1SFCA

Neuronal synaptic fusion complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
69
structure length
69
Chain Sequence
NLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords PROTEIN (SYNAPTOBREVIN 2)
publication title Crystal structure of a SNARE complex involved in synaptic exocytosis at 2.4 A resolution.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 31
structure length 69
sequence length 69
chains with identical sequence E, I
ec nomenclature
pdb deposition date 1998-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sfcA00
1GL2A 3RL0C 4WY4A 3HD7D 2NPSD 3B5NB 2XDJA 2M8RA 4W7YA 1SFCC 2NPSA 4N78E 1GL2C 3HD7B 3B5NC 4WY4C 3RK2C 4OH8B 5KJ7D 4JF7A 3B5ND 1NHLA 3KYQA 1XTGB 3HD7C 4W7ZA 5KJ7A 2H8PD 2NPSC 3B5NA 1N7SB 3TSIA 3HD7A 1N7SC 5KJ7C 3P8CE 2HFED 3RK3B 1N7SD 2PP6A 1N7SA 2HG5D 1L4AB 1URQB 3RK3C 5CCHC 3RK3D 5CCHD 1KILB 1T3JA 3RL0B 1URQC 2WZ7A 3HTKB 5CCGC 5CCHA 1L4AD 1URQD 3PP5A 5CCGD 1KILC 1SFCB 1JTHB 2N1TB 1L4AA 1URQA 1GL2B 3VOPA 1KILD 3M0DC 3RL0D 5CCGA 4WY4B 4W80A 3RK2B 1KILA 2N1TC 1SFCD 2NPSB 2YMYA 2N1TD 1HVVA 2KOGA 1L4AC 1GL2D 4LGDE 1SFCA 4WY4D 3RK2D 1JTHA 2N1TA
chains in the Genus database with same CATH superfamily
1CI6A 3D70A 4AUWA 3TGUE 4Y99B 1GD2E 5M1BA 3HUSA 3L72D 5BU8B 1BCCG 2MJZA 1QL2A 1FZCB 2XNXA 3BCCG 2O01H 3D6ZA 2IBZG 3ITKA 1S9KE 1HBWA 2WPVB 4RESB 2W27A 1GW3A 1EQ7A 1M1JC 1SQBD 2O01N 2WSCH 3HD7A 1RQVA 2O3JA 1Y9BA 1VQ9P 2YXQB 3BVHA 1GTWA 3N4XA 3L72E 3TGUG 3Q2YA 1FDIA 3F5HA 1L0NE 3NMDA 3RK3D 1OVVA 1RE3A 2IZ0A 2QJPC 2Y0EA 5APQA 3G3ZA 3EFGA 1YTZT 3FXDA 3FWLA 4AQRD 1NTZJ 3KDPB 1RE4C 4PJ0E 1GK6A 1J1EC 1SQVJ 1HGZA 1JY3P 3BRVB 3L75D 2K9JA 1KZUB 2LKMA 3CX5I 2RKLA 1RF1B 3H32A 3F89A 2I1JA 4BRYB 1NTMJ 4AYCA 1X9VA 3QWOC 3AE6C 1LT9A 2NPSB 3E1IA 1KN7A 1PPJD 5C39A 1JTHA 4I1LA 3NFQA 1MFZA 1P84I 1M90Q 1E79H 3L72G 3B5NB 3RK3E 1VQ7P 4W7YA 1L0NG 1PIXA 1ZP0C 2E76B 1UIXA 1KV4A 2WWWA 3Q5RA 2Q3IA 2WPQA 1SQBG 4XFJA 1KYOH 1YQ3C 1NU1J 1LTIC 2ZYDA 3CXHI 3H1KD 1PPJE 1H88A 4N78D 3P8CE 1ZXGA 2R3CA 1SQXD 3CWBJ 2OYHC 4EDFA 3L36A 4GOEA 4L75A 1M56D 3CLQA 3CX5D 4ASVA 1USEA 1NAYA 1U57A 4KHXA 2ZXXA 1W2BO 1NTZD 2YXRB 4JYCA 3HE4A 3AE3C 3IFMA 2BEQD 1SQVD 2WZ7A 1Q81Q 3L75G 1JB0J 4JPZB 3GHGA 2H89C 1URQA 1K04A 2WT7B 3M0DC 1P84D 3WU2H 3A0BH 3KHUA 3H6PA 1KILA 3HRNA 1KQLA 1PPJG 2N1TD 3KPEA 2R32A 1YJ9P 3G71P 1DX7A 1SFCA 1JY2O 2FYNC 3S4RA 2FXMA 1NTZE 4PV1B 3TYYA 1WT6A 3PH0A 1GL2C 3CXHD 1N8RQ 2A45I 3G4SP 1ZOYC 4PD4I 2L91A 1NTME 2J58A 4EYYQ 1PGJA 1P84E 3L70D 1S72P 3AE7C 2OYIA 1N7SB 4Y28J 5CMZA 2HPCB 2VRSA 5APTA 2OTLP 1GW4A 1BGYJ 1QEXA 2HFED 1SQPD 1NTKK 3L74J 1FOSE 4I7ZC 3BASA 3S9OA 3HE5A 2QE7H 2ZVNB 2QJKB 3N7NA 4A7PA 1OVUA 3PHLA 1L4AB 1DD4A 2HLOA 3AEDC 1NTZG 1BSNA 5KLIB 3CXHE 3M9BA 1AQTA 2J5UA 5E79E 1SQVG 3RL0B 5CCGC 3EFFK 2AXTE 1HF9A 1NTMG 1VDFA 1W2EA 1VF5D 2J59M 5AVWB 1NU1E 2JR8A 5KKZC 3D6YA 2M5AA 2KB7P 1TU3F 4WY4B 2FYUK 3CWBE 4DJGA 2FFDB 2YMYA 3AE5C 1GL2D 3JSVC 1PP9J 5AVYB 2JWAA 3OA7A 1GK4A 3Q5PA 3LIEA 3MUDA 3MIWA 3GLMA 4B86A 3R2PA 2NRGA 3RK2C 3TNUA 4JF7A 1JEKA 3L70G 4UB6H 1U7MA 1NU1G 3HD7C 1OFCX 2ZYAA 1VPCA 1BGYD 3CWBG 1FZCA 4JYBA 4H13B 1SQPG 3L74D 4GIFA 1M1KQ 1AQ5A 1IO4A 1SP4A 4PJ0H 1FDOA 2E43A 1NWQA 1N73C 5AVXB 1QLED 3AECC 1EC5A 2N9BA 1HGVA 3L35A 4BWNA 1OX3A 1YBKA 1IFPA 3A5TA 3CC7P 2JEEA 1SQQK 2CK3H 2GA1A 1BGYE 1BDCA 2AEMA 2Q7CA 3L74E 1PP9D 3A0HH 2K1AA 1CW5A 2A45G 2OARA 3RK2D 2KK7A 1JY2P 4YPCA 1RF1A 1EZVE 1K8AQ 4RJTA 1G2CB 4BRYA 3HD7D 3G9RA 3AE2C 2V7QJ 2WMMA 3GF7A 2NPSA 2C9LY 4L74A 3Q5SA 1HJ0A 2XNDH 1DH3A 2UWJE 1NHLA 3KYQA 4W7ZA 1ZN5A 2H8PD 3B5NA 4U3FJ 2Q6QA 1BGYG 1PP9E 1Y47A 1QVFO 1BE3D 2W83C 3L74G 1NVOA 2E42A 1IFNA 3RK3B 5AVUB 1EZVG 1X22A 1FZBA 3CL3D 3A7OA 1SQBJ 3GHGC 2QRXA 1URQC 3PRJA 3AE1C 5CJ4A 5EFWB 1KILC 1G1JA 3PJSK 2XV5A 2KZJA 1PP9G 2QJYC 1L0LD 3C9IA 2KOGA 1M1JB 1ZRTE 1VQKP 3BCCE 4LGDE 2IYPA 2PFXA 4OWFA 2WT7A 2ZFCA 2K37A 3O8ZA 1PGQA 1P84H 1G1IA 2B87B 2XDJA 3NTNA 4JBZA 3U1CA 3P32A 2WPRA 2B9BA 4IL6X 1VQNP 4OH8B 3G6EP 4RKUJ 2Q1KA 2QJPB 2Y0CA 3Q1MA 2PAJA 1Q2NA 3VTPC 2JKVA 3H1LJ 3CXHH 5AW7B 2PP6A 2YIUC 1N7SA 3V2QA 1KB9I 1NGMB 1VL2A 4QMAA 5TJHA 1OZHA 3CC2P 2HPCA 3C8VA 2JJLA 4UB8E 3FXEA 1VQ5P 5CCHA 4U3FE 3V4QA 2P10A 3H1KJ 2V4HA 5AVZB 1MV8A 2N1TB 1L4AA 4N3YB 1ZR4A 1RHZB 1SQXJ 1L0LG 1RQUA 3S1KA 1N7LA 3MUDC 1W5CE 4K35A 3ZDMA 4EI2A 1SQBE 3M06A 4WY4A 1NAFA 3CCVP 1KD1Q 2OYHB 2FFDA 1OIPA 2HYNA 3O6QB 4C7NB 1FE6A 2JO1A 3HTKA 4U3FG 5AW4B 1S5LX 3W68A 2H7HA 3H1LD 1PZQA 1KB9D 2D2CC 3PLNA 1LNQA 2RN0A 3AEEC 1LT1A 1FS0E 3L75E 2OTJP 4HH2A 1ZMEC 4ZKUA 1VQ8P 3D71A 1NO4A 3OW2O 3LW5J 1VF5B 2YO3A 3L70J 1L0NK 1LWUB 2FYNB 2WTYA 5GTHE 1IFDA 2CPSA 1SQPJ 1GL2B 1KB9E 2A06D 4R4LA 1RF1C 1FDMA 3FWNA 1KORA 1H0TB 1EDJA 2FXOA 3CCSP 2Y9YA 1T6AA 1T3UA 3MZWB 4IOIH 3AEAC 1HTLC 1VQOP 4HKZH 3A3YB 1FAVA 2H43A 1MKMA 3H1KE 4I7ZB 2D2CD 3CCQP 4N78E 2QM8A 5KAFE 2WSEJ 3B5NC 1U7JA 1SQXE 2QIWA 4WVZA 1RF0C 1KTMA 4IFMA 4H44C 1GDTA 1G2CA 4C7RA 3CX5E 3H1LG 2KZIA 1Q90D 1IJDB 2YMKA 4YXDC 2Q3EA 1SQVE 5KJ7C 5B66E 1N2DC 3P8MC 1KFNA 3SWFA 1EDKA 5APXA 3VMXA 3H1JD 2MKVA 5GTIE 3H1KG 2B88A 3V6IA 1JMMA 3VN0A 3KZIE 4TLFA 1J1DC 1SQXG 2ZJSE 3PP5A 1DIPA 5CJ0A 3WMM0 3KQGA 3Q3DA 3RK2B 1CZQA 2FY8A 4WB4A 2A06G 2QSIA 2KP8A 5KLVJ 4NPDA 2P1JA 2ZAEB 3B4SA 2ZVOB 2KI7B 1K73Q 2O1KA 3SWYA 2BCCJ 1KYOI 1IC2A 3L70E 1GZLA 4H44D 5K5GB 3L71J 3U59A 3WUVA 2WPSA 4O9BA 4DCKA 1SQQD 1NTZK 2E74C 1X79B 3USSA 3CD6P 1SQVK 1M1JA 1SQPE 1JM0A 1KMIZ 5KJ7D 4PV1C 1M8OB 1NTMK 3FGAD 3HUSC 1DEEG 3H1HJ 1N73B 1XTGB 4PD4D 1S4XA 2IZ1A 2B87A 1LP1B 2POHA 4H0LC 3JC22 1NJIQ 3I56P 3VMZA 1N7SC 2BASA 1MFTA 4UB8H 1FJPA 5H2FE 5AVVB 1LGHB 1YIJP 1RE4A 2K9YA 5CCHC 3CI9A 1QL1A 1PL5A 4GT1A 1KQSO 4R4MA 1T3JA 2O1JA 5AW0B 3SWKA 1M7LA 1BE3J 4D6TD 4PD4E 3OJAB 5CCGD 2XZRA 1NU1K 1KYOD 1RE3C 3TF5A 5KLVD 3C1LA 2ITAA 2H88C 3H1ID 4MN4C 2E74D 2B89A 4NPEA 2BCCD 1K05A 3WUUA 2WSFH 3MD0A 5APSA 1LTGC 3L71D 3IF4A 2N1TA 2AEFA 1S3JA 1OXZA 1JCCA 1T2KC 1LT9C 4I2LC 4IFDK 4H0LD 3M91A 3CMEP 1OW8A 2Q9IA 1E5WA 3AEGC 3H1HD 2GUVA 1L2PA 3RBZA 1L0LJ 1NOHA 3L4FA 5L8RJ 1LTJB 2C0XA 5KLVE 3RBXA 1IZNB 4N6JA 2BCCE 2OYHA 4RO0A 2W6AA 3O6QA 4C7NA 3WUTA 2I1KA 2YKOA 2ZT9C 3AE4C 5GTHH 3NXSA 3MHVA 2HG5D 4OVNF 4LLHA 2OGUA 4ASWA 2KSEA 1KB9H 3V5BA 3M0DA 3VP8A 3A2AA 1EDLA 3BATA 2W6JH 1YQ4C 4M3LA 5AVQB 3A0BE 5KLVG 2IFNA 3MTUE 1AVOA 1HJBA 1Y8AA 3AEFC 4EIJA 3M9QA 2BCCG 1LWUA 3U1AA 2FBWC 2LR2A 1BCCD 3L71G 2E75C 5KAFH 1GL2A 1T8ZA 2KNCB 5TISE 2KIKA 1KQGB 1MUUA 4IL6E 3CX5H 1BE3E 4OGQC 3E1RA 1SFCC 3H1HG 2YIUB 3CCEP 1N86A 1H0TA 5KAIE 2R3SA 2NZ2A 5B66H 3CCMP 1SLQA 4KT0J 2ZT9D 4WBAA 1GU4A 2YKQA 1Q7YQ 1NYHA 2I8DA 1JOCA 3FX0A 5GTIH 3H25A 2W6BA 1VQ6P 2QM7A 2OYIC 3KZIH 1ZR2A 3VMAA 1S9KD 2YNYA 1Q82Q 3RK3C 1SS1A 1BE3G 2XKMA 1L0LE 1FBMA 1J1EB 4HYTB 4NPFX 2K3RA 1R5SA 3BRTB 5E79H 1URQD 4CPGA 2BEZF 2E75D 2RMZA 3L37A 4DT0A 3R4YA 3ABVC 1KILD 3LW5H 2AXTH 2OYOA 1IK7A 2P2UA 2R44A 3RL0g 4OGQD 1L0ND 1DEBA 1SFCD 2OQQA 3JCUE 4L73A 2IX7C 4ZNCA 1JCDA 2D2CB 2Q5UA 1HWTC 2KYVA 1HUCA 1NTKJ 5B5EE 1QGKB 2WITA 3CCRP 2AEJA 4UB6E 2HODB 3V2RA 1S5LE 2DW3A 1KILE 2IYOA 2KSJA 3L73J 1WMKA 5H2FH 4L76A 1L0LK 2WSEH 3W67A 2Y0DA 4EOTA 3MGNA 1S1CX 5AW8B 4Y99C 1N73A 2FYUJ 3QH9A 2PRRA 5BU5A 3I55P 2A45H 1FZFA 1FZCC 4PD4H 1LP1A 1M57D 4LC1A 2RH0A 2OTKE 4HB1A 3LIDA 2Y9ZA 1GMJA 2M3BA 3P8CD 3AE9C 5AW9B 1YJNP 3VOPA 4W80A 3A0HE 4H44B 2N1TC 1FJKA 1VQPP 1X8YA 2PGDA 3H1JJ 1RY3A 3IN6A 5AW1B 1AV1A 2QVAA 4XA4A 2O01J 1NTKD 3T97B 1SQBK 4KJMA 2SPZA 3H1LE 1AJYA 1FZEA 1DD3A 3AE8C 5CHXA 4DOJA 1KC8Q 2WSCJ 1JY3N 2LXCB 3L73D 3TDKA 5CBNA 4GOFA 3M0AA 2NPSC 4GKGA 5DJUB 1J1DB 4I6MC 1FU1A 2QG4A 2WVRA 4GODA 1SQQJ 4GDOA 1ZV8A 3IAOA 2FYUD 3V2NA 1NTKE 1PFIA 3GMAA 1LTJA 5APVA 3RGUA 2E76C 1NTMD 3IR9A 2M3EA 1VQLP 2JP3A 2A06E 2P7JA 5KKZB 2WSSH 1YI2P 4WWIA 3L73E 2KS1B 1VF5C 3II6A 1D7MA 2E74B 1LTSC 1GU5A 1LWUC 2KUBA 1CI6B 1EXJA 1FZGA 1EXIA 5TISH 2FYUE 3HUSB 2LXBA 5CBOA 4IL6H 2QEXP 4K3AA 2E5YA 3VP9A 1J2JB 1NTKG 4H0LB 1AVYA 2ZYGA 5KAIH 3VYIA 1NU1D 1XTCC 4D6TJ 5BVZA 3EWKA 2NPSD 3CC4P 1S2EA 2GM4A 1YTZI 2N9YB 3CWBD 3HD7B 3B8EB 1PV3A 1SQXK 2KXPB 3L73G 3H1IJ 3P7KA 3AEBC 3B5ND 3V4WA 2KNCA 1VQMP 4ZMDA 2E76D 2E5TA 3H1JE 2FYUG 1PGPA 3MP7B 3SSUA 1ZW0A 3CCLP 2R5DA 5DJTB 1MZ9A 3M9HA 5AVSB 1EZVI 4U7JA 4YTPC 1JO5A 2K9JB 3H32B 1A02F 1K9MQ 2V7QH 1IFMA 3V2PA 1OWAA 2G3AA 2W90A 4HJGH 1KQFB 2P67A 2YO2A 1LT9B 3HTKB 1KFMA 2AXCA 3UIAA 3JCUH 1JTHB 1YHQP 1SQQE 3SFEC 3B71A 1QX8A 3H1JG 3CPWO 5APWA 5B5EH 2QJKC 2R5BA 1L4AC 1ZLLA 5APYA 5KLIC 1X0TA 4ZKPA 3CCUP 1R5LA 5AW2B 3RL0C 1S5LH 3VMYA 2KLUA 2ZT9B 2P58A 3K5BA 1RH5B 1FC2C 1SQPK 2IPPA 4WY4C 2C9NY 1LTAC 2FKWB 1BCCJ 1YJWP 5AVRB 4PV1D 4YXWH 2WQYC 1HH0A 2FFDC 1SQQG 3BCCJ 1EZVD 1OW6A 2XU6A 1BSHA 2ZXEB 2HODA 3HE4B 4D6TE 2IBZI 1N7SD 1KYOE 4XE5B 1WRGA 2M0BA 1OMIA 2FYZA 3GHGB 1CSBA 1YYCA 1URQB 1FZAA 2E75B 3EQ2A 3H1IE 5APUA 1JMBA 1NH4A 5CCHD 3OAKA 1KILB 5AW3B 3TGUJ 2CPBA 1AFOA 3L71E 2Z5HA 1L4AD 1LTBC 4OGQB 1SFCB 2QJYB 4H13C 2IFMA 1JY3O 3RL0D 1PGOA 5AW5B 1OW7A 1R8EA 1LJ2A 4TT3H 3H1HE 2K88A 4D6TG 2YKPA 1JUNA 4WY4D 1IFJA 3WU2E 2Z4EA 2JWDA 4Z1MH 1RF0A 2G8YA 5AW6B 1NKZB 2OYIB 4DZOA 3H1IG 1Z56A 1T2KD 2M8RA 5AVTB 3L72J 1ZRTD 3TK1A 3GF3A 1L0NJ 3T97A 1LTTC 3BCCD 2IBZD 5KLVK 1A02J 5KJ7A 2QA4P 3HE5B 1Q86Q 3TSIA 1LTJC 3GW6A 3I5CA 4BXLA 1IFIA 3KXDA 1FOSF 5KTBA 1JY2N 1YITP 4IFFA 2WSFJ 4H13D 2M5AB 1OVRA 3TGUD 3CCJP 4C46A 1BCCE 1SVFA 1VQ4P 3SFDC 2W8ZA 2IBZE 2C0WA 1JNMA 2L5GB 1NKNA 2Z5IA 1H8AA 4JQ0D 2IDBA 3GG2A 1AA0A 2FXPA 5CCGA 2HR3A 3L75J 1BDDA 1IK9A 3PTZA 1QVGO 2GUSA 3E7KA 1UIIA 1H89A 2KS1A 1HVVA 2KLVA 1USDA 1EDIA 2JDIH 3TNUB 3CMAP 4U3FD
chains in the Genus database with same CATH topology
1JY2P 1GZLA 1RF1A 1SQBK 1CI6A 3U59A 4AUWA 2WPSA 1G2CB 3HD7D 4O9BA 1FZEA 4Y99B 1GD2E 1NTZK 3HUSA 5CHXA 1X79B 4DOJA 5BU8B 2NPSA 2MJZA 1SQVK 2C9LY 1QL2A 1M1JA 1FZCB 2XNXA 1JY3N 2O01H 5KJ7D 1HBWA 1S9KE 1DH3A 1NTMK 1NHLA 3HUSC 3KYQA 1N73B 4RESB 1XTGB 2W27A 1GW3A 3M0AA 4W7ZA 1EQ7A 1ZN5A 2H8PD 2NPSC 3B5NA 4GKGA 1M1JC 1J1DB 4I6MC 2POHA 1FU1A 3VMZA 2WSCH 3HD7A 1ZV8A 1N7SC 3V2NA 2E42A 2BASA 1IFNA 1PFIA 3RK3B 5AVUB 1LTJA 5APVA 3BVHA 1FJPA 5AVVB 1GTWA 3N4XA 1LGHB 3IR9A 1RE4A 1FZBA 5CCHC 3CL3D 3A7OA 3CI9A 3NMDA 1QL1A 3RK3D 1RE3A 4GT1A 2P7JA 5APQA 3G3ZA 1T3JA 3EFGA 3GHGC 1YTZT 2O1JA 1URQC 5AW0B 4AQRD 3KDPB 1M7LA 3II6A 1RE4C 5CJ4A 1GK6A 1LTSC 1GU5A 3OJAB 5CCGD 1KILC 1J1EC 2XZRA 1NU1K 1G1JA 1HGZA 1JY3P 3BRVB 1RE3C 1LWUC 1KZUB 2LKMA 1RF1B 3H32A 1CI6B 2XV5A 2I1JA 1FZGA 3HUSB 4AYCA 1X9VA 1LT9A 2NPSB 3C9IA 2KOGA 1M1JB 3E1IA 3VP9A 1J2JB 2WSFH 3MD0A 4LGDE 5APSA 1LTGC 1JTHA 2N1TA 4I1LA 3NFQA 1MFZA 2WT7A 2ZFCA 3VYIA 1XTCC 1OXZA 1JCCA 1T2KC 5BVZA 1LT9C 3O8ZA 2NPSD 3B5NB 4I2LC 1G1IA 4IFDK 2XDJA 3NTNA 3U1CA 4W7YA 3M91A 3P32A 2GM4A 1YTZI 2WPRA 3HD7B 2WWWA 3B8EB 2Q9IA 1E5WA 1SQXK 2GUVA 3P7KA 4OH8B 3B5ND 1NOHA 2Q3IA 3L4FA 3V4WA 1LTJB 2C0XA 2WPQA 2PAJA 4N6JA 2OYHA 1LTIC 3VTPC 2W6AA 4C7NA 2I1KA 1H88A 4N78D 2YKOA 3P8CE 5AW7B 2R3CA 2R5DA 1MZ9A 2PP6A 2OYHC 3M9HA 5AVSB 3NXSA 1N7SA 3L36A 2HG5D 1JO5A 3V2QA 3CLQA 4LLHA 3H32B 1A02F 1IFMA 3V2PA 1OWAA 4KHXA 3V5BA 2HPCA 4JYCA 3HE4A 2JJLA 3IFMA 3M0DA 3VP8A 2P67A 3A2AA 3BATA 2YO2A 1LT9B 2WZ7A 3HTKB 5CCHA 1KFMA 3V4QA 3UIAA 4M3LA 5AVQB 1JTHB 5AVZB 1MV8A 2N1TB 3GHGA 1L4AA 2IFNA 3MTUE 1URQA 4N3YB 1ZR4A 2WT7B 3M0DC 1HJBA 4EIJA 3M9QA 3H6PA 1KILA 3HRNA 5APWA 1LWUA 1KQLA 3U1AA 2N1TD 3KPEA 2R5BA 1L4AC 2R32A 1ZLLA 1DX7A 1N7LA 1SFCA 5APYA 4ZKPA 1GL2A 1T8ZA 3M06A 5AW2B 3RL0C 1JY2O 4WY4A 3VMYA 1NAFA 2FXMA 1MUUA 3TYYA 1SFCC 2OYHB 2FFDA 1WT6A 2HYNA 1N86A 1GL2C 4C7NB 1SQPK 3HTKA 2IPPA 4WY4C 2A45I 2C9NY 5AW4B 1LTAC 2FKWB 2J58A 1SLQA 5AVRB 4WBAA 1HH0A 2FFDC 1GU4A 2H7HA 2YKQA 2OYIA 1N7SB 2XU6A 2ZXEB 1JOCA 5CMZA 2HPCB 2HODA 2VRSA 3HE4B 5APTA 1GW4A 2W6BA 2HFED 2QM7A 1NTKK 2OYIC 1N7SD 1ZR2A 1FOSE 4XE5B 1WRGA 1S9KD 3BASA 3HE5A 2YNYA 4HH2A 2FYZA 4ZKUA 3N7NA 3GHGB 1CSBA 1YYCA 1L4AB 2HLOA 1URQB 3RK3C 1FZAA 1NO4A 3EQ2A 2YO3A 5APUA 1L0NK 3M9BA 1NH4A 5CCHD 2XKMA 3OAKA 1FBMA 1J1EB 1KILB 3RL0B 5AW3B 4HYTB 2CPBA 1AFOA 1LWUB 2Z5HA 2WTYA 5CCGC 1L4AD 3BRTB 1URQD 1IFDA 1LTBC 2CPSA 3L37A 1VDFA 1W2EA 1SFCB 2J59M 5AVWB 2IFMA 1GL2B 2KB7P 1KILD 3LW5H 1JY3O 3RL0D 4WY4B 2P2UA 5AW5B 2FYUK 1RF1C 1DEBA 1SFCD 1FDMA 2FFDB 2YMYA 1GL2D 2IX7C 2YKPA 1JUNA 4WY4D 5AVYB 1IFJA 1JCDA 2Q5UA 1HWTC 1T3UA 2Z4EA 3OA7A 2KYVA 1HUCA 1GK4A 1HTLC 1RF0A 5AW6B 3LIEA 1NKZB 2OYIB 3MUDA 4DZOA 1Z56A 1T2KD 2WITA 3A3YB 2M8RA 1FAVA 2H43A 3MIWA 4N78E 5AVTB 4B86A 2QM8A 3R2PA 3B5NC 3RK2C 2HODB 3V2RA 3TNUA 1RF0C 4IFMA 4JF7A 3TK1A 3T97A 1LTTC 1GDTA 1G2CA 2KSJA 5KLVK 3HD7C 4C7RA 5KJ7A 1A02J 3HE5B 3TSIA 1IJDB 1LTJC 1VPCA 1L0LK 2WSEH 3I5CA 1IFIA 1FZCA 4EOTA 4JYBA 1FOSF 3MGNA 5KJ7C 5KTBA 1JY2N 4GIFA 5AW8B 4Y99C 1N73A 4IFFA 1AQ5A 5BU5A 2A45H 1N2DC 1IO4A 1SP4A 3P8MC 1FZFA 1FZCC 1KFNA 3SWFA 4LC1A 5APXA 2E43A 3VMXA 1NWQA 1N73C 4C46A 1JMMA 5AVXB 1SVFA 3VN0A 3LIDA 1J1DC 2N9BA 1HGVA 2C0WA 3L35A 2M3BA 3P8CD 1JNMA 3PP5A 5CJ0A 2L5GB 2Z5IA 1NKNA 1H8AA 5AW9B 3WMM0 3A5TA 2JEEA 1SQQK 3VOPA 3KQGA 5CCGA 3RK2B 4W80A 1CZQA 4WB4A 1IK9A 2KP8A 2Q7CA 2N1TC 2GUSA 1FJKA 2P1JA 1H89A 1CW5A 1HVVA 2KLVA 1X8YA 2A45G 2O1KA 3SWYA 1RY3A 2OARA 3RK2D 5AW1B 3TNUB 4XA4A 1IC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GL2 A;  3RL0 C;  4WY4 A;  3HD7 D;  2NPS D;  3B5N B;  2XDJ A;  2M8R A;  4W7Y A;  1SFC C;  2NPS A;  4N78 E;  1GL2 C;  3HD7 B;  3B5N C;  4WY4 C;  3RK2 C;  4OH8 B;  5KJ7 D;  4JF7 A;  3B5N D;  1NHL A;  3KYQ A;  1XTG B;  3HD7 C;  4W7Z A;  5KJ7 A;  2H8P D;  2NPS C;  3B5N A;  1N7S B;  3TSI A;  3HD7 A;  1N7S C;  5KJ7 C;  3P8C E;  2HFE D;  3RK3 B;  1N7S D;  2PP6 A;  1N7S A;  2HG5 D;  1L4A B;  1URQ B;  3RK3 C;  5CCH C;  3RK3 D;  5CCH D;  1KIL B;  1T3J A;  3RL0 B;  1URQ C;  2WZ7 A;  3HTK B;  5CCG C;  5CCH A;  1L4A D;  1URQ D;  3PP5 A;  5CCG D;  1KIL C;  1SFC B;  1JTH B;  2N1T B;  1L4A A;  1URQ A;  1GL2 B;  3VOP A;  1KIL D;  3M0D C;  3RL0 D;  5CCG A;  4WY4 B;  4W80 A;  3RK2 B;  1KIL A;  2N1T C;  1SFC D;  2NPS B;  2YMY A;  2N1T D;  1HVV A;  2KOG A;  1L4A C;  1GL2 D;  4LGD E;  1SFC A;  4WY4 D;  3RK2 D;  1JTH A;  2N1T A; 
#chains in the Genus database with same CATH topology
 1CI6 A;  3D70 A;  4AUW A;  3TGU E;  4Y99 B;  1GD2 E;  5M1B A;  3HUS A;  3L72 D;  5BU8 B;  1BCC G;  2MJZ A;  1QL2 A;  1FZC B;  2XNX A;  3BCC G;  2O01 H;  3D6Z A;  2IBZ G;  3ITK A;  1S9K E;  1HBW A;  2WPV B;  4RES B;  2W27 A;  1GW3 A;  1EQ7 A;  1M1J C;  1SQB D;  2O01 N;  2WSC H;  3HD7 A;  1RQV A;  2O3J A;  1Y9B A;  1VQ9 P;  2YXQ B;  3BVH A;  1GTW A;  3N4X A;  3L72 E;  3TGU G;  3Q2Y A;  1FDI A;  3F5H A;  1L0N E;  3NMD A;  3RK3 D;  1OVV A;  1RE3 A;  2IZ0 A;  2QJP C;  2Y0E A;  5APQ A;  3G3Z A;  3EFG A;  1YTZ T;  3FXD A;  3FWL A;  4AQR D;  1NTZ J;  3KDP B;  1RE4 C;  4PJ0 E;  1GK6 A;  1J1E C;  1SQV J;  1HGZ A;  1JY3 P;  3BRV B;  3L75 D;  2K9J A;  1KZU B;  2LKM A;  3CX5 I;  2RKL A;  1RF1 B;  3H32 A;  3F89 A;  2I1J A;  4BRY B;  1NTM J;  4AYC A;  1X9V A;  3QWO C;  3AE6 C;  1LT9 A;  2NPS B;  3E1I A;  1KN7 A;  1PPJ D;  5C39 A;  1JTH A;  4I1L A;  3NFQ A;  1MFZ A;  1P84 I;  1M90 Q;  1E79 H;  3L72 G;  3B5N B;  3RK3 E;  1VQ7 P;  4W7Y A;  1L0N G;  1PIX A;  1ZP0 C;  2E76 B;  1UIX A;  1KV4 A;  2WWW A;  3Q5R A;  2Q3I A;  2WPQ A;  1SQB G;  4XFJ A;  1KYO H;  1YQ3 C;  1NU1 J;  1LTI C;  2ZYD A;  3CXH I;  3H1K D;  1PPJ E;  1H88 A;  4N78 D;  3P8C E;  1ZXG A;  2R3C A;  1SQX D;  3CWB J;  2OYH C;  4EDF A;  3L36 A;  4GOE A;  4L75 A;  1M56 D;  3CLQ A;  3CX5 D;  4ASV A;  1USE A;  1NAY A;  1U57 A;  4KHX A;  2ZXX A;  1W2B O;  1NTZ D;  2YXR B;  4JYC A;  3HE4 A;  3AE3 C;  3IFM A;  2BEQ D;  1SQV D;  2WZ7 A;  1Q81 Q;  3L75 G;  1JB0 J;  4JPZ B;  3GHG A;  2H89 C;  1URQ A;  1K04 A;  2WT7 B;  3M0D C;  1P84 D;  3WU2 H;  3A0B H;  3KHU A;  3H6P A;  1KIL A;  3HRN A;  1KQL A;  1PPJ G;  2N1T D;  3KPE A;  2R32 A;  1YJ9 P;  3G71 P;  1DX7 A;  1SFC A;  1JY2 O;  2FYN C;  3S4R A;  2FXM A;  1NTZ E;  4PV1 B;  3TYY A;  1WT6 A;  3PH0 A;  1GL2 C;  3CXH D;  1N8R Q;  2A45 I;  3G4S P;  1ZOY C;  4PD4 I;  2L91 A;  1NTM E;  2J58 A;  4EYY Q;  1PGJ A;  1P84 E;  3L70 D;  1S72 P;  3AE7 C;  2OYI A;  1N7S B;  4Y28 J;  5CMZ A;  2HPC B;  2VRS A;  5APT A;  2OTL P;  1GW4 A;  1BGY J;  1QEX A;  2HFE D;  1SQP D;  1NTK K;  3L74 J;  1FOS E;  4I7Z C;  3BAS A;  3S9O A;  3HE5 A;  2QE7 H;  2ZVN B;  2QJK B;  3N7N A;  4A7P A;  1OVU A;  3PHL A;  1L4A B;  1DD4 A;  2HLO A;  3AED C;  1NTZ G;  1BSN A;  5KLI B;  3CXH E;  3M9B A;  1AQT A;  2J5U A;  5E79 E;  1SQV G;  3RL0 B;  5CCG C;  3EFF K;  2AXT E;  1HF9 A;  1NTM G;  1VDF A;  1W2E A;  1VF5 D;  2J59 M;  5AVW B;  1NU1 E;  2JR8 A;  5KKZ C;  3D6Y A;  2M5A A;  2KB7 P;  1TU3 F;  4WY4 B;  2FYU K;  3CWB E;  4DJG A;  2FFD B;  2YMY A;  3AE5 C;  1GL2 D;  3JSV C;  1PP9 J;  5AVY B;  2JWA A;  3OA7 A;  1GK4 A;  3Q5P A;  3LIE A;  3MUD A;  3MIW A;  3GLM A;  4B86 A;  3R2P A;  2NRG A;  3RK2 C;  3TNU A;  4JF7 A;  1JEK A;  3L70 G;  4UB6 H;  1U7M A;  1NU1 G;  3HD7 C;  1OFC X;  2ZYA A;  1VPC A;  1BGY D;  3CWB G;  1FZC A;  4JYB A;  4H13 B;  1SQP G;  3L74 D;  4GIF A;  1M1K Q;  1AQ5 A;  1IO4 A;  1SP4 A;  4PJ0 H;  1FDO A;  2E43 A;  1NWQ A;  1N73 C;  5AVX B;  1QLE D;  3AEC C;  1EC5 A;  2N9B A;  1HGV A;  3L35 A;  4BWN A;  1OX3 A;  1YBK A;  1IFP A;  3A5T A;  3CC7 P;  2JEE A;  1SQQ K;  2CK3 H;  2GA1 A;  1BGY E;  1BDC A;  2AEM A;  2Q7C A;  3L74 E;  1PP9 D;  3A0H H;  2K1A A;  1CW5 A;  2A45 G;  2OAR A;  3RK2 D;  2KK7 A;  1JY2 P;  4YPC A;  1RF1 A;  1EZV E;  1K8A Q;  4RJT A;  1G2C B;  4BRY A;  3HD7 D;  3G9R A;  3AE2 C;  2V7Q J;  2WMM A;  3GF7 A;  2NPS A;  2C9L Y;  4L74 A;  3Q5S A;  1HJ0 A;  2XND H;  1DH3 A;  2UWJ E;  1NHL A;  3KYQ A;  4W7Z A;  1ZN5 A;  2H8P D;  3B5N A;  4U3F J;  2Q6Q A;  1BGY G;  1PP9 E;  1Y47 A;  1QVF O;  1BE3 D;  2W83 C;  3L74 G;  1NVO A;  2E42 A;  1IFN A;  3RK3 B;  5AVU B;  1EZV G;  1X22 A;  1FZB A;  3CL3 D;  3A7O A;  1SQB J;  3GHG C;  2QRX A;  1URQ C;  3PRJ A;  3AE1 C;  5CJ4 A;  5EFW B;  1KIL C;  1G1J A;  3PJS K;  2XV5 A;  2KZJ A;  1PP9 G;  2QJY C;  1L0L D;  3C9I A;  2KOG A;  1M1J B;  1ZRT E;  1VQK P;  3BCC E;  4LGD E;  2IYP A;  2PFX A;  4OWF A;  2WT7 A;  2ZFC A;  2K37 A;  3O8Z A;  1PGQ A;  1P84 H;  1G1I A;  2B87 B;  2XDJ A;  3NTN A;  4JBZ A;  3U1C A;  3P32 A;  2WPR A;  2B9B A;  4IL6 X;  1VQN P;  4OH8 B;  3G6E P;  4RKU J;  2Q1K A;  2QJP B;  2Y0C A;  3Q1M A;  2PAJ A;  1Q2N A;  3VTP C;  2JKV A;  3H1L J;  3CXH H;  5AW7 B;  2PP6 A;  2YIU C;  1N7S A;  3V2Q A;  1KB9 I;  1NGM B;  1VL2 A;  4QMA A;  5TJH A;  1OZH A;  3CC2 P;  2HPC A;  3C8V A;  2JJL A;  4UB8 E;  3FXE A;  1VQ5 P;  5CCH A;  4U3F E;  3V4Q A;  2P10 A;  3H1K J;  2V4H A;  5AVZ B;  1MV8 A;  2N1T B;  1L4A A;  4N3Y B;  1ZR4 A;  1RHZ B;  1SQX J;  1L0L G;  1RQU A;  3S1K A;  1N7L A;  3MUD C;  1W5C E;  4K35 A;  3ZDM A;  4EI2 A;  1SQB E;  3M06 A;  4WY4 A;  1NAF A;  3CCV P;  1KD1 Q;  2OYH B;  2FFD A;  1OIP A;  2HYN A;  3O6Q B;  4C7N B;  1FE6 A;  2JO1 A;  3HTK A;  4U3F G;  5AW4 B;  1S5L X;  3W68 A;  2H7H A;  3H1L D;  1PZQ A;  1KB9 D;  2D2C C;  3PLN A;  1LNQ A;  2RN0 A;  3AEE C;  1LT1 A;  1FS0 E;  3L75 E;  2OTJ P;  4HH2 A;  1ZME C;  4ZKU A;  1VQ8 P;  3D71 A;  1NO4 A;  3OW2 O;  3LW5 J;  1VF5 B;  2YO3 A;  3L70 J;  1L0N K;  1LWU B;  2FYN B;  2WTY A;  5GTH E;  1IFD A;  2CPS A;  1SQP J;  1GL2 B;  1KB9 E;  2A06 D;  4R4L A;  1RF1 C;  1FDM A;  3FWN A;  1KOR A;  1H0T B;  1EDJ A;  2FXO A;  3CCS P;  2Y9Y A;  1T6A A;  1T3U A;  3MZW B;  4IOI H;  3AEA C;  1HTL C;  1VQO P;  4HKZ H;  3A3Y B;  1FAV A;  2H43 A;  1MKM A;  3H1K E;  4I7Z B;  2D2C D;  3CCQ P;  4N78 E;  2QM8 A;  5KAF E;  2WSE J;  3B5N C;  1U7J A;  1SQX E;  2QIW A;  4WVZ A;  1RF0 C;  1KTM A;  4IFM A;  4H44 C;  1GDT A;  1G2C A;  4C7R A;  3CX5 E;  3H1L G;  2KZI A;  1Q90 D;  1IJD B;  2YMK A;  4YXD C;  2Q3E A;  1SQV E;  5KJ7 C;  5B66 E;  1N2D C;  3P8M C;  1KFN A;  3SWF A;  1EDK A;  5APX A;  3VMX A;  3H1J D;  2MKV A;  5GTI E;  3H1K G;  2B88 A;  3V6I A;  1JMM A;  3VN0 A;  3KZI E;  4TLF A;  1J1D C;  1SQX G;  2ZJS E;  3PP5 A;  1DIP A;  5CJ0 A;  3WMM 0;  3KQG A;  3Q3D A;  3RK2 B;  1CZQ A;  2FY8 A;  4WB4 A;  2A06 G;  2QSI A;  2KP8 A;  5KLV J;  4NPD A;  2P1J A;  2ZAE B;  3B4S A;  2ZVO B;  2KI7 B;  1K73 Q;  2O1K A;  3SWY A;  2BCC J;  1KYO I;  1IC2 A;  3L70 E;  1GZL A;  4H44 D;  5K5G B;  3L71 J;  3U59 A;  3WUV A;  2WPS A;  4O9B A;  4DCK A;  1SQQ D;  1NTZ K;  2E74 C;  1X79 B;  3USS A;  3CD6 P;  1SQV K;  1M1J A;  1SQP E;  1JM0 A;  1KMI Z;  5KJ7 D;  4PV1 C;  1M8O B;  1NTM K;  3FGA D;  3HUS C;  1DEE G;  3H1H J;  1N73 B;  1XTG B;  4PD4 D;  1S4X A;  2IZ1 A;  2B87 A;  1LP1 B;  2POH A;  4H0L C;  3JC2 2;  1NJI Q;  3I56 P;  3VMZ A;  1N7S C;  2BAS A;  1MFT A;  4UB8 H;  1FJP A;  5H2F E;  5AVV B;  1LGH B;  1YIJ P;  1RE4 A;  2K9Y A;  5CCH C;  3CI9 A;  1QL1 A;  1PL5 A;  4GT1 A;  1KQS O;  4R4M A;  1T3J A;  2O1J A;  5AW0 B;  3SWK A;  1M7L A;  1BE3 J;  4D6T D;  4PD4 E;  3OJA B;  5CCG D;  2XZR A;  1NU1 K;  1KYO D;  1RE3 C;  3TF5 A;  5KLV D;  3C1L A;  2ITA A;  2H88 C;  3H1I D;  4MN4 C;  2E74 D;  2B89 A;  4NPE A;  2BCC D;  1K05 A;  3WUU A;  2WSF H;  3MD0 A;  5APS A;  1LTG C;  3L71 D;  3IF4 A;  2N1T A;  2AEF A;  1S3J A;  1OXZ A;  1JCC A;  1T2K C;  1LT9 C;  4I2L C;  4IFD K;  4H0L D;  3M91 A;  3CME P;  1OW8 A;  2Q9I A;  1E5W A;  3AEG C;  3H1H D;  2GUV A;  1L2P A;  3RBZ A;  1L0L J;  1NOH A;  3L4F A;  5L8R J;  1LTJ B;  2C0X A;  5KLV E;  3RBX A;  1IZN B;  4N6J A;  2BCC E;  2OYH A;  4RO0 A;  2W6A A;  3O6Q A;  4C7N A;  3WUT A;  2I1K A;  2YKO A;  2ZT9 C;  3AE4 C;  5GTH H;  3NXS A;  3MHV A;  2HG5 D;  4OVN F;  4LLH A;  2OGU A;  4ASW A;  2KSE A;  1KB9 H;  3V5B A;  3M0D A;  3VP8 A;  3A2A A;  1EDL A;  3BAT A;  2W6J H;  1YQ4 C;  4M3L A;  5AVQ B;  3A0B E;  5KLV G;  2IFN A;  3MTU E;  1AVO A;  1HJB A;  1Y8A A;  3AEF C;  4EIJ A;  3M9Q A;  2BCC G;  1LWU A;  3U1A A;  2FBW C;  2LR2 A;  1BCC D;  3L71 G;  2E75 C;  5KAF H;  1GL2 A;  1T8Z A;  2KNC B;  5TIS E;  2KIK A;  1KQG B;  1MUU A;  4IL6 E;  3CX5 H;  1BE3 E;  4OGQ C;  3E1R A;  1SFC C;  3H1H G;  2YIU B;  3CCE P;  1N86 A;  1H0T A;  5KAI E;  2R3S A;  2NZ2 A;  5B66 H;  3CCM P;  1SLQ A;  4KT0 J;  2ZT9 D;  4WBA A;  1GU4 A;  2YKQ A;  1Q7Y Q;  1NYH A;  2I8D A;  1JOC A;  3FX0 A;  5GTI H;  3H25 A;  2W6B A;  1VQ6 P;  2QM7 A;  2OYI C;  3KZI H;  1ZR2 A;  3VMA A;  1S9K D;  2YNY A;  1Q82 Q;  3RK3 C;  1SS1 A;  1BE3 G;  2XKM A;  1L0L E;  1FBM A;  1J1E B;  4HYT B;  4NPF X;  2K3R A;  1R5S A;  3BRT B;  5E79 H;  1URQ D;  4CPG A;  2BEZ F;  2E75 D;  2RMZ A;  3L37 A;  4DT0 A;  3R4Y A;  3ABV C;  1KIL D;  3LW5 H;  2AXT H;  2OYO A;  1IK7 A;  2P2U A;  2R44 A;  3RL0 g;  4OGQ D;  1L0N D;  1DEB A;  1SFC D;  2OQQ A;  3JCU E;  4L73 A;  2IX7 C;  4ZNC A;  1JCD A;  2D2C B;  2Q5U A;  1HWT C;  2KYV A;  1HUC A;  1NTK J;  5B5E E;  1QGK B;  2WIT A;  3CCR P;  2AEJ A;  4UB6 E;  2HOD B;  3V2R A;  1S5L E;  2DW3 A;  1KIL E;  2IYO A;  2KSJ A;  3L73 J;  1WMK A;  5H2F H;  4L76 A;  1L0L K;  2WSE H;  3W67 A;  2Y0D A;  4EOT A;  3MGN A;  1S1C X;  5AW8 B;  4Y99 C;  1N73 A;  2FYU J;  3QH9 A;  2PRR A;  5BU5 A;  3I55 P;  2A45 H;  1FZF A;  1FZC C;  4PD4 H;  1LP1 A;  1M57 D;  4LC1 A;  2RH0 A;  2OTK E;  4HB1 A;  3LID A;  2Y9Z A;  1GMJ A;  2M3B A;  3P8C D;  3AE9 C;  5AW9 B;  1YJN P;  3VOP A;  4W80 A;  3A0H E;  4H44 B;  2N1T C;  1FJK A;  1VQP P;  1X8Y A;  2PGD A;  3H1J J;  1RY3 A;  3IN6 A;  5AW1 B;  1AV1 A;  2QVA A;  4XA4 A;  2O01 J;  1NTK D;  3T97 B;  1SQB K;  4KJM A;  2SPZ A;  3H1L E;  1AJY A;  1FZE A;  1DD3 A;  3AE8 C;  5CHX A;  4DOJ A;  1KC8 Q;  2WSC J;  1JY3 N;  2LXC B;  3L73 D;  3TDK A;  5CBN A;  4GOF A;  3M0A A;  2NPS C;  4GKG A;  5DJU B;  1J1D B;  4I6M C;  1FU1 A;  2QG4 A;  2WVR A;  4GOD A;  1SQQ J;  4GDO A;  1ZV8 A;  3IAO A;  2FYU D;  3V2N A;  1NTK E;  1PFI A;  3GMA A;  1LTJ A;  5APV A;  3RGU A;  2E76 C;  1NTM D;  3IR9 A;  2M3E A;  1VQL P;  2JP3 A;  2A06 E;  2P7J A;  5KKZ B;  2WSS H;  1YI2 P;  4WWI A;  3L73 E;  2KS1 B;  1VF5 C;  3II6 A;  1D7M A;  2E74 B;  1LTS C;  1GU5 A;  1LWU C;  2KUB A;  1CI6 B;  1EXJ A;  1FZG A;  1EXI A;  5TIS H;  2FYU E;  3HUS B;  2LXB A;  5CBO A;  4IL6 H;  2QEX P;  4K3A A;  2E5Y A;  3VP9 A;  1J2J B;  1NTK G;  4H0L B;  1AVY A;  2ZYG A;  5KAI H;  3VYI A;  1NU1 D;  1XTC C;  4D6T J;  5BVZ A;  3EWK A;  2NPS D;  3CC4 P;  1S2E A;  2GM4 A;  1YTZ I;  2N9Y B;  3CWB D;  3HD7 B;  3B8E B;  1PV3 A;  1SQX K;  2KXP B;  3L73 G;  3H1I J;  3P7K A;  3AEB C;  3B5N D;  3V4W A;  2KNC A;  1VQM P;  4ZMD A;  2E76 D;  2E5T A;  3H1J E;  2FYU G;  1PGP A;  3MP7 B;  3SSU A;  1ZW0 A;  3CCL P;  2R5D A;  5DJT B;  1MZ9 A;  3M9H A;  5AVS B;  1EZV I;  4U7J A;  4YTP C;  1JO5 A;  2K9J B;  3H32 B;  1A02 F;  1K9M Q;  2V7Q H;  1IFM A;  3V2P A;  1OWA A;  2G3A A;  2W90 A;  4HJG H;  1KQF B;  2P67 A;  2YO2 A;  1LT9 B;  3HTK B;  1KFM A;  2AXC A;  3UIA A;  3JCU H;  1JTH B;  1YHQ P;  1SQQ E;  3SFE C;  3B71 A;  1QX8 A;  3H1J G;  3CPW O;  5APW A;  5B5E H;  2QJK C;  2R5B A;  1L4A C;  1ZLL A;  5APY A;  5KLI C;  1X0T A;  4ZKP A;  3CCU P;  1R5L A;  5AW2 B;  3RL0 C;  1S5L H;  3VMY A;  2KLU A;  2ZT9 B;  2P58 A;  3K5B A;  1RH5 B;  1FC2 C;  1SQP K;  2IPP A;  4WY4 C;  2C9N Y;  1LTA C;  2FKW B;  1BCC J;  1YJW P;  5AVR B;  4PV1 D;  4YXW H;  2WQY C;  1HH0 A;  2FFD C;  1SQQ G;  3BCC J;  1EZV D;  1OW6 A;  2XU6 A;  1BSH A;  2ZXE B;  2HOD A;  3HE4 B;  4D6T E;  2IBZ I;  1N7S D;  1KYO E;  4XE5 B;  1WRG A;  2M0B A;  1OMI A;  2FYZ A;  3GHG B;  1CSB A;  1YYC A;  1URQ B;  1FZA A;  2E75 B;  3EQ2 A;  3H1I E;  5APU A;  1JMB A;  1NH4 A;  5CCH D;  3OAK A;  1KIL B;  5AW3 B;  3TGU J;  2CPB A;  1AFO A;  3L71 E;  2Z5H A;  1L4A D;  1LTB C;  4OGQ B;  1SFC B;  2QJY B;  4H13 C;  2IFM A;  1JY3 O;  3RL0 D;  1PGO A;  5AW5 B;  1OW7 A;  1R8E A;  1LJ2 A;  4TT3 H;  3H1H E;  2K88 A;  4D6T G;  2YKP A;  1JUN A;  4WY4 D;  1IFJ A;  3WU2 E;  2Z4E A;  2JWD A;  4Z1M H;  1RF0 A;  2G8Y A;  5AW6 B;  1NKZ B;  2OYI B;  4DZO A;  3H1I G;  1Z56 A;  1T2K D;  2M8R A;  5AVT B;  3L72 J;  1ZRT D;  3TK1 A;  3GF3 A;  1L0N J;  3T97 A;  1LTT C;  3BCC D;  2IBZ D;  5KLV K;  1A02 J;  5KJ7 A;  2QA4 P;  3HE5 B;  1Q86 Q;  3TSI A;  1LTJ C;  3GW6 A;  3I5C A;  4BXL A;  1IFI A;  3KXD A;  1FOS F;  5KTB A;  1JY2 N;  1YIT P;  4IFF A;  2WSF J;  4H13 D;  2M5A B;  1OVR A;  3TGU D;  3CCJ P;  4C46 A;  1BCC E;  1SVF A;  1VQ4 P;  3SFD C;  2W8Z A;  2IBZ E;  2C0W A;  1JNM A;  2L5G B;  1NKN A;  2Z5I A;  1H8A A;  4JQ0 D;  2IDB A;  3GG2 A;  1AA0 A;  2FXP A;  5CCG A;  2HR3 A;  3L75 J;  1BDD A;  1IK9 A;  3PTZ A;  1QVG O;  2GUS A;  3E7K A;  1UII A;  1H89 A;  2KS1 A;  1HVV A;  2KLV A;  1USD A;  1EDI A;  2JDI H;  3TNU B;  3CMA P;  4U3F D; 
#chains in the Genus database with same CATH homology
 1JY2 P;  1GZL A;  1RF1 A;  1SQB K;  1CI6 A;  3U59 A;  4AUW A;  2WPS A;  1G2C B;  3HD7 D;  4O9B A;  1FZE A;  4Y99 B;  1GD2 E;  1NTZ K;  3HUS A;  5CHX A;  1X79 B;  4DOJ A;  5BU8 B;  2NPS A;  2MJZ A;  1SQV K;  2C9L Y;  1QL2 A;  1M1J A;  1FZC B;  2XNX A;  1JY3 N;  2O01 H;  5KJ7 D;  1HBW A;  1S9K E;  1DH3 A;  1NTM K;  1NHL A;  3HUS C;  3KYQ A;  1N73 B;  4RES B;  1XTG B;  2W27 A;  1GW3 A;  3M0A A;  4W7Z A;  1EQ7 A;  1ZN5 A;  2H8P D;  2NPS C;  3B5N A;  4GKG A;  1M1J C;  1J1D B;  4I6M C;  2POH A;  1FU1 A;  3VMZ A;  2WSC H;  3HD7 A;  1ZV8 A;  1N7S C;  3V2N A;  2E42 A;  2BAS A;  1IFN A;  1PFI A;  3RK3 B;  5AVU B;  1LTJ A;  5APV A;  3BVH A;  1FJP A;  5AVV B;  1GTW A;  3N4X A;  1LGH B;  3IR9 A;  1RE4 A;  1FZB A;  5CCH C;  3CL3 D;  3A7O A;  3CI9 A;  3NMD A;  1QL1 A;  3RK3 D;  1RE3 A;  4GT1 A;  2P7J A;  5APQ A;  3G3Z A;  1T3J A;  3EFG A;  3GHG C;  1YTZ T;  2O1J A;  1URQ C;  5AW0 B;  4AQR D;  3KDP B;  1M7L A;  3II6 A;  1RE4 C;  5CJ4 A;  1GK6 A;  1LTS C;  1GU5 A;  3OJA B;  5CCG D;  1KIL C;  1J1E C;  2XZR A;  1NU1 K;  1G1J A;  1HGZ A;  1JY3 P;  3BRV B;  1RE3 C;  1LWU C;  1KZU B;  2LKM A;  1RF1 B;  3H32 A;  1CI6 B;  2XV5 A;  2I1J A;  1FZG A;  3HUS B;  4AYC A;  1X9V A;  1LT9 A;  2NPS B;  3C9I A;  2KOG A;  1M1J B;  3E1I A;  3VP9 A;  1J2J B;  2WSF H;  3MD0 A;  4LGD E;  5APS A;  1LTG C;  1JTH A;  2N1T A;  4I1L A;  3NFQ A;  1MFZ A;  2WT7 A;  2ZFC A;  3VYI A;  1XTC C;  1OXZ A;  1JCC A;  1T2K C;  5BVZ A;  1LT9 C;  3O8Z A;  2NPS D;  3B5N B;  4I2L C;  1G1I A;  4IFD K;  2XDJ A;  3NTN A;  3U1C A;  4W7Y A;  3M91 A;  3P32 A;  2GM4 A;  1YTZ I;  2WPR A;  3HD7 B;  2WWW A;  3B8E B;  2Q9I A;  1E5W A;  1SQX K;  2GUV A;  3P7K A;  4OH8 B;  3B5N D;  1NOH A;  2Q3I A;  3L4F A;  3V4W A;  1LTJ B;  2C0X A;  2WPQ A;  2PAJ A;  4N6J A;  2OYH A;  1LTI C;  3VTP C;  2W6A A;  4C7N A;  2I1K A;  1H88 A;  4N78 D;  2YKO A;  3P8C E;  5AW7 B;  2R3C A;  2R5D A;  1MZ9 A;  2PP6 A;  2OYH C;  3M9H A;  5AVS B;  3NXS A;  1N7S A;  3L36 A;  2HG5 D;  1JO5 A;  3V2Q A;  3CLQ A;  4LLH A;  3H32 B;  1A02 F;  1IFM A;  3V2P A;  1OWA A;  4KHX A;  3V5B A;  2HPC A;  4JYC A;  3HE4 A;  2JJL A;  3IFM A;  3M0D A;  3VP8 A;  2P67 A;  3A2A A;  3BAT A;  2YO2 A;  1LT9 B;  2WZ7 A;  3HTK B;  5CCH A;  1KFM A;  3V4Q A;  3UIA A;  4M3L A;  5AVQ B;  1JTH B;  5AVZ B;  1MV8 A;  2N1T B;  3GHG A;  1L4A A;  2IFN A;  3MTU E;  1URQ A;  4N3Y B;  1ZR4 A;  2WT7 B;  3M0D C;  1HJB A;  4EIJ A;  3M9Q A;  3H6P A;  1KIL A;  3HRN A;  5APW A;  1LWU A;  1KQL A;  3U1A A;  2N1T D;  3KPE A;  2R5B A;  1L4A C;  2R32 A;  1ZLL A;  1DX7 A;  1N7L A;  1SFC A;  5APY A;  4ZKP A;  1GL2 A;  1T8Z A;  3M06 A;  5AW2 B;  3RL0 C;  1JY2 O;  4WY4 A;  3VMY A;  1NAF A;  2FXM A;  1MUU A;  3TYY A;  1SFC C;  2OYH B;  2FFD A;  1WT6 A;  2HYN A;  1N86 A;  1GL2 C;  4C7N B;  1SQP K;  3HTK A;  2IPP A;  4WY4 C;  2A45 I;  2C9N Y;  5AW4 B;  1LTA C;  2FKW B;  2J58 A;  1SLQ A;  5AVR B;  4WBA A;  1HH0 A;  2FFD C;  1GU4 A;  2H7H A;  2YKQ A;  2OYI A;  1N7S B;  2XU6 A;  2ZXE B;  1JOC A;  5CMZ A;  2HPC B;  2HOD A;  2VRS A;  3HE4 B;  5APT A;  1GW4 A;  2W6B A;  2HFE D;  2QM7 A;  1NTK K;  2OYI C;  1N7S D;  1ZR2 A;  1FOS E;  4XE5 B;  1WRG A;  1S9K D;  3BAS A;  3HE5 A;  2YNY A;  4HH2 A;  2FYZ A;  4ZKU A;  3N7N A;  3GHG B;  1CSB A;  1YYC A;  1L4A B;  2HLO A;  1URQ B;  3RK3 C;  1FZA A;  1NO4 A;  3EQ2 A;  2YO3 A;  5APU A;  1L0N K;  3M9B A;  1NH4 A;  5CCH D;  2XKM A;  3OAK A;  1FBM A;  1J1E B;  1KIL B;  3RL0 B;  5AW3 B;  4HYT B;  2CPB A;  1AFO A;  1LWU B;  2Z5H A;  2WTY A;  5CCG C;  1L4A D;  3BRT B;  1URQ D;  1IFD A;  1LTB C;  2CPS A;  3L37 A;  1VDF A;  1W2E A;  1SFC B;  2J59 M;  5AVW B;  2IFM A;  1GL2 B;  2KB7 P;  1KIL D;  3LW5 H;  1JY3 O;  3RL0 D;  4WY4 B;  2P2U A;  5AW5 B;  2FYU K;  1RF1 C;  1DEB A;  1SFC D;  1FDM A;  2FFD B;  2YMY A;  1GL2 D;  2IX7 C;  2YKP A;  1JUN A;  4WY4 D;  5AVY B;  1IFJ A;  1JCD A;  2Q5U A;  1HWT C;  1T3U A;  2Z4E A;  3OA7 A;  2KYV A;  1HUC A;  1GK4 A;  1HTL C;  1RF0 A;  5AW6 B;  3LIE A;  1NKZ B;  2OYI B;  3MUD A;  4DZO A;  1Z56 A;  1T2K D;  2WIT A;  3A3Y B;  2M8R A;  1FAV A;  2H43 A;  3MIW A;  4N78 E;  5AVT B;  4B86 A;  2QM8 A;  3R2P A;  3B5N C;  3RK2 C;  2HOD B;  3V2R A;  3TNU A;  1RF0 C;  4IFM A;  4JF7 A;  3TK1 A;  3T97 A;  1LTT C;  1GDT A;  1G2C A;  2KSJ A;  5KLV K;  3HD7 C;  4C7R A;  5KJ7 A;  1A02 J;  3HE5 B;  3TSI A;  1IJD B;  1LTJ C;  1VPC A;  1L0L K;  2WSE H;  3I5C A;  1IFI A;  1FZC A;  4EOT A;  4JYB A;  1FOS F;  3MGN A;  5KJ7 C;  5KTB A;  1JY2 N;  4GIF A;  5AW8 B;  4Y99 C;  1N73 A;  4IFF A;  1AQ5 A;  5BU5 A;  2A45 H;  1N2D C;  1IO4 A;  1SP4 A;  3P8M C;  1FZF A;  1FZC C;  1KFN A;  3SWF A;  4LC1 A;  5APX A;  2E43 A;  3VMX A;  1NWQ A;  1N73 C;  4C46 A;  1JMM A;  5AVX B;  1SVF A;  3VN0 A;  3LID A;  1J1D C;  2N9B A;  1HGV A;  2C0W A;  3L35 A;  2M3B A;  3P8C D;  1JNM A;  3PP5 A;  5CJ0 A;  2L5G B;  2Z5I A;  1NKN A;  1H8A A;  5AW9 B;  3WMM 0;  3A5T A;  2JEE A;  1SQQ K;  3VOP A;  3KQG A;  5CCG A;  3RK2 B;  4W80 A;  1CZQ A;  4WB4 A;  1IK9 A;  2KP8 A;  2Q7C A;  2N1T C;  2GUS A;  1FJK A;  2P1J A;  1H89 A;  1CW5 A;  1HVV A;  2KLV A;  1X8Y A;  2A45 G;  2O1K A;  3SWY A;  1RY3 A;  2OAR A;  3RK2 D;  5AW1 B;  3TNU B;  4XA4 A;  1IC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...