1L0NG

Native structure of bovine mitochondrial cytochrome bc1 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
total genus 15
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1l0nG00
1EZVG 1P84H 3CWBG 1BCCG 1PP9G 2BCCG 1L0NG 3L73G 3L75G 1NU1G 3L74G 4PD4H 3H1HG 1PPJG 3L70G 3L71G 2FYUG 1KB9H 3BCCG 3L72G 4U3FG 2IBZG 3H1JG 5KLVG 1SQQG 1KYOH 3H1LG 3TGUG 3CX5H 1SQPG 1SQXG 4D6TG 2A06G 1NTMG 1NTZG 1BGYG 3H1IG 1SQVG 1L0LG 1NTKG 3CXHH 1BE3G 1SQBG 3H1KG
chains in the Genus database with same CATH superfamily
2HODA 1YHQP 1M56D 1ZV8A 1PPJD 1L0LE 1SQBE 3HD7C 1A02F 2YO3A 3VMYA 1S1CX 1N8RQ 3IF4A 1RF0A 4MN4C 1HUCA 2WPQA 4NPDA 2Q6QA 3B5NC 1WRGA 1KC8Q 2NPSB 4R4LA 2QEXP 1P84E 2R44A 1W5CE 2FFDA 3VMAA 3A7OA 2N9YB 1RF1A 5CHXA 2Z5IA 1GW3A 3L72E 1L0NJ 3KZIE 3M06A 2JP3A 3MHVA 3F89A 4U7JA 1YBKA 2K37A 3M9HA 1S9KD 1BGYJ 3Q2YA 1SQVJ 2JKVA 2HFED 5KLIB 1NTMG 3HE4B 1GW4A 1RF1C 1EDJA 1BSNA 5BU8B 1USDA 3LIEA 2WWWA 3AE1C 4L73A 3K5BA 1NTZK 2AXTH 2IBZG 1NTKK 3H1IE 3GMAA 3HE5B 3CXHI 1SQPG 3V4WA 3Q5SA 1SQBD 3L73J 2JDIH 1JY2P 2OYIB 1KB9H 3LW5H 5DJUB 5AVTB 2G8YA 4EDFA 4DCKA 3LIDA 1NGMB 2J58A 1FDIA 3L71E 3WU2H 1P84D 2Q1KA 1VPCA 2FYUJ 2K3RA 2YO2A 3RK2C 3L72D 2NZ2A 3AEDC 1E79H 5APUA 3ZDMA 1A02J 3U59A 3IN6A 2JWDA 2M3EA 1K73Q 4WWIA 3G6EP 1NU1J 4WB4A 4PD4H 4U3FJ 2Y9YA 3AEGC 2OGUA 1LWUA 5DJTB 4W7YA 3GW6A 1HWTC 3MTUE 2P10A 2Z4EA 3TSIA 3CCMP 1DD4A 4L76A 2E75B 1BE3J 2KXPB 1LTSC 3H1ID 1Q86Q 1N73B 1GK4A 3VP8A 2WSSH 2KNCA 3H1HG 2B89A 2ZT9B 1FZEA 1DEEG 1N7SA 4GIFA 4KT0J 3F5HA 1L0NE 4PJ0H 2V7QH 2H7HA 3CCRP 1JO5A 1NKNA 3H1KD 1QEXA 3L35A 1YJNP 5CMZA 1HH0A 1NTMK 2K9JA 1SFCB 4JQ0D 4C7RA 2E76B 1GK6A 3L71D 2NPSC 1LGHB 4C46A 3C1LA 2YMYA 1S72P 4ASWA 1DH3A 4RJTA 1HGVA 1M1JB 2IPPA 1PP9J 2BEZF 3M9QA 1SQPK 2M0BA 1EXJA 3BCCG 2ZXEB 2OTLP 1FJPA 3L70D 3I55P 3KZIH 1S5LE 3WMM0 5KLIC 3L73E 2KLVA 1VQ4P 5AW6B 3PHLA 3RL0C 1FU1A 3PRJA 1KYOI 2QG4A 3WUVA 1AVYA 2H88C 4ZKPA 1VQNP 1FS0E 4AQRD 1FZGA 1BGYG 3RK2D 1SQVG 4TLFA 1UIIA 1XTGB 2FYUE 4XA4A 1FZCB 5APYA 1CI6B 2H89C 5TJHA 1YYCA 2KS1A 5EFWB 3EQ2A 3GHGA 1M7LA 2OYOA 2I1JA 3TNUA 1BDCA 2L5GB 1LTTC 3M91A 1NU1E 1ZP0C 4ZKUA 3GF3A 4U3FE 4L74A 4Y28J 3MIWA 3LW5J 3T97B 3ABVC 1FE6A 1R5SA 1JMMA 2W8ZA 4M3LA 1BE3E 1VL2A 3GHGC 1HJ0A 1NKZB 2M8RA 4IFMA 2CPSA 1BCCG 3OAKA 3VTPC 3L73D 2FYUG 3A0HE 2A45G 2QJPB 3VMXA 2KOGA 3WUUA 1H0TB 4IL6H 1RE3A 1L4AA 2E75C 3G9RA 3B71A 3FXDA 1MFZA 1N7SD 3M0DC 1N73C 2B87B 1AA0A 3CCUP 3GLMA 1KILA 4A7PA 1H88A 1KQFB 3TGUG 1RE3C 1PP9E 1L4AC 2A06D 3A5TA 4EIJA 5AVQB 2WITA 1HVVA 2HODB 1IZNB 1SFCC 1NU1D 3RL0D 5AW3B 1EC5A 2QJYB 1Q2NA 1X9VA 2V7QJ 1J1DC 2VRSA 3MGNA 3RBXA 4OVNF 1BDDA 1Q7YQ 2YXRB 3RL0g 1M1JC 1BE3D 2BASA 1YQ3C 2C9NY 1YTZI 2ZVNB 1SQVK 1NTZE 5AW1B 1YTZT 3G3ZA 2LR2A 3H32A 2FFDB 2AXTE 2J59M 4N78E 1RF1B 1EQ7A 3NFQA 1KILE 2FKWB 4GKGA 2QA4P 1OVUA 1OFCX 1SQQG 4IL6X 1FDOA 2ZFCA 1LTIC 3P7KA 1IK7A 2W6AA 2ZAEB 2CK3H 5KLVJ 2Q9IA 1IFPA 3AE6C 2KZJA 1EZVI 1KB9E 1GZLA 3CMEP 1PGOA 1YQ4C 1M1KQ 1FZCC 2P58A 2K88A 1VQ7P 2ZYGA 1GDTA 3L74G 3UIAA 1VF5C 2A45H 4I7ZB 3H1LD 3CL3D 1N86A 2FYUK 5TISE 4H0LC 3GG2A 1G1JA 3BASA 1LJ2A 1VDFA 3RK2B 1JCCA 1LT1A 2XV5A 1NTZD 1NTKD 1RQUA 3IR9A 3CCQP 2ITAA 3W67A 1L4AD 3H1HJ 2NRGA 1LTJA 1OVVA 3CWBD 5APSA 4N78D 4ZNCA 1JEKA 2O3JA 1KILD 3CLQA 3KYQA 2HYNA 1VQMP 3FWNA 2JEEA 4IOIH 1ZMEC 2YKQA 3RK3E 2WSEH 1NTME 1KB9D 1LWUB 4PJ0E 1U57A 1J1EC 3EFGA 3H6PA 1YITP 3MUDC 3O8ZA 1LTAC 1EZVG 2IBZE 3B4SA 3BCCJ 1SQPE 2Q3EA 2KNCB 2QJYC 1S2EA 1MUUA 1N7SB 4H44D 1RH5B 1QGKB 1KV4A 2LXCB 2E5YA 1UIXA 5APWA 1SQQK 1HGZA 1RQVA 3N7NA 3FWLA 1OX3A 4PD4D 1RF0C 1T6AA 2K9JB 1JY3O 2E43A 1LT9A 4H13C 4OGQC 2W27A 1VF5D 2KIKA 3KQGA 2FFDC 1VQ5P 2IX7C 3RL0B 4NPEA 2QM7A 1IFMA 3A0BE 2KB7P 4HKZH 2B88A 4H0LD 4WVZA 1OXZA 3CPWO 1VQ6P 1ZXGA 1GL2A 5AW5B 2QE7H 1NTMD 2WPSA 3SWYA 3OJAB 1GD2E 1L2PA 1L0LD 2O01J 2IYOA 2WTYA 3II6A 5KAFE 2KZIA 4K35A 1PGPA 1NO4A 3OW2O 3SFDC 2I8DA 5AW4B 4I7ZC 1MFTA 3P8MC 1SQPD 3CC4P 2RKLA 1DEBA 5KLVG 1JY3N 3H1HE 1BCCJ 2KSJA 1X8YA 3L75J 3FX0A 2OTKE 3U1AA 2WQYC 3CXHE 5TISH 2W6BA 2KS1B 5AVXB 4JYBA 2FXOA 3GHGB 1BSHA 1IO4A 3TNUB 3WUTA 1Z56A 4N3YB 1CSBA 4IL6E 5APQA 1HBWA 1SQXJ 3TGUJ 2WT7A 2R5DA 2B9BA 1K05A 3IAOA 5BU5A 3I5CA 3S1KA 4DOJA 1JCDA 1W2BO 3BCCE 2XNDH 3CCVP 2FBWC 1LNQA 1ZR4A 2JO1A 3B8EB 2IZ0A 1LWUC 1HTLC 1L4AB 2R5BA 4CPGA 3BATA 3H1KG 2Z5HA 2KK7A 4H13D 3TDKA 2O01N 4OGQD 2Q7CA 2R3CA 2AEMA 2WSEJ 1KFNA 3G71P 2E74B 1R5LA 3CCEP 1OVRA 3V2PA 1KILB 3H1HD 1BGYE 1Y8AA 1SQVE 4W7ZA 3AE2C 1FOSE 1M8OB 2IDBA 2OYHA 4ZMDA 1Q90D 1URQA 1AJYA 1J1DB 1N7SC 2OTJP 2OARA 3S4RA 5E79H 3V6IA 1YJ9P 2YIUB 1M90Q 5C39A 2YXQB 3L70G 1SQQJ 4QMAA 2OYHC 3D71A 2QIWA 3EFFK 4XFJA 1GL2D 3L74J 4GDOA 5H2FE 2XU6A 1FJKA 1X22A 4H44B 3BCCD 5KLVK 3M0AA 1FZBA 2WPVB 3AE4C 3A0BH 1JOCA 1BCCE 3L75E 3H32B 1KQGB 4N6JA 1USEA 4NPFX 3W68A 5CCGA 4PV1B 1NHLA 1L0ND 2M3BA 1JMBA 1AQTA 1VF5B 5KAFH 4BRYA 1BGYD 1SQVD 4BWNA 1SS1A 1ZW0A 1KYOE 4WY4A 2P67A 4H0LB 1MV8A 1JNMA 1ZR2A 1SQXE 3TGUE 4YTPC 5CCGC 1PZQA 2G3AA 2M5AA 4AUWA 3VN0A 3CXHH 2N1TA 4WY4C 3L75G 5AVZB 4DT0A 1NAYA 3KPEA 4UB6E 3CCSP 1M57D 1VQPP 4GT1A 4AYCA 1H89A 1KFMA 4L75A 1LP1A 1IFDA 3R4YA 3AE8C 1LTJB 2K9YA 3CX5I 1DX7A 4O9BA 2FYUD 3QH9A 1ZLLA 1SQXG 1X79B 5B66E 2A06G 2PGDA 2QM8A 4IFDK 1J1EB 1ZRTE 2GUVA 5AW9B 4EOTA 3JC22 3AEFC 4Z1MH 3V4QA 2Y0EA 1JY2N 1URQD 1SQQE 5CJ4A 2E74C 1KILC 2KI7B 4U3FD 5AVVB 1OZHA 1QL2A 3TGUD 5L8RJ 1PIXA 1NYHA 3L74E 2C0XA 2L91A 4GODA 1JY3P 2YIUC 1Q82Q 1EDKA 1FAVA 2XZRA 3H1JG 1JB0J 2FXMA 3V2RA 3VP9A 3M9BA 1T8ZA 2HPCA 4HB1A 4D6TG 4H13B 2YKPA 5KKZC 4OGQB 2P1JA 3L36A 2W90A 1G1IA 1KB9I 1YIJP 2BCCG 4C7NA 2O01H 2IZ1A 3TYYA 1E5WA 4H44C 2Y0DA 3AEBC 1HJBA 1LT9B 5CCGD 1QL1A 3O6QA 5H2FH 2WZ7A 5KJ7A 2XNXA 3NMDA 1T3JA 1FDMA 4YXDC 3U1CA 4PV1C 1JTHA 1PP9D 1ZRTD 4WY4D 1XTCC 2H43A 1SQQD 3CI9A 4RESB 1GL2B 2E5TA 5KJ7C 4PD4I 3N4XA 5M1BA 2AXCA 1D7MA 1MKMA 1KZUB 3RK3C 3L74D 2N1TD 2ZXXA 1KYOH 1EZVE 1PL5A 2QJKB 2Q3IA 2KLUA 4K3AA 3I56P 3EWKA 2KYVA 2QVAA 3CWBG 5AW7B 1SQXK 1PV3A 3AE7C 4KJMA 3CC7P 5AVYB 2E74D 1AV1A 3USSA 3H1KJ 4DZOA 4GOFA 1WT6A 1S9KE 3SWFA 4UB6H 5BVZA 5KTBA 1PPJG 2I1KA 4I6MC 1LTJC 3AEEC 2MJZA 3SFEC 3JSVC 3HD7A 2WT7B 1G2CA 3Q5PA 1P84I 2IYPA 1RE4A 5APVA 5CBNA 5B66H 3L70J 3B5NA 3E1RA 2JWAA 1NAFA 5E79E 2WSFH 4LLHA 2J5UA 2QRXA 1N2DC 5AVSB 1RE4C 1FZFA 1EZVD 1PGQA 1S4XA 2UWJE 3RBZA 3PH0A 3Q3DA 2C0WA 3CD6P 5KLVE 1R8EA 4PV1D 3CX5H 5GTHE 3HUSA 3V5BA 2OYHB 1URQB 3NXSA 3S9OA 3VMZA 2ZVOB 1KORA 1SP4A 5B5EH 5KJ7D 4UB8H 3E1IA 2R32A 1K9MQ 1EDIA 5AW8B 2KP8A 1LT9C 5APTA 3RK3D 3HUSC 1NWQA 2BEQD 2PRRA 2POHA 1L0LG 1LTBC 2R3SA 1SQBG 3AE9C 2IFNA 3PTZA 3IFMA 1GTWA 1N7LA 3PP5A 1H8AA 2IBZD 2HG5D 3MZWB 2D2CD 3ITKA 2PAJA 1GL2C 1QVFO 5AVRB 1QVGO 2FYNB 4DJGA 1FZAA 3L72G 2AEFA 3C8VA 2SPZA 1OW6A 3H1KE 2W83C 2QJKC 3HTKA 4BRYB 4I1LA 2HR3A 5KLVD 1YI2P 1KN7A 1QLED 1OIPA 1ZN5A 4WY4B 5KAIE 3CC2P 1IK9A 2N9BA 2RN0A 2O1KA 5CCHA 3JCUH 2M5AB 1VQLP 2LKMA 3H1IG 1RHZB 4Y99B 2H8PD 2WSCJ 3L70E 4LC1A 2N1TB 2WVRA 3HD7D 4HH2A 1U7JA 3CCLP 1PFIA 1J2JB 3R2PA 3MD0A 1K04A 1SLQA 3SSUA 5CCHC 4XE5B 3B5ND 3VYIA 3SWKA 3KHUA 3BRTB 1CW5A 2JJLA 1LP1B 2W6JH 3H1JJ 3L71G 2NPSA 4D6TJ 5AVUB 3G4SP 2P7JA 3CXHD 2BCCJ 3FXEA 3V2NA 1Q81Q 4HYTB 2KUBA 3KDPB 1GU4A 1OW8A 2WSFJ 1L0LK 1SQBK 5AW0B 4YXWH 3HE4A 1U7MA 5KKZB 3D6ZA 3AE5C 1URQC 1P84H 5GTHH 1NVOA 1EDLA 2A45I 4WBAA 1AVOA 2CPBA 3H1LJ 3HE5A 1NJIQ 1KQLA 3RGUA 4LGDE 3L37A 4R4MA 2HPCB 2IFMA 2FXPA 2YKOA 1PGJA 2GA1A 1L0NG 1DIPA 1AQ5A 2OYIA 1JM0A 1VQ9P 1JUNA 4C7NB 1VQ8P 3CCJP 1NTZJ 4TT3H 1NTKJ 3O6QB 1GMJA 4JF7A 3AECC 2Q5UA 3V2QA 1DD3A 3CWBJ 3FGAD 2FYNC 2OYIC 2A06E 1JTHB 1KQSO 3RK3B 2V4HA 5GTIE 1S3JA 3P8CE 2DW3A 3MP7B 1YJWP 1JY2O 4OH8B 1X0TA 2HLOA 4GOEA 3H25A 3OA7A 2WMMA 5CCHD 1IFIA 3BVHA 3L73G 1EXIA 1TU3F 2D2CB 3D70A 5KAIH 1OWAA 3CMAP 4Y99C 2FY8A 3M0DA 1N73A 3H1JE 2N1TC 1CZQA 3BRVB 1IFNA 4IFFA 1BCCD 4D6TE 2ZJSE 3L75D 4I2LC 1KMIZ 3P32A 4B86A 2BCCE 2NPSD 4JYCA 4ASVA 3GF7A 1SFCA 1NU1G 1Y9BA 4U3FG 2ZT9C 1GU5A 2P2UA 2LXBA 1KYOD 2O1JA 1SQXD 3HD7B 1G2CB 3VOPA 1M1JA 5AW2B 1BE3G 1VQOP 3Q1MA 1T2KC 4RKUJ 3A2AA 2ZYDA 3P8CD 2YMKA 3CX5E 3H1LE 3TF5A 1FBMA 4HJGH 2E76C 3B5NB 2Y9ZA 1NTMJ 3TK1A 2YNYA 2KSEA 1SVFA 1T3UA 1L0LJ 1L0NK 5B5EE 1OMIA 1SQBJ 4UB8E 3A3YB 3HRNA 2GM4A 2OQQA 3PLNA 2PP6A 4OWFA 5CJ0A 1NTKE 1SQPJ 2JR8A 3H1JD 1K8AQ 2E42A 2Y0CA 3E7KA 1MZ9A 3HUSB 4D6TD 3CWBE 1IFJA 1FZCA 3NTNA 1S5LH 1CI6A 1ZOYC 1PP9G 4KHXA 2FYZA 4RO0A 1WMKA 2RMZA 2BCCD 3L72J 5CBOA 3QWOC 1NOHA 1AFOA 3H1LG 4JBZA 1QX8A 3AEAC 1NH4A 5APXA 2AEJA 5K5GB 1PPJE 1KTMA 3PJSK 2GUSA 3Q5RA 3T97A 4BXLA 1IC2A 5AVWB 3WU2E 1OW7A 2C9LY 1FC2C 3CX5D 3H1IJ 1LTGC 1NTZG 1NTKG 3C9IA 1FOSF 1W2EA 5GTIH 2E75D 2QSIA 1Y47A 2WSCH 3JCUE 3AE3C 1KD1Q 4EYYQ 2K1AA 2D2CC 4YPCA 1H0TA 4JPZB 2ZT9D 2RH0A 2WPRA 3L4FA 1VQKP 4PD4E 1NU1K 2XKMA 4W80A 3HTKB 3KXDA 4EI2A 2B87A 2MKVA 1IJDB 3L71J 2IBZI 1T2KD 3D6YA 2ZYAA 1RY3A 2QJPC 1SFCD 2E76D 2XDJA 3A0HH 2PFXA 3MUDA 1S5LX 1HF9A
chains in the Genus database with same CATH topology
1EZVG 1P84H 3CWBG 1BCCG 1PP9G 2BCCG 1L0NG 3L73G 3L75G 1NU1G 3L74G 4PD4H 3H1HG 1PPJG 3L70G 3L71G 2FYUG 1KB9H 3BCCG 3L72G 4U3FG 2IBZG 3H1JG 5KLVG 1SQQG 1KYOH 3H1LG 3TGUG 3CX5H 1SQPG 1SQXG 4D6TG 2A06G 1NTMG 1NTZG 1BGYG 3H1IG 1SQVG 1L0LG 1NTKG 3CXHH 1BE3G 1SQBG 3H1KG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZV G;  1P84 H;  3CWB G;  1BCC G;  1PP9 G;  2BCC G;  1L0N G;  3L73 G;  3L75 G;  1NU1 G;  3L74 G;  4PD4 H;  3H1H G;  1PPJ G;  3L70 G;  3L71 G;  2FYU G;  1KB9 H;  3BCC G;  3L72 G;  4U3F G;  2IBZ G;  3H1J G;  5KLV G;  1SQQ G;  1KYO H;  3H1L G;  3TGU G;  3CX5 H;  1SQP G;  1SQX G;  4D6T G;  2A06 G;  1NTM G;  1NTZ G;  1BGY G;  3H1I G;  1SQV G;  1L0L G;  1NTK G;  3CXH H;  1BE3 G;  1SQB G;  3H1K G; 
#chains in the Genus database with same CATH topology
 2HOD A;  1YHQ P;  1M56 D;  1ZV8 A;  1PPJ D;  1L0L E;  1SQB E;  3HD7 C;  1A02 F;  2YO3 A;  3VMY A;  1S1C X;  1N8R Q;  3IF4 A;  1RF0 A;  4MN4 C;  1HUC A;  2WPQ A;  4NPD A;  2Q6Q A;  3B5N C;  1WRG A;  1KC8 Q;  2NPS B;  4R4L A;  2QEX P;  1P84 E;  2R44 A;  1W5C E;  2FFD A;  3VMA A;  3A7O A;  2N9Y B;  1RF1 A;  5CHX A;  2Z5I A;  1GW3 A;  3L72 E;  1L0N J;  3KZI E;  3M06 A;  2JP3 A;  3MHV A;  3F89 A;  4U7J A;  1YBK A;  2K37 A;  3M9H A;  1S9K D;  1BGY J;  3Q2Y A;  1SQV J;  2JKV A;  2HFE D;  5KLI B;  1NTM G;  3HE4 B;  1GW4 A;  1RF1 C;  1EDJ A;  1BSN A;  5BU8 B;  1USD A;  3LIE A;  2WWW A;  3AE1 C;  4L73 A;  3K5B A;  1NTZ K;  2AXT H;  2IBZ G;  1NTK K;  3H1I E;  3GMA A;  3HE5 B;  3CXH I;  1SQP G;  3V4W A;  3Q5S A;  1SQB D;  3L73 J;  2JDI H;  1JY2 P;  2OYI B;  1KB9 H;  3LW5 H;  5DJU B;  5AVT B;  2G8Y A;  4EDF A;  4DCK A;  3LID A;  1NGM B;  2J58 A;  1FDI A;  3L71 E;  3WU2 H;  1P84 D;  2Q1K A;  1VPC A;  2FYU J;  2K3R A;  2YO2 A;  3RK2 C;  3L72 D;  2NZ2 A;  3AED C;  1E79 H;  5APU A;  3ZDM A;  1A02 J;  3U59 A;  3IN6 A;  2JWD A;  2M3E A;  1K73 Q;  4WWI A;  3G6E P;  1NU1 J;  4WB4 A;  4PD4 H;  4U3F J;  2Y9Y A;  3AEG C;  2OGU A;  1LWU A;  5DJT B;  4W7Y A;  3GW6 A;  1HWT C;  3MTU E;  2P10 A;  2Z4E A;  3TSI A;  3CCM P;  1DD4 A;  4L76 A;  2E75 B;  1BE3 J;  2KXP B;  1LTS C;  3H1I D;  1Q86 Q;  1N73 B;  1GK4 A;  3VP8 A;  2WSS H;  2KNC A;  3H1H G;  2B89 A;  2ZT9 B;  1FZE A;  1DEE G;  1N7S A;  4GIF A;  4KT0 J;  3F5H A;  1L0N E;  4PJ0 H;  2V7Q H;  2H7H A;  3CCR P;  1JO5 A;  1NKN A;  3H1K D;  1QEX A;  3L35 A;  1YJN P;  5CMZ A;  1HH0 A;  1NTM K;  2K9J A;  1SFC B;  4JQ0 D;  4C7R A;  2E76 B;  1GK6 A;  3L71 D;  2NPS C;  1LGH B;  4C46 A;  3C1L A;  2YMY A;  1S72 P;  4ASW A;  1DH3 A;  4RJT A;  1HGV A;  1M1J B;  2IPP A;  1PP9 J;  2BEZ F;  3M9Q A;  1SQP K;  2M0B A;  1EXJ A;  3BCC G;  2ZXE B;  2OTL P;  1FJP A;  3L70 D;  3I55 P;  3KZI H;  1S5L E;  3WMM 0;  5KLI C;  3L73 E;  2KLV A;  1VQ4 P;  5AW6 B;  3PHL A;  3RL0 C;  1FU1 A;  3PRJ A;  1KYO I;  2QG4 A;  3WUV A;  1AVY A;  2H88 C;  4ZKP A;  1VQN P;  1FS0 E;  4AQR D;  1FZG A;  1BGY G;  3RK2 D;  1SQV G;  4TLF A;  1UII A;  1XTG B;  2FYU E;  4XA4 A;  1FZC B;  5APY A;  1CI6 B;  2H89 C;  5TJH A;  1YYC A;  2KS1 A;  5EFW B;  3EQ2 A;  3GHG A;  1M7L A;  2OYO A;  2I1J A;  3TNU A;  1BDC A;  2L5G B;  1LTT C;  3M91 A;  1NU1 E;  1ZP0 C;  4ZKU A;  3GF3 A;  4U3F E;  4L74 A;  4Y28 J;  3MIW A;  3LW5 J;  3T97 B;  3ABV C;  1FE6 A;  1R5S A;  1JMM A;  2W8Z A;  4M3L A;  1BE3 E;  1VL2 A;  3GHG C;  1HJ0 A;  1NKZ B;  2M8R A;  4IFM A;  2CPS A;  1BCC G;  3OAK A;  3VTP C;  3L73 D;  2FYU G;  3A0H E;  2A45 G;  2QJP B;  3VMX A;  2KOG A;  3WUU A;  1H0T B;  4IL6 H;  1RE3 A;  1L4A A;  2E75 C;  3G9R A;  3B71 A;  3FXD A;  1MFZ A;  1N7S D;  3M0D C;  1N73 C;  2B87 B;  1AA0 A;  3CCU P;  3GLM A;  1KIL A;  4A7P A;  1H88 A;  1KQF B;  3TGU G;  1RE3 C;  1PP9 E;  1L4A C;  2A06 D;  3A5T A;  4EIJ A;  5AVQ B;  2WIT A;  1HVV A;  2HOD B;  1IZN B;  1SFC C;  1NU1 D;  3RL0 D;  5AW3 B;  1EC5 A;  2QJY B;  1Q2N A;  1X9V A;  2V7Q J;  1J1D C;  2VRS A;  3MGN A;  3RBX A;  4OVN F;  1BDD A;  1Q7Y Q;  2YXR B;  3RL0 g;  1M1J C;  1BE3 D;  2BAS A;  1YQ3 C;  2C9N Y;  1YTZ I;  2ZVN B;  1SQV K;  1NTZ E;  5AW1 B;  1YTZ T;  3G3Z A;  2LR2 A;  3H32 A;  2FFD B;  2AXT E;  2J59 M;  4N78 E;  1RF1 B;  1EQ7 A;  3NFQ A;  1KIL E;  2FKW B;  4GKG A;  2QA4 P;  1OVU A;  1OFC X;  1SQQ G;  4IL6 X;  1FDO A;  2ZFC A;  1LTI C;  3P7K A;  1IK7 A;  2W6A A;  2ZAE B;  2CK3 H;  5KLV J;  2Q9I A;  1IFP A;  3AE6 C;  2KZJ A;  1EZV I;  1KB9 E;  1GZL A;  3CME P;  1PGO A;  1YQ4 C;  1M1K Q;  1FZC C;  2P58 A;  2K88 A;  1VQ7 P;  2ZYG A;  1GDT A;  3L74 G;  3UIA A;  1VF5 C;  2A45 H;  4I7Z B;  3H1L D;  3CL3 D;  1N86 A;  2FYU K;  5TIS E;  4H0L C;  3GG2 A;  1G1J A;  3BAS A;  1LJ2 A;  1VDF A;  3RK2 B;  1JCC A;  1LT1 A;  2XV5 A;  1NTZ D;  1NTK D;  1RQU A;  3IR9 A;  3CCQ P;  2ITA A;  3W67 A;  1L4A D;  3H1H J;  2NRG A;  1LTJ A;  1OVV A;  3CWB D;  5APS A;  4N78 D;  4ZNC A;  1JEK A;  2O3J A;  1KIL D;  3CLQ A;  3KYQ A;  2HYN A;  1VQM P;  3FWN A;  2JEE A;  4IOI H;  1ZME C;  2YKQ A;  3RK3 E;  2WSE H;  1NTM E;  1KB9 D;  1LWU B;  4PJ0 E;  1U57 A;  1J1E C;  3EFG A;  3H6P A;  1YIT P;  3MUD C;  3O8Z A;  1LTA C;  1EZV G;  2IBZ E;  3B4S A;  3BCC J;  1SQP E;  2Q3E A;  2KNC B;  2QJY C;  1S2E A;  1MUU A;  1N7S B;  4H44 D;  1RH5 B;  1QGK B;  1KV4 A;  2LXC B;  2E5Y A;  1UIX A;  5APW A;  1SQQ K;  1HGZ A;  1RQV A;  3N7N A;  3FWL A;  1OX3 A;  4PD4 D;  1RF0 C;  1T6A A;  2K9J B;  1JY3 O;  2E43 A;  1LT9 A;  4H13 C;  4OGQ C;  2W27 A;  1VF5 D;  2KIK A;  3KQG A;  2FFD C;  1VQ5 P;  2IX7 C;  3RL0 B;  4NPE A;  2QM7 A;  1IFM A;  3A0B E;  2KB7 P;  4HKZ H;  2B88 A;  4H0L D;  4WVZ A;  1OXZ A;  3CPW O;  1VQ6 P;  1ZXG A;  1GL2 A;  5AW5 B;  2QE7 H;  1NTM D;  2WPS A;  3SWY A;  3OJA B;  1GD2 E;  1L2P A;  1L0L D;  2O01 J;  2IYO A;  2WTY A;  3II6 A;  5KAF E;  2KZI A;  4K35 A;  1PGP A;  1NO4 A;  3OW2 O;  3SFD C;  2I8D A;  5AW4 B;  4I7Z C;  1MFT A;  3P8M C;  1SQP D;  3CC4 P;  2RKL A;  1DEB A;  5KLV G;  1JY3 N;  3H1H E;  1BCC J;  2KSJ A;  1X8Y A;  3L75 J;  3FX0 A;  2OTK E;  3U1A A;  2WQY C;  3CXH E;  5TIS H;  2W6B A;  2KS1 B;  5AVX B;  4JYB A;  2FXO A;  3GHG B;  1BSH A;  1IO4 A;  3TNU B;  3WUT A;  1Z56 A;  4N3Y B;  1CSB A;  4IL6 E;  5APQ A;  1HBW A;  1SQX J;  3TGU J;  2WT7 A;  2R5D A;  2B9B A;  1K05 A;  3IAO A;  5BU5 A;  3I5C A;  3S1K A;  4DOJ A;  1JCD A;  1W2B O;  3BCC E;  2XND H;  3CCV P;  2FBW C;  1LNQ A;  1ZR4 A;  2JO1 A;  3B8E B;  2IZ0 A;  1LWU C;  1HTL C;  1L4A B;  2R5B A;  4CPG A;  3BAT A;  3H1K G;  2Z5H A;  2KK7 A;  4H13 D;  3TDK A;  2O01 N;  4OGQ D;  2Q7C A;  2R3C A;  2AEM A;  2WSE J;  1KFN A;  3G71 P;  2E74 B;  1R5L A;  3CCE P;  1OVR A;  3V2P A;  1KIL B;  3H1H D;  1BGY E;  1Y8A A;  1SQV E;  4W7Z A;  3AE2 C;  1FOS E;  1M8O B;  2IDB A;  2OYH A;  4ZMD A;  1Q90 D;  1URQ A;  1AJY A;  1J1D B;  1N7S C;  2OTJ P;  2OAR A;  3S4R A;  5E79 H;  3V6I A;  1YJ9 P;  2YIU B;  1M90 Q;  5C39 A;  2YXQ B;  3L70 G;  1SQQ J;  4QMA A;  2OYH C;  3D71 A;  2QIW A;  3EFF K;  4XFJ A;  1GL2 D;  3L74 J;  4GDO A;  5H2F E;  2XU6 A;  1FJK A;  1X22 A;  4H44 B;  3BCC D;  5KLV K;  3M0A A;  1FZB A;  2WPV B;  3AE4 C;  3A0B H;  1JOC A;  1BCC E;  3L75 E;  3H32 B;  1KQG B;  4N6J A;  1USE A;  4NPF X;  3W68 A;  5CCG A;  4PV1 B;  1NHL A;  1L0N D;  2M3B A;  1JMB A;  1AQT A;  1VF5 B;  5KAF H;  4BRY A;  1BGY D;  1SQV D;  4BWN A;  1SS1 A;  1ZW0 A;  1KYO E;  4WY4 A;  2P67 A;  4H0L B;  1MV8 A;  1JNM A;  1ZR2 A;  1SQX E;  3TGU E;  4YTP C;  5CCG C;  1PZQ A;  2G3A A;  2M5A A;  4AUW A;  3VN0 A;  3CXH H;  2N1T A;  4WY4 C;  3L75 G;  5AVZ B;  4DT0 A;  1NAY A;  3KPE A;  4UB6 E;  3CCS P;  1M57 D;  1VQP P;  4GT1 A;  4AYC A;  1H89 A;  1KFM A;  4L75 A;  1LP1 A;  1IFD A;  3R4Y A;  3AE8 C;  1LTJ B;  2K9Y A;  3CX5 I;  1DX7 A;  4O9B A;  2FYU D;  3QH9 A;  1ZLL A;  1SQX G;  1X79 B;  5B66 E;  2A06 G;  2PGD A;  2QM8 A;  4IFD K;  1J1E B;  1ZRT E;  2GUV A;  5AW9 B;  4EOT A;  3JC2 2;  3AEF C;  4Z1M H;  3V4Q A;  2Y0E A;  1JY2 N;  1URQ D;  1SQQ E;  5CJ4 A;  2E74 C;  1KIL C;  2KI7 B;  4U3F D;  5AVV B;  1OZH A;  1QL2 A;  3TGU D;  5L8R J;  1PIX A;  1NYH A;  3L74 E;  2C0X A;  2L91 A;  4GOD A;  1JY3 P;  2YIU C;  1Q82 Q;  1EDK A;  1FAV A;  2XZR A;  3H1J G;  1JB0 J;  2FXM A;  3V2R A;  3VP9 A;  3M9B A;  1T8Z A;  2HPC A;  4HB1 A;  4D6T G;  4H13 B;  2YKP A;  5KKZ C;  4OGQ B;  2P1J A;  3L36 A;  2W90 A;  1G1I A;  1KB9 I;  1YIJ P;  2BCC G;  4C7N A;  2O01 H;  2IZ1 A;  3TYY A;  1E5W A;  4H44 C;  2Y0D A;  3AEB C;  1HJB A;  1LT9 B;  5CCG D;  1QL1 A;  3O6Q A;  5H2F H;  2WZ7 A;  5KJ7 A;  2XNX A;  3NMD A;  1T3J A;  1FDM A;  4YXD C;  3U1C A;  4PV1 C;  1JTH A;  1PP9 D;  1ZRT D;  4WY4 D;  1XTC C;  2H43 A;  1SQQ D;  3CI9 A;  4RES B;  1GL2 B;  2E5T A;  5KJ7 C;  4PD4 I;  3N4X A;  5M1B A;  2AXC A;  1D7M A;  1MKM A;  1KZU B;  3RK3 C;  3L74 D;  2N1T D;  2ZXX A;  1KYO H;  1EZV E;  1PL5 A;  2QJK B;  2Q3I A;  2KLU A;  4K3A A;  3I56 P;  3EWK A;  2KYV A;  2QVA A;  3CWB G;  5AW7 B;  1SQX K;  1PV3 A;  3AE7 C;  4KJM A;  3CC7 P;  5AVY B;  2E74 D;  1AV1 A;  3USS A;  3H1K J;  4DZO A;  4GOF A;  1WT6 A;  1S9K E;  3SWF A;  4UB6 H;  5BVZ A;  5KTB A;  1PPJ G;  2I1K A;  4I6M C;  1LTJ C;  3AEE C;  2MJZ A;  3SFE C;  3JSV C;  3HD7 A;  2WT7 B;  1G2C A;  3Q5P A;  1P84 I;  2IYP A;  1RE4 A;  5APV A;  5CBN A;  5B66 H;  3L70 J;  3B5N A;  3E1R A;  2JWA A;  1NAF A;  5E79 E;  2WSF H;  4LLH A;  2J5U A;  2QRX A;  1N2D C;  5AVS B;  1RE4 C;  1FZF A;  1EZV D;  1PGQ A;  1S4X A;  2UWJ E;  3RBZ A;  3PH0 A;  3Q3D A;  2C0W A;  3CD6 P;  5KLV E;  1R8E A;  4PV1 D;  3CX5 H;  5GTH E;  3HUS A;  3V5B A;  2OYH B;  1URQ B;  3NXS A;  3S9O A;  3VMZ A;  2ZVO B;  1KOR A;  1SP4 A;  5B5E H;  5KJ7 D;  4UB8 H;  3E1I A;  2R32 A;  1K9M Q;  1EDI A;  5AW8 B;  2KP8 A;  1LT9 C;  5APT A;  3RK3 D;  3HUS C;  1NWQ A;  2BEQ D;  2PRR A;  2POH A;  1L0L G;  1LTB C;  2R3S A;  1SQB G;  3AE9 C;  2IFN A;  3PTZ A;  3IFM A;  1GTW A;  1N7L A;  3PP5 A;  1H8A A;  2IBZ D;  2HG5 D;  3MZW B;  2D2C D;  3ITK A;  2PAJ A;  1GL2 C;  1QVF O;  5AVR B;  1QVG O;  2FYN B;  4DJG A;  1FZA A;  3L72 G;  2AEF A;  3C8V A;  2SPZ A;  1OW6 A;  3H1K E;  2W83 C;  2QJK C;  3HTK A;  4BRY B;  4I1L A;  2HR3 A;  5KLV D;  1YI2 P;  1KN7 A;  1QLE D;  1OIP A;  1ZN5 A;  4WY4 B;  5KAI E;  3CC2 P;  1IK9 A;  2N9B A;  2RN0 A;  2O1K A;  5CCH A;  3JCU H;  2M5A B;  1VQL P;  2LKM A;  3H1I G;  1RHZ B;  4Y99 B;  2H8P D;  2WSC J;  3L70 E;  4LC1 A;  2N1T B;  2WVR A;  3HD7 D;  4HH2 A;  1U7J A;  3CCL P;  1PFI A;  1J2J B;  3R2P A;  3MD0 A;  1K04 A;  1SLQ A;  3SSU A;  5CCH C;  4XE5 B;  3B5N D;  3VYI A;  3SWK A;  3KHU A;  3BRT B;  1CW5 A;  2JJL A;  1LP1 B;  2W6J H;  3H1J J;  3L71 G;  2NPS A;  4D6T J;  5AVU B;  3G4S P;  2P7J A;  3CXH D;  2BCC J;  3FXE A;  3V2N A;  1Q81 Q;  4HYT B;  2KUB A;  3KDP B;  1GU4 A;  1OW8 A;  2WSF J;  1L0L K;  1SQB K;  5AW0 B;  4YXW H;  3HE4 A;  1U7M A;  5KKZ B;  3D6Z A;  3AE5 C;  1URQ C;  1P84 H;  5GTH H;  1NVO A;  1EDL A;  2A45 I;  4WBA A;  1AVO A;  2CPB A;  3H1L J;  3HE5 A;  1NJI Q;  1KQL A;  3RGU A;  4LGD E;  3L37 A;  4R4M A;  2HPC B;  2IFM A;  2FXP A;  2YKO A;  1PGJ A;  2GA1 A;  1L0N G;  1DIP A;  1AQ5 A;  2OYI A;  1JM0 A;  1VQ9 P;  1JUN A;  4C7N B;  1VQ8 P;  3CCJ P;  1NTZ J;  4TT3 H;  1NTK J;  3O6Q B;  1GMJ A;  4JF7 A;  3AEC C;  2Q5U A;  3V2Q A;  1DD3 A;  3CWB J;  3FGA D;  2FYN C;  2OYI C;  2A06 E;  1JTH B;  1KQS O;  3RK3 B;  2V4H A;  5GTI E;  1S3J A;  3P8C E;  2DW3 A;  3MP7 B;  1YJW P;  1JY2 O;  4OH8 B;  1X0T A;  2HLO A;  4GOE A;  3H25 A;  3OA7 A;  2WMM A;  5CCH D;  1IFI A;  3BVH A;  3L73 G;  1EXI A;  1TU3 F;  2D2C B;  3D70 A;  5KAI H;  1OWA A;  3CMA P;  4Y99 C;  2FY8 A;  3M0D A;  1N73 A;  3H1J E;  2N1T C;  1CZQ A;  3BRV B;  1IFN A;  4IFF A;  1BCC D;  4D6T E;  2ZJS E;  3L75 D;  4I2L C;  1KMI Z;  3P32 A;  4B86 A;  2BCC E;  2NPS D;  4JYC A;  4ASV A;  3GF7 A;  1SFC A;  1NU1 G;  1Y9B A;  4U3F G;  2ZT9 C;  1GU5 A;  2P2U A;  2LXB A;  1KYO D;  2O1J A;  1SQX D;  3HD7 B;  1G2C B;  3VOP A;  1M1J A;  5AW2 B;  1BE3 G;  1VQO P;  3Q1M A;  1T2K C;  4RKU J;  3A2A A;  2ZYD A;  3P8C D;  2YMK A;  3CX5 E;  3H1L E;  3TF5 A;  1FBM A;  4HJG H;  2E76 C;  3B5N B;  2Y9Z A;  1NTM J;  3TK1 A;  2YNY A;  2KSE A;  1SVF A;  1T3U A;  1L0L J;  1L0N K;  5B5E E;  1OMI A;  1SQB J;  4UB8 E;  3A3Y B;  3HRN A;  2GM4 A;  2OQQ A;  3PLN A;  2PP6 A;  4OWF A;  5CJ0 A;  1NTK E;  1SQP J;  2JR8 A;  3H1J D;  1K8A Q;  2E42 A;  2Y0C A;  3E7K A;  1MZ9 A;  3HUS B;  4D6T D;  3CWB E;  1IFJ A;  1FZC A;  3NTN A;  1S5L H;  1CI6 A;  1ZOY C;  1PP9 G;  4KHX A;  2FYZ A;  4RO0 A;  1WMK A;  2RMZ A;  2BCC D;  3L72 J;  5CBO A;  3QWO C;  1NOH A;  1AFO A;  3H1L G;  4JBZ A;  1QX8 A;  3AEA C;  1NH4 A;  5APX A;  2AEJ A;  5K5G B;  1PPJ E;  1KTM A;  3PJS K;  2GUS A;  3Q5R A;  3T97 A;  4BXL A;  1IC2 A;  5AVW B;  3WU2 E;  1OW7 A;  2C9L Y;  1FC2 C;  3CX5 D;  3H1I J;  1LTG C;  1NTZ G;  1NTK G;  3C9I A;  1FOS F;  1W2E A;  5GTI H;  2E75 D;  2QSI A;  1Y47 A;  2WSC H;  3JCU E;  3AE3 C;  1KD1 Q;  4EYY Q;  2K1A A;  2D2C C;  4YPC A;  1H0T A;  4JPZ B;  2ZT9 D;  2RH0 A;  2WPR A;  3L4F A;  1VQK P;  4PD4 E;  1NU1 K;  2XKM A;  4W80 A;  3HTK B;  3KXD A;  4EI2 A;  2B87 A;  2MKV A;  1IJD B;  3L71 J;  2IBZ I;  1T2K D;  3D6Y A;  2ZYA A;  1RY3 A;  2QJP C;  1SFC D;  2E76 D;  2XDJ A;  3A0H H;  2PFX A;  3MUD A;  1S5L X;  1HF9 A; 
#chains in the Genus database with same CATH homology
 1EZV G;  1P84 H;  3CWB G;  1BCC G;  1PP9 G;  2BCC G;  1L0N G;  3L73 G;  3L75 G;  1NU1 G;  3L74 G;  4PD4 H;  3H1H G;  1PPJ G;  3L70 G;  3L71 G;  2FYU G;  1KB9 H;  3BCC G;  3L72 G;  4U3F G;  2IBZ G;  3H1J G;  5KLV G;  1SQQ G;  1KYO H;  3H1L G;  3TGU G;  3CX5 H;  1SQP G;  1SQX G;  4D6T G;  2A06 G;  1NTM G;  1NTZ G;  1BGY G;  3H1I G;  1SQV G;  1L0L G;  1NTK G;  3CXH H;  1BE3 G;  1SQB G;  3H1K G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...