1L0NG

Native structure of bovine mitochondrial cytochrome bc1 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 15
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1l0nG00
3L72G 1SQBG 3H1KG 1SQPG 2IBZG 1L0LG 3H1LG 2A06G 3L70G 1BCCG 3TGUG 1SQQG 2BCCG 1PP9G 1SQXG 3CWBG 1NTZG 1EZVG 3H1JG 1PPJG 2FYUG 1L0NG 1KYOH 1SQVG 4PD4H 4D6TG 3CXHH 3L74G 3L75G 3CX5H 3BCCG 1BGYG 3L71G 1BE3G 3H1IG 4U3FG 1KB9H 1NU1G 5KLVG 1NTMG 3H1HG 3L73G 1NTKG 1P84H
chains in the Genus database with same CATH superfamily
3KHUA 5E79E 3M91A 1GU5A 3L70J 1D7MA 2C9LY 1SQPE 2OARA 2L91A 2QG4A 2XNXA 3U1CA 3VP9A 2DW3A 4H0LC 1VQNP 1Y9BA 2Z5IA 4I2LC 4RESB 1KN7A 1KB9I 4DOJA 3RBXA 2Z4EA 2QJYC 4DCKA 2E74C 4IL6H 2B88A 3T97A 3BASA 3H1KD 2CPBA 4PD4D 3NXSA 3S9OA 4HYTB 1VL2A 2JKVA 3I55P 3VOPA 4N78D 2E76D 2KB7P 2CK3H 3L37A 3RGUA 2QM8A 2Q3EA 1R5LA 1J2JB 3HE4B 3V6IA 3L74D 2O01N 3CD6P 2K9JA 1SQQK 4BXLA 3GF7A 3SSUA 3RK3D 3KPEA 2YKQA 2MKVA 2KUBA 3L71J 3CWBD 1NTZD 5BU5A 1L0ND 1CI6A 5AW4B 2Q1KA 2QJPB 3BCCD 4U3FD 3W67A 1N7SA 1EC5A 1OWAA 2KS1B 3PP5A 1GL2D 2BASA 3E1RA 2J59M 4AQRD 3H1ID 1JY2P 3T97B 3M0AA 1H8AA 1PGQA 1IFNA 3WUUA 3TNUB 1NGMB 2JWAA 3KDPB 2Q6QA 2POHA 2R32A 3B5NC 3F89A 1KQSO 4IL6E 3L73D 5CMZA 4IFMA 3RL0C 3PHLA 2WPSA 4WY4D 1EZVD 1Y8AA 3GG2A 2E42A 1NTKK 5CCHD 2K9JB 2AEFA 3Q3DA 5C39A 1LTGC 3IF4A 2VRSA 3S1KA 2FYNB 3V2RA 1CSBA 3G6EP 2IZ1A 1T6AA 1AVOA 2K88A 1S5LE 4OGQD 5APSA 1NU1J 1OMIA 3BRVB 4BRYB 1N7SB 5AW6B 5KLVD 5AW0B 2R44A 1ZR2A 2BCCG 3P7KA 1DH3A 1YITP 2M5AA 1SFCA 3MIWA 1LP1A 2H89C 3G3ZA 1PFIA 2YXRB 1YIJP 2N9YB 2Q3IA 2A06D 5AVSB 2BCCE 2E75B 3CMEP 1Y47A 3D71A 3AEFC 2H43A 4H44B 2Y9YA 2HPCA 3CC7P 1EDJA 1IJDB 2WSSH 2OTKE 1FC2C 1FZAA 1HGZA 1W2BO 4N3YB 2R5DA 3B8EB 2ZXXA 5AW1B 2I8DA 4IFDK 1GL2B 4OH8B 1VQPP 3PH0A 1BSNA 3AE1C 1QLED 3L70G 4IOIH 3CPWO 1MUUA 2RH0A 4EI2A 1NH4A 2ZVNB 3RK2D 3D6YA 1L0LD 1NAYA 3GF3A 2LKMA 1ZRTD 4EYYQ 3H1JD 4Z1MH 1NTKG 2RN0A 2OYOA 1J1EC 2FXOA 1Q2NA 3L70E 2M8RA 1SFCB 1KILC 1FDMA 4GIFA 2Y0CA 5CHXA 4C7RA 4WY4B 2D2CD 1UIIA 2PAJA 3H1HG 3RBZA 1WMKA 2JJLA 5AW5B 1PP9J 1FZBA 2HODB 1NTZK 1SQVJ 3AECC 1G1IA 2XU6A 3GHGB 1L0NK 4RJTA 1FZCB 5APYA 1A02J 2QRXA 1S1CX 1S5LX 2HPCB 1RF0A 1JY3P 4OGQB 5KJ7A 5KLIC 2QJKC 4GT1A 1URQA 1L4AA 1AV1A 2H8PD 1BE3D 3A0BH 3H1HE 2YMYA 4H13D 3L35A 2FBWC 3L72D 2K3RA 4PV1B 3CX5H 2WQYC 4NPEA 1EXJA 2E43A 2ZT9C 5TJHA 1GK4A 3A5TA 2IPPA 1DIPA 3A2AA 2KZIA 3FWNA 4R4LA 2R3CA 4Y99B 2KSJA 2Y9ZA 5APQA 1RH5B 2AXCA 1HF9A 2HLOA 1Q86Q 2HG5D 2KSEA 2N1TA 4OVNF 4K35A 1YJ9P 1RF0C 5KJ7C 1T3JA 2WSEJ 3SFEC 1URQC 1KB9E 1LT9A 3CCMP 1KZUB 1LWUA 4QMAA 4WB4A 4DJGA 2Y0DA 2KYVA 3VYIA 2E74D 3R4YA 1X22A 1VDFA 2FFDA 1L4AB 1QVGO 5APWA 5KLVK 2M3BA 2K37A 2WT7B 3H6PA 4W80A 1SQQJ 4ASWA 2BCCJ 1SP4A 1M57D 3BCCG 2A45I 2ZAEB 3FXEA 2IZ0A 3JC22 2WPQA 1GW3A 1FDIA 3LIDA 4JQ0D 4RO0A 1LT9C 2PRRA 1NWQA 2ZYGA 2RMZA 3CX5E 4CPGA 3G4SP 4WWIA 1XTGB 1SQBG 3U59A 1YYCA 3O6QA 3M0DC 1MKMA 4H13B 2FFDC 1FJPA 2WITA 1ZV8A 1KTMA 1QEXA 1W2EA 1L2PA 1LWUB 3Q2YA 4C7NB 3HUSA 4L75A 1G2CA 2N9BA 1P84H 3UIAA 1L0LK 5GTIE 1JOCA 1SQBE 1N73C 3EQ2A 2NRGA 1RQVA 3HD7A 2W6BA 2E5TA 3CCVP 3AE5C 2YIUB 1E5WA 1NTKJ 1J1DB 3L71D 2HYNA 1HH0A 4EOTA 2ZJSE 3I5CA 3TF5A 1OX3A 2NPSA 4JYCA 3MGNA 4LLHA 2IBZD 3W68A 4BWNA 3RL0D 1H0TA 2PP6A 1LNQA 2HR3A 1KILE 1HJ0A 4L74A 3H1HJ 4PD4I 5AVTB 4H0LB 1IC2A 1PGPA 2P58A 1IK7A 1NHLA 2KLVA 1N7SD 3HUSC 2QJYB 1SQXK 2E74B 1HGVA 3L75J 1FE6A 1BCCD 5GTHH 3TSIA 5TISE 1U7MA 2W6JH 1S5LH 2WSEH 1VQ9P 5AVRB 1VQ5P 1K05A 4HJGH 1MV8A 3HD7C 1PP9G 3ABVC 4MN4C 3CLQA 1YI2P 1KYOH 1SQVG 4UB6H 3B5NA 2E75D 3A3YB 3MUDA 2QJPC 1K73Q 2J58A 1JEKA 4H44D 2XKMA 2B9BA 2NPSC 3WMM0 3SFDC 3P8CE 4KHXA 2GM4A 3AEBC 3B71A 1SVFA 3A0HH 3BATA 5AW9B 1ZLLA 1PP9E 1LGHB 3TGUD 3CCSP 1SQVE 1FU1A 1LTJA 1IO4A 1UIXA 1P84E 3V2QA 2XDJA 1DD3A 3H1LG 1CW5A 3TDKA 1NU1D 3OJAB 1NTMD 3HE5A 2O1KA 4GODA 4ASVA 3AEDC 2YKOA 3CXHH 3FGAD 1IK9A 2O3JA 1LTAC 5KKZC 2PFXA 1EDIA 1FS0E 3AE2C 1FBMA 4YXWH 3HRNA 3ZDMA 2QSIA 3MUDC 5AVXB 3H1LE 3MTUE 1SQPD 3SWFA 2RKLA 1SFCD 3CI9A 1QGKB 3C8VA 2BEQD 4I7ZC 3V4QA 2P7JA 1EZVI 3CWBJ 1SQXG 1NTZJ 4JBZA 3B5NB 1QVFO 1GZLA 1L0NJ 1LTJC 5L8RJ 1RHZB 3RL0B 4I6MC 5GTHE 3BCCJ 2OGUA 1CI6B 3CCJP 2E76C 5H2FH 2FY8A 2K9YA 1R5SA 3QWOC 1VQ4P 4U7JA 1SQQG 1KYOE 4UB6E 3Q1MA 3CCUP 1SQXE 4PV1D 2P67A 3K5BA 1EDKA 1VQ8P 1SQBJ 4LGDE 3HE5B 1HVVA 3RK3C 5KAIH 1S9KE 3A0HE 1M1KQ 2WPVB 1SQQE 2WMMA 2LXBA 1LT1A 2FKWB 2JO1A 2ITAA 1KILA 1RF1A 1FZEA 1VQ7P 2ZT9D 1ZXGA 1QX8A 3CXHE 1HTLC 1T3UA 1OVVA 1GK6A 1BGYG 2XZRA 1M1JA 5AVVB 5APUA 5KTBA 4DZOA 2W27A 4ZKUA 4WBAA 3MP7B 5AW8B 3II6A 1VQMP 4NPFX 4B86A 4PJ0E 2K1AA 1KB9H 5KLVJ 1URQD 1L4AD 5B5EE 2KK7A 1R8EA 3M06A 1BGYE 2B87A 3N7NA 1T2KD 4KT0J 2AEJA 3TYYA 1YJNP 1OVRA 2YXQB 1USEA 5M1BA 3H25A 1ZMEC 4PD4H 3TK1A 2M5AB 1RF1C 1ZOYC 5AVYB 1LP1B 1ZR4A 1JY2O 5H2FE 2R5BA 1LTSC 1N8RQ 1M1JC 1NTKE 2OYHA 5AVZB 1BSHA 3VMZA 1PV3A 1G1JA 3HTKA 3GMAA 3L75G 3U1AA 2OTJP 2KNCA 2QA4P 2W8ZA 2Q5UA 2QEXP 1NO4A 1AVYA 3WU2E 3M9QA 2N1TD 1SLQA 1Q81Q 1RE3A 4YPCA 1OZHA 5KAIE 1BDCA 1PPJG 3D6ZA 4D6TG 3S4RA 3V2PA 2G3AA 1HJBA 2QIWA 3M9HA 4XE5B 5CCGA 2IX7C 1NTMK 3L75E 2FXPA 4W7YA 3EFFK 4IFFA 1JCCA 2V7QJ 1L0LJ 5KLIB 3H1LJ 1MFTA 1K8AQ 3H1JJ 1YJWP 1EDLA 4JYBA 1FZGA 3H32A 2BCCD 1PPJE 4D6TE 2OYHC 2G8YA 4C46A 3H1KG 2WSFJ 1SQPK 2O01J 2KI7B 2ZT9B 1PL5A 5GTIH 1YTZI 3V2NA 1JY2N 3E7KA 4DT0A 1RE3C 2FYUD 5APXA 1SS1A 1K04A 2ZXEB 3USSA 4YTPC 4H0LD 2OTLP 3RK2C 1FAVA 1KV4A 1MFZA 3PRJA 1SQXJ 2JDIH 3H1KE 4PD4E 2JR8A 5CCGC 3P32A 3L74G 2H7HA 1KQGB 1BE3J 3M0DA 3GLMA 2OYIC 1URQB 3PTZA 3L72J 4N78E 3SWKA 4NPDA 2H88C 3CWBG 1KORA 1NTZG 1EXIA 1L0NG 2D2CC 1AQ5A 3L70D 3RL0g 1JUNA 3I56P 4U3FG 5EFWB 1VQLP 1W5CE 1N73A 3L74E 5TISH 3AE8C 3A7OA 1GTWA 1S3JA 3VMAA 3H32B 2CPSA 3HD7D 3RK3E 1N2DC 1GW4A 3CWBE 1NTZE 2WPRA 3H1IG 4TLFA 1L0NE 3CCEP 3BRTB 3NTNA 1VF5C 2GA1A 3BCCE 4U3FE 2N1TB 3V4WA 1X0TA 3CCRP 3H1HD 2NPSD 1RE4C 2ZYAA 2WWWA 1JCDA 1LT9B 1FJKA 1USDA 1BGYJ 1KQLA 3L73G 3HE4A 5CJ4A 3H1IE 1OXZA 2IFMA 2WSCJ 1RQUA 3IR9A 1LJ2A 1EZVG 1S72P 2XV5A 2AXTH 1JY3O 2FFDB 2ZFCA 1J1DC 3N4XA 4AUWA 5B66E 1GMJA 1VQKP 3L73E 1WRGA 2QVAA 1AJYA 2LR2A 2I1JA 1XTCC 1N7LA 3B5ND 2V7QH 4ZKPA 1N73B 4JF7A 1EZVE 2V4HA 1E79H 1OW7A 1KB9D 5KLVG 2KS1A 2IBZI 1K9MQ 3AEGC 1JNMA 1IFIA 3V5BA 5AVUB 1Q7YQ 2WSFH 1OIPA 2O01H 2YO2A 3TNUA 2NZ2A 3OAKA 4JPZB 3AE3C 3G9RA 4LC1A 3O6QB 1FOSF 4EDFA 2A06G 3E1IA 5AW2B 5KLVE 2WTYA 4HKZH 1EQ7A 3C1LA 4D6TJ 1IZNB 3HUSB 1JTHA 1G2CB 3G71P 5BVZA 1Q90D 1S4XA 3GW6A 2R3SA 3JSVC 2E5YA 2ZVOB 1JY3N 1IFPA 1IFDA 2A06E 3HD7B 1M8OB 3KZIE 1PGJA 1NAFA 3CC2P 3CX5D 2AEMA 1QL2A 1YTZT 3MHVA 3FWLA 1KD1Q 3CX5I 3FXDA 4M3LA 2WVRA 3H1KJ 1L0LG 4ZNCA 4N6JA 1JMMA 3VMXA 1DD4A 2NPSB 2I1KA 4BRYA 2AXTE 3H1JG 1JO5A 3QH9A 1H0TB 2P2UA 2FYUK 4R4MA 3D70A 1MZ9A 5K5GB 3O8ZA 1FDOA 1NKZB 1PZQA 1BCCJ 1LTBC 1L0LE 1SQBD 5APTA 2W90A 3EFGA 1VPCA 5AW7B 3L74J 1ZRTE 5DJUB 3H1JE 2Q9IA 3IFMA 4PJ0H 1OVUA 3ITKA 5KKZB 4XA4A 5B5EH 3LIEA 3L4FA 1KFNA 2Q7CA 2FYNC 2ZYDA 1N86A 3FX0A 1Q82Q 2MJZA 1JTHB 2B89A 2WSCH 3Q5RA 1BE3G 1Z56A 2KLUA 2O1JA 4U3FJ 4I1LA 2IYPA 1DEEG 1KILD 2YKPA 3WUVA 1N7SC 3L72G 1GL2A 4I7ZB 1NYHA 2C9NY 3TGUJ 2GUVA 1NKNA 2IYOA 3KYQA 3AE4C 2QE7H 2A45H 2M3EA 1LTJB 1YBKA 3H1IJ 4K3AA 1NTMJ 4UB8H 1YQ4C 3M9BA 2GUSA 1BE3E 3P8MC 5KAFH 2HFED 2E76B 3WU2H 3B4SA 1AQTA 2YO3A 3NFQA 3L72E 2E75C 3CMAP 3AEEC 3OA7A 1IFMA 2WZ7A 5CBNA 4H44C 3IN6A 1VQ6P 2KP8A 3L73J 4WY4A 2IDBA 1OW8A 1T8ZA 1SQPJ 3CC4P 1X79B 5CCHA 3P8CD 1X9VA 2KIKA 2FYUG 3PJSK 2IFNA 3RK3B 1KMIZ 2HODA 1LTIC 3JCUH 1GL2C 3GHGA 1PP9D 1FZCA 1OW6A 4Y28J 1NVOA 1SQVD 1M90Q 1P84D 3AEAC 4A7PA 4W7ZA 3EWKA 1JMBA 4GOEA 1P84I 2L5GB 3VP8A 3SWYA 1GD2E 5KJ7D 2FYUE 1H88A 1ZN5A 2KZJA 4L76A 2A45G 5AVQB 4O9BA 3AE6C 1A02F 1SFCC 5CBOA 2YNYA 4WY4C 3H1LD 1H89A 5CCGD 5CCHC 2M0BA 4IL6X 1HBWA 1JB0J 2OQQA 1RY3A 3GHGC 1FZCC 1J1EB 2BEZF 1OFCX 5APVA 4OGQC 3AE9C 1FZFA 3CCQP 4UB8E 1KILB 4GOFA 1RF1B 2JWDA 5KAFE 3WUTA 2JEEA 4PV1C 4HB1A 2JP3A 3LW5J 1KYOD 1M1JB 2QM7A 1SQXD 3CL3D 2P1JA 1KYOI 1NU1K 1PIXA 3KXDA 4GDOA 1VF5D 1M56D 2QJKB 2OYIA 5BU8B 3C9IA 4ZMDA 2WT7A 2LXCB 1S9KD 4Y99C 3JCUE 3L71G 5CJ0A 1SQQD 2B87B 5AW3B 1CZQA 2IBZG 1SQBK 1AA0A 1YHQP 2KXPB 3BVHA 1QL1A 3CXHD 3PLNA 1DX7A 3CXHI 3VN0A 3L71E 1S2EA 5B66H 2XNDH 2OYHB 5E79H 2Z5HA 3CCLP 1X8YA 3MZWB 1BCCG 1BDDA 1KQFB 3HTKB 3F5HA 1ZW0A 2IBZE 4XFJA 1YQ3C 1L4AC 2KNCB 1JM0A 3R2PA 1FOSE 3Q5SA 1RE4A 2W83C 4C7NA 1GU4A 1T2KC 1BGYD 1U57A 2YMKA 3AE7C 3RK2B 2PGDA 1BCCE 4OWFA 1GDTA 1WT6A 4AYCA 2P10A 2SPZA 3Q5PA 5AVWB 4EIJA 3OW2O 1M7LA 2W6AA 3IAOA 2OYIB 1LTTC 1DEBA 4WVZA 1VQOP 3TGUG 1NTKD 4KJMA 1NOHA 2FXMA 1KFMA 3VTPC 2D2CB 2N1TC 1NU1G 1NTMG 1TU3F 3L36A 3A0BE 4TT3H 4H13C 2KOGA 4YXDC 3MD0A 5DJTB 2FYZA 1LWUC 1KC8Q 4L73A 2FYUJ 1HUCA 1SQVK 3TGUE 3KZIH 1AFOA 2UWJE 1IFJA 4HH2A 1PGOA 3L75D 1SQPG 1NU1E 1VF5B 1NTME 1ZP0C 4RKUJ 2C0XA 3VMYA 2Y0EA 3NMDA 4GKGA 2J5UA 2YIUC 3KQGA 1NJIQ 1HWTC 1U7JA 1PPJD 2C0WA 3LW5H 4D6TD
chains in the Genus database with same CATH topology
3L72G 1SQBG 3H1KG 1SQPG 2IBZG 1L0LG 3H1LG 2A06G 3L70G 1BCCG 3TGUG 1SQQG 2BCCG 1PP9G 1SQXG 3CWBG 1NTZG 1EZVG 3H1JG 1PPJG 2FYUG 1L0NG 1KYOH 1SQVG 4PD4H 4D6TG 3CXHH 3L74G 3L75G 3CX5H 3BCCG 1BGYG 3L71G 1BE3G 3H1IG 4U3FG 1KB9H 1NU1G 5KLVG 1NTMG 3H1HG 3L73G 1NTKG 1P84H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L72 G;  1SQB G;  3H1K G;  1SQP G;  2IBZ G;  1L0L G;  3H1L G;  2A06 G;  3L70 G;  1BCC G;  3TGU G;  1SQQ G;  2BCC G;  1PP9 G;  1SQX G;  3CWB G;  1NTZ G;  1EZV G;  3H1J G;  1PPJ G;  2FYU G;  1L0N G;  1KYO H;  1SQV G;  4PD4 H;  4D6T G;  3CXH H;  3L74 G;  3L75 G;  3CX5 H;  3BCC G;  1BGY G;  3L71 G;  1BE3 G;  3H1I G;  4U3F G;  1KB9 H;  1NU1 G;  5KLV G;  1NTM G;  3H1H G;  3L73 G;  1NTK G;  1P84 H; 
#chains in the Genus database with same CATH topology
 3KHU A;  5E79 E;  3M91 A;  1GU5 A;  3L70 J;  1D7M A;  2C9L Y;  1SQP E;  2OAR A;  2L91 A;  2QG4 A;  2XNX A;  3U1C A;  3VP9 A;  2DW3 A;  4H0L C;  1VQN P;  1Y9B A;  2Z5I A;  4I2L C;  4RES B;  1KN7 A;  1KB9 I;  4DOJ A;  3RBX A;  2Z4E A;  2QJY C;  4DCK A;  2E74 C;  4IL6 H;  2B88 A;  3T97 A;  3BAS A;  3H1K D;  2CPB A;  4PD4 D;  3NXS A;  3S9O A;  4HYT B;  1VL2 A;  2JKV A;  3I55 P;  3VOP A;  4N78 D;  2E76 D;  2KB7 P;  2CK3 H;  3L37 A;  3RGU A;  2QM8 A;  2Q3E A;  1R5L A;  1J2J B;  3HE4 B;  3V6I A;  3L74 D;  2O01 N;  3CD6 P;  2K9J A;  1SQQ K;  4BXL A;  3GF7 A;  3SSU A;  3RK3 D;  3KPE A;  2YKQ A;  2MKV A;  2KUB A;  3L71 J;  3CWB D;  1NTZ D;  5BU5 A;  1L0N D;  1CI6 A;  5AW4 B;  2Q1K A;  2QJP B;  3BCC D;  4U3F D;  3W67 A;  1N7S A;  1EC5 A;  1OWA A;  2KS1 B;  3PP5 A;  1GL2 D;  2BAS A;  3E1R A;  2J59 M;  4AQR D;  3H1I D;  1JY2 P;  3T97 B;  3M0A A;  1H8A A;  1PGQ A;  1IFN A;  3WUU A;  3TNU B;  1NGM B;  2JWA A;  3KDP B;  2Q6Q A;  2POH A;  2R32 A;  3B5N C;  3F89 A;  1KQS O;  4IL6 E;  3L73 D;  5CMZ A;  4IFM A;  3RL0 C;  3PHL A;  2WPS A;  4WY4 D;  1EZV D;  1Y8A A;  3GG2 A;  2E42 A;  1NTK K;  5CCH D;  2K9J B;  2AEF A;  3Q3D A;  5C39 A;  1LTG C;  3IF4 A;  2VRS A;  3S1K A;  2FYN B;  3V2R A;  1CSB A;  3G6E P;  2IZ1 A;  1T6A A;  1AVO A;  2K88 A;  1S5L E;  4OGQ D;  5APS A;  1NU1 J;  1OMI A;  3BRV B;  4BRY B;  1N7S B;  5AW6 B;  5KLV D;  5AW0 B;  2R44 A;  1ZR2 A;  2BCC G;  3P7K A;  1DH3 A;  1YIT P;  2M5A A;  1SFC A;  3MIW A;  1LP1 A;  2H89 C;  3G3Z A;  1PFI A;  2YXR B;  1YIJ P;  2N9Y B;  2Q3I A;  2A06 D;  5AVS B;  2BCC E;  2E75 B;  3CME P;  1Y47 A;  3D71 A;  3AEF C;  2H43 A;  4H44 B;  2Y9Y A;  2HPC A;  3CC7 P;  1EDJ A;  1IJD B;  2WSS H;  2OTK E;  1FC2 C;  1FZA A;  1HGZ A;  1W2B O;  4N3Y B;  2R5D A;  3B8E B;  2ZXX A;  5AW1 B;  2I8D A;  4IFD K;  1GL2 B;  4OH8 B;  1VQP P;  3PH0 A;  1BSN A;  3AE1 C;  1QLE D;  3L70 G;  4IOI H;  3CPW O;  1MUU A;  2RH0 A;  4EI2 A;  1NH4 A;  2ZVN B;  3RK2 D;  3D6Y A;  1L0L D;  1NAY A;  3GF3 A;  2LKM A;  1ZRT D;  4EYY Q;  3H1J D;  4Z1M H;  1NTK G;  2RN0 A;  2OYO A;  1J1E C;  2FXO A;  1Q2N A;  3L70 E;  2M8R A;  1SFC B;  1KIL C;  1FDM A;  4GIF A;  2Y0C A;  5CHX A;  4C7R A;  4WY4 B;  2D2C D;  1UII A;  2PAJ A;  3H1H G;  3RBZ A;  1WMK A;  2JJL A;  5AW5 B;  1PP9 J;  1FZB A;  2HOD B;  1NTZ K;  1SQV J;  3AEC C;  1G1I A;  2XU6 A;  3GHG B;  1L0N K;  4RJT A;  1FZC B;  5APY A;  1A02 J;  2QRX A;  1S1C X;  1S5L X;  2HPC B;  1RF0 A;  1JY3 P;  4OGQ B;  5KJ7 A;  5KLI C;  2QJK C;  4GT1 A;  1URQ A;  1L4A A;  1AV1 A;  2H8P D;  1BE3 D;  3A0B H;  3H1H E;  2YMY A;  4H13 D;  3L35 A;  2FBW C;  3L72 D;  2K3R A;  4PV1 B;  3CX5 H;  2WQY C;  4NPE A;  1EXJ A;  2E43 A;  2ZT9 C;  5TJH A;  1GK4 A;  3A5T A;  2IPP A;  1DIP A;  3A2A A;  2KZI A;  3FWN A;  4R4L A;  2R3C A;  4Y99 B;  2KSJ A;  2Y9Z A;  5APQ A;  1RH5 B;  2AXC A;  1HF9 A;  2HLO A;  1Q86 Q;  2HG5 D;  2KSE A;  2N1T A;  4OVN F;  4K35 A;  1YJ9 P;  1RF0 C;  5KJ7 C;  1T3J A;  2WSE J;  3SFE C;  1URQ C;  1KB9 E;  1LT9 A;  3CCM P;  1KZU B;  1LWU A;  4QMA A;  4WB4 A;  4DJG A;  2Y0D A;  2KYV A;  3VYI A;  2E74 D;  3R4Y A;  1X22 A;  1VDF A;  2FFD A;  1L4A B;  1QVG O;  5APW A;  5KLV K;  2M3B A;  2K37 A;  2WT7 B;  3H6P A;  4W80 A;  1SQQ J;  4ASW A;  2BCC J;  1SP4 A;  1M57 D;  3BCC G;  2A45 I;  2ZAE B;  3FXE A;  2IZ0 A;  3JC2 2;  2WPQ A;  1GW3 A;  1FDI A;  3LID A;  4JQ0 D;  4RO0 A;  1LT9 C;  2PRR A;  1NWQ A;  2ZYG A;  2RMZ A;  3CX5 E;  4CPG A;  3G4S P;  4WWI A;  1XTG B;  1SQB G;  3U59 A;  1YYC A;  3O6Q A;  3M0D C;  1MKM A;  4H13 B;  2FFD C;  1FJP A;  2WIT A;  1ZV8 A;  1KTM A;  1QEX A;  1W2E A;  1L2P A;  1LWU B;  3Q2Y A;  4C7N B;  3HUS A;  4L75 A;  1G2C A;  2N9B A;  1P84 H;  3UIA A;  1L0L K;  5GTI E;  1JOC A;  1SQB E;  1N73 C;  3EQ2 A;  2NRG A;  1RQV A;  3HD7 A;  2W6B A;  2E5T A;  3CCV P;  3AE5 C;  2YIU B;  1E5W A;  1NTK J;  1J1D B;  3L71 D;  2HYN A;  1HH0 A;  4EOT A;  2ZJS E;  3I5C A;  3TF5 A;  1OX3 A;  2NPS A;  4JYC A;  3MGN A;  4LLH A;  2IBZ D;  3W68 A;  4BWN A;  3RL0 D;  1H0T A;  2PP6 A;  1LNQ A;  2HR3 A;  1KIL E;  1HJ0 A;  4L74 A;  3H1H J;  4PD4 I;  5AVT B;  4H0L B;  1IC2 A;  1PGP A;  2P58 A;  1IK7 A;  1NHL A;  2KLV A;  1N7S D;  3HUS C;  2QJY B;  1SQX K;  2E74 B;  1HGV A;  3L75 J;  1FE6 A;  1BCC D;  5GTH H;  3TSI A;  5TIS E;  1U7M A;  2W6J H;  1S5L H;  2WSE H;  1VQ9 P;  5AVR B;  1VQ5 P;  1K05 A;  4HJG H;  1MV8 A;  3HD7 C;  1PP9 G;  3ABV C;  4MN4 C;  3CLQ A;  1YI2 P;  1KYO H;  1SQV G;  4UB6 H;  3B5N A;  2E75 D;  3A3Y B;  3MUD A;  2QJP C;  1K73 Q;  2J58 A;  1JEK A;  4H44 D;  2XKM A;  2B9B A;  2NPS C;  3WMM 0;  3SFD C;  3P8C E;  4KHX A;  2GM4 A;  3AEB C;  3B71 A;  1SVF A;  3A0H H;  3BAT A;  5AW9 B;  1ZLL A;  1PP9 E;  1LGH B;  3TGU D;  3CCS P;  1SQV E;  1FU1 A;  1LTJ A;  1IO4 A;  1UIX A;  1P84 E;  3V2Q A;  2XDJ A;  1DD3 A;  3H1L G;  1CW5 A;  3TDK A;  1NU1 D;  3OJA B;  1NTM D;  3HE5 A;  2O1K A;  4GOD A;  4ASV A;  3AED C;  2YKO A;  3CXH H;  3FGA D;  1IK9 A;  2O3J A;  1LTA C;  5KKZ C;  2PFX A;  1EDI A;  1FS0 E;  3AE2 C;  1FBM A;  4YXW H;  3HRN A;  3ZDM A;  2QSI A;  3MUD C;  5AVX B;  3H1L E;  3MTU E;  1SQP D;  3SWF A;  2RKL A;  1SFC D;  3CI9 A;  1QGK B;  3C8V A;  2BEQ D;  4I7Z C;  3V4Q A;  2P7J A;  1EZV I;  3CWB J;  1SQX G;  1NTZ J;  4JBZ A;  3B5N B;  1QVF O;  1GZL A;  1L0N J;  1LTJ C;  5L8R J;  1RHZ B;  3RL0 B;  4I6M C;  5GTH E;  3BCC J;  2OGU A;  1CI6 B;  3CCJ P;  2E76 C;  5H2F H;  2FY8 A;  2K9Y A;  1R5S A;  3QWO C;  1VQ4 P;  4U7J A;  1SQQ G;  1KYO E;  4UB6 E;  3Q1M A;  3CCU P;  1SQX E;  4PV1 D;  2P67 A;  3K5B A;  1EDK A;  1VQ8 P;  1SQB J;  4LGD E;  3HE5 B;  1HVV A;  3RK3 C;  5KAI H;  1S9K E;  3A0H E;  1M1K Q;  2WPV B;  1SQQ E;  2WMM A;  2LXB A;  1LT1 A;  2FKW B;  2JO1 A;  2ITA A;  1KIL A;  1RF1 A;  1FZE A;  1VQ7 P;  2ZT9 D;  1ZXG A;  1QX8 A;  3CXH E;  1HTL C;  1T3U A;  1OVV A;  1GK6 A;  1BGY G;  2XZR A;  1M1J A;  5AVV B;  5APU A;  5KTB A;  4DZO A;  2W27 A;  4ZKU A;  4WBA A;  3MP7 B;  5AW8 B;  3II6 A;  1VQM P;  4NPF X;  4B86 A;  4PJ0 E;  2K1A A;  1KB9 H;  5KLV J;  1URQ D;  1L4A D;  5B5E E;  2KK7 A;  1R8E A;  3M06 A;  1BGY E;  2B87 A;  3N7N A;  1T2K D;  4KT0 J;  2AEJ A;  3TYY A;  1YJN P;  1OVR A;  2YXQ B;  1USE A;  5M1B A;  3H25 A;  1ZME C;  4PD4 H;  3TK1 A;  2M5A B;  1RF1 C;  1ZOY C;  5AVY B;  1LP1 B;  1ZR4 A;  1JY2 O;  5H2F E;  2R5B A;  1LTS C;  1N8R Q;  1M1J C;  1NTK E;  2OYH A;  5AVZ B;  1BSH A;  3VMZ A;  1PV3 A;  1G1J A;  3HTK A;  3GMA A;  3L75 G;  3U1A A;  2OTJ P;  2KNC A;  2QA4 P;  2W8Z A;  2Q5U A;  2QEX P;  1NO4 A;  1AVY A;  3WU2 E;  3M9Q A;  2N1T D;  1SLQ A;  1Q81 Q;  1RE3 A;  4YPC A;  1OZH A;  5KAI E;  1BDC A;  1PPJ G;  3D6Z A;  4D6T G;  3S4R A;  3V2P A;  2G3A A;  1HJB A;  2QIW A;  3M9H A;  4XE5 B;  5CCG A;  2IX7 C;  1NTM K;  3L75 E;  2FXP A;  4W7Y A;  3EFF K;  4IFF A;  1JCC A;  2V7Q J;  1L0L J;  5KLI B;  3H1L J;  1MFT A;  1K8A Q;  3H1J J;  1YJW P;  1EDL A;  4JYB A;  1FZG A;  3H32 A;  2BCC D;  1PPJ E;  4D6T E;  2OYH C;  2G8Y A;  4C46 A;  3H1K G;  2WSF J;  1SQP K;  2O01 J;  2KI7 B;  2ZT9 B;  1PL5 A;  5GTI H;  1YTZ I;  3V2N A;  1JY2 N;  3E7K A;  4DT0 A;  1RE3 C;  2FYU D;  5APX A;  1SS1 A;  1K04 A;  2ZXE B;  3USS A;  4YTP C;  4H0L D;  2OTL P;  3RK2 C;  1FAV A;  1KV4 A;  1MFZ A;  3PRJ A;  1SQX J;  2JDI H;  3H1K E;  4PD4 E;  2JR8 A;  5CCG C;  3P32 A;  3L74 G;  2H7H A;  1KQG B;  1BE3 J;  3M0D A;  3GLM A;  2OYI C;  1URQ B;  3PTZ A;  3L72 J;  4N78 E;  3SWK A;  4NPD A;  2H88 C;  3CWB G;  1KOR A;  1NTZ G;  1EXI A;  1L0N G;  2D2C C;  1AQ5 A;  3L70 D;  3RL0 g;  1JUN A;  3I56 P;  4U3F G;  5EFW B;  1VQL P;  1W5C E;  1N73 A;  3L74 E;  5TIS H;  3AE8 C;  3A7O A;  1GTW A;  1S3J A;  3VMA A;  3H32 B;  2CPS A;  3HD7 D;  3RK3 E;  1N2D C;  1GW4 A;  3CWB E;  1NTZ E;  2WPR A;  3H1I G;  4TLF A;  1L0N E;  3CCE P;  3BRT B;  3NTN A;  1VF5 C;  2GA1 A;  3BCC E;  4U3F E;  2N1T B;  3V4W A;  1X0T A;  3CCR P;  3H1H D;  2NPS D;  1RE4 C;  2ZYA A;  2WWW A;  1JCD A;  1LT9 B;  1FJK A;  1USD A;  1BGY J;  1KQL A;  3L73 G;  3HE4 A;  5CJ4 A;  3H1I E;  1OXZ A;  2IFM A;  2WSC J;  1RQU A;  3IR9 A;  1LJ2 A;  1EZV G;  1S72 P;  2XV5 A;  2AXT H;  1JY3 O;  2FFD B;  2ZFC A;  1J1D C;  3N4X A;  4AUW A;  5B66 E;  1GMJ A;  1VQK P;  3L73 E;  1WRG A;  2QVA A;  1AJY A;  2LR2 A;  2I1J A;  1XTC C;  1N7L A;  3B5N D;  2V7Q H;  4ZKP A;  1N73 B;  4JF7 A;  1EZV E;  2V4H A;  1E79 H;  1OW7 A;  1KB9 D;  5KLV G;  2KS1 A;  2IBZ I;  1K9M Q;  3AEG C;  1JNM A;  1IFI A;  3V5B A;  5AVU B;  1Q7Y Q;  2WSF H;  1OIP A;  2O01 H;  2YO2 A;  3TNU A;  2NZ2 A;  3OAK A;  4JPZ B;  3AE3 C;  3G9R A;  4LC1 A;  3O6Q B;  1FOS F;  4EDF A;  2A06 G;  3E1I A;  5AW2 B;  5KLV E;  2WTY A;  4HKZ H;  1EQ7 A;  3C1L A;  4D6T J;  1IZN B;  3HUS B;  1JTH A;  1G2C B;  3G71 P;  5BVZ A;  1Q90 D;  1S4X A;  3GW6 A;  2R3S A;  3JSV C;  2E5Y A;  2ZVO B;  1JY3 N;  1IFP A;  1IFD A;  2A06 E;  3HD7 B;  1M8O B;  3KZI E;  1PGJ A;  1NAF A;  3CC2 P;  3CX5 D;  2AEM A;  1QL2 A;  1YTZ T;  3MHV A;  3FWL A;  1KD1 Q;  3CX5 I;  3FXD A;  4M3L A;  2WVR A;  3H1K J;  1L0L G;  4ZNC A;  4N6J A;  1JMM A;  3VMX A;  1DD4 A;  2NPS B;  2I1K A;  4BRY A;  2AXT E;  3H1J G;  1JO5 A;  3QH9 A;  1H0T B;  2P2U A;  2FYU K;  4R4M A;  3D70 A;  1MZ9 A;  5K5G B;  3O8Z A;  1FDO A;  1NKZ B;  1PZQ A;  1BCC J;  1LTB C;  1L0L E;  1SQB D;  5APT A;  2W90 A;  3EFG A;  1VPC A;  5AW7 B;  3L74 J;  1ZRT E;  5DJU B;  3H1J E;  2Q9I A;  3IFM A;  4PJ0 H;  1OVU A;  3ITK A;  5KKZ B;  4XA4 A;  5B5E H;  3LIE A;  3L4F A;  1KFN A;  2Q7C A;  2FYN C;  2ZYD A;  1N86 A;  3FX0 A;  1Q82 Q;  2MJZ A;  1JTH B;  2B89 A;  2WSC H;  3Q5R A;  1BE3 G;  1Z56 A;  2KLU A;  2O1J A;  4U3F J;  4I1L A;  2IYP A;  1DEE G;  1KIL D;  2YKP A;  3WUV A;  1N7S C;  3L72 G;  1GL2 A;  4I7Z B;  1NYH A;  2C9N Y;  3TGU J;  2GUV A;  1NKN A;  2IYO A;  3KYQ A;  3AE4 C;  2QE7 H;  2A45 H;  2M3E A;  1LTJ B;  1YBK A;  3H1I J;  4K3A A;  1NTM J;  4UB8 H;  1YQ4 C;  3M9B A;  2GUS A;  1BE3 E;  3P8M C;  5KAF H;  2HFE D;  2E76 B;  3WU2 H;  3B4S A;  1AQT A;  2YO3 A;  3NFQ A;  3L72 E;  2E75 C;  3CMA P;  3AEE C;  3OA7 A;  1IFM A;  2WZ7 A;  5CBN A;  4H44 C;  3IN6 A;  1VQ6 P;  2KP8 A;  3L73 J;  4WY4 A;  2IDB A;  1OW8 A;  1T8Z A;  1SQP J;  3CC4 P;  1X79 B;  5CCH A;  3P8C D;  1X9V A;  2KIK A;  2FYU G;  3PJS K;  2IFN A;  3RK3 B;  1KMI Z;  2HOD A;  1LTI C;  3JCU H;  1GL2 C;  3GHG A;  1PP9 D;  1FZC A;  1OW6 A;  4Y28 J;  1NVO A;  1SQV D;  1M90 Q;  1P84 D;  3AEA C;  4A7P A;  4W7Z A;  3EWK A;  1JMB A;  4GOE A;  1P84 I;  2L5G B;  3VP8 A;  3SWY A;  1GD2 E;  5KJ7 D;  2FYU E;  1H88 A;  1ZN5 A;  2KZJ A;  4L76 A;  2A45 G;  5AVQ B;  4O9B A;  3AE6 C;  1A02 F;  1SFC C;  5CBO A;  2YNY A;  4WY4 C;  3H1L D;  1H89 A;  5CCG D;  5CCH C;  2M0B A;  4IL6 X;  1HBW A;  1JB0 J;  2OQQ A;  1RY3 A;  3GHG C;  1FZC C;  1J1E B;  2BEZ F;  1OFC X;  5APV A;  4OGQ C;  3AE9 C;  1FZF A;  3CCQ P;  4UB8 E;  1KIL B;  4GOF A;  1RF1 B;  2JWD A;  5KAF E;  3WUT A;  2JEE A;  4PV1 C;  4HB1 A;  2JP3 A;  3LW5 J;  1KYO D;  1M1J B;  2QM7 A;  1SQX D;  3CL3 D;  2P1J A;  1KYO I;  1NU1 K;  1PIX A;  3KXD A;  4GDO A;  1VF5 D;  1M56 D;  2QJK B;  2OYI A;  5BU8 B;  3C9I A;  4ZMD A;  2WT7 A;  2LXC B;  1S9K D;  4Y99 C;  3JCU E;  3L71 G;  5CJ0 A;  1SQQ D;  2B87 B;  5AW3 B;  1CZQ A;  2IBZ G;  1SQB K;  1AA0 A;  1YHQ P;  2KXP B;  3BVH A;  1QL1 A;  3CXH D;  3PLN A;  1DX7 A;  3CXH I;  3VN0 A;  3L71 E;  1S2E A;  5B66 H;  2XND H;  2OYH B;  5E79 H;  2Z5H A;  3CCL P;  1X8Y A;  3MZW B;  1BCC G;  1BDD A;  1KQF B;  3HTK B;  3F5H A;  1ZW0 A;  2IBZ E;  4XFJ A;  1YQ3 C;  1L4A C;  2KNC B;  1JM0 A;  3R2P A;  1FOS E;  3Q5S A;  1RE4 A;  2W83 C;  4C7N A;  1GU4 A;  1T2K C;  1BGY D;  1U57 A;  2YMK A;  3AE7 C;  3RK2 B;  2PGD A;  1BCC E;  4OWF A;  1GDT A;  1WT6 A;  4AYC A;  2P10 A;  2SPZ A;  3Q5P A;  5AVW B;  4EIJ A;  3OW2 O;  1M7L A;  2W6A A;  3IAO A;  2OYI B;  1LTT C;  1DEB A;  4WVZ A;  1VQO P;  3TGU G;  1NTK D;  4KJM A;  1NOH A;  2FXM A;  1KFM A;  3VTP C;  2D2C B;  2N1T C;  1NU1 G;  1NTM G;  1TU3 F;  3L36 A;  3A0B E;  4TT3 H;  4H13 C;  2KOG A;  4YXD C;  3MD0 A;  5DJT B;  2FYZ A;  1LWU C;  1KC8 Q;  4L73 A;  2FYU J;  1HUC A;  1SQV K;  3TGU E;  3KZI H;  1AFO A;  2UWJ E;  1IFJ A;  4HH2 A;  1PGO A;  3L75 D;  1SQP G;  1NU1 E;  1VF5 B;  1NTM E;  1ZP0 C;  4RKU J;  2C0X A;  3VMY A;  2Y0E A;  3NMD A;  4GKG A;  2J5U A;  2YIU C;  3KQG A;  1NJI Q;  1HWT C;  1U7J A;  1PPJ D;  2C0W A;  3LW5 H;  4D6T D; 
#chains in the Genus database with same CATH homology
 3L72 G;  1SQB G;  3H1K G;  1SQP G;  2IBZ G;  1L0L G;  3H1L G;  2A06 G;  3L70 G;  1BCC G;  3TGU G;  1SQQ G;  2BCC G;  1PP9 G;  1SQX G;  3CWB G;  1NTZ G;  1EZV G;  3H1J G;  1PPJ G;  2FYU G;  1L0N G;  1KYO H;  1SQV G;  4PD4 H;  4D6T G;  3CXH H;  3L74 G;  3L75 G;  3CX5 H;  3BCC G;  1BGY G;  3L71 G;  1BE3 G;  3H1I G;  4U3F G;  1KB9 H;  1NU1 G;  5KLV G;  1NTM G;  3H1H G;  3L73 G;  1NTK G;  1P84 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...