1SFCA

Neuronal synaptic fusion complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
69
structure length
69
Chain Sequence
b'NLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SYNAPTOBREVIN 2)
publication title Crystal structure of a SNARE complex involved in synaptic exocytosis at 2.4 A resolution.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 31
structure length 69
sequence length 69
chains with identical sequence E, I
ec nomenclature
pdb deposition date 1998-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sfcA00
5CCHA 4WY4B 2NPSA 5CCHC 4LGDE 2NPSC 2M8RA 1HVVA 1JTHA 3PP5A 4WY4A 3P8CE 1SFCB 4WY4C 1N7SB 2N1TD 4N78E 2YMYA 1SFCA 1N7SA 1SFCC 1N7SC 3VOPA 3RK2D 5CCGA 5CCGC 1NHLA 1GL2D 3TSIA 2XDJA 1KILD 2HG5D 3RK3B 1L4AD 2N1TB 3M0DC 1XTGB 3RK3D 4W7ZA 2N1TA 2N1TC 3KYQA 3RK2B 4W7YA 1GL2B 1KILB 3RK2C 1GL2A 1L4AB 1GL2C 1KILA 3HTKB 1KILC 3B5ND 1L4AA 1URQD 1L4AC 3RK3C 4W80A 3HD7D 5KJ7D 3RL0D 2H8PD 2KOGA 3B5NB 5CCHD 1URQB 2NPSD 4JF7A 1T3JA 3B5NA 4WY4D 3B5NC 1URQA 1URQC 3HD7B 3RL0B 2HFED 1SFCD 1N7SD 3HD7A 5KJ7A 3HD7C 5KJ7C 3RL0C 5CCGD 4OH8B 2NPSB 2PP6A 1JTHB 2WZ7A
chains in the Genus database with same CATH superfamily
4YTPC 4DJGA 3NFQA 4IFMA 3P8CD 3CMAP 1YJ9P 1ZP0C 1AVOA 4N78E 5KAIH 4NPDA 1VQPP 4QMAA 1SQXK 1U7MA 1J1DC 3WUUA 3CCMP 3TGUJ 3AEBC 1JB0J 3EFGA 3G9RA 3KZIE 4A7PA 2FYUE 1G2CA 1QL1A 1Q81Q 3WU2E 1Q90D 1GW4A 4R4MA 3CCRP 1NTMK 2IBZD 3FWNA 2LXCB 1GL2C 1VQ4P 3HTKB 5DJUB 3H1LG 2A45H 1NWQA 3H1LD 1S1CX 1QVGO 5M1BA 2P10A 3V6IA 2J58A 3GHGC 2XV5A 4WVZA 3BCCJ 4PJ0E 2WQYC 1NTZK 3K5BA 1MKMA 3GF7A 1URQA 4EYYQ 3L74E 4N78D 2V7QH 4ZKUA 1OW6A 3HUSB 1LNQA 2BEZF 3M9HA 5APVA 3KQGA 1SQPK 2WZ7A 1M7LA 4NPFX 2CPBA 2FYUG 1FE6A 1VF5C 5APWA 3H1KJ 1ZV8A 5APSA 1IK9A 2PGDA 4H13B 3AECC 1H88A 2ZXEB 1BE3J 2WWWA 5H2FE 2Q3EA 2Q6QA 3HE5A 1KYOH 1AQ5A 5AW2B 1DH3A 2FXMA 3VMXA 4GKGA 1T2KC 1FBMA 1PPJE 1SQVJ 5AVRB 4K3AA 4UB8H 1J1EC 4IFDK 3LW5H 4I7ZB 5B66E 1E5WA 4C46A 2QM7A 3CCLP 1BCCE 1IZNB 1M1JC 1FDIA 1DD3A 3L74D 1KFMA 1DX7A 1VPCA 5B5EE 2BCCJ 3A0HH 3E7KA 3ABVC 3PHLA 1XTCC 3USSA 3CLQA 2R44A 4PD4I 1OX3A 2E76D 1AJYA 2QRXA 4I1LA 1KQLA 1KORA 2H43A 2I1KA 2FFDB 1NTKJ 1N7SD 3MUDC 1S4XA 3AE8C 3T97B 2RMZA 3HE4A 3NXSA 1PPJG 1NU1K 2OTKE 4PD4E 2R5DA 1JM0A 2NRGA 3VYIA 1PPJD 1ZXGA 5TJHA 2ZXXA 1BCCG 1AV1A 3VMZA 1Y9BA 2KK7A 1BCCD 3Q1MA 2QIWA 3NMDA 1RH5B 1HGZA 2MJZA 1VQ9P 1K8AQ 2WPRA 5CBNA 1GK4A 1OXZA 1GL2A 1S5LE 1LTJB 1W5CE 3IN6A 1U57A 1YQ3C 3JSVC 2ZYAA 3AE3C 3CXHI 3B5ND 4GIFA 2QSIA 2YO2A 3VP9A 1JY3P 5AVVB 3O6QB 3GHGA 3GG2A 2WSCH 2O3JA 1JMBA 5CBOA 3H1LJ 5CCHD 4HJGH 1CSBA 1FZCA 4PD4D 3A7OA 3M9QA 1RE4A 1WRGA 1L0LE 2JO1A 1OVRA 3C1LA 3AEGC 3MZWB 1U7JA 4YXWH 2KLVA 4AUWA 1EDJA 3CXHE 5CCGD 2E76B 2IYPA 2QG4A 1FZGA 1NAYA 4ASVA 1SQQE 3TNUB 1N7SB 3I56P 5AW1B 2OYHB 4RESB 2H89C 2FYUJ 1NHLA 3L73E 2IPPA 3B71A 2KSJA 3CX5H 5APQA 4XFJA 5TISH 2WITA 4H44D 2YXQB 4DOJA 3JC22 1ZLLA 1M1JA 1RF0C 3AE5C 2R3SA 4EI2A 5CJ4A 1L0LD 3Q5RA 2O01N 3CXHD 2H88C 2ZVOB 2NZ2A 5KLVK 5BU8B 3L74J 2IYOA 1SQQG 3B5NB 4TLFA 5APTA 1SQQD 1L0NE 1N86A 1IFDA 3MUDA 2R32A 1GU5A 3L73G 3QH9A 4GOFA 5BU5A 1Y47A 2E74D 1CI6A 4IL6X 3HUSC 3CCSP 4UB6H 1JMMA 1FU1A 1OW8A 5KAIE 1N73C 5AW6B 4RO0A 1JCDA 2A45I 2HYNA 3H32B 1NKZB 1IFMA 1IFJA 1FZEA 5GTIH 5CMZA 2KUBA 2YNYA 2QJPB 5E79H 1W2EA 1SQVK 1BCCJ 3CCEP 2W90A 1LTGC 3VN0A 3H1HE 4N6JA 1L0NG 3Q2YA 4HB1A 1PIXA 1ZR4A 1SS1A 2WSEH 1DEBA 1L0ND 1KILE 1RF1B 2WT7A 1H0TB 5KKZC 3IF4A 5KTBA 4H0LD 4H44B 2E5YA 4W80A 2HPCA 1N7LA 3WUVA 2AXCA 5AVTB 4C7NA 2C9NY 4BXLA 1S3JA 2PRRA 2BCCD 1Q2NA 4WWIA 2XZRA 4JF7A 4I2LC 1RQUA 1NTKK 2WSFJ 3M06A 1KYOI 1PGQA 1K05A 4LLHA 1VDFA 2FFDC 3SWYA 1ZRTE 4IOIH 3SWFA 1R5LA 1MV8A 2PP6A 2QEXP 3D70A 3SSUA 4R4LA 1HVVA 3PP5A 4DCKA 2KYVA 2YXRB 4O9BA 1ZR2A 3H1HG 4HKZH 2WMMA 3LIDA 1QX8A 1S72P 2O01H 3H1HD 4U3FD 1OW7A 1VL2A 3L75E 2A45G 1KYOE 2XDJA 1KILD 4H13D 3NTNA 1OMIA 3AE1C 2VRSA 1PP9G 3AEDC 5BVZA 1EDIA 4UB8E 1NTME 1LJ2A 1JY2P 1RF0A 1OZHA 1EQ7A 1PGJA 3R2PA 1WMKA 1LTJC 3HTKA 3A0HE 1GD2E 4EDFA 1VQNP 3HD7D 1ZRTD 1BSHA 2Y0CA 2C9LY 3KXDA 5DJTB 3VMYA 3V4WA 1NTZE 1OFCX 2QJYB 1L0LJ 2H7HA 1HH0A 2NPSD 1PV3A 1VQOP 4H0LB 2UWJE 4GOEA 1PL5A 4WY4D 1Z56A 3PLNA 3L75G 1YTZI 1SQXG 3L70E 1SQQJ 2J59M 2DW3A 3G6EP 1YBKA 1KYOD 1SQPE 2ZYDA 2A06E 3PJSK 1M1KQ 3HUSA 3L72E 2E76C 2WPVB 3TDKA 1IO4A 1EDKA 1N73A 1NTMG 3AE7C 3CC7P 2N1TD 3L73J 1NO4A 3MP7B 1NTMD 1X8YA 1N7SC 4B86A 2P58A 1SQBK 4OWFA 2OYHC 3OA7A 3F89A 1USDA 4I6MC 2YKPA 4L75A 5AVYB 1LT1A 1K73Q 2FYUD 1M56D 3BVHA 3P7KA 1NTZG 1ZOYC 1LGHB 4NPEA 1KILB 2FYNC 3W67A 1NOHA 2B87B 1LTTC 1Q82Q 3L70G 4C7RA 2IDBA 3AEEC 3L36A 5APYA 1SQPG 2I1JA 2A06G 1L0NJ 3L72G 3CWBG 2A06D 2KXPB 3L72D 1KV4A 2B9BA 1T3JA 2D2CD 3I5CA 3B5NC 1AQTA 3HD7B 1KQFB 3CX5I 3IR9A 1OVUA 1SFCD 1T8ZA 3Q3DA 3MD0A 1IFPA 2NPSB 2AEFA 3H1JE 3MTUE 1NGMB 4DT0A 1GU4A 3V2RA 4WY4B 5CCHC 1NKNA 1NU1E 3T97A 5AVSB 2I8DA 3CD6P 1OVVA 3SFEC 1LTAC 3V2QA 2E42A 1LWUB 4HYTB 2Y9YA 5CCGC 2K88A 3PRJA 2N9BA 3CX5E 5KLIB 2SPZA 3E1RA 1N2DC 3RK3B 3H1HJ 1L4AD 4U3FJ 2N1TB 2P67A 5TISE 3KYQA 1NJIQ 3H1IE 2QJPC 1LP1B 1PFIA 1GDTA 3Q5SA 3M0AA 1AVYA 2FXPA 5APXA 1LTJA 2OTLP 3S1KA 2IX7C 3H1JG 4ZKPA 5AVXB 1DD4A 3RL0D 2GUSA 1HJ0A 4H44C 3H1JD 2V7QJ 2O1JA 3O6QA 1NU1G 2HLOA 3A0BH 2KS1A 1NU1D 1GTWA 4ZMDA 1VQMP 3CCJP 1HTLC 1FAVA 3V2NA 2RH0A 3L71E 5CJ0A 1YI2P 1K04A 1R5SA 1S9KE 2Q3IA 1NYHA 4UB6E 2D2CB 4WBAA 1JTHB 2OYIB 1OWAA 3BATA 4WB4A 3L75J 2W6AA 3H1IG 2AEMA 5KAFH 1KN7A 1SFCB 3ZDMA 1LT9B 1M57D 2L5GB 1JEKA 1P84H 1N7SA 1DIPA 2YKQA 1UIIA 5GTIE 1EXJA 2E74C 2KP8A 1NTMJ 5E79E 1S2EA 3LW5J 1ZMEC 4Z1MH 3N4XA 3M0DC 1IFIA 2M5AB 3R4YA 2AXTH 3P8MC 4KT0J 1FZCB 2ZJSE 3FWLA 1L4AB 3EFFK 1JY3N 2KNCA 3GW6A 3L71G 2W6JH 2K9JB 1NTZJ 2LKMA 3L71D 3O8ZA 1YIJP 4YXDC 5KLVE 1L0LK 2FXOA 1S9KD 2P7JA 1GW3A 2E5TA 2IZ1A 3L70J 1ZN5A 4LC1A 4BWNA 2W27A 2P1JA 3B5NA 1SQPJ 2QJYC 1A02F 1S5LX 4H0LC 3L72J 3RL0B 1HUCA 2O1KA 1JO5A 1W2BO 1LTSC 2BASA 2Y9ZA 3CL3D 1MUUA 5CCHA 3OAKA 1QL2A 3ITKA 3EWKA 5CCGA 1G1JA 3FXDA 3L73D 3S4RA 3H32A 1RQVA 1KQGB 5C39A 5KLVG 1E79H 3CI9A 4BRYB 3LIEA 5KLVD 4L76A 2Q9IA 2XNDH 1IK7A 1USEA 1M90Q 2WSCJ 1KILC 4H13C 2B89A 1VQ8P 4CPGA 2E75B 3P32A 1QEXA 3A5TA 2Z4EA 1FS0E 1H0TA 4OGQD 5KJ7D 1CI6B 4IL6H 1YTZT 3D6ZA 1PZQA 2LR2A 3B4SA 3H1JJ 4I7ZC 2Y0EA 3QWOC 1AA0A 3HD7C 1HF9A 1NU1J 2POHA 5AW4B 2C0WA 1PP9E 1KB9H 2QJKB 3I55P 3VTPC 2GUVA 3VP8A 2WSSH 3EQ2A 3CMEP 1FOSE 4LGDE 2NPSC 2M8RA 1BGYE 2QM8A 5AW9B 2IBZI 3P8CE 4WY4C 3GMAA 1Q7YQ 4L74A 1KMIZ 3TK1A 3CC2P 4GDOA 3WUTA 1FZAA 3GF3A 3H1IJ 3V2PA 1LWUC 3A3YB 2JEEA 2PAJA 3M0DA 4GODA 2HPCB 2E43A 1BDCA 4W7ZA 1Q86Q 1FOSF 2HODB 2N1TC 3MHVA 4W7YA 1NTKG 3CCUP 1SQXE 2W83C 1JUNA 1J2JB 2IBZE 3FGAD 1SP4A 1T3UA 4PV1D 1URQD 1H89A 3L35A 3RBXA 1RHZB 3AE4C 3RK3E 4Y28J 1PP9D 3IAOA 2H8PD 2KB7P 1X0TA 1BGYG 1EC5A 1ZW0A 3L71J 2ZVNB 1BGYD 1VQLP 4OGQB 1MZ9A 1KTMA 2GA1A 2Q1KA 2W8ZA 3CC4P 4N3YB 4JYBA 2BEQD 1SLQA 3S9OA 4MN4C 1TU3F 2D2CC 2OYIC 3B8EB 2Z5IA 2ZFCA 1IFNA 3D71A 2IBZG 1SQBE 1SFCC 3L75D 1LT9C 1SQXD 5AW7B 3RK2D 2FYZA 2K1AA 3TSIA 2HG5D 1YITP 4YPCA 3CCQP 1G2CB 3CWBE 2WSEJ 3C8VA 1XTGB 5AW8B 3RK3D 1A02J 1VQKP 1JY2N 3L37A 4JPZB 2FYUK 1FDMA 2KZJA 3JCUH 2KIKA 5L8RJ 2V4HA 2W6BA 2WPQA 1HBWA 1KILA 5KLVJ 4Y99B 2B88A 4EIJA 2WTYA 1EXIA 1FZCC 2Y0DA 1L4AC 4TT3H 2B87A 1CW5A 1RE4C 3A2AA 5APUA 1H8AA 2ZT9D 2R5BA 2RKLA 1P84I 2M3BA 3A0BE 3F5HA 3V4QA 1NTZD 4L73A 4PV1B 2OYOA 2YIUB 1N73B 1URQB 1RE3C 5GTHH 1CZQA 3W68A 2J5UA 1T6AA 1SQBG 2KLUA 2K3RA 1SQBD 3L70D 2OQQA 3HD7A 5EFWB 2AEJA 1KC8Q 3RL0C 1SQPD 4OH8B 2O01J 2C0XA 2K9YA 2JWAA 2NPSA 3M91A 4RKUJ 3CWBD 5KAFE 4D6TE 4WY4A 1P84E 2Q7CA 2YMYA 1LTBC 3PH0A 2FFDA 1JY3O 3HE5B 1JOCA 1GL2D 5KKZB 1LWUA 3L74G 3MIWA 1YJNP 2AXTE 4AQRD 3U1AA 2CPSA 2N1TA 3BRTB 3RK2B 3KZIH 3WU2H 1KFNA 1LP1A 3TYYA 2XNXA 3RBZA 3AEAC 3U1CA 1X9VA 3E1IA 3IFMA 3AE9C 4JBZA 2E75C 4D6TG 2R3CA 1VF5D 4PJ0H 4D6TD 2K37A 2PFXA 1PP9J 5AW5B 3KDPB 1P84D 1VQ6P 1VQ7P 2WPSA 2ZT9B 3Q5PA 2OGUA 1RF1C 3H25A 1BGYJ 1VQ5P 2JJLA 3HE4B 1FJPA 2JR8A 2QJKC 1EZVI 1YYCA 1JTHA 2OYIA 3KHUA 4KHXA 1T2KD 2XU6A 1SFCA 1LT9A 3AE2C 1J1DB 2YO3A 1GK6A 3G71P 3BASA 3CX5D 3HRNA 2FY8A 1BSNA 5H2FH 1SQXJ 1G1IA 1MFTA 3MGNA 1KQSO 3H1ID 2KSEA 3TNUA 2M5AA 1EZVE 1GL2B 3TGUE 1NH4A 2KS1B 1BDDA 2OYHA 1YQ4C 1KB9I 3RGUA 1X79B 2LXBA 5B66H 1L4AA 1JNMA 1YHQP 1QVFO 3GHGB 2XKMA 1HGVA 2K9JA 4IL6E 1KD1Q 1FZBA 1MFZA 2E75D 1YJWP 2GM4A 5B5EH 1HJBA 2Q5UA 2KOGA 3OW2O 1QGKB 1RE3A 2OARA 5AW0B 4AYCA 1HWTC 2ZYGA 3VMAA 3BCCE 1UIXA 1KB9E 2JKVA 1QLED 4OGQC 2QA4P 5KJ7C 2YKOA 1VF5B 1NAFA 1JCCA 2WSFH 2WVRA 1SQBJ 3N7NA 4U7JA 4JQ0D 1EZVG 3TGUG 2Z5HA 1SQQK 5AVQB 2ITAA 1GZLA 1L2PA 1EZVD 2FYNB 3CWBJ 4PD4H 3TGUD 4IFFA 3AE6C 3VOPA 5AVWB 2KNCB 1IC2A 3H1KE 4EOTA 1L0LG 2G3AA 2CK3H 1R8EA 1IJDB 1BE3E 1NVOA 3H6PA 3C9IA 3CCVP 1J1EB 2M3EA 4BRYA 4GT1A 1M1JB 1FDOA 2JP3A 3BCCG 3L4FA 3D6YA 2ZAEB 1S5LH 2OTJP 3G3ZA 3BCCD 4Y99C 1EDLA 1SQVE 3V5BA 1KB9D 2IFNA 1N8RQ 5AW3B 2KI7B 1K9MQ 5AVUB 3U59A 2BCCE 3RL0g 4PV1C 2YIUC 1URQC 1L0NK 3FX0A 2RN0A 1RF1A 2HFED 3H1KG 4D6TJ 3FXEA 4RJTA 1PGPA 1OIPA 3G4SP 2JWDA 3H1KD 1DEEG 3M9BA 4OVNF 2QVAA 3CXHH 3SWKA 1NTKE 1BE3G 3GLMA 1JY2O 2L91A 1BE3D 2P2UA 2JDIH 4M3LA 1X22A 2QE7H 4U3FE 4ZNCA 1FJKA 1LTIC 3CPWO 5K5GB 1SQVG 1PGOA 1FZFA 3WMM0 2YMKA 1SQVD 4K35A 1Y8AA 4KJMA 2KZIA 3PTZA 3AEFC 1AFOA 3JCUE 2IZ0A 1M8OB 2BCCG 2HODA 3RK2C 2IFMA 2FBWC 2WT7B 2N9YB 3II6A 4ASWA 5AVZB 3TF5A 3KPEA 4DZOA 5KLIC 3RK3C 3UIAA 4C7NB 4HH2A 2M0BA 1WT6A 3SFDC 5CHXA 2FKWB 2MKVA 5GTHE 1RY3A 1NTKD 1KZUB 3OJAB 1GMJA 1SVFA 2G8YA 1D7MA 4XA4A 4U3FG 4JYCA 2HR3A 3H1LE 4XE5B 5KJ7A 2E74B 2ZT9C 1FC2C 3BRVB
chains in the Genus database with same CATH topology
2NPSA 3M91A 3BATA 4WB4A 2W6AA 1JMMA 1FU1A 3NFQA 4IFMA 3P8CD 4WY4A 1N73C 1SFCB 1LT9B 2Q7CA 5AW6B 2L5GB 4N78E 2YMYA 1JCDA 2A45I 1LTBC 1N7SA 2FFDA 2YKQA 1JY3O 2HYNA 3HE5B 1JOCA 3H32B 1NKZB 1GL2D 1SQXK 1IFMA 1LWUA 3MIWA 1IFJA 1J1DC 1FZEA 2KP8A 5CMZA 2YNYA 3N4XA 3M0DC 3EFGA 4AQRD 1W2EA 1IFIA 3U1AA 1G2CA 2CPSA 1QL1A 2N1TA 1SQVK 3BRTB 3RK2B 1LTGC 3P8MC 3VN0A 1GW4A 4N6JA 1NTMK 1FZCB 1KFNA 1ZR4A 3TYYA 2XNXA 1L4AB 1GL2C 2WSEH 1DEBA 3HTKB 1JY3N 1RF1B 2WT7A 3U1CA 1X9VA 3E1IA 5KTBA 2LKMA 2A45H 3IFMA 1NWQA 3O8ZA 4W80A 2HPCA 1N7LA 2J58A 1L0LK 3GHGC 1S9KD 2XV5A 2P7JA 5AVTB 4C7NA 2C9NY 1GW3A 1ZN5A 2R3CA 1NTZK 2XZRA 4JF7A 4LC1A 4I2LC 2W27A 2P1JA 1NTKK 5AW5B 3B5NA 3KDPB 3M06A 1URQA 1A02F 2WPSA 4N78D 4LLHA 3RL0B 1HUCA 1RF1C 1VDFA 2O1KA 4ZKUA 1JO5A 2FFDC 3SWYA 3HUSB 1LTSC 2BASA 3SWFA 3CL3D 1MV8A 2PP6A 2JJLA 3M9HA 5APVA 1MUUA 3HE4B 3KQGA 1SQPK 1FJPA 2WZ7A 1M7LA 2CPBA 5CCHA 1YYCA 3OAKA 1HVVA 1JTHA 2OYIA 3PP5A 5APWA 2KYVA 4O9BA 1ZR2A 1QL2A 4KHXA 1T2KD 2XU6A 3LIDA 2O01H 1ZV8A 1SFCA 5APSA 1LT9A 1IK9A 1J1DB 1H88A 2ZXEB 5CCGA 2A45G 2YO3A 1GK6A 1G1JA 2XDJA 2WWWA 3BASA 1OWAA 1KILD 3NTNA 3HRNA 3HE5A 3H32A 1AQ5A 5AW2B 1DH3A 1G1IA 2FXMA 3VMXA 2VRSA 3CI9A 3LIEA 4GKGA 3MGNA 5BVZA 1T2KC 1FBMA 3TNUA 2Q9IA 1GL2B 1NH4A 2OYHA 5AVRB 4IFDK 1J1EC 3LW5H 1JY2P 1X79B 1E5WA 1KILC 1RF0A 4C46A 2QM7A 1EQ7A 3R2PA 1M1JC 1L4AA 1LTJC 1JNMA 3HTKA 1KFMA 1GD2E 3GHGB 2XKMA 3P32A 1DX7A 1VPCA 1HGVA 3A5TA 2Z4EA 3HD7D 5KJ7D 1FZBA 1CI6B 1MFZA 2GM4A 2C9LY 1XTCC 3CLQA 1HJBA 2Q5UA 3VMYA 2KOGA 3V4WA 1YTZT 2H7HA 1HH0A 2NPSD 1RE3A 4I1LA 1KQLA 2OARA 2H43A 5AW0B 4AYCA 1HWTC 2I1KA 1Z56A 4WY4D 2FFDB 1YTZI 1N7SD 3HD7C 5KJ7C 2POHA 5AW4B 2C0WA 2J59M 2YKOA 3VTPC 1NAFA 2GUVA 1JCCA 3HUSA 2WSFH 3VP8A 1IO4A 3EQ2A 1FOSE 4LGDE 2NPSC 2M8RA 3N7NA 3HE4A 2QM8A 5AW9B 1N73A 3NXSA 3P8CE 4WY4C 2Z5HA 1NU1K 1SQQK 5AVQB 2N1TD 2R5DA 1GZLA 1NO4A 3VYIA 1X8YA 1N7SC 4IFFA 4B86A 3VOPA 5AVWB 1SQBK 3TK1A 2OYHC 1IC2A 3VMZA 1FZAA 3OA7A 3V2PA 1LWUC 4EOTA 3A3YB 2JEEA 4I6MC 2PAJA 2YKPA 3NMDA 5AVYB 3M0DA 2HPCB 1IJDB 2E43A 4W7ZA 1FOSF 3H6PA 3BVHA 3C9IA 2HODB 1HGZA 2N1TC 3P7KA 2MJZA 1J1EB 4W7YA 2WPRA 1LGHB 4GT1A 1GK4A 1KILB 1JUNA 1M1JB 1OXZA 1J2JB 1GL2A 1LTJB 1SP4A 1T3UA 3L4FA 1NOHA 3B5ND 1LTTC 4C7RA 1URQD 3G3ZA 1H89A 3L35A 4GIFA 3L36A 4Y99C 5APYA 3V5BA 2YO2A 2I1JA 2IFNA 3VP9A 1JY3P 5AVVB 5AW3B 3GHGA 2WSCH 2H8PD 2KB7P 5AVUB 5CCHD 3U59A 1CSBA 1T3JA 3I5CA 1FZCA 3B5NC 1URQC 1L0NK 3HD7B 3A7OA 3M9QA 3IR9A 1RE4A 1WRGA 1RF1A 1MZ9A 2HFED 1SFCD 1T8ZA 2KLVA 4AUWA 5CCGD 3MD0A 3M9BA 2NPSB 3MTUE 4N3YB 1FZGA 1GU4A 4JYBA 3V2RA 4WY4B 1SLQA 5CCHC 1JY2O 1NKNA 3T97A 2OYIC 5AVSB 3B8EB 3TNUB 1N7SB 2Z5IA 2P2UA 2ZFCA 1IFNA 5AW1B 2OYHB 4RESB 1LTAC 3V2QA 2E42A 1SFCC 4M3LA 1LT9C 1LWUB 5AW7B 3RK2D 2FYZA 4HYTB 5CCGC 1NHLA 1FJKA 1LTIC 3TSIA 2HG5D 2N9BA 1FZFA 2IPPA 2KSJA 1N2DC 3RK3B 3WMM0 1G2CB 1L4AD 2N1TB 2P67A 5APQA 1XTGB 5AW8B 3RK3D 1A02J 1JY2N 3L37A 2WITA 3KYQA 1AFOA 2FYUK 1FDMA 2HODA 1PFIA 1GDTA 3RK2C 2IFMA 4DOJA 2W6BA 2WT7B 2WPQA 1ZLLA 1HBWA 1KILA 3II6A 4Y99B 5AVZB 3M0AA 4EIJA 2WTYA 1M1JA 1RF0C 5APXA 1FZCC 1LTJA 1L4AC 3KPEA 4DZOA 1CW5A 5CJ4A 1RE4C 2IX7C 3RK3C 3UIAA 4C7NB 4ZKPA 3A2AA 4HH2A 5APUA 1H8AA 2R5BA 5AVXB 1WT6A 3RL0D 2GUSA 5CHXA 5KLVK 2M3BA 2FKWB 5BU8B 2O1JA 3V4QA 1RY3A 2HLOA 3B5NB 1N73B 1KZUB 1URQB 3OJAB 5APTA 1RE3C 1CZQA 1SVFA 1GTWA 1HTLC 1FAVA 3V2NA 4XA4A 1N86A 4JYCA 1IFDA 5CJ0A 3MUDA 3HD7A 2R32A 4XE5B 5KJ7A 1GU5A 3RL0C 4OH8B 1S9KE 5BU5A 2Q3IA 3BRVB 2C0XA 1CI6A 4WBAA 1JTHB 2OYIB 3HUSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCH A;  4WY4 B;  2NPS A;  5CCH C;  4LGD E;  2NPS C;  2M8R A;  1HVV A;  1JTH A;  3PP5 A;  4WY4 A;  3P8C E;  1SFC B;  4WY4 C;  1N7S B;  2N1T D;  4N78 E;  2YMY A;  1SFC A;  1N7S A;  1SFC C;  1N7S C;  3VOP A;  3RK2 D;  5CCG A;  5CCG C;  1NHL A;  1GL2 D;  3TSI A;  2XDJ A;  1KIL D;  2HG5 D;  3RK3 B;  1L4A D;  2N1T B;  3M0D C;  1XTG B;  3RK3 D;  4W7Z A;  2N1T A;  2N1T C;  3KYQ A;  3RK2 B;  4W7Y A;  1GL2 B;  1KIL B;  3RK2 C;  1GL2 A;  1L4A B;  1GL2 C;  1KIL A;  3HTK B;  1KIL C;  3B5N D;  1L4A A;  1URQ D;  1L4A C;  3RK3 C;  4W80 A;  3HD7 D;  5KJ7 D;  3RL0 D;  2H8P D;  2KOG A;  3B5N B;  5CCH D;  1URQ B;  2NPS D;  4JF7 A;  1T3J A;  3B5N A;  4WY4 D;  3B5N C;  1URQ A;  1URQ C;  3HD7 B;  3RL0 B;  2HFE D;  1SFC D;  1N7S D;  3HD7 A;  5KJ7 A;  3HD7 C;  5KJ7 C;  3RL0 C;  5CCG D;  4OH8 B;  2NPS B;  2PP6 A;  1JTH B;  2WZ7 A; 
#chains in the Genus database with same CATH topology
 4YTP C;  4DJG A;  3NFQ A;  4IFM A;  3P8C D;  3CMA P;  1YJ9 P;  1ZP0 C;  1AVO A;  4N78 E;  5KAI H;  4NPD A;  1VQP P;  4QMA A;  1SQX K;  1U7M A;  1J1D C;  3WUU A;  3CCM P;  3TGU J;  3AEB C;  1JB0 J;  3EFG A;  3G9R A;  3KZI E;  4A7P A;  2FYU E;  1G2C A;  1QL1 A;  1Q81 Q;  3WU2 E;  1Q90 D;  1GW4 A;  4R4M A;  3CCR P;  1NTM K;  2IBZ D;  3FWN A;  2LXC B;  1GL2 C;  1VQ4 P;  3HTK B;  5DJU B;  3H1L G;  2A45 H;  1NWQ A;  3H1L D;  1S1C X;  1QVG O;  5M1B A;  2P10 A;  3V6I A;  2J58 A;  3GHG C;  2XV5 A;  4WVZ A;  3BCC J;  4PJ0 E;  2WQY C;  1NTZ K;  3K5B A;  1MKM A;  3GF7 A;  1URQ A;  4EYY Q;  3L74 E;  4N78 D;  2V7Q H;  4ZKU A;  1OW6 A;  3HUS B;  1LNQ A;  2BEZ F;  3M9H A;  5APV A;  3KQG A;  1SQP K;  2WZ7 A;  1M7L A;  4NPF X;  2CPB A;  2FYU G;  1FE6 A;  1VF5 C;  5APW A;  3H1K J;  1ZV8 A;  5APS A;  1IK9 A;  2PGD A;  4H13 B;  3AEC C;  1H88 A;  2ZXE B;  1BE3 J;  2WWW A;  5H2F E;  2Q3E A;  2Q6Q A;  3HE5 A;  1KYO H;  1AQ5 A;  5AW2 B;  1DH3 A;  2FXM A;  3VMX A;  4GKG A;  1T2K C;  1FBM A;  1PPJ E;  1SQV J;  5AVR B;  4K3A A;  4UB8 H;  1J1E C;  4IFD K;  3LW5 H;  4I7Z B;  5B66 E;  1E5W A;  4C46 A;  2QM7 A;  3CCL P;  1BCC E;  1IZN B;  1M1J C;  1FDI A;  1DD3 A;  3L74 D;  1KFM A;  1DX7 A;  1VPC A;  5B5E E;  2BCC J;  3A0H H;  3E7K A;  3ABV C;  3PHL A;  1XTC C;  3USS A;  3CLQ A;  2R44 A;  4PD4 I;  1OX3 A;  2E76 D;  1AJY A;  2QRX A;  4I1L A;  1KQL A;  1KOR A;  2H43 A;  2I1K A;  2FFD B;  1NTK J;  1N7S D;  3MUD C;  1S4X A;  3AE8 C;  3T97 B;  2RMZ A;  3HE4 A;  3NXS A;  1PPJ G;  1NU1 K;  2OTK E;  4PD4 E;  2R5D A;  1JM0 A;  2NRG A;  3VYI A;  1PPJ D;  1ZXG A;  5TJH A;  2ZXX A;  1BCC G;  1AV1 A;  3VMZ A;  1Y9B A;  2KK7 A;  1BCC D;  3Q1M A;  2QIW A;  3NMD A;  1RH5 B;  1HGZ A;  2MJZ A;  1VQ9 P;  1K8A Q;  2WPR A;  5CBN A;  1GK4 A;  1OXZ A;  1GL2 A;  1S5L E;  1LTJ B;  1W5C E;  3IN6 A;  1U57 A;  1YQ3 C;  3JSV C;  2ZYA A;  3AE3 C;  3CXH I;  3B5N D;  4GIF A;  2QSI A;  2YO2 A;  3VP9 A;  1JY3 P;  5AVV B;  3O6Q B;  3GHG A;  3GG2 A;  2WSC H;  2O3J A;  1JMB A;  5CBO A;  3H1L J;  5CCH D;  4HJG H;  1CSB A;  1FZC A;  4PD4 D;  3A7O A;  3M9Q A;  1RE4 A;  1WRG A;  1L0L E;  2JO1 A;  1OVR A;  3C1L A;  3AEG C;  3MZW B;  1U7J A;  4YXW H;  2KLV A;  4AUW A;  1EDJ A;  3CXH E;  5CCG D;  2E76 B;  2IYP A;  2QG4 A;  1FZG A;  1NAY A;  4ASV A;  1SQQ E;  3TNU B;  1N7S B;  3I56 P;  5AW1 B;  2OYH B;  4RES B;  2H89 C;  2FYU J;  1NHL A;  3L73 E;  2IPP A;  3B71 A;  2KSJ A;  3CX5 H;  5APQ A;  4XFJ A;  5TIS H;  2WIT A;  4H44 D;  2YXQ B;  4DOJ A;  3JC2 2;  1ZLL A;  1M1J A;  1RF0 C;  3AE5 C;  2R3S A;  4EI2 A;  5CJ4 A;  1L0L D;  3Q5R A;  2O01 N;  3CXH D;  2H88 C;  2ZVO B;  2NZ2 A;  5KLV K;  5BU8 B;  3L74 J;  2IYO A;  1SQQ G;  3B5N B;  4TLF A;  5APT A;  1SQQ D;  1L0N E;  1N86 A;  1IFD A;  3MUD A;  2R32 A;  1GU5 A;  3L73 G;  3QH9 A;  4GOF A;  5BU5 A;  1Y47 A;  2E74 D;  1CI6 A;  4IL6 X;  3HUS C;  3CCS P;  4UB6 H;  1JMM A;  1FU1 A;  1OW8 A;  5KAI E;  1N73 C;  5AW6 B;  4RO0 A;  1JCD A;  2A45 I;  2HYN A;  3H32 B;  1NKZ B;  1IFM A;  1IFJ A;  1FZE A;  5GTI H;  5CMZ A;  2KUB A;  2YNY A;  2QJP B;  5E79 H;  1W2E A;  1SQV K;  1BCC J;  3CCE P;  2W90 A;  1LTG C;  3VN0 A;  3H1H E;  4N6J A;  1L0N G;  3Q2Y A;  4HB1 A;  1PIX A;  1ZR4 A;  1SS1 A;  2WSE H;  1DEB A;  1L0N D;  1KIL E;  1RF1 B;  2WT7 A;  1H0T B;  5KKZ C;  3IF4 A;  5KTB A;  4H0L D;  4H44 B;  2E5Y A;  4W80 A;  2HPC A;  1N7L A;  3WUV A;  2AXC A;  5AVT B;  4C7N A;  2C9N Y;  4BXL A;  1S3J A;  2PRR A;  2BCC D;  1Q2N A;  4WWI A;  2XZR A;  4JF7 A;  4I2L C;  1RQU A;  1NTK K;  2WSF J;  3M06 A;  1KYO I;  1PGQ A;  1K05 A;  4LLH A;  1VDF A;  2FFD C;  3SWY A;  1ZRT E;  4IOI H;  3SWF A;  1R5L A;  1MV8 A;  2PP6 A;  2QEX P;  3D70 A;  3SSU A;  4R4L A;  1HVV A;  3PP5 A;  4DCK A;  2KYV A;  2YXR B;  4O9B A;  1ZR2 A;  3H1H G;  4HKZ H;  2WMM A;  3LID A;  1QX8 A;  1S72 P;  2O01 H;  3H1H D;  4U3F D;  1OW7 A;  1VL2 A;  3L75 E;  2A45 G;  1KYO E;  2XDJ A;  1KIL D;  4H13 D;  3NTN A;  1OMI A;  3AE1 C;  2VRS A;  1PP9 G;  3AED C;  5BVZ A;  1EDI A;  4UB8 E;  1NTM E;  1LJ2 A;  1JY2 P;  1RF0 A;  1OZH A;  1EQ7 A;  1PGJ A;  3R2P A;  1WMK A;  1LTJ C;  3HTK A;  3A0H E;  1GD2 E;  4EDF A;  1VQN P;  3HD7 D;  1ZRT D;  1BSH A;  2Y0C A;  2C9L Y;  3KXD A;  5DJT B;  3VMY A;  3V4W A;  1NTZ E;  1OFC X;  2QJY B;  1L0L J;  2H7H A;  1HH0 A;  2NPS D;  1PV3 A;  1VQO P;  4H0L B;  2UWJ E;  4GOE A;  1PL5 A;  4WY4 D;  1Z56 A;  3PLN A;  3L75 G;  1YTZ I;  1SQX G;  3L70 E;  1SQQ J;  2J59 M;  2DW3 A;  3G6E P;  1YBK A;  1KYO D;  1SQP E;  2ZYD A;  2A06 E;  3PJS K;  1M1K Q;  3HUS A;  3L72 E;  2E76 C;  2WPV B;  3TDK A;  1IO4 A;  1EDK A;  1N73 A;  1NTM G;  3AE7 C;  3CC7 P;  2N1T D;  3L73 J;  1NO4 A;  3MP7 B;  1NTM D;  1X8Y A;  1N7S C;  4B86 A;  2P58 A;  1SQB K;  4OWF A;  2OYH C;  3OA7 A;  3F89 A;  1USD A;  4I6M C;  2YKP A;  4L75 A;  5AVY B;  1LT1 A;  1K73 Q;  2FYU D;  1M56 D;  3BVH A;  3P7K A;  1NTZ G;  1ZOY C;  1LGH B;  4NPE A;  1KIL B;  2FYN C;  3W67 A;  1NOH A;  2B87 B;  1LTT C;  1Q82 Q;  3L70 G;  4C7R A;  2IDB A;  3AEE C;  3L36 A;  5APY A;  1SQP G;  2I1J A;  2A06 G;  1L0N J;  3L72 G;  3CWB G;  2A06 D;  2KXP B;  3L72 D;  1KV4 A;  2B9B A;  1T3J A;  2D2C D;  3I5C A;  3B5N C;  1AQT A;  3HD7 B;  1KQF B;  3CX5 I;  3IR9 A;  1OVU A;  1SFC D;  1T8Z A;  3Q3D A;  3MD0 A;  1IFP A;  2NPS B;  2AEF A;  3H1J E;  3MTU E;  1NGM B;  4DT0 A;  1GU4 A;  3V2R A;  4WY4 B;  5CCH C;  1NKN A;  1NU1 E;  3T97 A;  5AVS B;  2I8D A;  3CD6 P;  1OVV A;  3SFE C;  1LTA C;  3V2Q A;  2E42 A;  1LWU B;  4HYT B;  2Y9Y A;  5CCG C;  2K88 A;  3PRJ A;  2N9B A;  3CX5 E;  5KLI B;  2SPZ A;  3E1R A;  1N2D C;  3RK3 B;  3H1H J;  1L4A D;  4U3F J;  2N1T B;  2P67 A;  5TIS E;  3KYQ A;  1NJI Q;  3H1I E;  2QJP C;  1LP1 B;  1PFI A;  1GDT A;  3Q5S A;  3M0A A;  1AVY A;  2FXP A;  5APX A;  1LTJ A;  2OTL P;  3S1K A;  2IX7 C;  3H1J G;  4ZKP A;  5AVX B;  1DD4 A;  3RL0 D;  2GUS A;  1HJ0 A;  4H44 C;  3H1J D;  2V7Q J;  2O1J A;  3O6Q A;  1NU1 G;  2HLO A;  3A0B H;  2KS1 A;  1NU1 D;  1GTW A;  4ZMD A;  1VQM P;  3CCJ P;  1HTL C;  1FAV A;  3V2N A;  2RH0 A;  3L71 E;  5CJ0 A;  1YI2 P;  1K04 A;  1R5S A;  1S9K E;  2Q3I A;  1NYH A;  4UB6 E;  2D2C B;  4WBA A;  1JTH B;  2OYI B;  1OWA A;  3BAT A;  4WB4 A;  3L75 J;  2W6A A;  3H1I G;  2AEM A;  5KAF H;  1KN7 A;  1SFC B;  3ZDM A;  1LT9 B;  1M57 D;  2L5G B;  1JEK A;  1P84 H;  1N7S A;  1DIP A;  2YKQ A;  1UII A;  5GTI E;  1EXJ A;  2E74 C;  2KP8 A;  1NTM J;  5E79 E;  1S2E A;  3LW5 J;  1ZME C;  4Z1M H;  3N4X A;  3M0D C;  1IFI A;  2M5A B;  3R4Y A;  2AXT H;  3P8M C;  4KT0 J;  1FZC B;  2ZJS E;  3FWL A;  1L4A B;  3EFF K;  1JY3 N;  2KNC A;  3GW6 A;  3L71 G;  2W6J H;  2K9J B;  1NTZ J;  2LKM A;  3L71 D;  3O8Z A;  1YIJ P;  4YXD C;  5KLV E;  1L0L K;  2FXO A;  1S9K D;  2P7J A;  1GW3 A;  2E5T A;  2IZ1 A;  3L70 J;  1ZN5 A;  4LC1 A;  4BWN A;  2W27 A;  2P1J A;  3B5N A;  1SQP J;  2QJY C;  1A02 F;  1S5L X;  4H0L C;  3L72 J;  3RL0 B;  1HUC A;  2O1K A;  1JO5 A;  1W2B O;  1LTS C;  2BAS A;  2Y9Z A;  3CL3 D;  1MUU A;  5CCH A;  3OAK A;  1QL2 A;  3ITK A;  3EWK A;  5CCG A;  1G1J A;  3FXD A;  3L73 D;  3S4R A;  3H32 A;  1RQV A;  1KQG B;  5C39 A;  5KLV G;  1E79 H;  3CI9 A;  4BRY B;  3LIE A;  5KLV D;  4L76 A;  2Q9I A;  2XND H;  1IK7 A;  1USE A;  1M90 Q;  2WSC J;  1KIL C;  4H13 C;  2B89 A;  1VQ8 P;  4CPG A;  2E75 B;  3P32 A;  1QEX A;  3A5T A;  2Z4E A;  1FS0 E;  1H0T A;  4OGQ D;  5KJ7 D;  1CI6 B;  4IL6 H;  1YTZ T;  3D6Z A;  1PZQ A;  2LR2 A;  3B4S A;  3H1J J;  4I7Z C;  2Y0E A;  3QWO C;  1AA0 A;  3HD7 C;  1HF9 A;  1NU1 J;  2POH A;  5AW4 B;  2C0W A;  1PP9 E;  1KB9 H;  2QJK B;  3I55 P;  3VTP C;  2GUV A;  3VP8 A;  2WSS H;  3EQ2 A;  3CME P;  1FOS E;  4LGD E;  2NPS C;  2M8R A;  1BGY E;  2QM8 A;  5AW9 B;  2IBZ I;  3P8C E;  4WY4 C;  3GMA A;  1Q7Y Q;  4L74 A;  1KMI Z;  3TK1 A;  3CC2 P;  4GDO A;  3WUT A;  1FZA A;  3GF3 A;  3H1I J;  3V2P A;  1LWU C;  3A3Y B;  2JEE A;  2PAJ A;  3M0D A;  4GOD A;  2HPC B;  2E43 A;  1BDC A;  4W7Z A;  1Q86 Q;  1FOS F;  2HOD B;  2N1T C;  3MHV A;  4W7Y A;  1NTK G;  3CCU P;  1SQX E;  2W83 C;  1JUN A;  1J2J B;  2IBZ E;  3FGA D;  1SP4 A;  1T3U A;  4PV1 D;  1URQ D;  1H89 A;  3L35 A;  3RBX A;  1RHZ B;  3AE4 C;  3RK3 E;  4Y28 J;  1PP9 D;  3IAO A;  2H8P D;  2KB7 P;  1X0T A;  1BGY G;  1EC5 A;  1ZW0 A;  3L71 J;  2ZVN B;  1BGY D;  1VQL P;  4OGQ B;  1MZ9 A;  1KTM A;  2GA1 A;  2Q1K A;  2W8Z A;  3CC4 P;  4N3Y B;  4JYB A;  2BEQ D;  1SLQ A;  3S9O A;  4MN4 C;  1TU3 F;  2D2C C;  2OYI C;  3B8E B;  2Z5I A;  2ZFC A;  1IFN A;  3D71 A;  2IBZ G;  1SQB E;  1SFC C;  3L75 D;  1LT9 C;  1SQX D;  5AW7 B;  3RK2 D;  2FYZ A;  2K1A A;  3TSI A;  2HG5 D;  1YIT P;  4YPC A;  3CCQ P;  1G2C B;  3CWB E;  2WSE J;  3C8V A;  1XTG B;  5AW8 B;  3RK3 D;  1A02 J;  1VQK P;  1JY2 N;  3L37 A;  4JPZ B;  2FYU K;  1FDM A;  2KZJ A;  3JCU H;  2KIK A;  5L8R J;  2V4H A;  2W6B A;  2WPQ A;  1HBW A;  1KIL A;  5KLV J;  4Y99 B;  2B88 A;  4EIJ A;  2WTY A;  1EXI A;  1FZC C;  2Y0D A;  1L4A C;  4TT3 H;  2B87 A;  1CW5 A;  1RE4 C;  3A2A A;  5APU A;  1H8A A;  2ZT9 D;  2R5B A;  2RKL A;  1P84 I;  2M3B A;  3A0B E;  3F5H A;  3V4Q A;  1NTZ D;  4L73 A;  4PV1 B;  2OYO A;  2YIU B;  1N73 B;  1URQ B;  1RE3 C;  5GTH H;  1CZQ A;  3W68 A;  2J5U A;  1T6A A;  1SQB G;  2KLU A;  2K3R A;  1SQB D;  3L70 D;  2OQQ A;  3HD7 A;  5EFW B;  2AEJ A;  1KC8 Q;  3RL0 C;  1SQP D;  4OH8 B;  2O01 J;  2C0X A;  2K9Y A;  2JWA A;  2NPS A;  3M91 A;  4RKU J;  3CWB D;  5KAF E;  4D6T E;  4WY4 A;  1P84 E;  2Q7C A;  2YMY A;  1LTB C;  3PH0 A;  2FFD A;  1JY3 O;  3HE5 B;  1JOC A;  1GL2 D;  5KKZ B;  1LWU A;  3L74 G;  3MIW A;  1YJN P;  2AXT E;  4AQR D;  3U1A A;  2CPS A;  2N1T A;  3BRT B;  3RK2 B;  3KZI H;  3WU2 H;  1KFN A;  1LP1 A;  3TYY A;  2XNX A;  3RBZ A;  3AEA C;  3U1C A;  1X9V A;  3E1I A;  3IFM A;  3AE9 C;  4JBZ A;  2E75 C;  4D6T G;  2R3C A;  1VF5 D;  4PJ0 H;  4D6T D;  2K37 A;  2PFX A;  1PP9 J;  5AW5 B;  3KDP B;  1P84 D;  1VQ6 P;  1VQ7 P;  2WPS A;  2ZT9 B;  3Q5P A;  2OGU A;  1RF1 C;  3H25 A;  1BGY J;  1VQ5 P;  2JJL A;  3HE4 B;  1FJP A;  2JR8 A;  2QJK C;  1EZV I;  1YYC A;  1JTH A;  2OYI A;  3KHU A;  4KHX A;  1T2K D;  2XU6 A;  1SFC A;  1LT9 A;  3AE2 C;  1J1D B;  2YO3 A;  1GK6 A;  3G71 P;  3BAS A;  3CX5 D;  3HRN A;  2FY8 A;  1BSN A;  5H2F H;  1SQX J;  1G1I A;  1MFT A;  3MGN A;  1KQS O;  3H1I D;  2KSE A;  3TNU A;  2M5A A;  1EZV E;  1GL2 B;  3TGU E;  1NH4 A;  2KS1 B;  1BDD A;  2OYH A;  1YQ4 C;  1KB9 I;  3RGU A;  1X79 B;  2LXB A;  5B66 H;  1L4A A;  1JNM A;  1YHQ P;  1QVF O;  3GHG B;  2XKM A;  1HGV A;  2K9J A;  4IL6 E;  1KD1 Q;  1FZB A;  1MFZ A;  2E75 D;  1YJW P;  2GM4 A;  5B5E H;  1HJB A;  2Q5U A;  2KOG A;  3OW2 O;  1QGK B;  1RE3 A;  2OAR A;  5AW0 B;  4AYC A;  1HWT C;  2ZYG A;  3VMA A;  3BCC E;  1UIX A;  1KB9 E;  2JKV A;  1QLE D;  4OGQ C;  2QA4 P;  5KJ7 C;  2YKO A;  1VF5 B;  1NAF A;  1JCC A;  2WSF H;  2WVR A;  1SQB J;  3N7N A;  4U7J A;  4JQ0 D;  1EZV G;  3TGU G;  2Z5H A;  1SQQ K;  5AVQ B;  2ITA A;  1GZL A;  1L2P A;  1EZV D;  2FYN B;  3CWB J;  4PD4 H;  3TGU D;  4IFF A;  3AE6 C;  3VOP A;  5AVW B;  2KNC B;  1IC2 A;  3H1K E;  4EOT A;  1L0L G;  2G3A A;  2CK3 H;  1R8E A;  1IJD B;  1BE3 E;  1NVO A;  3H6P A;  3C9I A;  3CCV P;  1J1E B;  2M3E A;  4BRY A;  4GT1 A;  1M1J B;  1FDO A;  2JP3 A;  3BCC G;  3L4F A;  3D6Y A;  2ZAE B;  1S5L H;  2OTJ P;  3G3Z A;  3BCC D;  4Y99 C;  1EDL A;  1SQV E;  3V5B A;  1KB9 D;  2IFN A;  1N8R Q;  5AW3 B;  2KI7 B;  1K9M Q;  5AVU B;  3U59 A;  2BCC E;  3RL0 g;  4PV1 C;  2YIU C;  1URQ C;  1L0N K;  3FX0 A;  2RN0 A;  1RF1 A;  2HFE D;  3H1K G;  4D6T J;  3FXE A;  4RJT A;  1PGP A;  1OIP A;  3G4S P;  2JWD A;  3H1K D;  1DEE G;  3M9B A;  4OVN F;  2QVA A;  3CXH H;  3SWK A;  1NTK E;  1BE3 G;  3GLM A;  1JY2 O;  2L91 A;  1BE3 D;  2P2U A;  2JDI H;  4M3L A;  1X22 A;  2QE7 H;  4U3F E;  4ZNC A;  1FJK A;  1LTI C;  3CPW O;  5K5G B;  1SQV G;  1PGO A;  1FZF A;  3WMM 0;  2YMK A;  1SQV D;  4K35 A;  1Y8A A;  4KJM A;  2KZI A;  3PTZ A;  3AEF C;  1AFO A;  3JCU E;  2IZ0 A;  1M8O B;  2BCC G;  2HOD A;  3RK2 C;  2IFM A;  2FBW C;  2WT7 B;  2N9Y B;  3II6 A;  4ASW A;  5AVZ B;  3TF5 A;  3KPE A;  4DZO A;  5KLI C;  3RK3 C;  3UIA A;  4C7N B;  4HH2 A;  2M0B A;  1WT6 A;  3SFD C;  5CHX A;  2FKW B;  2MKV A;  5GTH E;  1RY3 A;  1NTK D;  1KZU B;  3OJA B;  1GMJ A;  1SVF A;  2G8Y A;  1D7M A;  4XA4 A;  4U3F G;  4JYC A;  2HR3 A;  3H1L E;  4XE5 B;  5KJ7 A;  2E74 B;  2ZT9 C;  1FC2 C;  3BRV B; 
#chains in the Genus database with same CATH homology
 2NPS A;  3M91 A;  3BAT A;  4WB4 A;  2W6A A;  1JMM A;  1FU1 A;  3NFQ A;  4IFM A;  3P8C D;  4WY4 A;  1N73 C;  1SFC B;  1LT9 B;  2Q7C A;  5AW6 B;  2L5G B;  4N78 E;  2YMY A;  1JCD A;  2A45 I;  1LTB C;  1N7S A;  2FFD A;  2YKQ A;  1JY3 O;  2HYN A;  3HE5 B;  1JOC A;  3H32 B;  1NKZ B;  1GL2 D;  1SQX K;  1IFM A;  1LWU A;  3MIW A;  1IFJ A;  1J1D C;  1FZE A;  2KP8 A;  5CMZ A;  2YNY A;  3N4X A;  3M0D C;  3EFG A;  4AQR D;  1W2E A;  1IFI A;  3U1A A;  1G2C A;  2CPS A;  1QL1 A;  2N1T A;  1SQV K;  3BRT B;  3RK2 B;  1LTG C;  3P8M C;  3VN0 A;  1GW4 A;  4N6J A;  1NTM K;  1FZC B;  1KFN A;  1ZR4 A;  3TYY A;  2XNX A;  1L4A B;  1GL2 C;  2WSE H;  1DEB A;  3HTK B;  1JY3 N;  1RF1 B;  2WT7 A;  3U1C A;  1X9V A;  3E1I A;  5KTB A;  2LKM A;  2A45 H;  3IFM A;  1NWQ A;  3O8Z A;  4W80 A;  2HPC A;  1N7L A;  2J58 A;  1L0L K;  3GHG C;  1S9K D;  2XV5 A;  2P7J A;  5AVT B;  4C7N A;  2C9N Y;  1GW3 A;  1ZN5 A;  2R3C A;  1NTZ K;  2XZR A;  4JF7 A;  4LC1 A;  4I2L C;  2W27 A;  2P1J A;  1NTK K;  5AW5 B;  3B5N A;  3KDP B;  3M06 A;  1URQ A;  1A02 F;  2WPS A;  4N78 D;  4LLH A;  3RL0 B;  1HUC A;  1RF1 C;  1VDF A;  2O1K A;  4ZKU A;  1JO5 A;  2FFD C;  3SWY A;  3HUS B;  1LTS C;  2BAS A;  3SWF A;  3CL3 D;  1MV8 A;  2PP6 A;  2JJL A;  3M9H A;  5APV A;  1MUU A;  3HE4 B;  3KQG A;  1SQP K;  1FJP A;  2WZ7 A;  1M7L A;  2CPB A;  5CCH A;  1YYC A;  3OAK A;  1HVV A;  1JTH A;  2OYI A;  3PP5 A;  5APW A;  2KYV A;  4O9B A;  1ZR2 A;  1QL2 A;  4KHX A;  1T2K D;  2XU6 A;  3LID A;  2O01 H;  1ZV8 A;  1SFC A;  5APS A;  1LT9 A;  1IK9 A;  1J1D B;  1H88 A;  2ZXE B;  5CCG A;  2A45 G;  2YO3 A;  1GK6 A;  1G1J A;  2XDJ A;  2WWW A;  3BAS A;  1OWA A;  1KIL D;  3NTN A;  3HRN A;  3HE5 A;  3H32 A;  1AQ5 A;  5AW2 B;  1DH3 A;  1G1I A;  2FXM A;  3VMX A;  2VRS A;  3CI9 A;  3LIE A;  4GKG A;  3MGN A;  5BVZ A;  1T2K C;  1FBM A;  3TNU A;  2Q9I A;  1GL2 B;  1NH4 A;  2OYH A;  5AVR B;  4IFD K;  1J1E C;  3LW5 H;  1JY2 P;  1X79 B;  1E5W A;  1KIL C;  1RF0 A;  4C46 A;  2QM7 A;  1EQ7 A;  3R2P A;  1M1J C;  1L4A A;  1LTJ C;  1JNM A;  3HTK A;  1KFM A;  1GD2 E;  3GHG B;  2XKM A;  3P32 A;  1DX7 A;  1VPC A;  1HGV A;  3A5T A;  2Z4E A;  3HD7 D;  5KJ7 D;  1FZB A;  1CI6 B;  1MFZ A;  2GM4 A;  2C9L Y;  1XTC C;  3CLQ A;  1HJB A;  2Q5U A;  3VMY A;  2KOG A;  3V4W A;  1YTZ T;  2H7H A;  1HH0 A;  2NPS D;  1RE3 A;  4I1L A;  1KQL A;  2OAR A;  2H43 A;  5AW0 B;  4AYC A;  1HWT C;  2I1K A;  1Z56 A;  4WY4 D;  2FFD B;  1YTZ I;  1N7S D;  3HD7 C;  5KJ7 C;  2POH A;  5AW4 B;  2C0W A;  2J59 M;  2YKO A;  3VTP C;  1NAF A;  2GUV A;  1JCC A;  3HUS A;  2WSF H;  3VP8 A;  1IO4 A;  3EQ2 A;  1FOS E;  4LGD E;  2NPS C;  2M8R A;  3N7N A;  3HE4 A;  2QM8 A;  5AW9 B;  1N73 A;  3NXS A;  3P8C E;  4WY4 C;  2Z5H A;  1NU1 K;  1SQQ K;  5AVQ B;  2N1T D;  2R5D A;  1GZL A;  1NO4 A;  3VYI A;  1X8Y A;  1N7S C;  4IFF A;  4B86 A;  3VOP A;  5AVW B;  1SQB K;  3TK1 A;  2OYH C;  1IC2 A;  3VMZ A;  1FZA A;  3OA7 A;  3V2P A;  1LWU C;  4EOT A;  3A3Y B;  2JEE A;  4I6M C;  2PAJ A;  2YKP A;  3NMD A;  5AVY B;  3M0D A;  2HPC B;  1IJD B;  2E43 A;  4W7Z A;  1FOS F;  3H6P A;  3BVH A;  3C9I A;  2HOD B;  1HGZ A;  2N1T C;  3P7K A;  2MJZ A;  1J1E B;  4W7Y A;  2WPR A;  1LGH B;  4GT1 A;  1GK4 A;  1KIL B;  1JUN A;  1M1J B;  1OXZ A;  1J2J B;  1GL2 A;  1LTJ B;  1SP4 A;  1T3U A;  3L4F A;  1NOH A;  3B5N D;  1LTT C;  4C7R A;  1URQ D;  3G3Z A;  1H89 A;  3L35 A;  4GIF A;  3L36 A;  4Y99 C;  5APY A;  3V5B A;  2YO2 A;  2I1J A;  2IFN A;  3VP9 A;  1JY3 P;  5AVV B;  5AW3 B;  3GHG A;  2WSC H;  2H8P D;  2KB7 P;  5AVU B;  5CCH D;  3U59 A;  1CSB A;  1T3J A;  3I5C A;  1FZC A;  3B5N C;  1URQ C;  1L0N K;  3HD7 B;  3A7O A;  3M9Q A;  3IR9 A;  1RE4 A;  1WRG A;  1RF1 A;  1MZ9 A;  2HFE D;  1SFC D;  1T8Z A;  2KLV A;  4AUW A;  5CCG D;  3MD0 A;  3M9B A;  2NPS B;  3MTU E;  4N3Y B;  1FZG A;  1GU4 A;  4JYB A;  3V2R A;  4WY4 B;  1SLQ A;  5CCH C;  1JY2 O;  1NKN A;  3T97 A;  2OYI C;  5AVS B;  3B8E B;  3TNU B;  1N7S B;  2Z5I A;  2P2U A;  2ZFC A;  1IFN A;  5AW1 B;  2OYH B;  4RES B;  1LTA C;  3V2Q A;  2E42 A;  1SFC C;  4M3L A;  1LT9 C;  1LWU B;  5AW7 B;  3RK2 D;  2FYZ A;  4HYT B;  5CCG C;  1NHL A;  1FJK A;  1LTI C;  3TSI A;  2HG5 D;  2N9B A;  1FZF A;  2IPP A;  2KSJ A;  1N2D C;  3RK3 B;  3WMM 0;  1G2C B;  1L4A D;  2N1T B;  2P67 A;  5APQ A;  1XTG B;  5AW8 B;  3RK3 D;  1A02 J;  1JY2 N;  3L37 A;  2WIT A;  3KYQ A;  1AFO A;  2FYU K;  1FDM A;  2HOD A;  1PFI A;  1GDT A;  3RK2 C;  2IFM A;  4DOJ A;  2W6B A;  2WT7 B;  2WPQ A;  1ZLL A;  1HBW A;  1KIL A;  3II6 A;  4Y99 B;  5AVZ B;  3M0A A;  4EIJ A;  2WTY A;  1M1J A;  1RF0 C;  5APX A;  1FZC C;  1LTJ A;  1L4A C;  3KPE A;  4DZO A;  1CW5 A;  5CJ4 A;  1RE4 C;  2IX7 C;  3RK3 C;  3UIA A;  4C7N B;  4ZKP A;  3A2A A;  4HH2 A;  5APU A;  1H8A A;  2R5B A;  5AVX B;  1WT6 A;  3RL0 D;  2GUS A;  5CHX A;  5KLV K;  2M3B A;  2FKW B;  5BU8 B;  2O1J A;  3V4Q A;  1RY3 A;  2HLO A;  3B5N B;  1N73 B;  1KZU B;  1URQ B;  3OJA B;  5APT A;  1RE3 C;  1CZQ A;  1SVF A;  1GTW A;  1HTL C;  1FAV A;  3V2N A;  4XA4 A;  1N86 A;  4JYC A;  1IFD A;  5CJ0 A;  3MUD A;  3HD7 A;  2R32 A;  4XE5 B;  5KJ7 A;  1GU5 A;  3RL0 C;  4OH8 B;  1S9K E;  5BU5 A;  2Q3I A;  3BRV B;  2C0X A;  1CI6 A;  4WBA A;  1JTH B;  2OYI B;  3HUS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...