UVHA 3WS7A 3I5MA 2J3IA 4S3MA 3NYWA 3I6IA 1E7WA 4MINA 4IMRA 3QP9A 1KEVA 1ENPA 5JFOA 4ZGWA 1J5PA 1QLHA 3TZKA 2PZLA 2WDZA 1LQUA 4C7KA 4UULA 1A71A 2HQ1A 3GGGA 1U3UA 4NNJA 3BMQA 4PGFA 6LDHA 2UAGA 1KY4A 3HSKA 4GQAA 5TNXA 3GHHA 3T7EA 3IOYA 1UP7A 3PWKA 4IDBA 2NNLD 1BVRA 1DXYA 1MFPA 1XYGA 3EYWA 1WW8A 3DBLA 5TQVA 4UVIA 3VZRA 4TRNA 3WDSA 3VKVA 1TT5A 4FOOA 1X0VA 1LLCA 3HDHA 1ZMTA 2EJWA 4MVJG 3PVZA 4XIYA 3QWBA 1JVBA 3DL2A 3DONA 3LC2O 4PCVA 5HRUA 1PZHA 2VZ0A 5B1YA 5EN4A 5TT1A 1GY8A 1NVTA 1LDBA 2P9GA 1XELA 5G0UA 1NVMB 1D4FA 4YQZA 3RAJA 4D3FA 4ALIA 3JV7A 4YJGA 2FR8A 2EP7A 5G0TA 3NJ8A 1R4NA 2V65A 5DCWA 1ENOA 3SC4A 1HSZA 2GZ1A 4WLEA 1A7KA 4D46A 1PJ4A 3C7DB 4EYEA 1LLUA 1VL6A 1YB1A 2RH4A 4KQXA 3DAGA 4LRTB 4RQTA 4ILKA 1T2AA 3EUWA 4F3YA 4YRBA 1HT0A 1T1SA 2YW9A 1KS9A 3O26A 2D0IA 2FP4A 3GVHA 3JQGB 4IDEA 1EE2A 3ICCA 4MVJE 5JNLA 3C85A 1X1EA 4UEKA 2W2KA 4IZHA 2IE0A 3H7AA 5KKAA 3HN7A 1ARZA 3TZHA 1IHYA 2IDZA 3AUAA 1PZGA 4RVHA 5EINA 3Q9NA 2NQTA 4J1NA 3NGLA 1E7QA 1EBFA 4GL4A 4CM8A 1PTJA 3ZWNA 1NASA 3OIFA 1LRJA 3JD1A 3PHHA 4UEJA 4H16A 1KYQA 2JKVA 2P2SA 3KSUA 2Y05A 3RC1A 2PTGA 5L45A 3N74A 3MWDB 1PGOA 3KYDB 1HE5A 1I30A 4G5HA 3ITDA 3VPSA 4ND5A 2RH8A 3NJ4A 4WLOA 5ITWA 3C1TA 3PLNA 3VTFA 5AVOA 4XJSA 2GERA 3FD8A 5A4DA 3GZ4A 1M2WA 1MGOA 2DVMA 2YV2A 3GEGA 3NGXA 5F1OA 3GR6A 1WDKA 1G0OA 3CEAA 4ZD6A 1XR3A 3OEWA 1YKFA 3FF4A 2HDHA 1UDAA 1BG6A 1XEAA 4GVXA 4UUNA 1NR1A 3QW2A 1P44A 3ZW8A 4B7CA 1W8DA 2B0JA 1PWZA 2QRLA 3DBHB 5FFFA 5TIIA 3VPXA 1VL8A 2O4UX 1V8BA 4BNMA 1U7HA 1O8CA 1WMBA 3F5QA 3FN4A 1V3VA 4I1IA 2CF6A 3GQVA 4CM4B 1PL6A 3ROQA 1DAOA 5L51A 1DJNA 4CM1A 4JNKA 4H15A 2X9NA 4QO8A 5IDQA 1T2FA 4Z9FA 1YB5A 1EK6A 1A9YA 2Q1SA 3ZV4A 1ISMA 3EW7A 1IUKA 3OA0A 5EL0A 3PHJA 1HTBA 1RYEA 1NXQA 3ON5A 4WNIA 2NVBA 2PLAA 2PKRA 2RBEA 4PRLA 3H5RA 2ZB4A 2GD1O 2PZKA 1YO6A 4E2WA 1EUZA 1TT5B 3GNTA 4U0JA 3TSCA 3PQDA 4NIMA 3JQ8B 1SAYA 1GL3A 4R9RA 2YY7A 4XIJA 2UDPA 4FC7A 2E37A 1UUFA 4OM8A 2RHRA 1PL7A 1FDSA 2J6IA 5THQA 2JHGA 1EDZA 2B4RO 4QT0A 2X1HA 4W6ZA 3FTPA 4BNTA 3TZCA 1QYWA 1LDGA 4I9UA 4NU5A 4ND1A 2HAEA 1EVYA 1IHXA 4XQCA 3TOZA 4GKBA 4R1NA 2GSDA 1U3TA 5KJEA 3WQQA 3Q6IA 4L8VA 1W4ZA 2J3HA 1XU7A 2I3AA 4CMEC 5KIAA 2HJSA 4IGEA 3NT2A 1EVZA 2Q1WA 4M55A 4NDNE 6ADHA 1T1RA 1P74A 3P7MA 2ZB7A 1YE3A 1WZIA 4ALLA 1N7HA 4IM7A 1NHGA 2JAPA 4QSMA 5DCUA 1PZEA 5EESA 5KKCA 1ISIA 1DDOA 1F12A 3R0IA 4KDFA 5T5QA 1ADCA 4G2NA 3ZWCA 1UP4A 2PD4A 2PGLA 1SC6A 2FSVA 4CLRA 4AJ2A 4WLUA 4K28A 4M8SA 2Z1NA 2RHCA 4BO5A 1BWSA 3DMTC 5F21A 2NU8A 5TS3A 4CLDA 4XB1A 2W2LD 4QXMA 3E82A 4E5MA 1DC3A 1BXGB 3PYMA 4BNGA 5AXDA 3TFQA 1CQIA 4NBUA 5C7LO 3ROPA 1BXZA 1ONNA 1GZ6A 1NR7A 1XQ6A 3OQBA 1Z75A 4QTZA 5CDUA 1YQDA 3NTQA 1DO8A 2Y68A 4D42A 3MJVA 4ZRNA 3DR3A 4R1TA 4ZA2A 3VZSA 4NG5A 1LLDA 4RF4A 3MTJA 4DREA 1C1DB 4BKPA 3CIFA 2NADA 4LSMA 4GBJA 1B8PA 4CM5A 2BGMA 3PQFA 4GGOA 2BH9A 4WEOA 1HKUA 4BGEA 1DFHA 1JKFA 4XD2A 2CFCA 3HG7A 4XYGA 2OMEA 3I3OA 2DFDA 5J23A 3KBOA 1JWAB 3VAZA 3QE3A 3DBHA 1ZNQO 4J16A 4E2XA 3AM4A 4ND4A 4YAJA 5JLAA 3VH1A 1UH5A 1A4UA 1ZCJA 4HX5A 4DRYA 2ZKLA 4K1LA 4XX0A 2GRAA 1LC3A 3ST7A 1PGNA 4R54A 1DB3A 4EJMA 2H5LA 4GX2A 1B15A 3WGZA 3JYPA 1UZNA 5IN4A 4X54A 3GPIA 3C1OA 3RUCA 3RJ5A 4YRAA 3B1FA 3KYDA 1Z74A 1ADFA 5DBIA 4HADA 1NM5A 2OBNA 1E1NA 3HADA 4CR6A 1A7AA 4EITA 3QSGA 3IIEA 1H2BA 1P1RA 2CZCA 1LDYA 4AJ4A 3JQ7A 1UXJA 3H3FA 4HFNA 4R4JA 4WUVA 3FSRA 1NQTA 3DBRA 3ZGYA 5JC1A 2Y93A 1LNQA 1E0DA 4BO6A 3BA1A 4D45A 4I5EA 4WKGA 3WGQA 1EQUA 1WAMA 4TWRA 4AJPA 4R68A 3I1JA 2QIOA 2P4HX 1DBVO 1YDWA 3MJCA 5CEEA 4IDDA 1NP3A 3OICA 2OBYA 1ADGA 3JYLA 3Q2KA 1S7CA 4B4OA 4CUJA 2Y1CA 1H93A 1SOWA 1JAXA 2NU9A 4YDRA 4N5NA 1P9LA 3R1IA 2EKQA 3VH2A 4GH5A 1EK5A 3UAGA 1I5RA 1GV0A 2J3KA 5TRTA 3D3WA 1NX6A 3WX0A 2YV1A 4IS3A 5CEFA 4DTIA 4AVYA 4LVCA 2Q3EA 3CINA 2HO5A 3KXDA 2HK9A 1ZFNA 3ZHZA 4WLVA 4MIYA 4J91A 5KVCA 1A4IA 1V6AA 3VPGA 4U8GA 1JA9A 2AXQA 1M75A 4PLGA 2GYYA 3E6AA 5U9CA 1HDYA 2WYVA 3DBRB 4Q3NA 2R6JA 1A27A 1GDHA 3NDJA 3Q3CA 2O4CA 4ZQBA 3VDQA 1DFGA 1YOVA 3U0BA 4L4RA 5T57A 5CDGA 1WWKA 1I3NA 1P1KA 4ALNA 3WTBA 3LYLA 1XCBA 2QQ5A 1IY8A 4U6QA 4RZHA 2OP1A 1B14A 4J4TA 5AYVA 2HMUA 5JO9A 2I3GA 3ITKA 3H9EO 1MXHA 4EZBA 5F5LA 3OJEA 4RQUA 2V6FA 4J0FA 4NI5A 1HYEA 4RZIA 4J7CA 1PGPA 1NQAO 2VRBA 4CMCA 1EVJA 2VHWA 1FXSA 2VOEA 4JN6B 2POQX 2VRCA 1BTOA 3IDSA 4MVJA 4Q3EA 2ZB8A 4P22A 4MIEA 4NU6A 1U7TA 1YB4A 2F00A 2Q99A 4R16A 3L4BC 3DTTA 5JAQA 3HB5X 4ZN6A 4PG6A 1X7DA 2WYUA 4J4BA 3WR5A 5JCJA 3INTA 2I65A 1HLDA 3RCBA 1C0PA 2CDAA 3JQBC 1K6JA 4N5MA 2AA3A 4N54A 2GZ3A 4XRGA 4YAGA 5A05A 4LRSB 1YXMA 3K92A 4MVJI 1X1TA 4OOFA 3WMXA 1DLIA 4CMKA 4J4HA 4XEHA 1C0KA 4INAA 2SCUA 4NFHA 4L4XA 2H63A 3PIIA 1H9AA 1N5DA 2VZ8A 4BMNA 1VJ0A 1JN0A 2IODA 4R5HA 1D3AA 3JXOA 3LT1A 3N7UA 3IQDB 2EV9A 1P1HA 2X0NA 3HFGA 1EFLA 1IZ0A 8LDHA 4GAEA 5KOIA 3ZHBA 4HFMA 2I6TA 4MO2A 3LC7O 2V6GA 4M49A 1VRWA 2FN7A 2WJPA 3MJEA 1BHSA 4FJ2A 4CQLA 5IN5A 4YPOA 5JAIA 4E21A 3MJSA 2DTDA 4KWIA 4XR9A 4E5YA 3G17A 4B79A 2WE8A 2UV8A 1GUYA 4RV9A 3QVXA 3AFNA 3W4KA 1P3DA 3RSHA 1XLTA 4RVSA 3W1VA 4LISA 2Q2QA 3ICPA 4XGIA 1JDJA 5AXAA 1FJHA 3EDMA 1CETA 3FBGA 1KC3A 3PJDA 1W73A 4LCJA 1CRWG 3DZIA 5KTKA 1XHLA 4XYBA 4YJDA 2O48X 2GN8A 1PJSA 1JVSA 2W8ZA 1H0KA 3H9JA 1EBUA 3PRJA 3U4CA 1ZK3A 4WNCA 1H5QA 2ZJ0A 2V6BA 3MZ0A 4JK3A 3VKUA 3B1KA 3WWZA 4CMJA 4GVLA 1XSEA 5I8WA 1BDBA 1AGNA 4Y6SA 2CDBA 5CFZA 1MV8A 3ZV5A 2OUIA 5JPIA 3DHYA 1R16A 1CJCA 4HFJA 4IXWA 4J9UE 1E3SA 4Z9YA 1VL0A 2D8AA 3HUDA 3WQSB 3KYCB 4FD3A 4FFNA 4Q9NA 1D7OA 4RO0A 3AOEC 2XOXA 3JQCA 4L74A 3KO8A 4WECA 4BQRA 2B4TO 5I7FA 3G1TA 3LF1A 1C1XA 1RKXA 3DZKA 4W4TA 2ZK7A 3JQFC 3S2EA 1C1XB 3RBVA 2HCTA 3U3XA 1HDGO 1HETA 3ZWXA 5ER6A 2O3RA 5JYEA 4CV3A 1BXGA 4Y98A 3LT2A 5HS4A 2F1KA 4GMFA 2XXBA 3ZNPA 5L4LA 4Q3CA 3NUGA 4IINA 2CMDA 5JXWA 1TLTA 1B16A 4DXHA 4W99A 3I9LA 3JQ7B 3DFZA 2O7QA 1SOVA 5DT9A 2RIRA 1ULUA 3W8DA 1X0XA 4XR4A 2NVWA 2O2SA 1GQYA 1YS4A 4B8WA 2X0IA 4CV1A 2O7SA 2B4QA 2VUSA 2Q1TA 1KVUA 1V9LA 1YQXA 3SJUA 5I7EA 2HK7A 1Y5RA 4IZIA 2X8LA 3BHIA 2XF8A 4DPKA 3F6YA 4O1MA 2CUKA 3GT0A 3DQPA 2YFQA 4DA9A 1N9GA 2PGDA 2EXXA 3A14A 4R9SA 4IQ8A 1RM0A 3OA2A 3F47A 4BGUA 1E5QA 4FGWA 3H2SA 1DEHA 4AG3A 1ZZEA 1ULSA 3BZUA 4XYEA 3K5PA 4TROA 1O94A 4BKQA 1VKOA 4B3IA 4F46A 3PQEA 3MCVA 5GZ3A 3PWZA 3WNVA 1LDNA 4NQZA 1E6WA 4BV9A 2IZ1A 4XQEA 3RFTA 1H94A 1PJCA 4CLOA 2PWZA 1KOLA 3RKRA 5MDHA 4BNFA 1GUZA 4P4NA 5DZSA 5LC1A 1KBZA 3JYQA 4Q3BA 4BO8A 1SB8A 2VWHA 3WSWA 1PZFA 1WP4A 4L75A 1WDMA 2NWQA 3JQAD 1GADO 1K2WA 1N1EA 3UVEA 4M1QA 4YCAA 1GQQA 3HE3A 2WD8A 3HQ4O 4PLWA 3TRIA 3SX2A 1DRWA 4GSLA 4ZHSA 3LQFA 2P9EA 5AOVA 5IG2A 3LU1A 1EMDA 1PQPA 1P1IA 4RPJA 3WGOA 5JS6A 1C1DA 4IGFA 4DBZA 1GYPA 3MWEB 3TN7A 4F6CA 3DOOA 1CIVA 4P38A 3X2EA 2QX7A 1FMCA 2XXJA 4BGIA 1PJ2A 2O50A 4KMSA 3DB2A 3KLPX 1D1SA 3KHUA 4GMGA 4BL5A 5L7WA 1IOLA 4PVDA 2NM0A 4NR0A 2HMWA 2NSDA 5A02A 5T6BA 4QX6A 4MVJM 3OH8A 1IE3A 3O8QB 2VTDA 4BNWA 5A1TA 3ZWPA 1JWBB 4BNYA 1HE3A 3BMQB 1LA2A 3L4BA 3V1YA 1ZKMA 2YYYA 4B7UA 2Y1EA 2D5AA 1BW9A 1VC2A 2PKQP 1P1FA 3BMOA 4TKLA 4CLHA 1MX3A 4E31A 3INGA 2HMSA 2GZ2A 1HE4A 3RUIA 2ZYDA 4PZEA 1OC2A 3R3SA 3PJGA 4NBRA 2GN9A 2E82A 1K89A 5DBFA 2NACA 1L7EA 2GUGA 4R3WA 1KEWA 5EIOA 2D5CA 1T4DA 4S1VA 2O3QA 4YJHA 4XGNA 1Y9EA 1NPDA 1ZVMA 1LEHA 3DBVO 4JQCA 3IUSA 3GC6A 2OZPA 4BNHA 4ZQHA 1LX6A 2YQ4A 1B7GO 1E1LA 3M6IA 4P4LA 4CQLB 4CUKA 1U9JA 9LDBA 4MVJP 1NFRA 3F1KA 2VHXA 1Y8RB 2IEBA 3WJ7A 1QYVA 3CSDA 4XRRA 3NT4A 2O3UA 1KETA 1MC5A 1PS8A 3AW9A 4WPGA 3VDRA 1Y1PA 2CNBA 1XU9A 3I83A 4HP8A 4AJKA 4DIBA 3WGIA 4TMFA 4WOKA 1ZIDA 1DJQA 1HDOA 4HKTA 3ZV6A 4B4WA 1I01A 4BNXA 3GMDA 3UXYA 1DC5A 2NTJA 4FQ8A 2V6MA 4K6CA 5KJFA 4BNLA 1SBYA 1HSOA 4IJWA 2ZTMA 4YJFA 2NQ8A 5A3VA 3GK3A 1QR6A 2ZYAA 2Y0CA 3ONDA 2DTEA 1YL7A 2OOSA 1MFZA 4IXTA 3E18A 3KYCA 4OSPA 5FEUA 1Z7BA 3GDOA 1R12A 3UOGA 1SEVA 5JYDA 1LC0A 4A26A 1GEEA 1T25A 4UREA 4PLZA 2BI7A 1KIFA 2WD7B 2CSUA 4MP8A 2AG5A 1TA4A 3NAQA 3BMCA 3TQHA 2FMUA 1ZJZA 2C5EA 2VNAA 3BMNA 3C8MA 4ZVVA 3SXPA 2EF1A 5CAEA 3RUFA 4XZ3A 3WG9A 4DIFA 1EQ2A 4BO3A 1R0SA 4QUKA 4JGBA 3FNEA 1KVQA 2YFHA 4Y9DA 3AM3A 1I24A 3TNLA 4I8XA 4WOJA 1AN9A 4DIOA 4RPLA 3ZHYA 4YS2A 1T2DA 4W9NC 2X5KO 5G4KA 2IXAA 4CL3A 2AE1A 5H83A 3RFVA 3M1LA 5GZ1A 3ZWAA 2GPTA 2B83A 1PJBA 2FWMX 3GN2A 3I9MA 3WTCA 5U1PA 1QORA 5IAAA 1G0NA 5COAA 4B8ZA 2I9PA 2OO5A 2AQ8A 3GHYA 1NBOA 4WGGA 1NYTA 3S55A 4KTTE 3RU7A 7ADHA 2OL4A 1HEUA 1YH3A 1YL5A 2Y0EA 4BNKA 1ZMOA 4FFMA 5IZ4A 3T7CA 1Y8QA 4XQ9A 4CPDA 1BGVA 1IPEA 3C3XA 2DFVA 3GZNB 4CM3A 2D3TA 2WSBA 2VCYA 3F4LA 3PPIA 4LMRA 1O89A 4M87A 3AM5A 3AU8A 3GOHA 1GD1O 2VYND 4O63O 2Z1MA 3CTMA 3EZYA 4BHTA 3EHEA 2IZ0A 4OOEA 5CHEA 1N1GA 1NQ5A 3PJEA 3LT4A 1YRLA 3M2TA 1CYDA 1HLPA 3QWAA 4NPCA 3VZPA 2FSSA 3QY9A 3CZRA 4Y6PA 4OKNA 3WIDA 4H3VA 3DXFA 1XDWA 4D41A 4YR9A 3NDIA 4HBGA 3ETEA 1BXKA 2LDBA 2GO1A 2CVQA 1X7GA 1XGKA 1I3MA 4LVUA 1M76A 3PWSA 3UH1A 2YZ7A 4GSKA 4J1SA 2J8ZA 4AJIA 1S6YA 4IMPA 1T26A 1CWUA 4NFYA 3GDGA 1U28A 1JTVA 1FDUA 3OP4A 2CY0A 3OJFA 4D3SA 3H9UA 3PTZA 3LC1O 1UDBA 1BRMA 1DC4A 5JSFA 4K6FA 5B4UA 1DC6A 4DLLA 5CP8A 1E1MA 2B5VA 4LN1A 2CVOA 2BELA 3OEYA 4IQ0A 2JD1A 2Q2VA 3S8MA 1H6DA 1F0YA 4FJ1A 2PD3A 3PI7A 3I9NA 1B3RA 2EERA 3PDJA 3O9ZA 2PV7A 4UEOA 4E13A 1WPQA 3G1UA 2Y99A 3P19A 4I5DA 1MG0A 1ZEMA 3PXXA 1PS0A 4RORA 2BD0A 4NZ9A 4J90A 1B2LA 1GUFA
chains in the Genus database with same CATH superfamily
1JQBA 5A9SA 3E9DA 3D1LA 1JEAA 3EGXA 4FGSA 4WWSA 2B8PA 2K7JA 1RKVA 2DEUA 3AWIA 1VECA 4ONEA 3VZQA 3JCUH 2KW5A 3DUWA 7MHTA 4RNFA 4LF6B 3BCCE 4I7ZC 3L70G 4Y6GB 3KRTA 1C3OB 3S44A 1O57A 4L57A 2C59A 2O52A 3HL0A 1MU2B 4NWIA 2F7SA 4TY9A 3W34A 2EEZA 4NYJQ 4Z7CA 1ETHA 4MKAA 1A9XA 2ECFA 1GRNA 2ZIWB 4PC2A 5K3BA 3CB2A 1HR0B 2NYVA 2LV8A 4OQPA 5A4JA 1P61B 2JGJA 2H51B 4WIQA 5K0FA 4D8WA 1PS9A 1RWNA 5DP1A 3L7KA 2YTZA 4U02A 2CXUA 1J5OA 5GIOE 5E0KB 3BILA 4DR4J 3PNOA 1LK5A 4M76B 4IDFA 1BCCJ 2A9KA 4KIWA 1W4BA 2I80A 3GNQA 4ZDKA 1JH9A 5FBLB 4O1IA 3M8RA 4D3DA 3IR6A 1O5IA 3VC2A 1LI4A 1L1FA 1E89A 2D00A 3V4MA 1RPJA 4OTZA 3ZJYA 5H1YA 4EHHA 3KJFA 5EWGA 3SM9A 3C45A 3JQDA 1P2SA 4D43A 1UF9A 5BR8B 3OQVA 3EZXA 4FN5A 1QP8A 5AHRA 2XDYA 4R8RA 3RZAA 1ZQ9A 1ODFA 3WWPA 1ZMRA 5L3QB 3LM8A 1VLOA 4PWZA 2JCYA 2ZIVB 3QA9A 1JLHA 3C2QA 4N8EA 4WK6A 2AJ2A 4NLTA 5LD2C 1J1UA 3QGIA 1DKNA 4YRFA 5DDIP 3UB3A 1Z0DA 2NREA 2G88A 1GAJA 5ER9A 1N8KA 1KHWA 3NP7A 3QWPA 1RU3A 1SV5B 1Q7YQ 1DSSG 1Y3HA 4RGVA 4S0XA 1Y7TA 1PJ8A 1EIZA 2FFBA 2X8WA 4PO8A 1SRRA 2AGQA 1UBHS 1LRKA 1NKBA 3K5OA 3HI9A 1E2QA 1WMDA 4IOJA 5HZHA 3QVLA 2XI2A 1Z83A 3UC9A 2QK4A 3E8XA 3ITEA 3LHSA 4WFNQ 4LJYA 4IG9A 1RQ0A 4XAQA 4J94A 3G13A 3C6ZA 2QRZA 3L79A 4G0VA 4O3QA 1NVXQ 3K8ZA 2R42A 4FR2A 1YBMA 3POTB 2WJIA 1R8XA 2ALZA 2AZMA 2Z3ZA 3QGPA 3KZXA 2QEXS 3SU8A 3NWEA 2Z8XA 2QN1A 3HNRA 1TKXB 2BANB 4Q05A 4CMBA 4C4WA 1RYMA 2KS1B 4JA2A 2I38A 3G0CA 1LTJB 2R8PA 4GOFA 5FI3A 4PLHA 4I4CA 1WO8A 3G0GA 3I53A 4RKQA 4C2AA 2QN2A 1U0FA 4WBAA 3VOAA 3EQ2A 1GQRA 1M2JA 1SQBD 1O77A 1ACJA 1OFUX 4INPA 1MD9A 1E6YB 2BGGA 1E4YA 3OJOA 3UN2A 4C9BA 2GRUA 3KYQA 2QRVA 1YF3A 1EFVB 3TFOA 4P98A 4LQ4A 2B56A 4OL0A 3S2FA 3I6BA 4OIFA 5FD8A 1VQNS 1CZRA 1Q8IA 1YQ4C 3SP1A 3PNQA 1CJTA 1CSEE 1ZEJA 4L22A 2CD9A 3EVZA 1QZ3A 1K08A 2ORVA 1O94C 4AS1A 2OP0A 1QQ5A 4B9UA 1AW0A 3U4DA 3UAZA 3C14B 1EETB 2VF4X 4EAAA 1UVKA 3AEAC 4FF1A 5E1MA 4IJUA 2QVYX 1KZ6A 4X66F 1UEXC 4PEVA 3IAEA 4KBIA 3MGNA 4HJGH 1L2PA 2OHHA 3BWEA 1EDLA 2ID8A 3K2YA 1GILA 4HLUC 3VYSB 4A2PA 3UDLA 3Q8PB 2GEVA 4BMVA 2UV8G 3OTOF 4K4SA 2VASA 3BMNB 5FYQA 3T54A 2XXAB 4BN4A 5B57C 2AW5A 3PEWA 3DDCA 3IILA 4ZMSA 4ZT6A 2ZUVA 1CSJA 1TFRA 3FJ1A 3GAFA 2WYWA 4ALMA 2OHXA 1X1BA 3PC8C 5EJ5A 2P4QA 4EHBA 1QB7A 4PLVA 4L78A 3C4JA 4K40A 4E7PA 3A12A 4GX1A 3UPFA 2D0PB 3NONA 3ZDYB 1TM2A 1VMBA 2GYVA 3EXIB 1QGED 5AK3A 5HK4A 4O4JA 3JQQA 2IC3A 3KFLA 1TELA 4OGKA 4MS3B 2WITA 1VQYA 1GPKA 1OAAA 4DR2F 1ML4A 2MZTA 1TLLA 3HRHA 3K9FC 1AE1A 4UU1A 3KL2A 4IV5A 3C43A 4GYYA 5H70A 2Q46A 3IN6A 3CZMA 2NQPA 4XM2A 4WRRA 4ZZ0A 5J58A 5CT9A 4BLVA 1GZ7A 1N5TA 5J1NA 4K9DA 3C41J 4JHLA 3EXIA 2JRSA 3HLTA 2EARA 4S24A 2PG3A 5EYPA 1Z0JA 2ACYA 1OREA 2OSBA 1SQGA 3TVDA 4AY5A 1U1QA 4POAA 3BJEA 2DIVA 4DPTA 1VMKA 2FHPA 3Q8MA 1QQ6A 3TKYA 2E5WA 4HDQB 2C8JA 3A9UA 1QX8A 1RTZA 3HP6A 1LWCA 3HYNA 1C5KA 1WHWA 1NJFA 3TVTA 1XXLA 3HB1A 1E8NA 4LWPA 3NFQA 2IHVA 3S27A 1USUA 1DAMA 5FYDA 3O4HA 2CUTA 2XDQA 1NTMK 3WIVA 3FWNA 2IOYA 3LHIA 2MDTA 1ZOOA 1F2GA 5K20B 3W5HA 1PFUA 4IL6H 4XYMA 3ILHA 2HZAA 1QWSA 2VXCA 3C6QA 2FSFA 3CZ9A 3UD4P 1Z47A 3TSIA 3U81A 4P7TA 3SR4A 4WESB 4LF9B 3V2HA 2C2KB 1ZMBA 4ERNA 1CNMA 1AN0A 1KOOA 1UXGA 4KPGA 5IKXA 1RXYA 2L41A 1AUXA 2IYUA 3HXOA 2PC6A 2E18A 3MJDA 4RTRA 5E2QA 3N5BA 1FVOA 3AE6C 5ULLA 1YRWA 3AF4A 1UDCA 5B4TA 3Q12A 3CD6P 2W6PA 1HR0J 1WLYA 1S8OA 4EWTA 2EQ5A 1WTBA 4ZK7M 2JJ1A 1OYYA 1KHHA 2HR1A 3ETCA 2OZLB 2L82A 2M6KA 3LWBA 1FE6A 3H25A 2Z98A 4DS3A 4JI4B 3BEDA 3JAWA 3HJGA 3VBEA 3TYTA 3RK4A 3MG9A 1T8RA 4HDNA 2O7NA 4GLJA 2BDPA 5JR3A 1DCMA 2I2CA 5JW6A 1Y4ZB 4LIWA 4Y65A 3VR3A 4EM6A 2ONYA 5L6LB 4YRSA 1B8UA 2K6GA 4OI2A 3EVGA 5IXSA 1H38A 3KLNA 3WYEA 5IWAB 4ANEA 3OSUA 3AEQA 2EIXA 1EARA 1E0KA 5T7LB 1P1JA 1FX4A 4LBIA 1V3ZA 4DCTA 3SAJA 1JLGA 4ECXA 3IJRA 4R1SA 4KQCA 3TZ6A 2FRDC 4ZTUB 4EH1A 1JA1A 2VJBA 4C05A 1K73T 3FYDA 4IX9A 2X15A 4BMOB 5DLEA 2UU9F 1KL7A 1FXWF 2WJ6A 1XNRB 4DT1A 3PU6A 4KGDA 4A6PA 2FXOA 2HU5A 2XT6A 3Q1LA 2E2WA 3QMMA 3IWLA 1GZHB 2VDIA 3D67A 3R4CA 1M6HA 4LK2A 1IDOA 2I2YA 3JVEA 1FNMA 4K88A 4NYOA 4B9VA 3MEGA 1Q84A 3VR6D 3VOSA 2L48A 1BIFA 4UM9B 3SQDA 2GVDA 1A5TA 5CFQA 2GPAA 4ZDIA 1Q0PA 2OD7A 1PGJA 3D5MA 1DIPA 2P9YA 1GT91 3JQEA 2FJBB 4BEJA 3RIXA 4DV1F 2XHEA 3PNIA 1S3SA 3N87A 5KLVJ 4KRXA 3K59A 1HJBA 2YQ0A 4ENOA 3FZYA 3I04A 4YCBA 1KH2A 1A1VA 1K63A 2XRMA 1S77D 2PX2A 4Y99B 1T9AA 3L70D 3W1EA 4DSKA 2QTTA 1TRKA 5HCUA 3ES9A 4WY5A 1Q78A 1JEOA 1S0VA 1Z4JA 2G77B 3ZWDA 2MKKA 4FFRA 1F5AA 2CZVC 2C07A 2LD4A 4F2GA 3JQ9A 1T43A 3D3EA 2EZTA 3PX4A 2UVUA 3T7KA 4YYEA 1MNAA 4HTFA 1SXHA 4AMUA 4RV4A 1Y3BE 1KFEB 3UGQA 2RT3A 1V1RB 3U4HA 1EA7A 1TNDA 1LTTC 5DGTA 3UMMA 2LQ9A 2G76A 4ICLB 4IHJB 5JAOA 3JYOA 4V0LA 1SNYA 2E76B 1YMVA 3K9CA 3F7MA 4ANDA 3CJKA 3A3PB 3ZPXA 1NGSA 3BV8A 5F5NA 4GMXA 1D07A 1L2TA 2QR2A 3KKNA 5ALPA 3K1ZA 4LFAJ 5JBQA 5AM1A 3COSA 4EYQA 1YSJA 1TCVA 1SU4A 4KZPA 2P67A 4K0KJ 4GC7A 3HA5A 1M2NA 3ZCRA 2FE4A 3S7ZA 2W2MA 4XJTA 3ONVA 1KMMA 4DUPA 3D0OA 3PDHA 3O8OB 1LBEA 3EF1A 4JNCA 3QU2A 3QVJA 4CMIB 1LWXA 2GK6A 3J81A 2Z6AA 1REQA 1HYBA 1EK0A 2WVFA 1YRHA 1WOOA 1JFTA 3CWCA 5KVAA 3I5AA 1GDTA 1FFSB 1Z22A 4WY8A 2F5GA 5F33A 2PAJA 3T5KA 4LE0A 3KPVA 3EA4A 3O7MA 2IBSA 3HJVA 3M4XA 2P9FA 5SZIA 2HXGA 1EGVB 3THWA 3D2LA 2ZYIA 1WMFA 4X93A 3EGOA 3CKLA 4WD3A 3TEHB 4TKMA 4UVHA 3FCYA 3U59A 1N73A 4BVBA 3FYUB 1USEA 1YQ3C 7AT1B 1J5PA 2VH7A 1A71A 4BEVA 2NYUA 2ZI9A 2HHAA 3IOYA 4A36A 1T9KA 5TQVA 1VP9A 2ZSKA 1U0NA 1FDNA 4UMDA 1RTHB 5CBOA 5AKHA 1GQSA 4B3MJ 2JDID 3DLIA 1GPAA 2G9ZA 4ALIA 2XITA 3FWHA 4KH1A 1RJEA 5DCWA 2QTLA 4HXFB 4D46A 2XX3A 3EQ9A 4QODA 2LXNA 1KQFA 4LRTB 3JQMA 3FETA 3GR1A 3O8BA 3V3TA 3SDSA 5CH8A 4L4UA 1TKZA 4R4MA 2IE0A 2PJUA 3H7AA 1LI7A 3IB6A 1E1YA 5ISMA 4NBNA 2Q07A 2H5JA 2R1VB 3NGLA 1PAEX 3IAS6 4UEJA 3HO1A 4XCXA 1Z2EA 2Y05A 1I30A 1NU1J 2RH8A 2ZZKA 1CVIA 2J3MA 3ESDA 1DG3A 1Y7LA 2IYQA 4PXCA 1UAWA 4O2RA 2AT1A 2ZSIA 3TW0A 3LP8A 2FZCA 2HHTA 1GK6A 4ZMDA 4DXAA 1T2FA 3OTDA 4DMGA 4DJJA 4M3LA 2E76C 5A0FA 3OA0A 3QVUA 3PHJA 1HZZC 1PZMA 1IZ8A 1RF1B 4OGQB 1TTPB 2X8JA 3RABA 3NASA 1YZ6A 4J0QA 3SJCA 4JJEA 3DE4X 1IXZA 3KXIA 5DG9A 1SAYA 3BXFA 4XIJA 1ABFA 1ZPWX 1XA3A 3IAXA 4QUAA 3QIAA 1JY3O 4NU5A 2FFRA 1SIWA 1Y00A 3FLBA 2W8LA 2DO4A 5BYJA 4AS3A 2OCGA 2H51A 1ICIA 1THTA 5EESA 5HBMB 1K9MQ 4WK0B 5KKCA 3IQZA 1ODLA 5LXTF 5AW5B 2PD4A 2PGLA 5K0CA 4C7NA 2RHCA 1XN1A 5TS3A 1SUIA 3HV2A 3RPEA 1WHTA 3TZZA 4NBUA 2XG8A 4Z86A 4DA7A 1FESA 2P1JA 3ZDXB 3FQKA 1XRLA 1KC8T 4JFAA 1DOAA 5HZMA 1RFLA 3BSOA 3NOOA 4HVLA 3FOEC 1X79B 3VAZA 2C0XA 1GA4A 1IY1A 3B2NA 4M21A 3ANXA 4C7RA 1ZCAA 3G0BA 2CFRA 3HHDA 1LC3A 2WF6A 3CN7A 3WC2A 5K3FB 3EULA 1R0YA 4X54A 1CEYA 3U3ZA 3AR7A 3U4QA 4YCCA 3HD1A 1RTJB 2MEWA 1KJNA 1LD3A 4CR6A 1A7AA 1LDYA 1XVLA 3JQ7A 4JC5A 1A98A 5LMUF 4K4UA 1SXJA 4R0NA 1N32B 2AEEA 3DEJA 3DVAB 3BA1A 3WGQA 3M2VA 1FZGA 4MRRA 3EGIA 2XCIA 1RT4B 4BQNA 2C9CA 1G8JA 3JYLA 2JK0A 4B4OA 3SR3A 4EI9A 1GZUA 1XTJA 4OPMA 1NTKG 3HD7A 2CJYB 4HB4A 3PG5A 1D8TA 2DCMA 2FHOB 3OA7A 2Q6TA 3WXMA 3T9ZA 2PMFA 1I7PA 3R9IA 3ZJ5A 1TUGA 4BFWA 2QM7A 2Z4RA 2J7PA 1CJUA 1V5IB 5C8YB 4Q3NA 1A6LA 1K1QA 5CDGA 1P1KA 2IIPA 4LTDA 4USTA 3QZUA 2XD4A 4TN2A 1G3QA 3KZMA 2HHSA 2WAQD 6YASA 1SQQK 5CLHA 1KB9D 5A7HA 2BFNA 4CG0A 5DGAA 3ZBPA 4AWXA 2ZB8A 4E94A 4QIGA 1FKPA 1SHKA 1NXOA 2F00A 2ODQA 2NV2B 2DNYA 3WADA 4DR6J 4M0FA 1WBBA 1CC8A 4KAIA 1YXMA 1UWCA 1JJIA 4DJBA 1MU0A 4CTJA 3PIIA 4RZ3A 3ZZ0A 4PS0A 1O51A 1E2HA 2H54A 5FPSA 2EV9A 2J07A 3D8UA 5B1SA 5EIWA 2W4MA 3VNVA 2RJNA 4BLPA 2D74B 4C0AC 2I6TA 3LC7O 1UPTA 3VYRB 1SVFA 5KKZB 3ZIAA 2HBQA 3GCXP 1SUFA 4B79A 4Q43A 4MV4A 3D4JA 4LISA 2YXBA 4M5DB 5DNUA 4V1CI 5KTKA 3DDIA 1VE5A 3ICOA 4X1OA 3UENA 4WFAQ 3CDAA 2QLBB 2XBUA 3BWVA 1UMBB 5CFZA 1WY5A 1OSCA 1J0EA 2AOVA 5CTJA 3BULA 1HL6A 3HUDA 1P3JA 2ZRMA 3B38A 1C0TB 4Q9NA 4FCWA 2N1TD 4OZ3A 2KH9A 4GBED 1T34A 2EDCA 3LHFA 4D1YA 2AIRB 2ZK7A 1C1XB 1HDGO 3A3YA 1NHVA 4DZDA 1RNLA 4LF7B 1FRHA 5BWMA 1R8CA 1P6TA 1B7FA 3IT3A 5FWDA 3CJTA 2G28A 2ZVNB 4PQUA 3JQ7B 2O7QA 5CHCB 3L1UA 5A2QU 2JVOA 4NCHA 4NZMA 4CYUA 4HB3A 3O8WA 4LF9J 1R64A 4ZVSB 5TV2A 1V8DA 3CHYA 1W7AA 1KZ4A 2CMHA 4Q1BA 5H2FE 2FKWB 1N5LA 4HWRA 1E5QA 2OHDA 2VPIA 1ZJ4A 3O31A 5TXGA 4TROA 3MCVA 4RKUJ 3U4AA 1FHTA 4NXNJ 2YV4A 5JCOC 4BVGA 4UPVA 4HNAB 3ZUGA 4ZOCA 2KSEA 4DLXA 4AT1A 3HE3A 1S7HA 3A2KA 1U1FA 2O1JA 4KYIB 4P6VF 4AULA 1X5OA 2VDWB 1PZXA 1Z5OA 3C3WA 4IGFA 1CIVA 2WJGA 3R7FA 4LR7A 5FLKA 2XXJA 1MMDA 1M33A 3KLIB 2OAEA 4WZQA 3FSGD 2BGTA 5A7GA 3NNDA 2RHTA 3HZOA 1Y63A 4MWSA 3COJA 1Q2NA 3PT9A 3AYZB 3BMQB 1DQPA 2ZHAA 4IFDK 1P1FA 1OE0A 4MLDA 5HMXA 1Z0FA 2O8DA 2ZJ8A 3AESB 5EIOA 4KPCA 1VIVA 2Q6CA 1ZC4A 3CX4A 3OZTA 1LKZA 1LX6A 2YQ4A 1U0SY 3P2EA 4BRYB 1MC5A 5H59A 4O3OA 2D41A 4WPGA 2V59A 5JG7A 2DY0A 4DIBA 2I8LA 4WOKA 3KK1A 4LX8A 4WKRA 1TP7A 1GZDA 2BA9A 2BM9A 2V9CA 3U80A 1QVFO 3DLEA 1L7XA 2W2MP 4QWCA 1ZTWA 2HMAA 3N0TA 3A1DA 1DTSA 2F9FA 4CKEB 1ZW0A 2ZRDA 4I1RA 5AVXA 3EFFK 3VR5A 1KK2A 3CUUA 1Z56A 1WD7A 1NVUQ 4IRKA 2IXAA 3IJ5A 3GJZA 4U8HA 2B83A 4NOKA 4M22A 3WTCA 1V9SA 2I9PA 4B6FA 3L7NA 4YCMA 5HM6A 1LPNA 5BOSB 2FCRA 2QN6A 4P7JA 3T7CA 4EQZA 2QT1A 1YRXA 1JLQA 3AINA 2H54B 2WSBA 2PR7A 3FNBA 1O89A 1UPAA 4K3UA 1QE1A 2Z1MA 1YMQA 4BHTA 2F3UA 3HJFA 4ID8A 1N1GA 3G2PA 5BSVA 3SYLA 3IO1A 3KHKA 3VAIA 2UYQA 4RGQA 3BIJA 3PFHA 3LQRA 1I9CA 3CZRA 2N4DA 2YMLA 1PYOA 4URXR 2ZJ3A 3SWFA 5EWMA 1L4AB 2F55A 3QSYB 1OXMA 1AKQA 1RWVA 3ZR4B 2PZBA 5K8OA 1GGVA 1JTVA 2PUTA 2W7OA 1DC4A 5C51B 1U6JA 3T1AA 3PC3A 1Z4OA 3C15A 2EERA 2QJFA 4F7WA 3FMGA 2MMGA 2UU9J 3I32A 2OQRA 1O9GA 3P27A 1B2LA 3I56S 4DX8H 3BFXA 2PFFB 3AI1A 1NYRA 4NMWA 2LDXA 3M8PA 5KFSA 3POTA 4M46A 2JAXA 2C83A 3VAFA 1H8HD 3KQTA 1G9TA 1FP2A 3NOQA 1QUEA 3BGVA 2J6CA 2ZJYA 4NPAA 4REMA 3HKDA 2GEFA 1QRTA 5FLXA 4BWYA 5F8GA 4RNMA 2VQ6A 1WF3A 2WD9A 3OZRA 1H8AA 3H1HE 2G13A 2QL5B 4NFLA 4F4JA 2ERRA 4HVAA 1L5UA 2RSQA 1J27A 3N2LA 4ND2A 4DLYA 4RUKA 5C53B 2CFIA 3LF0A 4CF6A 1WORA 1BH2A 3NAGA 3RTVA 1MORA 3VC1A 4C3UA 1IBKB 1Y1SA 1I32A 2E87A 3V8PA 5K9ZA 3BE8A 3A11A 1YHQP 4J0IA 3HX9A 3R3UA 1AHIA 5AM0A 1JB0J 2X7HA 4YPVA 3VHRA 3TBKA 4OU4A 4E2FA 1FLVA 2JBHA 1ILWA 2P5YA 4YRRA 1LW6E 4JBHA 2KBEA 4MVJD 4X8MA 2YHUA 5K4GA 3MILA 1L4AA 3QWIA 1JR6A 1SIZA 5ALEA 2O1XA 3Q11A 2BKAA 2PSHA 5A5FA 1QAIA 4XWTA 5DP2A 1ULRA 3QOXA 4D44A 1OI3A 3MWEA 2NV0A 2Z6VA 1VQLP 2X5OA 1CF2O 3OZXA 4J0EA 4KC5A 3AUTA 1IG3A 5H81A 2QRVB 1QDUB 5C80A 5HANA 2X6TA 1E1DA 4CM9D 4BLUA 3O6QB 1EP1B 3JQAB 4DOJA 4XWWA 1ADYA 5CYPA 3Q8RB 3G6XA 4L2IB 3FSEA 2IU3A 3TX2A 3VSAA 2G0AA 2GM4A 1PCXA 3QENA 1VA5A 4XPEA 1P73A 2WFAA 4JYAJ 2F1HA 2CADA 2YCLA 4IG0A 4AF6A 1VLVA 5EQJB 4HRVA 2YVKA 1KIAA 1JB0C 1RY3A 4G4SP 5DMHA 2GM9A 2G5GX 3PL1A 1I3LA 4OV6B 3R0ZA 2O2IA 2XH8A 4IICA 1T02A 5J40A 2IYNA 5FUBA 4MV8A 3QU7A 5TF0A 5I42A 4DRXA 1S2NA 1RWOB 3Q8VA 2ZRLA 1ZOSA 2ZWPA 1MV5A 4TYQA 2PZ8A 2ZYRA 3M6MD 4DCUA 2P9TA 1T36A 3RVNA 2X0DA 3TLYA 1MOQA 1MBZA 1C81A 3IV6A 5HM8A 1N6LA 2F4VJ 1EDOA 4X4RA 4TYWA 4FT4A 4KWHA 1UAGA 3GI1A 3HHEA 4ZVLA 4H4KC 4KQHA 4UU0A 3T3MB 1D9FA 2QX8A 2B2CA 1HD0A 3IHWA 3VU9B 3OLZA 2H4WB 5BNFA 4DNFA 5A3JA 5CW2A 1Q20A 4BLWA 4LOAA 4QLBA 2RHHA 4M94A 4QMAA 1K0UA 2WPRA 3K30A 1Z7WA 4YIHA 4ENTA 1SKWA 4MMXB 4LWQA 4AY2A 4DX7A 2AG1A 3G79A 1TQLA 1P2GA 4OHUA 1NTRA 3N0RA 2IBKA 2P4EA 3QA3E 2YN2A 4ES2A 3IL2A 4YMUA 2BKNA 3R7BA 1WTFA 2OEMA 3PD0A 5C52B 4MTPA 5EXXA 3F5SA 1UZLA 1D9DA 3KDSE 1P9RA 4Q01A 1RE0A 5AE1A 4UAGA 4MR9A 3BL6A 2WWTA 1C7ZA 2CV2A 1IXKA 3NEJA 2CLLB 3KK2B 5ITZB 2R8ZA 3NWPA 1YRQA 2JEOA 1M6YA 1Y3JA 4GXRA 1G2QA 3H8YA 1K7FB 5J2PB 2AD5A 2WVRA 5IFLA 1I36A 1KQLA 8ATCB 3A32A 3IPRA 1IKVA 1QEXA 1OXBB 4OA8A 4U67Q 3AETA 1E5LA 3ICQB 1KI6A 4DJ5X 2G67A 5EIEA 1QTIA 1RF0C 2DNRA 4QIWD 1PT9A 1VSBA 1YIOA 2QNRA 4I64A 4DCVA 10MHA 2XUAA 5T3UA 1XTTA 2B82A 1W5SA 4L72B 3VAMA 2QUAA 2FZEA 2BH2A 4BC9A 3IEIA 2XEDA 3WGHA 2QXUA 2FEMA 4DE5A 3AK4A 1F5BA 5EMLA 4YR7A 4YUYA 3R0JA 4M8NE 3WGVA 4ZGBA 3OTHA 3EIHA 3SJBA 4F92B 3FYUA 1C30A 4KODA 5ALMA 2OHJA 4G4SO 9RUBA 4WCFA 1P84E 3CRMA 2ZYVX 2J3LA 2EXUA 3JYTB 3RS8A 3L09A 1RPTA 3IDOA 4ER8A 3P9NA 4NCBA 2Q5JA 4DDVA 4Z4CA 3ENZA 1FFDA 3ZXYA 1NP7A 1Z5ZA 1DXQA 2X22A 4DV0F 3SNHA 1BQNB 2QGFA 1Z7EA 1U99A 4QASA 4IOIH 1R3DA 1P1TA 2AMFA 2B5JA 3I30X 4DQKA 1HFWA 3I31A 4DSEA 3KPYA 4Q3LA 5E6UB 2XBPA 1NWHA 3H86A 5E1BA 5JEEA 2DO0A 3NEAA 3GRPA 4BS9A 1PG5A 4UBLA 1RRMA 1HBMA 1T0JB 3HH8A 3HYLA 4BB6A 1QGZA 3OJLA 4NRUA 3W5JA 4RPGA 4UE2A 3NCTA 2QFJA 4C7OA 2QLLA 3P20A 4EHNA 3B6ZA 1SB9A 3UWDA 5BR4A 5EJ4A 3H75A 1L8OA 1P75A 3V3KA 4DNPA 5DDPC 2VKTA 1S0MA 3FPJA 3RS2A 2WQZA 1UOOA 4WZ6A 3A3PA 3L71D 2FPSA 1OZAA 8RUCA 4ZODA 1GTVA 2RE8A 3I92A 1MLAA 3R4YA 1SBNE 1UBRS 2I99A 5IK2A 3VVUA 2CT8A 2EG5A 3A3YB 4EG8A 2VWGA 1B0TA 1GK8A 2GEUA 2HQGA 2BQRA 4HXYA 2BFCB 3FUUA 3R9XA 3A7DA 4FINA 2HPHA 3OSZA 3E9NA 2YNIB 1A04A 3DMJB 2DPXA 2QLJB 4PZCA 1JQJC 2P3LA 2UVVA 3AEBC 3W8RA 4IIDA 2IUYA 2B4VA 2H5JB 3H6KA 3NFRA 2GF9A 2GBPA 4EOGA 4QFMA 1UK6A 1LWUB 2RMZA 1ZH8A 4HAVA 2HMTA 2V03A 3SY8A 2RKIB 3HNOA 5GOTA 1KY2A 3BAZA 3BICA 2A35A 3WGMA 1Q8LA 4Z7JA 3NYIA 1EZ4A 3CBQA 4N8DA 3THVA 4KZKA 4OG2A 4UZSA 1FQWA 3IA2A 1QONA 3NRCA 2Q3MA 1ZISA 4OMUA 1CJMA 3WC0A 4HNHA 1NXTA 2MHCA 1PZQA 1M56D 1HWTC 3QNMA 4DLZA 5IVPA 4NXMJ 3RU0A 3LO3A 1DDGA 2HXSA 1FFXB 3MM4A 3B5ND 5A5DA 3KOUA 1FTGA 3U5TA 2EW8A 3ROMA 3BFJA 3DMTA 2IBZD 4J07A 2UUBJ 3IAS9 2HIGA 4GIFA 4ZV9A 3IVCA 2XQKA 1LTGC 4HH1A 3BMOB 4ZI7A 3QI2A 3P9ZA 3I39X 1EPUA 3GFBA 2UUBB 4GR9A 4TY8A 5KOXA 5KFXA 1S8NA 3H1BA 4DR4B 1ECBA 1Z5UA 4Q7KA 1T8ZA 3CCVS 1EFRD 2J0WA 4TSKA 3D1QA 4ZVFA 4L95C 3BO3A 2YNMD 2KB2A 3BC1A 3L06A 4NLGA 3MF5A 3TIIA 3B5IA 5K8MA 2SXLA 4RHXA 3NNHA 3NGDA 4BBPA 4HC4A 1HG1A 4I7FA 3LY9A 4UTVA 2W9BB 1PAUB 4PXBA 4P3NA 4I50B 5HP1A 1JTEA 1UXIA 2QA5A 4F36A 1NTME 1HHTP 1NU1D 3D7KA 4XCQA 2IRYA 5ETSA 1SKUB 3RFCA 2Z6QA 3UFCX 3H1JJ 4OZ1A 3SX0A 2UUTA 4AF8A 1QHXA 4ELVA 3GFGA 3TARA 1V3TA 4N41A 3G85A 2F67A 2D1FA 4PLTA 2XULA 5J2PA 2CQ4A 3NBPB 4EB3A 1BDMA 4A8JA 3D71A 2VJCA 2X3GA 2C96A 3LL7A 1FJGF 2D5LA 4P36A 3GELA 4TUYA 2J9GA 4A8OA 2CXEA 2CYAA 2WTFA 3Q7IA 3M0DC 1WXXA 1PQUA 1GL2B 1UP1A 4IDAA 1FJPA 1CVJA 3L0CA 2PM8A 5KYYB 4Q4AA 1O6GA 3DTVA 4EB6A 3L3CA 2G1DA 2IYSA 4C04A 1EHIA 1L0LG 2L3MA 1GEGA 1NAHA 1TL3B 1T35A 3LF2A 4DCNA 3KK0A 2IYXA 2VHVA 2GQCA 3R7AA 2QVZX 3OCUA 2PMCA 1XZKA 5BNWA 1YU9A 1DIRA 3CR8A 4FS8A 3M0DA 1KFDA 1J97A 1ATIA 2IKQA 4UUPA 2AN3A 2WAAA 5I7HA 2IS2A 4G0QA 3OESA 1JLEB 2E9ZA 2VPQA 5C24B 2OTCA 1USIA 4X85A 1AK9A 2AQKA 4YBRA 2WIGA 3TNFA 3C15B 3MM6B 4RNHA 3A4VA 1VE7A 1LT9A 3TCKA 1XA4A 1VBZA 5BXQC 3QEKA 2XVAA 3ZDEA 2JLWA 3HBJA 4EKIA 4LRCA 3QRWA 4J0DA 3WHPA 4PEOA 1N2SA 2DX7A 1U94A 4G37A 1L5VA 2UVRA 4UB8E 4A8KA 1AKRA 1SQ6A 3E1KA 2H29A 3UCXA 3AW8A 2RH0A 4ZEXA 3USZA 1L4BA 3KLGB 4H1UA 1YTZI 4B3XA 4Z7YA 1DWPA 2OFFA 5B1DA 2DHSA 2JX2A 4LY6A 3H5IA 5I3QA 5DHQA 2ZIXB 1KQOA 2OSVA 4CLUA 4NECA 5LU8A 2PSEA 4O4LA 4O3MA 4R1UA 1Q3KA 3LTOA 3R5FA 5D3GB 1RAJA 2OP5A 2JJ2A 4HQKA 1R6XA 2VHCA 4RX1A 3NYWA 2MR5A 1MJFA 1E7WA 3LQ4A 5APVA 3K5MA 1U81A 1N32J 5REQA 3UMRA 1SUSA 3BMQA 1NG1A 2V0NA 5TNXA 4B86A 1F1BA 4P53A 2W6IA 2POHA 3IAS1 2JFXA 5TVGA 4RA9A 1A7GE 2IQIA 1W5CE 4YIKA 1HNWB 2XBMA 3NHLA 3F98A 4JDPA 4HYEA 1Q21A 1GY8A 1LDBA 2R8JA 2P40A 3B52X 3EAFA 3BK7A 1PJZA 3FOWA 1L7PA 1WEKA 1L3KA 3LP6A 4UTPA 2I4LA 4UXHA 1ZH4A 3GZTB 1I4WA 2HX1A 1ENOA 5AESA 1HSZA 3YASA 5KJ7A 4ZAVA 4ETNA 5KU7A 2F3QA 4DDMA 4NCIA 5LJ3Y 2KJVA 4IFVA 5B66E 4OYAA 3SQGB 1X1EA 4ECSA 4O2AA 4UT4A 2W2KA 5EINA 2LBPA 1NMEB 4B3SB 2VLIA 2FSVC 4CM8A 5EGYA 4B75A 1HQEB 3PFEA 4ZK2A 2FFDB 1MQ9A 3VPSA 3MMSA 4DSOA 3PLNA 3EC1A 2WWYA 3VTFA 2WHYA 5AVOA 1IATA 5C5DA 1J8VA 1DPFA 4NS4A 1XR3A 4GVXA 2GBLA 1L0NJ 1FIUA 4M8IA 1KBQA 1TQ2A 4OHVA 4GF5A 2D0OB 3JQPA 2BJ7A 1QAYA 2H4HA 4PJ0E 1HOTA 4U9UA 4GPAA 3W5IA 2V68A 3DMDA 2W42A 2JEZA 5SZKB 2GA9A 3NR2A 3GGDA 1JHAA 4ES6A 5I7RA 1C0TA 1DZ5A 4TV9F 1NXQA 3AVUA 1CUCA 2IYTA 2PLAA 4ZV7A 2FB9A 1A8HA 4QHTA 2B7BB 2V45A 4Z53A 2CN1A 1YZFA 2A78A 2Q62A 3SR0A 3DEFA 4OM8A 3V55A 1E2EA 2EBWA 1C41A 3KJNB 2J6IA 1TK3A 3G4SP 1QYWA 4HKZH 1MDBA 2Z30B 3ILSA 2D2VA 2GSDA 4H17A 1OT3A 1YBKA 3MD0A 3IXMA 4DPOA 3D6NB 1MENA 5TEVA 2VQSA 2WSCC 3KAKA 4K2HA 1DDOA 3ZGZA 4C6RA 1OSNA 4DG8A 2GILA 5CBPA 2NU8A 4FHCA 2J08A 4LFBB 2ZJQQ 2IK8A 1JIHA 1N5KA 2WLTA 5FBVB 1VGRA 3RRGA 4YRGA 3MMNA 3RLFA 4DSAA 2ZDPA 3MJVA 2UXCJ 4RF4A 3K8WA 4G26A 1H7XA 3FCUB 1Y6RA 3QBCA 1C1DB 5C34B 2IY7A 3CIFA 1QFMA 2ZOMA 4B6JA 3A25A 2OECA 3U6KA 2C5HA 3VOTA 3SE7A 4LF8J 1PEYA 3VDNB 3QIPB 1Y6QA 5IKPA 2DPJA 4NCNA 3FYUC 1UH5A 4DRYA 1VLMA 2OC4A 5HHTA 3ST7A 1PGNA 2I4RA 4NX9A 1RWKA 1BN6A 5FTLA 4FDUA 1B15A 3NL0A 5CNJA 1DJPA 3B1FA 4KR9A 4GI5A 4WE1B 1RISA 4KT0J 4FPIA 5EUCA 4HFNA 4V19X 1FP1D 5ETMA 1SXQA 4DCSA 2V4MA 1XMIA 3O5AA 5EMMA 2UZ1B 3VZDA 3OPXA 3QIPA 4I2VA 3SQGA 4JLAA 4YRZA 2Z2ZA 4P71A 3MEDB 1T5SA 4WUTA 4XVHA 4NCKA 4CUJA 1JQ5A 3AXKA 4DILA 2FPPB 3HD7C 4DBQA 4C20A 3H5XA 4BY9E 4X7PA 5CB0A 1YV9A 1RFGE 3N4WA 2QTAA 4OBXA 4MKHA 3VPBA 1UWAA 1BQEA 5U9CA 2Q5HA 2RFLA 1MJ5A 2AQ4A 4URWR 3U0BA 4GMDA 5FULA 1I3NA 2C2MA 4KMMA 1RJFA 4D6PA 1B14A 2HMUA 2QVGA 5EHGA 3E01A 3OJEA 2BDUA 4Q2LA 1XZEA 3ZCTA 4DHVA 3GFSA 4W98A 1EVEA 1E6VA 3U1AA 1S1WB 5I3UB 1KYOI 2Q99A 4R16A 1AZWA 3B6KA 3QYPA 1ZTTA 2QLXA 3H1LJ 4IFVB 4DV7J 2I65A 3WLRA 1C0PA 2CDAA 5DWQA 1PNRA 3BRQA 3RK2D 4B3GA 4OX6A 4HMQA 3OSNA 1NJSA 2OV2A 3IEPA 3LP2B 4XEHA 1HJ0A 2XGQA 4JYPA 1WB5A 1M7GA 1OY9A 4BMNA 3BGOP 3NGKA 2ZU0C 2GN2A 1V7CA 5CURA 5KBYA 3LS2A 5TISE 1KV4A 1XMOJ 2QNBA 4GAEA 4K35A 3R20A 3ZDAA 1NDPA 2IV7A 1FJEB 3MJSA 2ZDHA 2VAPA 2KFYA 2Z2KA 3RT9A 1ZVJA 1B0VA 2HSWA 1S0UA 4U3JA 1N2ZA 3GYXB 2ZR9A 4IG0B 4ZOLB 4O08A 2Y9HA 2KXNB 3T0GA 3L73D 2Q3HA 4XYBA 4YI3A 3EWIA 2C2BA 4XIGS 3U4CA 5JPCA 1YA6A 2MZSA 2ZBCA 3VKUA 2QLWA 2BBOA 2ZWVA 3VFDA 3V4ZA 3Q8UA 1Z4LA 4E51A 3VN0A 1Y5NA 4RADA 3JQCA 4L74A 1ZUWA 2IZ5A 3A6KA 4FPRA 3DZKA 1RRCA 2WZ1A 4DG1A 1UFVA 1CUYA 2ASEA 1BXGA 2HHHB 2IYZA 4FYIA 1RWMB 2HIHA 3HU3A 1QIGA 2P62A 1WI8A 5HF8A 2WQ7A 4X91A 4PRFA 4DOZA 4D9HA 3SPXA 5CYMA 2VUSA 3NQ41 5E3QA 3KOZA 4FFBA 4C6TA 4MK8A 4D0LB 1A5BB 2J8AA 4O23A 3WZ0A 3NTLA 3DYAB 3BFPA 2NPSC 1SQPD 1B6GA 1DEHA 1O94A 3VYTB 2WTEA 3DH0A 3TTYA 4W5TA 2YNGB 2EFOA 5FIIA 2HA7A 4OP1A 3T3IA 2F1JA 3CNNA 1DAHA 1Z8DA 2ENWA 5D01A 3WSWA 2DNGA 4QELA 4ZHRB 3LU1A 3OZCA 3L7YA 2VK1A 5AK4A 2QL5A 3Q85A 3AIOA 1FMCA 1H2RS 1LS6A 2GI4A 3KHUA 3CCBA 2HNBA 5CDFE 3ILIA 1GUDA 2XE7A 2GZMA 4RL1A 2ACEA 4BNYA 3E3LA 5JJ5A 4USHA 3AD7C 3BMOA 4ZI7B 3GRCA 1DAFA 3KSBC 2GVZA 3IEVA 5IVKA 2QTZA 1T4DA 1N77A 4Q0BA 3L5OA 1WETA 4V39A 4S1VA 4XGNA 3DGPB 3I9ZA 2CZ4A 4I14A 4E7OA 1VMAA 2XUFA 3IP6A 3WJ7A 2FG7C 4NXMB 1OJ4A 3A3OB 1XU9A 3PFCA 3WGIA 4WK2B 3ZVKA 2FLNA 1RS0A 4QEKA 4X65B 3GMDA 3UXYA 3TVZA 3D3KA 2ZUUA 4DR7F 4TV8A 4F02A 4TLRA 3GD7A 4GO7X 3E18A 3V6IA 5JYDA 4A26A 1YC2A 1KN7A 5KKZC 4NTZA 2GJ4A 3RIEA 1DCKA 3KTAA 1FTWA 3T3EA 4GOJA 2Q4RA 1U90A 3TNLA 1DRKA 4TKUA 2R6DA 1SCBA 1NJXA 2HZBA 3EGDB 4IOMA 2VDLB 1M8OB 1ZD8A 1LFAA 1XTSA 3MCNA 4WGGA 1IH8A 5DDOC 1HEUA 2H2WA 1KQGA 1FFAA 2POKA 1L8LA 2OPHA 1JG4A 4FFMA 3WGLA 4I68A 2Q66A 4CIWA 1KQ3A 2JARA 5AK6A 1QL2A 4CM3A 3H4BA 4NYIQ 3CC2S 4LMRA 2YY6A 3KP1A 4MGYR 2V3CC 4TXLA 4TMTA 4OJYA 4FKYA 2W4IA 1I3OB 3AL2A 1CQJB 3OM8A 2CJWB 3PNSA 1XDWA 1TRHA 1NU1K 1EZVG 5CTAA 5JAHA 1V3RA 2WPQA 4KGXB 2A10A 3EIEA 1EFVA 1OW3B 4Y2RA 1ZNZA 1X7GA 1UDWA 1QHGA 2MMYA 4EPTA 3KJHA 4RHEA 5B0FA 2XNKA 2V3WA 1DP4A 1Y6ZA 1GKLA 3RBEA 5EJ7A 1CZKA 3C6UB