1SFCA

Neuronal synaptic fusion complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
69
structure length
69
Chain Sequence
NLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a SNARE complex involved in synaptic exocytosis at 2.4 A resolution.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
molecule keywords PROTEIN (SYNAPTOBREVIN 2)
total genus 31
structure length 69
sequence length 69
chains with identical sequence E, I
ec nomenclature
pdb deposition date 1998-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sfcA00
2XDJA 1JTHB 2N1TB 3B5ND 3P8CE 1SFCB 3TSIA 1L4AD 1NHLA 1KILD 3PP5A 2N1TD 1URQB 1GL2B 1URQD 4W80A 1N7SA 1L4AB 2YMYA 2H8PD 3HD7D 1N7SB 4JF7A 3VOPA 2NPSD 1GL2C 1KILB 5CCGC 1L4AC 3RK3B 2N1TC 4W7YA 2N1TA 1KILA 4N78E 2M8RA 1GL2D 1XTGB 5KJ7C 2PP6A 3RK2C 2HG5D 2NPSC 5CCGA 5CCHC 5CCGD 3RL0D 4LGDE 3B5NC 2WZ7A 1HVVA 3KYQA 1KILC 1L4AA 5KJ7D 1T3JA 2NPSB 2HFED 1N7SD 3RK3C 3HD7B 3HD7A 4OH8B 1SFCC 5CCHD 1JTHA 4WY4D 2NPSA 4WY4B 3RK2B 3B5NA 3RK3D 3HD7C 3B5NB 5KJ7A 3HTKB 3RL0B 2KOGA 1GL2A 1N7SC 1URQA 3M0DC 4WY4C 4W7ZA 1SFCA 1SFCD 3RK2D 1URQC 3RL0C 5CCHA 4WY4A
chains in the Genus database with same CATH superfamily
1M1JC 1ZV8A 1BGYE 2N1TB 1NTZD 2PFXA 2Q9IA 1OW6A 2ZFCA 1GU4A 2K9YA 3BASA 3JCUH 3R2PA 4HH2A 2PRRA 3CXHH 4NPEA 5AW1B 4ASWA 1BCCD 3EFFK 1S4XA 4ASVA 3MIWA 3A0BH 2RN0A 2WSEJ 2O3JA 3H1KD 3G71P 1M90Q 2R5DA 2JO1A 4H0LB 1J2JB 4RKUJ 1YQ3C 1JY3O 4B86A 1M1JB 2R3SA 4UB8H 3USSA 2LXBA 2P10A 4IOIH 1SQQJ 3C1LA 1SQQD 1L4AB 2IZ0A 2YMYA 3A5TA 1RF1A 4D6TD 2E42A 3B8EB 4AYCA 1SQPJ 1YJWP 2BEQD 5B66E 1GZLA 1OVVA 2GA1A 2Q7CA 3BCCE 4TLFA 1AV1A 2JP3A 3L70D 2ZAEB 3PRJA 3QWOC 3VOPA 1X9VA 1QL2A 2AEMA 1YHQP 2ZYDA 1NWQA 2IBZE 2NPSD 2YNYA 3H1KJ 1SQBE 4H0LC 1SQXJ 1NTME 1VQ8P 3WU2E 1VQKP 5AVSB 4YXDC 5AVQB 4GIFA 2V4HA 2H88C 1PP9E 1JOCA 1LWUC 4U3FD 1L4AC 1OW8A 1YYCA 4GODA 4U7JA 1SQXG 2IPPA 2MJZA 3IAOA 3IFMA 3A3YB 5E79H 1H8AA 3HE5B 2QSIA 4W7YA 2KUBA 1CW5A 2CK3H 1VQ4P 1HTLC 1BE3D 1CI6B 1QL1A 4H44D 2Z5HA 4JPZB 2E75B 4R4MA 1GL2D 1NTZK 3H1LG 1OX3A 3ITKA 4K3AA 2P1JA 2L5GB 1LWUB 3AE9C 3OAKA 4GT1A 2QA4P 2E76D 1WMKA 3L73D 5KJ7C 4EOTA 2KSEA 2FYUE 1GMJA 1L0NE 3AE7C 3U1AA 3CMEP 5CCGA 1LTSC 2J5UA 2FKWB 2QM7A 3TDKA 4DT0A 3TGUD 1JMBA 3FWNA 1KQSO 3I56P 1USEA 2E75C 2Y9YA 2KZJA 1FZFA 2WZ7A 1LTBC 1R5SA 3AEFC 1JY2N 1FOSE 5KLIC 1U57A 3F5HA 2O01H 1T3JA 1K04A 2I1JA 2LR2A 2OYHC 1CZQA 2HFED 5TISH 3L71J 2W83C 3V5BA 2WT7A 1SQVD 3RK3C 1SQXE 3NXSA 3H1KE 3ABVC 2XNDH 4BRYA 1NKNA 2FYNB 2HLOA 1X79B 3LIDA 2NZ2A 1MFTA 4TT3H 5KLIB 1YITP 2YXQB 2LXCB 2K37A 3IR9A 2V7QJ 3L71E 3CWBJ 4Y28J 2OYHB 3GHGC 1JTHA 3H1ID 2IYOA 2JWAA 2NPSA 5KAIE 3CL3D 3HTKA 2Y0CA 1RF1C 4WVZA 4JQ0D 3H32B 4N6JA 4LC1A 2G3AA 3CXHE 4YTPC 3RK3D 1DH3A 4D6TE 2FYUG 3JCUE 3AE3C 2BCCE 1EZVE 1LGHB 2FYNC 4Y99B 4YXWH 2ZVOB 3B5NB 3V2PA 1W2EA 1T3UA 1IFJA 2KSJA 1QVGO 4I6MC 1G1JA 3TGUE 3Q3DA 1K8AQ 2N9BA 5APYA 3TK1A 3GHGB 4U3FG 5B5EE 3G3ZA 3M0DC 2KLVA 1SQVK 2FFDB 3TNUB 3IF4A 1KQGB 3MHVA 1H0TB 5AVWB 3CC4P 2JKVA 2JJLA 3BRVB 2XV5A 1SQBK 3MUDC 1NTMK 1PPJD 3AEDC 4Y99C 1GW4A 1IZNB 3HE4A 3K5BA 1KB9H 1BCCJ 4WBAA 1OZHA 3H1IJ 4WB4A 2IZ1A 2YXRB 5APQA 3M0DA 5AW4B 3WUVA 1BGYD 4OVNF 5CCGD 1KB9I 1KV4A 1HWTC 3CMAP 1RE3C 4PV1B 1LP1B 3P8CE 4BXLA 3C9IA 3HE4B 1AA0A 1FC2C 1ZR2A 1U7JA 2Q5UA 3L72D 2AXTH 2OQQA 3VMAA 2Y0DA 1PP9J 3U1CA 1S1CX 2FYZA 1DX7A 1J1DB 3L73J 1H88A 1KILD 4PD4D 1L2PA 1J1EB 1S3JA 2C9LY 3PLNA 1RE3A 5CBOA 5GTHE 1G2CA 1QLED 1L0NG 1ZN5A 2M5AB 5KLVE 1NU1D 2W27A 3CX5D 3GG2A 4HKZH 3O6QB 5AVYB 3TGUJ 3KZIH 1SQQK 2OTKE 4OWFA 2ITAA 2YMKA 2HPCB 1EZVD 2B87A 4I1LA 1VQMP 4RO0A 1NU1K 3HD7D 1NVOA 3L74G 3VMZA 2JDIH 2YIUC 1N7SB 1LTTC 3AE4C 3P8MC 1NTZE 1HH0A 1UIIA 2BASA 5KAFE 1W5CE 2QM8A 5AVXB 2QIWA 2R44A 2C9NY 4PD4H 3M9QA 2P58A 3E7KA 2OYIB 2KNCA 2SPZA 1USDA 3LW5H 4ZKPA 1PGQA 1ZXGA 1GDTA 4L75A 4IFDK 1AQ5A 1FBMA 1K9MQ 5AVUB 3Q5PA 1VQNP 1JY3N 1QGKB 2WVRA 2K9JB 5APTA 2KP8A 4BRYB 1GD2E 3PH0A 1EZVI 3P8CD 3HUSA 1SQXK 3KPEA 2GM4A 3RGUA 1Q90D 1YIJP 3VN0A 3Q5RA 1KQLA 4UB8E 2WSFJ 1RY3A 1YBKA 2OYIC 1N73C 3H1LJ 1RQUA 4I7ZC 2V7QH 5GTIH 3JC22 1FZGA 1EXIA 3I5CA 3V2NA 2FXMA 3TGUG 3V4QA 1DD3A 1Q7YQ 1NOHA 2PP6A 1X0TA 3E1IA 2Q1KA 3KQGA 1BSHA 1PIXA 1NTMG 1LTGC 3O6QA 2BCCG 5AW7B 3RBZA 2XU6A 2M5AA 2KNCB 5AW5B 2OYIA 4QMAA 5KAFH 3D71A 3RL0D 4LGDE 2I1KA 1KFMA 2POHA 4K35A 2MKVA 4PD4I 3AEAC 4IL6E 2AEFA 1LTJB 3SFDC 2A45I 3FXEA 4RJTA 2QJYC 2WSCJ 3P32A 4OGQB 1PFIA 4ZNCA 2PGDA 1PV3A 3N4XA 1KQFB 1S5LH 4EIJA 1LWUA 4RESB 1K05A 1KILC 1P84I 1SQXD 1Y47A 2B87B 2ZJSE 3AEBC 5KJ7D 1A02J 3H1IG 2Z5IA 3L74J 4KT0J 5EFWB 1P84H 4EDFA 1HUCA 1RE4A 3CX5I 2B88A 3L70J 1G2CB 3H1JJ 1CI6A 3GLMA 1N7SD 1L0NK 1AJYA 2QRXA 3HD7B 1VF5C 2QJYB 3HE5A 3H1HD 4OGQC 1FDOA 3GMAA 1IFMA 4M3LA 1S2EA 3HD7A 2O1KA 3TNUA 5CCHD 2YO3A 4I2LC 3GHGA 3CLQA 4HB1A 3TYYA 3Q2YA 3WUTA 2PAJA 1T6AA 2WITA 1OVUA 2QVAA 1JY3P 2WPQA 3RK2B 2QG4A 3CC2P 2Q3EA 1MFZA 2FYUK 3AE8C 3B5NA 3CCVP 3BCCJ 3HD7C 4EYYQ 4IL6H 5AW8B 1IFPA 4PJ0E 1RHZB 1RH5B 3L35A 1LTJA 1EXJA 1JEKA 1Q2NA 1MZ9A 1Z56A 3HTKB 3Q1MA 1OMIA 4CPGA 2K88A 1NTZG 2GUSA 2KYVA 3CX5H 2IBZI 4IL6X 4JYCA 3CCUP 1PGPA 1Y9BA 1BE3G 2N9YB 1R8EA 1JY2P 3V2QA 1PL5A 1SQVG 1FE6A 4A7PA 2J58A 1KMIZ 1BCCE 3CCSP 3AEEC 1YTZT 1SQPD 5DJUB 3V6IA 3RK2D 1RQVA 2KXPB 2OYOA 3MTUE 3D6ZA 5AVZB 1ZR4A 2ZT9D 2FYUJ 3BCCG 2XDJA 1JTHB 1KB9D 1NTKD 2E5TA 1KYOE 1IK9A 2Q6QA 3A0HE 5APWA 3B5ND 1MV8A 3GW6A 3HUSB 3NFQA 3OW2O 2W90A 2XZRA 4JYBA 3ZDMA 4H13B 1KN7A 1HGZA 1SFCB 2K9JA 2QJPB 3A0BE 4IFMA 2WPVB 4XA4A 4L73A 3CCRP 1L4AD 4GOEA 2E76B 1MKMA 1NHLA 1NGMB 3CC7P 1IFDA 1YJ9P 2C0XA 1P84E 2BCCJ 1FZCC 1FDIA 1N8RQ 1BDDA 1SQBD 4PV1D 2WT7B 1VQ6P 2M0BA 1GL2B 1OVRA 3WMM0 2B9BA 2E75D 4GOFA 2KZIA 3L75D 1WT6A 3FX0A 2YKOA 3VP9A 3CCMP 2Z4EA 1KFNA 1N7SA 2XNXA 1FOSF 3A7OA 1KZUB 1M56D 1ZOYC 2QJPC 5DJTB 1L0LE 2BEZF 4OGQD 2HPCA 1FU1A 2R5BA 2E76C 1RF0A 1MUUA 2W8ZA 4BWNA 4JF7A 1JUNA 5M1BA 1LT1A 3QH9A 3BATA 1BE3E 3L37A 3H1LD 2IYPA 1GL2C 2WSSH 5CCGC 2AXTE 2QEXP 2E74C 2KIKA 1HJBA 1LNQA 2J59M 3BRTB 1GU5A 3TF5A 5KKZB 5H2FH 4GDOA 4XFJA 1Q86Q 3P7KA 1KC8Q 5C39A 3RK3B 2CPBA 1LP1A 2N1TC 1KYOD 5BU8B 4AUWA 3SSUA 1HJ0A 2C0WA 2L91A 2M3BA 1AQTA 1QX8A 2IBZD 2HYNA 3OA7A 3R4YA 2M8RA 4L74A 5AW0B 2KK7A 3PHLA 1S5LX 3L70E 2O01N 2B89A 2YO2A 3L74E 4N3YB 4Z1MH 3V4WA 2KLUA 2UWJE 1JO5A 1E79H 5APUA 2A06D 2IFMA 2W6AA 1JNMA 1JM0A 5KKZC 1L0NJ 4LLHA 1RF1B 1BGYG 1VPCA 1HBWA 1SQBG 1PP9D 2NRGA 5AW2B 1N2DC 3HRNA 3L75E 3S4RA 2NPSC 3CCJP 1SQVE 2FFDA 1FS0E 1PZQA 2YKPA 5CCHC 1W2BO 4R4LA 1TU3F 1KYOH 3AEGC 3F89A 3B5NC 4DZOA 3G4SP 1VF5D 3VTPC 3CXHI 1U7MA 3B4SA 3EQ2A 1T2KC 3H1KG 3KXDA 1HVVA 3MUDA 1NTKK 2JWDA 2FFDC 3MP7B 1WRGA 1L4AA 3L4FA 1NU1J 2LKMA 2M3EA 3H32A 2KS1A 2QE7H 2K1AA 3H1HG 5K5GB 5AVRB 2WSCH 3CPWO 1SQPG 2NPSB 1H89A 3WUUA 3CCLP 2WSFH 3AE5C 4HYTB 1SQQG 1XTCC 3CWBE 1K73Q 2H7HA 1HF9A 2G8YA 1EDKA 1ZRTD 4O9BA 1BE3J 1M1KQ 3CD6P 2HR3A 2O1JA 3MGNA 5CMZA 4DJGA 3H1JD 1NAFA 1RE4C 2WWWA 1NTMD 1NKZB 2GUVA 2ZXXA 3L74D 4H0LD 2ZYGA 4JBZA 3SFEC 3SWFA 1T8ZA 4WY4D 3JSVC 1VQ9P 3FXDA 1IFIA 1KYOI 3N7NA 5APVA 5AVTB 1J1EC 1HGVA 4GKGA 1EQ7A 3S1KA 1FJKA 1PGOA 1ZW0A 2Y9ZA 1RF0C 2KB7P 1Q82Q 4DCKA 3RL0B 1OXZA 1SS1A 1X8YA 1YTZI 3PTZA 1GK6A 2KOGA 2WQYC 3S9OA 1SQVJ 1N7SC 1URQA 3V2RA 1DEEG 2E74D 3C8VA 2ZYAA 1SVFA 2RH0A 3L71D 3L75J 1S9KD 3G9RA 1N73A 3L73E 4KJMA 4D6TG 4U3FJ 5L8RJ 2OTLP 3L71G 2H89C 3L72E 1JMMA 4W7ZA 3H1HE 1BDCA 1T2KD 1ZRTE 2R32A 3NTNA 1IO4A 3L70G 2W6JH 1VQOP 1H0TA 1DEBA 1SFCD 3CXHD 2WMMA 3RK3E 1VQ5P 1KTMA 1KB9E 1NTKE 1URQC 1VDFA 3RL0C 1GW3A 4WY4A 1S9KE 4N78D 2A45G 1M8OB 5KLVG 4UB6E 1EZVG 3SWKA 3W67A 1NTKJ 4UB6H 3EWKA 1DD4A 1ZLLA 2KI7B 2FY8A 1LTIC 2QJKB 1FZEA 5KLVK 3LIEA 3Q5SA 3L36A 3TSIA 3A2AA 1PPJE 3EFGA 2RMZA 4I7ZB 4U3FE 4L76A 3PP5A 5BVZA 2HODA 1NTMJ 2N1TD 1AVOA 1SQBJ 2IFNA 1URQB 5BU5A 2D2CB 1IC2A 1URQD 1M57D 4W80A 1ZMEC 4KHXA 2WSEH 1X22A 1L0LD 3GF3A 1L0LJ 1OIPA 2QJKC 1SQPE 1E5WA 1SLQA 3KZIE 3VMYA 2H8PD 5CJ0A 2R3CA 1LTJC 1NU1G 2RKLA 2FBWC 3A0HH 5B66H 1FAVA 1OFCX 1M1JA 3SWYA 5AW3B 1JB0J 4H44C 3AE1C 2IDBA 3M9BA 3RBXA 2D2CC 5KLVD 1FZBA 1KILB 5CJ4A 1KILE 4PD4E 1EDJA 1M7LA 1NJIQ 3H1JE 1OW7A 1P84D 1YI2P 3B71A 3KDPB 1JCDA 2WPSA 4PJ0H 1SP4A 1LTAC 1FZAA 3I55P 3M9HA 4PV1C 1BGYJ 2N1TA 1YJNP 2OYHA 1Y8AA 1KILA 4N78E 2P7JA 1LT9B 3II6A 4H44B 1JY2O 2E5YA 1L0LK 1JCCA 3GF7A 2A06G 2JEEA 2D2CD 1FDMA 1L0LG 5GTHH 1PPJG 1Q81Q 1J1DC 2KS1B 2VRSA 1G1IA 2A45H 2AEJA 1R5LA 1XTGB 3BVHA 2AXCA 5GTIE 2H43A 2XKMA 2HG5D 3RK2C 4C7NB 3W68A 1A02F 3L73G 1IK7A 1NO4A 3H1IE 5KAIH 1NYHA 1LT9C 3T97B 5CHXA 3NMDA 2ZT9C 1QEXA 4HJGH 3H1LE 4NPFX 2OGUA 1GTWA 1VQ7P 2YIUB 5E79E 2I8DA 4NPDA 4C46A 2FYUD 1NTKG 1VQPP 1EDIA 2BCCD 3D6YA 1KORA 3KYQA 3O8ZA 4WWIA 4XE5B 4C7RA 1S72P 2Q3IA 1AFOA 1S5LE 2ZXEB 4H13D 1SQPK 3L72G 1FZCA 1YQ4C 3H25A 1VQLP 3CWBD 1CSBA 3E1RA 1DIPA 2OTJP 3FGAD 2JR8A 1GK4A 2CPSA 2K3RA 3KHUA 2FXPA 5APXA 1UIXA 2ZT9B 3VYIA 2IX7C 5B5EH 1BSNA 2HODB 4MN4C 4D6TJ 5AVVB 1QVFO 3H6PA 3M0AA 3CCEP 1AVYA 3L75G 2OARA 1KD1Q 3PJSK 2Y0EA 1NTZJ 2WPRA 4ZKUA 3FWLA 3HUSC 1EDLA 2P2UA 1N73B 4H13C 1PP9G 1SFCC 1N86A 2FXOA 4OH8B 3U59A 2WTYA 1VL2A 3AE6C 3G6EP 1ZP0C 3IN6A 3OJAB 4WY4B 3AECC 3RL0g 1FJPA 1IFNA 1IJDB 1FZCB 5KLVJ 3CCQP 2W6BA 1PGJA 3D70A 5H2FE 3AE2C 1BCCG 1NH4A 2YKQA 3MZWB 5AW9B 1SQQE 3CWBG 2E43A 5KJ7A 4IFFA 5AW6B 5APSA 4AQRD 5CBNA 3T97A 1NU1E 3CX5E 3UIAA 5TISE 1GL2A 2O01J 1L0ND 4WY4C 4YPCA 1OWAA 3VMXA 2DW3A 2IBZG 3M91A 4ZMDA 4C7NA 3MD0A 3M06A 3BCCD 1N7LA 3CI9A 3H1JG 5KTBA 2ZVNB 1EC5A 1SFCA 2A06E 3LW5J 2P67A 2E74B 4DOJA 1D7MA 1LJ2A 4EI2A 3H1HJ 5TJHA 3WU2H 3L72J 1VF5B 5CCHA 3VP8A 1LT9A 1NAYA
chains in the Genus database with same CATH topology
1M1JC 1ZV8A 2N1TB 2Q9IA 2ZFCA 1GU4A 3BASA 4HH2A 3R2PA 5AW1B 3MIWA 2R5DA 1J2JB 1JY3O 4B86A 1M1JB 3A5TA 1L4AB 2YMYA 1RF1A 2E42A 1HBWA 3B8EB 4AYCA 1GZLA 2Q7CA 3VOPA 1X9VA 1QL2A 1NWQA 2NPSD 2YNYA 5AVSB 5AVQB 4GIFA 1JOCA 1LWUC 1L4AC 1YYCA 2IPPA 2MJZA 3IFMA 3A3YB 1H8AA 3HE5B 1CW5A 4W7YA 1HTLC 1CI6B 1QL1A 2Z5HA 1GL2D 1NTZK 2P1JA 2L5GB 1LWUB 3OAKA 4GT1A 5KJ7C 4EOTA 3U1AA 5CCGA 1LTSC 2FKWB 2QM7A 1FZFA 2WZ7A 1LTBC 1JY2N 1FOSE 2O01H 1T3JA 2I1JA 2OYHC 1CZQA 2HFED 2WT7A 3V5BA 3RK3C 3NXSA 1NKNA 2HLOA 1X79B 3LIDA 3IR9A 2OYHB 3GHGC 1JTHA 2NPSA 3CL3D 3HTKA 1RF1C 3H32B 4N6JA 4LC1A 3RK3D 1DH3A 1FZGA 1LGHB 4Y99B 3B5NB 3V2PA 1W2EA 1T3UA 1IFJA 2KSJA 4I6MC 1G1JA 2N9BA 5APYA 3TK1A 3GHGB 3G3ZA 3M0DC 2KLVA 1SQVK 2FFDB 3TNUB 5AVWB 2JJLA 3BRVB 2XV5A 1SQBK 1NTMK 4Y99C 1GW4A 3HE4A 1H88A 4WBAA 5AW4B 4WB4A 5APQA 3M0DA 1HWTC 1RE3C 3P8CE 3C9IA 3HE4B 1ZR2A 2Q5UA 3U1CA 2FYZA 1DX7A 1J1DB 1KILD 1J1EB 2C9LY 1RE3A 1G2CA 1ZN5A 3BVHA 2W27A 5AVYB 1SQQK 2HPCB 4I1LA 1NU1K 3HD7D 3VMZA 1N7SB 1LTTC 3P8MC 2BASA 1HH0A 2QM8A 5AVXB 2C9NY 3M9QA 2OYIB 3LW5H 4ZKPA 1AQ5A 1GDTA 4IFDK 1FBMA 5AVUB 1JY3N 5APTA 2KP8A 1GD2E 3P8CD 3HUSA 1SQXK 3KPEA 2GM4A 3VN0A 1KQLA 1RY3A 2OYIC 1N73C 3I5CA 3V2NA 2FXMA 3V4QA 1NOHA 2PP6A 3KQGA 3E1IA 1LTGC 5AW7B 2XU6A 5AW5B 2OYIA 3RL0D 4LGDE 2I1KA 1KFMA 2POHA 1LTJB 2A45I 3P32A 1PFIA 3N4XA 4EIJA 1LWUA 4RESB 1KILC 1A02J 5KJ7D 2Z5IA 1HUCA 1RE4A 1G2CB 1CI6A 1N7SD 1L0NK 3HE5A 3HD7B 1IFMA 4M3LA 3HD7A 2O1KA 3TNUA 5CCHD 2YO3A 4I2LC 3GHGA 3CLQA 3TYYA 2PAJA 2WITA 1JY3P 2WPQA 3RK2B 1MFZA 2FYUK 3B5NA 3HD7C 5AW8B 3L35A 1LTJA 1Z56A 1MZ9A 3HTKB 2GUSA 2KYVA 4JYCA 1JY2P 3V2QA 2J58A 1YTZT 3RK2D 3MTUE 1ZR4A 5AVZB 2XDJA 1JTHB 2OYHA 1IK9A 5APWA 1FDMA 3B5ND 1MV8A 3HUSB 3NFQA 2XZRA 4JYBA 1HGZA 1SFCB 4IFMA 1JO5A 4XA4A 1L4AD 1NHLA 1IFDA 2C0XA 1FZCC 2WT7B 1GL2B 3WMM0 1WT6A 3VP9A 2YKOA 2Z4EA 1FOSF 1KFNA 1N7SA 2XNXA 3A7OA 1KZUB 2HPCA 1FU1A 2R5BA 1RF0A 1MUUA 4JF7A 3BATA 3L37A 1GL2C 5CCGC 2J59M 3BRTB 1GU5A 3P7KA 3RK3B 2CPBA 2N1TC 4AUWA 2M3BA 2C0WA 5BU8B 2HYNA 3OA7A 5AW0B 1S9KD 1HJBA 2M8RA 2YO2A 4N3YB 3V4WA 5APUA 2IFMA 2W6AA 1JNMA 4LLHA 1RF1B 1VPCA 5AW2B 1N2DC 3HRNA 2FFDA 2NPSC 2YKPA 5CCHC 4DZOA 3B5NC 3VTPC 3EQ2A 1T2KC 1HVVA 3MUDA 1NTKK 2FFDC 1WRGA 1L4AA 3L4FA 1JUNA 2LKMA 3H32A 5AVRB 2WSCH 1H89A 2NPSB 2WSFH 4HYTB 1XTCC 2H7HA 4O9BA 2O1JA 3MGNA 5CMZA 1NAFA 1RE4C 2WWWA 1NKZB 2GUVA 3SWFA 1T8ZA 4WY4D 3N7NA 1IFIA 5APVA 5AVTB 1J1EC 1HGVA 4GKGA 1EQ7A 1FJKA 1RF0C 2KB7P 3RL0B 1OXZA 1X8YA 1YTZI 1GK6A 2KOGA 1A02F 1N7SC 1URQA 3V2RA 1SVFA 1N73A 1JMMA 4W7ZA 1T2KD 2R32A 3NTNA 1IO4A 1DEBA 1SFCD 1URQC 1VDFA 3RL0C 1GW3A 4WY4A 1S9KE 4N78D 2A45G 1ZLLA 5KLVK 1LTIC 1FZEA 3LIEA 3L36A 3TSIA 3A2AA 3EFGA 3PP5A 5BVZA 2HODA 2N1TD 2IFNA 1URQB 5BU5A 1IC2A 1URQD 4W80A 4KHXA 2WSEH 1E5WA 1SLQA 3VMYA 2H8PD 5CJ0A 2R3CA 1LTJC 1FAVA 1M1JA 3SWYA 5AW3B 3M9BA 1FZBA 1KILB 5CJ4A 1M7LA 3KDPB 1JCDA 2WPSA 1SP4A 1LTAC 1FZAA 3M9HA 2N1TA 1KILA 4N78E 2P7JA 1LT9B 3II6A 1JY2O 1JCCA 1L0LK 2JEEA 1J1DC 2VRSA 1G1IA 2A45H 1XTGB 2H43A 2XKMA 2HG5D 3RK2C 4C7NB 1NO4A 1LT9C 5CCGD 5CHXA 3NMDA 1GTWA 4C46A 3KYQA 3O8ZA 4XE5B 4C7RA 1AFOA 2Q3IA 2ZXEB 1SQPK 1FZCA 1CSBA 1GK4A 2CPSA 3VYIA 5APXA 2IX7C 2HODB 5AVVB 3H6PA 3M0AA 2OARA 2WPRA 4ZKUA 3HUSC 2P2UA 1N73B 4OH8B 1SFCC 1N86A 3U59A 2WTYA 3OJAB 4WY4B 1FJPA 1IFNA 1IJDB 1FZCB 2W6BA 1NH4A 2YKQA 5AW9B 2E43A 5KJ7A 4IFFA 5AW6B 5APSA 4AQRD 3T97A 3UIAA 1GL2A 4WY4C 1OWAA 3VMXA 3M91A 4C7NA 3MD0A 3M06A 1N7LA 3CI9A 5KTBA 1SFCA 4DOJA 2P67A 5CCHA 3VP8A 1LT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XDJ A;  1JTH B;  2N1T B;  3B5N D;  3P8C E;  1SFC B;  3TSI A;  1L4A D;  1NHL A;  1KIL D;  3PP5 A;  2N1T D;  1URQ B;  1GL2 B;  1URQ D;  4W80 A;  1N7S A;  1L4A B;  2YMY A;  2H8P D;  3HD7 D;  1N7S B;  4JF7 A;  3VOP A;  2NPS D;  1GL2 C;  1KIL B;  5CCG C;  1L4A C;  3RK3 B;  2N1T C;  4W7Y A;  2N1T A;  1KIL A;  4N78 E;  2M8R A;  1GL2 D;  1XTG B;  5KJ7 C;  2PP6 A;  3RK2 C;  2HG5 D;  2NPS C;  5CCG A;  5CCH C;  5CCG D;  3RL0 D;  4LGD E;  3B5N C;  2WZ7 A;  1HVV A;  3KYQ A;  1KIL C;  1L4A A;  5KJ7 D;  1T3J A;  2NPS B;  2HFE D;  1N7S D;  3RK3 C;  3HD7 B;  3HD7 A;  4OH8 B;  1SFC C;  5CCH D;  1JTH A;  4WY4 D;  2NPS A;  4WY4 B;  3RK2 B;  3B5N A;  3RK3 D;  3HD7 C;  3B5N B;  5KJ7 A;  3HTK B;  3RL0 B;  2KOG A;  1GL2 A;  1N7S C;  1URQ A;  3M0D C;  4WY4 C;  4W7Z A;  1SFC A;  1SFC D;  3RK2 D;  1URQ C;  3RL0 C;  5CCH A;  4WY4 A; 
#chains in the Genus database with same CATH topology
 1M1J C;  1ZV8 A;  1BGY E;  2N1T B;  1NTZ D;  2PFX A;  2Q9I A;  1OW6 A;  2ZFC A;  1GU4 A;  2K9Y A;  3BAS A;  3JCU H;  3R2P A;  4HH2 A;  2PRR A;  3CXH H;  4NPE A;  5AW1 B;  4ASW A;  1BCC D;  3EFF K;  1S4X A;  4ASV A;  3MIW A;  3A0B H;  2RN0 A;  2WSE J;  2O3J A;  3H1K D;  3G71 P;  1M90 Q;  2R5D A;  2JO1 A;  4H0L B;  1J2J B;  4RKU J;  1YQ3 C;  1JY3 O;  4B86 A;  1M1J B;  2R3S A;  4UB8 H;  3USS A;  2LXB A;  2P10 A;  4IOI H;  1SQQ J;  3C1L A;  1SQQ D;  1L4A B;  2IZ0 A;  2YMY A;  3A5T A;  1RF1 A;  4D6T D;  2E42 A;  3B8E B;  4AYC A;  1SQP J;  1YJW P;  2BEQ D;  5B66 E;  1GZL A;  1OVV A;  2GA1 A;  2Q7C A;  3BCC E;  4TLF A;  1AV1 A;  2JP3 A;  3L70 D;  2ZAE B;  3PRJ A;  3QWO C;  3VOP A;  1X9V A;  1QL2 A;  2AEM A;  1YHQ P;  2ZYD A;  1NWQ A;  2IBZ E;  2NPS D;  2YNY A;  3H1K J;  1SQB E;  4H0L C;  1SQX J;  1NTM E;  1VQ8 P;  3WU2 E;  1VQK P;  5AVS B;  4YXD C;  5AVQ B;  4GIF A;  2V4H A;  2H88 C;  1PP9 E;  1JOC A;  1LWU C;  4U3F D;  1L4A C;  1OW8 A;  1YYC A;  4GOD A;  4U7J A;  1SQX G;  2IPP A;  2MJZ A;  3IAO A;  3IFM A;  3A3Y B;  5E79 H;  1H8A A;  3HE5 B;  2QSI A;  4W7Y A;  2KUB A;  1CW5 A;  2CK3 H;  1VQ4 P;  1HTL C;  1BE3 D;  1CI6 B;  1QL1 A;  4H44 D;  2Z5H A;  4JPZ B;  2E75 B;  4R4M A;  1GL2 D;  1NTZ K;  3H1L G;  1OX3 A;  3ITK A;  4K3A A;  2P1J A;  2L5G B;  1LWU B;  3AE9 C;  3OAK A;  4GT1 A;  2QA4 P;  2E76 D;  1WMK A;  3L73 D;  5KJ7 C;  4EOT A;  2KSE A;  2FYU E;  1GMJ A;  1L0N E;  3AE7 C;  3U1A A;  3CME P;  5CCG A;  1LTS C;  2J5U A;  2FKW B;  2QM7 A;  3TDK A;  4DT0 A;  3TGU D;  1JMB A;  3FWN A;  1KQS O;  3I56 P;  1USE A;  2E75 C;  2Y9Y A;  2KZJ A;  1FZF A;  2WZ7 A;  1LTB C;  1R5S A;  3AEF C;  1JY2 N;  1FOS E;  5KLI C;  1U57 A;  3F5H A;  2O01 H;  1T3J A;  1K04 A;  2I1J A;  2LR2 A;  2OYH C;  1CZQ A;  2HFE D;  5TIS H;  3L71 J;  2W83 C;  3V5B A;  2WT7 A;  1SQV D;  3RK3 C;  1SQX E;  3NXS A;  3H1K E;  3ABV C;  2XND H;  4BRY A;  1NKN A;  2FYN B;  2HLO A;  1X79 B;  3LID A;  2NZ2 A;  1MFT A;  4TT3 H;  5KLI B;  1YIT P;  2YXQ B;  2LXC B;  2K37 A;  3IR9 A;  2V7Q J;  3L71 E;  3CWB J;  4Y28 J;  2OYH B;  3GHG C;  1JTH A;  3H1I D;  2IYO A;  2JWA A;  2NPS A;  5KAI E;  3CL3 D;  3HTK A;  2Y0C A;  1RF1 C;  4WVZ A;  4JQ0 D;  3H32 B;  4N6J A;  4LC1 A;  2G3A A;  3CXH E;  4YTP C;  3RK3 D;  1DH3 A;  4D6T E;  2FYU G;  3JCU E;  3AE3 C;  2BCC E;  1EZV E;  1LGH B;  2FYN C;  4Y99 B;  4YXW H;  2ZVO B;  3B5N B;  3V2P A;  1W2E A;  1T3U A;  1IFJ A;  2KSJ A;  1QVG O;  4I6M C;  1G1J A;  3TGU E;  3Q3D A;  1K8A Q;  2N9B A;  5APY A;  3TK1 A;  3GHG B;  4U3F G;  5B5E E;  3G3Z A;  3M0D C;  2KLV A;  1SQV K;  2FFD B;  3TNU B;  3IF4 A;  1KQG B;  3MHV A;  1H0T B;  5AVW B;  3CC4 P;  2JKV A;  2JJL A;  3BRV B;  2XV5 A;  1SQB K;  3MUD C;  1NTM K;  1PPJ D;  3AED C;  4Y99 C;  1GW4 A;  1IZN B;  3HE4 A;  3K5B A;  1KB9 H;  1BCC J;  4WBA A;  1OZH A;  3H1I J;  4WB4 A;  2IZ1 A;  2YXR B;  5APQ A;  3M0D A;  5AW4 B;  3WUV A;  1BGY D;  4OVN F;  5CCG D;  1KB9 I;  1KV4 A;  1HWT C;  3CMA P;  1RE3 C;  4PV1 B;  1LP1 B;  3P8C E;  4BXL A;  3C9I A;  3HE4 B;  1AA0 A;  1FC2 C;  1ZR2 A;  1U7J A;  2Q5U A;  3L72 D;  2AXT H;  2OQQ A;  3VMA A;  2Y0D A;  1PP9 J;  3U1C A;  1S1C X;  2FYZ A;  1DX7 A;  1J1D B;  3L73 J;  1H88 A;  1KIL D;  4PD4 D;  1L2P A;  1J1E B;  1S3J A;  2C9L Y;  3PLN A;  1RE3 A;  5CBO A;  5GTH E;  1G2C A;  1QLE D;  1L0N G;  1ZN5 A;  2M5A B;  5KLV E;  1NU1 D;  2W27 A;  3CX5 D;  3GG2 A;  4HKZ H;  3O6Q B;  5AVY B;  3TGU J;  3KZI H;  1SQQ K;  2OTK E;  4OWF A;  2ITA A;  2YMK A;  2HPC B;  1EZV D;  2B87 A;  4I1L A;  1VQM P;  4RO0 A;  1NU1 K;  3HD7 D;  1NVO A;  3L74 G;  3VMZ A;  2JDI H;  2YIU C;  1N7S B;  1LTT C;  3AE4 C;  3P8M C;  1NTZ E;  1HH0 A;  1UII A;  2BAS A;  5KAF E;  1W5C E;  2QM8 A;  5AVX B;  2QIW A;  2R44 A;  2C9N Y;  4PD4 H;  3M9Q A;  2P58 A;  3E7K A;  2OYI B;  2KNC A;  2SPZ A;  1USD A;  3LW5 H;  4ZKP A;  1PGQ A;  1ZXG A;  1GDT A;  4L75 A;  4IFD K;  1AQ5 A;  1FBM A;  1K9M Q;  5AVU B;  3Q5P A;  1VQN P;  1JY3 N;  1QGK B;  2WVR A;  2K9J B;  5APT A;  2KP8 A;  4BRY B;  1GD2 E;  3PH0 A;  1EZV I;  3P8C D;  3HUS A;  1SQX K;  3KPE A;  2GM4 A;  3RGU A;  1Q90 D;  1YIJ P;  3VN0 A;  3Q5R A;  1KQL A;  4UB8 E;  2WSF J;  1RY3 A;  1YBK A;  2OYI C;  1N73 C;  3H1L J;  1RQU A;  4I7Z C;  2V7Q H;  5GTI H;  3JC2 2;  1FZG A;  1EXI A;  3I5C A;  3V2N A;  2FXM A;  3TGU G;  3V4Q A;  1DD3 A;  1Q7Y Q;  1NOH A;  2PP6 A;  1X0T A;  3E1I A;  2Q1K A;  3KQG A;  1BSH A;  1PIX A;  1NTM G;  1LTG C;  3O6Q A;  2BCC G;  5AW7 B;  3RBZ A;  2XU6 A;  2M5A A;  2KNC B;  5AW5 B;  2OYI A;  4QMA A;  5KAF H;  3D71 A;  3RL0 D;  4LGD E;  2I1K A;  1KFM A;  2POH A;  4K35 A;  2MKV A;  4PD4 I;  3AEA C;  4IL6 E;  2AEF A;  1LTJ B;  3SFD C;  2A45 I;  3FXE A;  4RJT A;  2QJY C;  2WSC J;  3P32 A;  4OGQ B;  1PFI A;  4ZNC A;  2PGD A;  1PV3 A;  3N4X A;  1KQF B;  1S5L H;  4EIJ A;  1LWU A;  4RES B;  1K05 A;  1KIL C;  1P84 I;  1SQX D;  1Y47 A;  2B87 B;  2ZJS E;  3AEB C;  5KJ7 D;  1A02 J;  3H1I G;  2Z5I A;  3L74 J;  4KT0 J;  5EFW B;  1P84 H;  4EDF A;  1HUC A;  1RE4 A;  3CX5 I;  2B88 A;  3L70 J;  1G2C B;  3H1J J;  1CI6 A;  3GLM A;  1N7S D;  1L0N K;  1AJY A;  2QRX A;  3HD7 B;  1VF5 C;  2QJY B;  3HE5 A;  3H1H D;  4OGQ C;  1FDO A;  3GMA A;  1IFM A;  4M3L A;  1S2E A;  3HD7 A;  2O1K A;  3TNU A;  5CCH D;  2YO3 A;  4I2L C;  3GHG A;  3CLQ A;  4HB1 A;  3TYY A;  3Q2Y A;  3WUT A;  2PAJ A;  1T6A A;  2WIT A;  1OVU A;  2QVA A;  1JY3 P;  2WPQ A;  3RK2 B;  2QG4 A;  3CC2 P;  2Q3E A;  1MFZ A;  2FYU K;  3AE8 C;  3B5N A;  3CCV P;  3BCC J;  3HD7 C;  4EYY Q;  4IL6 H;  5AW8 B;  1IFP A;  4PJ0 E;  1RHZ B;  1RH5 B;  3L35 A;  1LTJ A;  1EXJ A;  1JEK A;  1Q2N A;  1MZ9 A;  1Z56 A;  3HTK B;  3Q1M A;  1OMI A;  4CPG A;  2K88 A;  1NTZ G;  2GUS A;  2KYV A;  3CX5 H;  2IBZ I;  4IL6 X;  4JYC A;  3CCU P;  1PGP A;  1Y9B A;  1BE3 G;  2N9Y B;  1R8E A;  1JY2 P;  3V2Q A;  1PL5 A;  1SQV G;  1FE6 A;  4A7P A;  2J58 A;  1KMI Z;  1BCC E;  3CCS P;  3AEE C;  1YTZ T;  1SQP D;  5DJU B;  3V6I A;  3RK2 D;  1RQV A;  2KXP B;  2OYO A;  3MTU E;  3D6Z A;  5AVZ B;  1ZR4 A;  2ZT9 D;  2FYU J;  3BCC G;  2XDJ A;  1JTH B;  1KB9 D;  1NTK D;  2E5T A;  1KYO E;  1IK9 A;  2Q6Q A;  3A0H E;  5APW A;  3B5N D;  1MV8 A;  3GW6 A;  3HUS B;  3NFQ A;  3OW2 O;  2W90 A;  2XZR A;  4JYB A;  3ZDM A;  4H13 B;  1KN7 A;  1HGZ A;  1SFC B;  2K9J A;  2QJP B;  3A0B E;  4IFM A;  2WPV B;  4XA4 A;  4L73 A;  3CCR P;  1L4A D;  4GOE A;  2E76 B;  1MKM A;  1NHL A;  1NGM B;  3CC7 P;  1IFD A;  1YJ9 P;  2C0X A;  1P84 E;  2BCC J;  1FZC C;  1FDI A;  1N8R Q;  1BDD A;  1SQB D;  4PV1 D;  2WT7 B;  1VQ6 P;  2M0B A;  1GL2 B;  1OVR A;  3WMM 0;  2B9B A;  2E75 D;  4GOF A;  2KZI A;  3L75 D;  1WT6 A;  3FX0 A;  2YKO A;  3VP9 A;  3CCM P;  2Z4E A;  1KFN A;  1N7S A;  2XNX A;  1FOS F;  3A7O A;  1KZU B;  1M56 D;  1ZOY C;  2QJP C;  5DJT B;  1L0L E;  2BEZ F;  4OGQ D;  2HPC A;  1FU1 A;  2R5B A;  2E76 C;  1RF0 A;  1MUU A;  2W8Z A;  4BWN A;  4JF7 A;  1JUN A;  5M1B A;  1LT1 A;  3QH9 A;  3BAT A;  1BE3 E;  3L37 A;  3H1L D;  2IYP A;  1GL2 C;  2WSS H;  5CCG C;  2AXT E;  2QEX P;  2E74 C;  2KIK A;  1HJB A;  1LNQ A;  2J59 M;  3BRT B;  1GU5 A;  3TF5 A;  5KKZ B;  5H2F H;  4GDO A;  4XFJ A;  1Q86 Q;  3P7K A;  1KC8 Q;  5C39 A;  3RK3 B;  2CPB A;  1LP1 A;  2N1T C;  1KYO D;  5BU8 B;  4AUW A;  3SSU A;  1HJ0 A;  2C0W A;  2L91 A;  2M3B A;  1AQT A;  1QX8 A;  2IBZ D;  2HYN A;  3OA7 A;  3R4Y A;  2M8R A;  4L74 A;  5AW0 B;  2KK7 A;  3PHL A;  1S5L X;  3L70 E;  2O01 N;  2B89 A;  2YO2 A;  3L74 E;  4N3Y B;  4Z1M H;  3V4W A;  2KLU A;  2UWJ E;  1JO5 A;  1E79 H;  5APU A;  2A06 D;  2IFM A;  2W6A A;  1JNM A;  1JM0 A;  5KKZ C;  1L0N J;  4LLH A;  1RF1 B;  1BGY G;  1VPC A;  1HBW A;  1SQB G;  1PP9 D;  2NRG A;  5AW2 B;  1N2D C;  3HRN A;  3L75 E;  3S4R A;  2NPS C;  3CCJ P;  1SQV E;  2FFD A;  1FS0 E;  1PZQ A;  2YKP A;  5CCH C;  1W2B O;  4R4L A;  1TU3 F;  1KYO H;  3AEG C;  3F89 A;  3B5N C;  4DZO A;  3G4S P;  1VF5 D;  3VTP C;  3CXH I;  1U7M A;  3B4S A;  3EQ2 A;  1T2K C;  3H1K G;  3KXD A;  1HVV A;  3MUD A;  1NTK K;  2JWD A;  2FFD C;  3MP7 B;  1WRG A;  1L4A A;  3L4F A;  1NU1 J;  2LKM A;  2M3E A;  3H32 A;  2KS1 A;  2QE7 H;  2K1A A;  3H1H G;  5K5G B;  5AVR B;  2WSC H;  3CPW O;  1SQP G;  2NPS B;  1H89 A;  3WUU A;  3CCL P;  2WSF H;  3AE5 C;  4HYT B;  1SQQ G;  1XTC C;  3CWB E;  1K73 Q;  2H7H A;  1HF9 A;  2G8Y A;  1EDK A;  1ZRT D;  4O9B A;  1BE3 J;  1M1K Q;  3CD6 P;  2HR3 A;  2O1J A;  3MGN A;  5CMZ A;  4DJG A;  3H1J D;  1NAF A;  1RE4 C;  2WWW A;  1NTM D;  1NKZ B;  2GUV A;  2ZXX A;  3L74 D;  4H0L D;  2ZYG A;  4JBZ A;  3SFE C;  3SWF A;  1T8Z A;  4WY4 D;  3JSV C;  1VQ9 P;  3FXD A;  1IFI A;  1KYO I;  3N7N A;  5APV A;  5AVT B;  1J1E C;  1HGV A;  4GKG A;  1EQ7 A;  3S1K A;  1FJK A;  1PGO A;  1ZW0 A;  2Y9Z A;  1RF0 C;  2KB7 P;  1Q82 Q;  4DCK A;  3RL0 B;  1OXZ A;  1SS1 A;  1X8Y A;  1YTZ I;  3PTZ A;  1GK6 A;  2KOG A;  2WQY C;  3S9O A;  1SQV J;  1N7S C;  1URQ A;  3V2R A;  1DEE G;  2E74 D;  3C8V A;  2ZYA A;  1SVF A;  2RH0 A;  3L71 D;  3L75 J;  1S9K D;  3G9R A;  1N73 A;  3L73 E;  4KJM A;  4D6T G;  4U3F J;  5L8R J;  2OTL P;  3L71 G;  2H89 C;  3L72 E;  1JMM A;  4W7Z A;  3H1H E;  1BDC A;  1T2K D;  1ZRT E;  2R32 A;  3NTN A;  1IO4 A;  3L70 G;  2W6J H;  1VQO P;  1H0T A;  1DEB A;  1SFC D;  3CXH D;  2WMM A;  3RK3 E;  1VQ5 P;  1KTM A;  1KB9 E;  1NTK E;  1URQ C;  1VDF A;  3RL0 C;  1GW3 A;  4WY4 A;  1S9K E;  4N78 D;  2A45 G;  1M8O B;  5KLV G;  4UB6 E;  1EZV G;  3SWK A;  3W67 A;  1NTK J;  4UB6 H;  3EWK A;  1DD4 A;  1ZLL A;  2KI7 B;  2FY8 A;  1LTI C;  2QJK B;  1FZE A;  5KLV K;  3LIE A;  3Q5S A;  3L36 A;  3TSI A;  3A2A A;  1PPJ E;  3EFG A;  2RMZ A;  4I7Z B;  4U3F E;  4L76 A;  3PP5 A;  5BVZ A;  2HOD A;  1NTM J;  2N1T D;  1AVO A;  1SQB J;  2IFN A;  1URQ B;  5BU5 A;  2D2C B;  1IC2 A;  1URQ D;  1M57 D;  4W80 A;  1ZME C;  4KHX A;  2WSE H;  1X22 A;  1L0L D;  3GF3 A;  1L0L J;  1OIP A;  2QJK C;  1SQP E;  1E5W A;  1SLQ A;  3KZI E;  3VMY A;  2H8P D;  5CJ0 A;  2R3C A;  1LTJ C;  1NU1 G;  2RKL A;  2FBW C;  3A0H H;  5B66 H;  1FAV A;  1OFC X;  1M1J A;  3SWY A;  5AW3 B;  1JB0 J;  4H44 C;  3AE1 C;  2IDB A;  3M9B A;  3RBX A;  2D2C C;  5KLV D;  1FZB A;  1KIL B;  5CJ4 A;  1KIL E;  4PD4 E;  1EDJ A;  1M7L A;  1NJI Q;  3H1J E;  1OW7 A;  1P84 D;  1YI2 P;  3B71 A;  3KDP B;  1JCD A;  2WPS A;  4PJ0 H;  1SP4 A;  1LTA C;  1FZA A;  3I55 P;  3M9H A;  4PV1 C;  1BGY J;  2N1T A;  1YJN P;  2OYH A;  1Y8A A;  1KIL A;  4N78 E;  2P7J A;  1LT9 B;  3II6 A;  4H44 B;  1JY2 O;  2E5Y A;  1L0L K;  1JCC A;  3GF7 A;  2A06 G;  2JEE A;  2D2C D;  1FDM A;  1L0L G;  5GTH H;  1PPJ G;  1Q81 Q;  1J1D C;  2KS1 B;  2VRS A;  1G1I A;  2A45 H;  2AEJ A;  1R5L A;  1XTG B;  3BVH A;  2AXC A;  5GTI E;  2H43 A;  2XKM A;  2HG5 D;  3RK2 C;  4C7N B;  3W68 A;  1A02 F;  3L73 G;  1IK7 A;  1NO4 A;  3H1I E;  5KAI H;  1NYH A;  1LT9 C;  3T97 B;  5CHX A;  3NMD A;  2ZT9 C;  1QEX A;  4HJG H;  3H1L E;  4NPF X;  2OGU A;  1GTW A;  1VQ7 P;  2YIU B;  5E79 E;  2I8D A;  4NPD A;  4C46 A;  2FYU D;  1NTK G;  1VQP P;  1EDI A;  2BCC D;  3D6Y A;  1KOR A;  3KYQ A;  3O8Z A;  4WWI A;  4XE5 B;  4C7R A;  1S72 P;  2Q3I A;  1AFO A;  1S5L E;  2ZXE B;  4H13 D;  1SQP K;  3L72 G;  1FZC A;  1YQ4 C;  3H25 A;  1VQL P;  3CWB D;  1CSB A;  3E1R A;  1DIP A;  2OTJ P;  3FGA D;  2JR8 A;  1GK4 A;  2CPS A;  2K3R A;  3KHU A;  2FXP A;  5APX A;  1UIX A;  2ZT9 B;  3VYI A;  2IX7 C;  5B5E H;  1BSN A;  2HOD B;  4MN4 C;  4D6T J;  5AVV B;  1QVF O;  3H6P A;  3M0A A;  3CCE P;  1AVY A;  3L75 G;  2OAR A;  1KD1 Q;  3PJS K;  2Y0E A;  1NTZ J;  2WPR A;  4ZKU A;  3FWL A;  3HUS C;  1EDL A;  2P2U A;  1N73 B;  4H13 C;  1PP9 G;  1SFC C;  1N86 A;  2FXO A;  4OH8 B;  3U59 A;  2WTY A;  1VL2 A;  3AE6 C;  3G6E P;  1ZP0 C;  3IN6 A;  3OJA B;  4WY4 B;  3AEC C;  3RL0 g;  1FJP A;  1IFN A;  1IJD B;  1FZC B;  5KLV J;  3CCQ P;  2W6B A;  1PGJ A;  3D70 A;  5H2F E;  3AE2 C;  1BCC G;  1NH4 A;  2YKQ A;  3MZW B;  5AW9 B;  1SQQ E;  3CWB G;  2E43 A;  5KJ7 A;  4IFF A;  5AW6 B;  5APS A;  4AQR D;  5CBN A;  3T97 A;  1NU1 E;  3CX5 E;  3UIA A;  5TIS E;  1GL2 A;  2O01 J;  1L0N D;  4WY4 C;  4YPC A;  1OWA A;  3VMX A;  2DW3 A;  2IBZ G;  3M91 A;  4ZMD A;  4C7N A;  3MD0 A;  3M06 A;  3BCC D;  1N7L A;  3CI9 A;  3H1J G;  5KTB A;  2ZVN B;  1EC5 A;  1SFC A;  2A06 E;  3LW5 J;  2P67 A;  2E74 B;  4DOJ A;  1D7M A;  1LJ2 A;  4EI2 A;  3H1H J;  5TJH A;  3WU2 H;  3L72 J;  1VF5 B;  5CCH A;  3VP8 A;  1LT9 A;  1NAY A; 
#chains in the Genus database with same CATH homology
 1M1J C;  1ZV8 A;  2N1T B;  2Q9I A;  2ZFC A;  1GU4 A;  3BAS A;  4HH2 A;  3R2P A;  5AW1 B;  3MIW A;  2R5D A;  1J2J B;  1JY3 O;  4B86 A;  1M1J B;  3A5T A;  1L4A B;  2YMY A;  1RF1 A;  2E42 A;  1HBW A;  3B8E B;  4AYC A;  1GZL A;  2Q7C A;  3VOP A;  1X9V A;  1QL2 A;  1NWQ A;  2NPS D;  2YNY A;  5AVS B;  5AVQ B;  4GIF A;  1JOC A;  1LWU C;  1L4A C;  1YYC A;  2IPP A;  2MJZ A;  3IFM A;  3A3Y B;  1H8A A;  3HE5 B;  1CW5 A;  4W7Y A;  1HTL C;  1CI6 B;  1QL1 A;  2Z5H A;  1GL2 D;  1NTZ K;  2P1J A;  2L5G B;  1LWU B;  3OAK A;  4GT1 A;  5KJ7 C;  4EOT A;  3U1A A;  5CCG A;  1LTS C;  2FKW B;  2QM7 A;  1FZF A;  2WZ7 A;  1LTB C;  1JY2 N;  1FOS E;  2O01 H;  1T3J A;  2I1J A;  2OYH C;  1CZQ A;  2HFE D;  2WT7 A;  3V5B A;  3RK3 C;  3NXS A;  1NKN A;  2HLO A;  1X79 B;  3LID A;  3IR9 A;  2OYH B;  3GHG C;  1JTH A;  2NPS A;  3CL3 D;  3HTK A;  1RF1 C;  3H32 B;  4N6J A;  4LC1 A;  3RK3 D;  1DH3 A;  1FZG A;  1LGH B;  4Y99 B;  3B5N B;  3V2P A;  1W2E A;  1T3U A;  1IFJ A;  2KSJ A;  4I6M C;  1G1J A;  2N9B A;  5APY A;  3TK1 A;  3GHG B;  3G3Z A;  3M0D C;  2KLV A;  1SQV K;  2FFD B;  3TNU B;  5AVW B;  2JJL A;  3BRV B;  2XV5 A;  1SQB K;  1NTM K;  4Y99 C;  1GW4 A;  3HE4 A;  1H88 A;  4WBA A;  5AW4 B;  4WB4 A;  5APQ A;  3M0D A;  1HWT C;  1RE3 C;  3P8C E;  3C9I A;  3HE4 B;  1ZR2 A;  2Q5U A;  3U1C A;  2FYZ A;  1DX7 A;  1J1D B;  1KIL D;  1J1E B;  2C9L Y;  1RE3 A;  1G2C A;  1ZN5 A;  3BVH A;  2W27 A;  5AVY B;  1SQQ K;  2HPC B;  4I1L A;  1NU1 K;  3HD7 D;  3VMZ A;  1N7S B;  1LTT C;  3P8M C;  2BAS A;  1HH0 A;  2QM8 A;  5AVX B;  2C9N Y;  3M9Q A;  2OYI B;  3LW5 H;  4ZKP A;  1AQ5 A;  1GDT A;  4IFD K;  1FBM A;  5AVU B;  1JY3 N;  5APT A;  2KP8 A;  1GD2 E;  3P8C D;  3HUS A;  1SQX K;  3KPE A;  2GM4 A;  3VN0 A;  1KQL A;  1RY3 A;  2OYI C;  1N73 C;  3I5C A;  3V2N A;  2FXM A;  3V4Q A;  1NOH A;  2PP6 A;  3KQG A;  3E1I A;  1LTG C;  5AW7 B;  2XU6 A;  5AW5 B;  2OYI A;  3RL0 D;  4LGD E;  2I1K A;  1KFM A;  2POH A;  1LTJ B;  2A45 I;  3P32 A;  1PFI A;  3N4X A;  4EIJ A;  1LWU A;  4RES B;  1KIL C;  1A02 J;  5KJ7 D;  2Z5I A;  1HUC A;  1RE4 A;  1G2C B;  1CI6 A;  1N7S D;  1L0N K;  3HE5 A;  3HD7 B;  1IFM A;  4M3L A;  3HD7 A;  2O1K A;  3TNU A;  5CCH D;  2YO3 A;  4I2L C;  3GHG A;  3CLQ A;  3TYY A;  2PAJ A;  2WIT A;  1JY3 P;  2WPQ A;  3RK2 B;  1MFZ A;  2FYU K;  3B5N A;  3HD7 C;  5AW8 B;  3L35 A;  1LTJ A;  1Z56 A;  1MZ9 A;  3HTK B;  2GUS A;  2KYV A;  4JYC A;  1JY2 P;  3V2Q A;  2J58 A;  1YTZ T;  3RK2 D;  3MTU E;  1ZR4 A;  5AVZ B;  2XDJ A;  1JTH B;  2OYH A;  1IK9 A;  5APW A;  1FDM A;  3B5N D;  1MV8 A;  3HUS B;  3NFQ A;  2XZR A;  4JYB A;  1HGZ A;  1SFC B;  4IFM A;  1JO5 A;  4XA4 A;  1L4A D;  1NHL A;  1IFD A;  2C0X A;  1FZC C;  2WT7 B;  1GL2 B;  3WMM 0;  1WT6 A;  3VP9 A;  2YKO A;  2Z4E A;  1FOS F;  1KFN A;  1N7S A;  2XNX A;  3A7O A;  1KZU B;  2HPC A;  1FU1 A;  2R5B A;  1RF0 A;  1MUU A;  4JF7 A;  3BAT A;  3L37 A;  1GL2 C;  5CCG C;  2J59 M;  3BRT B;  1GU5 A;  3P7K A;  3RK3 B;  2CPB A;  2N1T C;  4AUW A;  2M3B A;  2C0W A;  5BU8 B;  2HYN A;  3OA7 A;  5AW0 B;  1S9K D;  1HJB A;  2M8R A;  2YO2 A;  4N3Y B;  3V4W A;  5APU A;  2IFM A;  2W6A A;  1JNM A;  4LLH A;  1RF1 B;  1VPC A;  5AW2 B;  1N2D C;  3HRN A;  2FFD A;  2NPS C;  2YKP A;  5CCH C;  4DZO A;  3B5N C;  3VTP C;  3EQ2 A;  1T2K C;  1HVV A;  3MUD A;  1NTK K;  2FFD C;  1WRG A;  1L4A A;  3L4F A;  1JUN A;  2LKM A;  3H32 A;  5AVR B;  2WSC H;  1H89 A;  2NPS B;  2WSF H;  4HYT B;  1XTC C;  2H7H A;  4O9B A;  2O1J A;  3MGN A;  5CMZ A;  1NAF A;  1RE4 C;  2WWW A;  1NKZ B;  2GUV A;  3SWF A;  1T8Z A;  4WY4 D;  3N7N A;  1IFI A;  5APV A;  5AVT B;  1J1E C;  1HGV A;  4GKG A;  1EQ7 A;  1FJK A;  1RF0 C;  2KB7 P;  3RL0 B;  1OXZ A;  1X8Y A;  1YTZ I;  1GK6 A;  2KOG A;  1A02 F;  1N7S C;  1URQ A;  3V2R A;  1SVF A;  1N73 A;  1JMM A;  4W7Z A;  1T2K D;  2R32 A;  3NTN A;  1IO4 A;  1DEB A;  1SFC D;  1URQ C;  1VDF A;  3RL0 C;  1GW3 A;  4WY4 A;  1S9K E;  4N78 D;  2A45 G;  1ZLL A;  5KLV K;  1LTI C;  1FZE A;  3LIE A;  3L36 A;  3TSI A;  3A2A A;  3EFG A;  3PP5 A;  5BVZ A;  2HOD A;  2N1T D;  2IFN A;  1URQ B;  5BU5 A;  1IC2 A;  1URQ D;  4W80 A;  4KHX A;  2WSE H;  1E5W A;  1SLQ A;  3VMY A;  2H8P D;  5CJ0 A;  2R3C A;  1LTJ C;  1FAV A;  1M1J A;  3SWY A;  5AW3 B;  3M9B A;  1FZB A;  1KIL B;  5CJ4 A;  1M7L A;  3KDP B;  1JCD A;  2WPS A;  1SP4 A;  1LTA C;  1FZA A;  3M9H A;  2N1T A;  1KIL A;  4N78 E;  2P7J A;  1LT9 B;  3II6 A;  1JY2 O;  1JCC A;  1L0L K;  2JEE A;  1J1D C;  2VRS A;  1G1I A;  2A45 H;  1XTG B;  2H43 A;  2XKM A;  2HG5 D;  3RK2 C;  4C7N B;  1NO4 A;  1LT9 C;  5CCG D;  5CHX A;  3NMD A;  1GTW A;  4C46 A;  3KYQ A;  3O8Z A;  4XE5 B;  4C7R A;  1AFO A;  2Q3I A;  2ZXE B;  1SQP K;  1FZC A;  1CSB A;  1GK4 A;  2CPS A;  3VYI A;  5APX A;  2IX7 C;  2HOD B;  5AVV B;  3H6P A;  3M0A A;  2OAR A;  2WPR A;  4ZKU A;  3HUS C;  2P2U A;  1N73 B;  4OH8 B;  1SFC C;  1N86 A;  3U59 A;  2WTY A;  3OJA B;  4WY4 B;  1FJP A;  1IFN A;  1IJD B;  1FZC B;  2W6B A;  1NH4 A;  2YKQ A;  5AW9 B;  2E43 A;  5KJ7 A;  4IFF A;  5AW6 B;  5APS A;  4AQR D;  3T97 A;  3UIA A;  1GL2 A;  4WY4 C;  1OWA A;  3VMX A;  3M91 A;  4C7N A;  3MD0 A;  3M06 A;  1N7L A;  3CI9 A;  5KTB A;  1SFC A;  4DOJ A;  2P67 A;  5CCH A;  3VP8 A;  1LT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...