4N6JA

Crystal structure of human striatin-3 coiled coil domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
49
structure length
49
Chain Sequence
STMDWEVERAELQARIAMLQGERKGQENLKKDLVRRIKMLEMALKQERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Striatins Contain a Noncanonical Coiled Coil That Binds PP2A A to Form a 2:2 Heterotetrameric Core of Striatin-interacting Phosphatase and Kinase (STRIPAK) Complex
doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Striatin-3
total genus 17
structure length 49
sequence length 49
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.300 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4n6jA00
1ZV8A 4EIJA 2FYZA 4N6JA 1SVFA 3KPEA 1G2CA 3EFGA 3SWYA
chains in the Genus database with same CATH superfamily
1OVRA 1JMBA 3HE5A 3MD0A 4U3FD 4PJ0E 2IYOA 1LWUB 2ZXEB 1FE6A 1SQQG 2IPPA 4JF7A 4TLFA 1EXIA 3MTUE 1R5LA 3L71J 1N7SC 4IOIH 3IR9A 1LGHB 2CK3H 1FDIA 3O6QA 1HBWA 4PJ0H 3H1LJ 1NH4A 2WSSH 3NMDA 3U1AA 3Q5PA 1NTKD 3BRTB 3P8MC 5BU5A 1YITP 2K9JA 4I2LC 1KB9D 1AVOA 2UWJE 3P7KA 4WY4B 1CI6B 1NKNA 2IYPA 2KZJA 1L4AD 3AE7C 3AEAC 3B71A 1Y47A 2LXCB 3BCCE 3C1LA 5AVZB 4U7JA 1FZCA 2WSFJ 1M1JC 4A7PA 1HVVA 1GK4A 2FFDC 1MKMA 4R4MA 3C9IA 1J2JB 1RY3A 2QJKC 4H0LD 3VP9A 1S9KD 3TGUD 3OA7A 1SQPD 3S9OA 2QJKB 4H13D 1L0LE 2AEMA 2M3EA 1SQVJ 5AVYB 3L73G 2M8RA 4OWFA 1SFCB 1N73B 2FXPA 1EDIA 1YBKA 2KZIA 1QX8A 2HR3A 3A0HE 3PH0A 4W80A 1BDCA 2Q7CA 4EOTA 1R5SA 4D6TG 4Z1MH 4DOJA 5KAFH 1Q86Q 2HODB 1USEA 1HH0A 3B8EB 3H1HJ 1OIPA 2FYUD 2G3AA 2KYVA 1KC8Q 2A45I 2AXTE 2FKWB 5CCHD 1NKZB 1ZRTE 2MJZA 3FXDA 4I7ZB 4ZNCA 1JUNA 1N7SB 1OXZA 2RKLA 2OYIA 2IFMA 3L37A 3G3ZA 5DJTB 3L36A 1GD2E 1JM0A 1G1IA 2FYNB 2P67A 4WWIA 1SQQE 1URQB 2MKVA 1PZQA 2KB7P 5AVRB 2WPQA 5EFWB 1SFCC 1NO4A 1EDLA 5L8RJ 1JB0J 3SSUA 3TNUB 3AE4C 3V4WA 2IX7C 4JYBA 3HD7C 4I7ZC 3A7OA 3FXEA 2QRXA 1QL2A 3USSA 1ZW0A 2JO1A 3WUTA 1VQ8P 1S5LE 5CCHC 1JCDA 3HUSA 1WMKA 3L75E 5TJHA 2BCCG 3RBZA 1Q2NA 1RF0C 2K37A 3OAKA 2H8PD 2H89C 3CC2P 1W5CE 1BSHA 1LTBC 1M1JA 1P84H 2AEFA 2D2CD 2PRRA 2QJPC 2FFDA 1SQQJ 1X9VA 4IFDK 2M3BA 2BEZF 2O01H 2WWWA 3L71G 3L71D 2Q9IA 1PP9G 1BCCD 2BCCE 3AE6C 5KLIB 3GHGC 4IL6X 3RBXA 1M90Q 2WVRA 2FFDB 4UB8H 1SQPK 3KYQA 1NTKE 2WPRA 1NJIQ 1GMJA 3TGUG 3C8VA 1IK9A 1P84D 2ZVOB 3HTKB 1RE4C 5CBOA 3CCLP 1HTLC 3CX5H 3WMM0 4WVZA 4C7RA 3AE1C 3QH9A 1VQKP 3A0HH 1HF9A 1T8ZA 1WT6A 5AVVB 2XNXA 2Y0CA 3IF4A 3I5CA 4H0LC 3S4RA 3V5BA 1Q7YQ 2ITAA 1NTMJ 2WPSA 2Y9YA 2QJYB 4XFJA 1JY2P 2AXTH 2QVAA 4L73A 1HJBA 1BGYE 2KS1B 1G1JA 2A45G 1UIXA 2JP3A 4PD4I 3U1CA 1S1CX 5AVTB 5CHXA 1D7MA 2N9BA 2NRGA 3V2NA 5KLVG 1DD4A 1ZV8A 3H1ID 1M7LA 2QEXP 1NOHA 1KYOH 3PHLA 4N78E 2GA1A 1SP4A 3CI9A 1K8AQ 1FDOA 5KLIC 1SQXG 2YMYA 1T6AA 5CCGA 2E76D 3VP8A 3KHUA 2D2CC 1YIJP 1YJWP 3VYIA 3HUSC 4Y99C 1MV8A 2W83C 1U7MA 2IZ1A 2HODA 3CCUP 2FYUK 3VMXA 3TYYA 1JO5A 3SWYA 3SFEC 2JDIH 1VF5D 5AVXB 3CL3D 3KXDA 5GTIE 2I1KA 4PV1B 3CPWO 3LW5H 1KYOI 5B5EH 1PGQA 1RQUA 1T3UA 3M0DA 1K04A 2M5AB 4OH8B 1VL2A 5AVWB 1PGPA 2GUVA 1BE3E 2W27A 1PFIA 1S2EA 4PD4H 1CZQA 3L72E 1ZMEC 1SQBD 3KZIE 3H1JG 1IFIA 1SQXK 4EI2A 1LT9A 1AQTA 1JEKA 2B87A 2NPSA 1RF1A 2O01N 5AW8B 3W68A 2WSEH 1Q81Q 2KS1A 1FZEA 4JYCA 2XZRA 1N8RQ 1OMIA 2A06G 4N3YB 2CPSA 2C9LY 3UIAA 1S5LX 1IFDA 2OYOA 1PIXA 1DIPA 4WBAA 4C46A 3O6QB 3RL0B 3CCJP 3VTPC 1RQVA 4OGQD 5KTBA 5AVSB 3CCVP 2G8YA 1W2BO 1BCCJ 1YTZI 4DT0A 1KILD 1KILE 2FY8A 2JWDA 3AE9C 2I8DA 3AEDC 3BCCJ 2KUBA 3EWKA 4D6TE 3L72G 2QA4P 1KN7A 1DD3A 1OWAA 2OARA 3L73E 3V2QA 4ZMDA 3B5NA 1M56D 5CCGD 1FZCB 1PPJD 1N7LA 3TGUJ 1T2KD 3Q3DA 1T2KC 1URQD 3L74D 1VQ9P 1QEXA 2FXMA 1SQPG 1GZLA 1YTZT 2K9JB 2WZ7A 2XKMA 3PTZA 2ZVNB 2J5UA 5APTA 1YYCA 4H13B 5CCGC 2WTYA 1L0LD 1VQLP 5AW9B 3WU2H 4KT0J 1FAVA 4AQRD 1NTZD 1ZRTD 4MN4C 2N1TC 2L91A 4JPZB 5KKZB 2POHA 2R5DA 3JC22 3L75D 1NTMD 1Y9BA 2P1JA 2PFXA 2W6JH 4PV1D 4C7NB 1NGMB 1GDTA 1J1DC 1VQPP 5KJ7C 1FZGA 1YQ3C 3GG2A 1NU1E 2FYUJ 3CCRP 1FZCC 3M9BA 2E74C 2XDJA 5AW0B 2IZ0A 4L75A 2RN0A 1LTAC 1MFTA 1SQVK 1QLED 1LTJB 1ZXGA 3P32A 2KXPB 2YNYA 1SQXJ 1NTZE 2HG5D 2Q3EA 4IL6H 5C39A 1K9MQ 3D70A 1SQVG 1MFZA 1LT9C 1JTHB 2A06E 2CPBA 2NPSC 3L70E 1NU1K 1SVFA 3GMAA 3R4YA 2OQQA 4I1LA 1W2EA 4HB1A 5KAFE 1DX7A 1JY3P 2H88C 2WITA 2PAJA 3BCCD 3K5BA 4D6TJ 3L73D 2FYNC 1QL1A 1X0TA 2Q6QA 3AEFC 2OYIB 1AFOA 1NU1G 2KK7A 1M8OB 1QGKB 1J1EB 1UIIA 3FWNA 3KPEA 3OW2O 1S3JA 1NVOA 2BEQD 3A0BE 4HYTB 4EYYQ 2ZT9B 4NPEA 4NPDA 4UB6H 1NTME 1PP9E 3MIWA 4AUWA 1LTJC 1KV4A 3A3YB 4RKUJ 3VN0A 1MZ9A 4R4LA 3NFQA 1IO4A 3CX5E 2QM7A 2N9YB 2R3CA 5AW4B 3TSIA 2KSEA 3B5NC 3BRVB 1OVUA 1SQQD 2K9YA 2QM8A 2ZAEB 3AEBC 5DJUB 3M0AA 1SFCA 4WY4C 2W6AA 2IBZD 3ITKA 5AW5B 1SS1A 3L74E 4QMAA 5H2FE 4EDFA 1LT1A 1OW8A 1U7JA 1ZN5A 3RL0D 2E75B 1FJPA 3E7KA 3HD7A 1GL2D 4ASVA 3G4SP 3H1JD 1H8AA 3RK2C 2HPCB 2ZT9C 3E1IA 2DW3A 2N1TA 5KLVD 5KLVE 1SLQA 2K88A 2E76B 5AW6B 1LTSC 2BCCJ 2R32A 2WSFH 1IZNB 1SQBG 3IFMA 1BGYG 1NU1D 3GF3A 2V4HA 3HTKA 2YKOA 1SQBK 1N2DC 2LKMA 5M1BA 1VQMP 3CMAP 1NTZG 5B66H 3E1RA 1NWQA 1IFJA 2A45H 3AE3C 1SQPJ 3H1KD 3IAOA 4LC1A 2LXBA 3S1KA 1ZLLA 3M9HA 1IK7A 2FBWC 2I1JA 2QE7H 3PLNA 4IFMA 1SQVD 2Z5HA 1EDJA 2O3JA 5B66E 1YJNP 3CC7P 1GL2B 3ABVC 2ZT9D 2JWAA 3VMYA 2R5BA 4Y28J 3GW6A 3L75J 3Q2YA 1SQQK 2IFNA 2ZXXA 1Y8AA 2J58A 3LW5J 1EDKA 3PJSK 4DCKA 4BRYA 2FYUG 3RK3D 1EZVI 5TISH 3CMEP 3H1HD 2PP6A 2E74D 4BWNA 1J1DB 3B5NB 4K3AA 1T3JA 5APYA 1OZHA 4Y99B 1BDDA 5APVA 3FWLA 1S5LH 3RK2B 1U57A 3MZWB 3FGAD 1IC2A 3I56P 1N86A 1LTJA 2A06D 3CXHI 1L0LG 3QWOC 1S9KE 2K3RA 1OVVA 2H43A 1HUCA 1ZP0C 3BASA 3H1LD 3HD7D 5GTHH 1NTKJ 1AQ5A 3EFFK 2XU6A 2E75D 1JCCA 2E5TA 5AW3B 3H1HE 3MP7B 4D6TD 5KLVJ 1NTKK 1SFCD 2B88A 1H89A 2IDBA 2JEEA 1P84I 2Y0DA 1ZR4A 1NHLA 1LTGC 5GTHE 1JTHA 1NU1J 2FYUE 2L5GB 2SPZA 3H6PA 3L72D 1LTIC 1JNMA 2Z4EA 2B87B 2E42A 4L76A 1Z56A 2P2UA 1KILC 1J1EC 1FJKA 5H2FH 2B89A 2NPSD 1L0NK 3L35A 1AJYA 1L4AC 3M06A 2J59M 1FBMA 1VF5B 1G2CA 1PV3A 2YIUB 1JY3O 5AVQB 1KORA 1K73Q 1OW6A 3W67A 3D6YA 2O1JA 1K05A 2JKVA 3BATA 3MGNA 4XE5B 5KLVK 3L70G 4M3LA 1LP1A 3M0DC 1M57D 4OVNF 3TK1A 1EZVG 1PPJE 5E79H 2NZ2A 4B86A 4ZKPA 3HRNA 1IFNA 3WUVA 2RH0A 1KILB 1CW5A 2W90A 1KYOD 2YKQA 3G71P 3H1JJ 2E5YA 4O9BA 1IFMA 3Q5SA 3U59A 1JY3N 1AA0A 1E5WA 1KB9E 4EIJA 3H25A 3B5ND 3CCQP 3HE4B 2OYHA 2IBZE 5APXA 3H1LE 4W7YA 5E79E 1FZAA 3AE8C 4H44C 4L74A 3V6IA 3G6EP 2N1TB 5KKZC 1NTZJ 1GW4A 3LIDA 4GODA 5B5EE 2ZYAA 4NPFX 1NTMK 2D2CB 3SWFA 2QG4A 1GL2A 3H1KJ 3HD7B 3FX0A 4GKGA 1BCCG 2HFED 1L2PA 3P8CE 3TF5A 3Q5RA 1QVFO 3H1LG 2K1AA 3L72J 3MHVA 2KI7B 2QSIA 1VQ4P 2AXCA 3RK3B 3CWBJ 2R3SA 4KHXA 1E79H 1VQ7P 4GDOA 2WPVB 3I55P 1KTMA 1URQA 1XTGB 1SQXD 1FDMA 2YKPA 3RK2D 1FU1A 1IFPA 1L0ND 2C0WA 1L0NG 2KLVA 2E76C 2ZYGA 3F5HA 3H1KE 3M9QA 4GIFA 4IFFA 5CMZA 3RL0C 4U3FJ 1KILA 2ZFCA 1VPCA 2N1TD 5TISE 1HGVA 3TGUE 1L4AA 2V7QJ 4RO0A 1S72P 1LWUC 1A02F 4HH2A 5CBNA 5KJ7A 3L73J 3SFDC 1VQNP 2KNCB 4WB4A 1L0NE 1KQGB 2OTJP 4PV1C 1GW3A 3D6ZA 1JY2N 3AEEC 1VQ5P 2ZYDA 3SWKA 1L0LK 1L4AB 3H1IE 4YTPC 3KQGA 4N6JA 2YMKA 1KFMA 3T97B 2Q1KA 2W6BA 3L71E 4GOFA 3HUSB 1AVYA 1MUUA 2R44A 1ZOYC 2YO3A 3P8CD 2XV5A 4H44D 1KQFB 1ZR2A 1KMIZ 2YO2A 1PL5A 1YJ9P 3PP5A 2OTLP 3T97A 3TDKA 1GTWA 2OYIC 2OYHC 2RMZA 2Y9ZA 3CX5D 1S4XA 5APQA 1YI2P 2WSCJ 4HKZH 3A0BH 1N73C 1OFCX 1BE3J 1G2CB 2IBZG 3CWBD 4OGQC 1QVGO 3JSVC 2HPCA 2P7JA 4LGDE 1GL2C 2IBZI 2P58A 1HGZA 3AE5C 3H1IG 1FZFA 1KYOE 3A2AA 1KZUB 3MUDA 2VRSA 4TT3H 1KB9I 1NTZK 4WY4D 2GUSA 1FS0E 1KFNA 4W7ZA 2C0XA 2Q5UA 2M5AA 3L70D 4I6MC 3OJAB 2KP8A 5CCHA 2Z5IA 2JJLA 4LLHA 4WY4A 1YHQP 1GK6A 1JOCA 3NTNA 2WSCH 1Q82Q 1A02J 4BXLA 1URQC 3L74J 1RF0A 3M91A 3AE2C 1EQ7A 4RESB 1VF5C 2YIUC 3RL0g 5K5GB 4AYCA 1EC5A 2FYZA 2V7QH 5AVUB 1FOSF 1KB9H 3A5TA 3CX5I 3V2PA 2KIKA 3AEGC 4C7NA 3D71A 1VQ6P 1X79B 3H1KG 1PP9J 1LWUA 2AEJA 2O1KA 4XA4A 5BVZA 4UB6E 2HYNA 1X8YA 3GHGA 4OGQB 4PD4E 2E75C 1SQBJ 2YXRB 1BGYJ 4GT1A 4H44B 3EFGA 4PD4D 3BVHA 2QJPB 2C9NY 3ZDMA 2E74B 2HLOA 3CWBG 3EQ2A 3G9RA 4JBZA 3RK3C 1VDFA 2OYHB 3L4FA 5GTIH 3HE4A 3GHGB 1RE4A 1L0NJ 1PGOA 3LIEA 1SQPE 5APSA 4ASWA 5CJ4A 1X22A 2LR2A 1JY2O 1YQ4C 4U3FG 1H88A 1TU3F 2BASA 3CXHD 3PRJA 1EXJA 1EZVD 1NTMG 4YXWH 2OGUA 1PGJA 3L75G 1H0TA 2XNDH 1VQOP 3N7NA 4HJGH 5KJ7D 1XTCC 3V4QA 3CD6P 3VOPA 3V2RA 3VMZA 1KQLA 3AECC 3RK3E 4YXDC 1LP1B 1RE3C 4N78D 3JCUH 3F89A 1N73A 1R8EA 3II6A 3CWBE 2GM4A 3H32A 2FXOA 3KDPB 1EZVE 1PPJG 3VMAA 1N7SA 1LT9B 2NPSB 1NYHA 2Y0EA 4H0LB 1LNQA 3MUDC 1SQVE 2W8ZA 2WT7B 1IJDB 1L0LJ 4K35A 1AV1A 1BSNA 1GU5A 2O01J 2P10A 2B9BA 5KAIE 3CCMP 3WU2E 2WMMA 1NTKG 1M1KQ 1JMMA 5CJ0A 5AW1B 1SQBE 3Q1MA 5APWA 1PP9D 3RGUA 5AW7B 2KNCA 2H7HA 5KAIH 1OX3A 1HJ0A 2YXQB 2QJYC 3H1HG 1RHZB 1P84E 1BE3G 5AW2B 1BE3D 1NAFA 1DEBA 2JR8A 4RJTA 1RH5B 1KD1Q 2KSJA 2WQYC 3H1IJ 3H32B 3N4XA 3O8ZA 4UB8E 3CC4P 3CCEP 1NAYA 1BCCE 1LTTC 2BCCD 3GLMA 3H1JE 1USDA 3IN6A 1DEEG 3NXSA 4H13C 3TNUA 1GU4A 1DH3A 2E43A 1FZBA 3CXHE 3HE5B 4JQ0D 4GOEA 1H0TB 1LJ2A 3KZIH 2KLUA 3L70J 3B4SA 1RF1C 2WSEJ 4DJGA 3WUUA 1CI6A 2KOGA 4DZOA 3L74G 4BRYB 1RF1B 1OW7A 4U3FE 1SQXE 3GF7A 5APUA 1KQSO 4YPCA 1WRGA 1FOSE 1Q90D 3CLQA 2PGDA 3CCSP 4ZKUA 4CPGA 1FC2C 3R2PA 1HWTC 2WT7A 2OTKE 3CXHH 1CSBA 3JCUE 1M1JB 2ZJSE 3BCCG 2M0BA 2QIWA 5BU8B 4KJMA 1N7SD 2Q3IA 1BGYD 4IL6E 1RE3A
chains in the Genus database with same CATH topology
3HE5A 3MD0A 2ZXEB 1LWUB 4JF7A 2IPPA 3MTUE 1N7SC 3IR9A 1LGHB 1HBWA 1NH4A 3NMDA 3U1AA 3BRTB 3P8MC 5BU5A 4I2LC 3P7KA 4WY4B 1CI6B 1NKNA 1L4AD 5AVZB 1FZCA 1M1JC 1HVVA 1GK4A 2FFDC 3C9IA 1J2JB 1RY3A 3VP9A 1S9KD 3OA7A 5AVYB 2M8RA 1N73B 1SFCB 4W80A 2Q7CA 4EOTA 4DOJA 2HODB 1HH0A 3B8EB 2KYVA 2A45I 2FKWB 5CCHD 1NKZB 2MJZA 1JUNA 1N7SB 1OXZA 2OYIA 2IFMA 3L37A 3G3ZA 3L36A 1GD2E 1G1IA 2P67A 1URQB 2KB7P 5AVRB 2WPQA 1SFCC 1NO4A 3TNUB 3V4WA 2IX7C 4JYBA 3HD7C 3A7OA 1QL2A 5CCHC 1JCDA 3HUSA 1RF0C 3OAKA 2H8PD 1LTBC 1M1JA 2FFDA 1X9VA 4IFDK 2M3BA 2O01H 2WWWA 2Q9IA 3GHGC 2FFDB 1SQPK 3KYQA 2WPRA 1IK9A 3HTKB 1RE4C 1HTLC 3WMM0 4C7RA 1T8ZA 1WT6A 5AVVB 2XNXA 3I5CA 3V5BA 2WPSA 1JY2P 1HJBA 1G1JA 2A45G 3U1CA 5AVTB 5CHXA 2N9BA 3V2NA 1ZV8A 1M7LA 1NOHA 4N78E 1SP4A 3CI9A 2YMYA 5CCGA 3VP8A 3VYIA 3HUSC 4Y99C 1MV8A 2HODA 2FYUK 3VMXA 1JO5A 3SWYA 5AVXB 3CL3D 2I1KA 3LW5H 1T3UA 3M0DA 4OH8B 5AVWB 2GUVA 2W27A 1CZQA 1IFIA 1SQXK 1LT9A 2NPSA 1RF1A 5AW8B 2WSEH 1FZEA 4JYCA 2XZRA 4N3YB 2CPSA 2C9LY 3UIAA 1IFDA 4WBAA 4C46A 3RL0B 3VTPC 5KTBA 5AVSB 1YTZI 1KILD 3V2QA 1OWAA 2OARA 5CCGD 1FZCB 3B5NA 1N7LA 1T2KD 1T2KC 1URQD 2FXMA 1YTZT 1GZLA 2WZ7A 2XKMA 5CCGC 5APTA 1YYCA 2WTYA 5AW9B 1FAVA 4AQRD 2N1TC 2POHA 2R5DA 4C7NB 2P1JA 1GDTA 1J1DC 5KJ7C 1FZGA 1FZCC 3M9BA 2XDJA 5AW0B 1LTAC 1SQVK 3P32A 1LTJB 2YNYA 2HG5D 1MFZA 1LT9C 1JTHB 2CPBA 2NPSC 1NU1K 1SVFA 4I1LA 1W2EA 1DX7A 1JY3P 2WITA 2PAJA 1QL1A 2OYIB 1AFOA 1J1EB 3KPEA 4HYTB 3MIWA 4AUWA 1LTJC 3A3YB 1IO4A 1MZ9A 3NFQA 2QM7A 2R3CA 5AW4B 3VN0A 3TSIA 3B5NC 3BRVB 2QM8A 3M0AA 1SFCA 4WY4C 2W6AA 5AW5B 1S9KE 1ZN5A 3RL0D 3HD7A 1GL2D 1H8AA 2HPCB 3RK2C 3E1IA 2N1TA 1SLQA 5AW6B 1LTSC 2WSFH 2R32A 3IFMA 3HTKA 2YKOA 1SQBK 1N2DC 2LKMA 1NWQA 1IFJA 2A45H 4LC1A 1PFIA 1ZLLA 3M9HA 2I1JA 4IFMA 2Z5HA 1GL2B 3VMYA 2R5BA 1SQQK 2IFNA 2J58A 3RK3D 2PP6A 1J1DB 3B5NB 1T3JA 5APYA 4Y99B 5APVA 3RK2B 1IC2A 1N86A 1LTJA 2H43A 1HUCA 3BASA 3HD7D 2XU6A 1JCCA 1H89A 5AW3B 1NTKK 1SFCD 2JEEA 1ZR4A 1NHLA 1LTGC 1JTHA 3H6PA 2L5GB 1JNMA 2Z4EA 2E42A 1LTIC 1Z56A 2P2UA 1KILC 1J1EC 1FJKA 2NPSD 1L0NK 3L35A 1L4AC 3M06A 2J59M 1FBMA 1G2CA 5AVQB 1JY3O 2O1JA 3BATA 4XE5B 3MGNA 5KLVK 4M3LA 3M0DC 3TK1A 4B86A 4ZKPA 3HRNA 1IFNA 1KILB 1CW5A 2YKQA 4O9BA 1IFMA 3U59A 1JY3N 4EIJA 1E5WA 3B5ND 3HE4B 2OYHA 5APXA 4W7YA 1FZAA 2N1TB 1GW4A 3LIDA 1NTMK 3SWFA 3HD7B 1GL2A 4GKGA 2HFED 3P8CE 3RK3B 4KHXA 1URQA 1XTGB 1FDMA 2YKPA 3RK2D 1FU1A 2C0WA 3TYYA 2KLVA 4IFFA 3M9QA 4GIFA 5CMZA 3RL0C 1KILA 2ZFCA 1VPCA 2N1TD 1HGVA 1L4AA 1LWUC 1A02F 4HH2A 5KJ7A 4WB4A 1GW3A 1JY2N 1L0LK 1L4AB 3KQGA 4N6JA 1KFMA 2W6BA 3HUSB 3P8CD 1MUUA 2YO3A 2XV5A 1ZR2A 2YO2A 3PP5A 3T97A 2OYIC 1GTWA 2OYHC 5APQA 1N73C 1G2CB 2HPCA 2P7JA 4LGDE 1GL2C 1HGZA 1FZFA 3A2AA 1KZUB 3MUDA 2VRSA 1NTZK 4WY4D 2GUSA 1KFNA 4W7ZA 2C0XA 2Q5UA 4I6MC 3OJAB 2KP8A 5CCHA 2Z5IA 2JJLA 4LLHA 4WY4A 1GK6A 1JOCA 3NTNA 2WSCH 1A02J 1URQC 1RF0A 3M91A 1EQ7A 4RESB 4AYCA 5AVUB 2FYZA 1FOSF 3A5TA 3V2PA 4C7NA 1X79B 1LWUA 2O1KA 4XA4A 5BVZA 2HYNA 1X8YA 3GHGA 3BVHA 4GT1A 2C9NY 3EFGA 2HLOA 3EQ2A 3RK3C 1VDFA 2OYHB 3L4FA 3HE4A 3GHGB 1RE4A 5APSA 5CJ4A 3LIEA 1JY2O 1H88A 2BASA 3N7NA 5KJ7D 3V4QA 1XTCC 3VOPA 3V2RA 3VMZA 1KQLA 1RE3C 4N78D 1N73A 3II6A 2GM4A 3H32A 3KDPB 1N7SA 1LT9B 2NPSB 2WT7B 1IJDB 1GU5A 1JMMA 5CJ0A 5AW1B 5APWA 5AW7B 2H7HA 5AW2B 1NAFA 1DEBA 1FJPA 1AQ5A 2KSJA 3H32B 3N4XA 3O8ZA 1LTTC 2E43A 3NXSA 3TNUA 1GU4A 1DH3A 1FZBA 3HE5B 1RF1C 1CI6A 2KOGA 4DZOA 1RF1B 5APUA 1WRGA 1FOSE 3CLQA 4ZKUA 3R2PA 1HWTC 2WT7A 1CSBA 1M1JB 5BU8B 1N7SD 2Q3IA 1RE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZV8 A;  4EIJ A;  2FYZ A;  4N6J A;  1SVF A;  3KPE A;  1G2C A;  3EFG A;  3SWY A; 
#chains in the Genus database with same CATH topology
 1OVR A;  1JMB A;  3HE5 A;  3MD0 A;  4U3F D;  4PJ0 E;  2IYO A;  1LWU B;  2ZXE B;  1FE6 A;  1SQQ G;  2IPP A;  4JF7 A;  4TLF A;  1EXI A;  3MTU E;  1R5L A;  3L71 J;  1N7S C;  4IOI H;  3IR9 A;  1LGH B;  2CK3 H;  1FDI A;  3O6Q A;  1HBW A;  4PJ0 H;  3H1L J;  1NH4 A;  2WSS H;  3NMD A;  3U1A A;  3Q5P A;  1NTK D;  3BRT B;  3P8M C;  5BU5 A;  1YIT P;  2K9J A;  4I2L C;  1KB9 D;  1AVO A;  2UWJ E;  3P7K A;  4WY4 B;  1CI6 B;  1NKN A;  2IYP A;  2KZJ A;  1L4A D;  3AE7 C;  3AEA C;  3B71 A;  1Y47 A;  2LXC B;  3BCC E;  3C1L A;  5AVZ B;  4U7J A;  1FZC A;  2WSF J;  1M1J C;  4A7P A;  1HVV A;  1GK4 A;  2FFD C;  1MKM A;  4R4M A;  3C9I A;  1J2J B;  1RY3 A;  2QJK C;  4H0L D;  3VP9 A;  1S9K D;  3TGU D;  3OA7 A;  1SQP D;  3S9O A;  2QJK B;  4H13 D;  1L0L E;  2AEM A;  2M3E A;  1SQV J;  5AVY B;  3L73 G;  2M8R A;  4OWF A;  1SFC B;  1N73 B;  2FXP A;  1EDI A;  1YBK A;  2KZI A;  1QX8 A;  2HR3 A;  3A0H E;  3PH0 A;  4W80 A;  1BDC A;  2Q7C A;  4EOT A;  1R5S A;  4D6T G;  4Z1M H;  4DOJ A;  5KAF H;  1Q86 Q;  2HOD B;  1USE A;  1HH0 A;  3B8E B;  3H1H J;  1OIP A;  2FYU D;  2G3A A;  2KYV A;  1KC8 Q;  2A45 I;  2AXT E;  2FKW B;  5CCH D;  1NKZ B;  1ZRT E;  2MJZ A;  3FXD A;  4I7Z B;  4ZNC A;  1JUN A;  1N7S B;  1OXZ A;  2RKL A;  2OYI A;  2IFM A;  3L37 A;  3G3Z A;  5DJT B;  3L36 A;  1GD2 E;  1JM0 A;  1G1I A;  2FYN B;  2P67 A;  4WWI A;  1SQQ E;  1URQ B;  2MKV A;  1PZQ A;  2KB7 P;  5AVR B;  2WPQ A;  5EFW B;  1SFC C;  1NO4 A;  1EDL A;  5L8R J;  1JB0 J;  3SSU A;  3TNU B;  3AE4 C;  3V4W A;  2IX7 C;  4JYB A;  3HD7 C;  4I7Z C;  3A7O A;  3FXE A;  2QRX A;  1QL2 A;  3USS A;  1ZW0 A;  2JO1 A;  3WUT A;  1VQ8 P;  1S5L E;  5CCH C;  1JCD A;  3HUS A;  1WMK A;  3L75 E;  5TJH A;  2BCC G;  3RBZ A;  1Q2N A;  1RF0 C;  2K37 A;  3OAK A;  2H8P D;  2H89 C;  3CC2 P;  1W5C E;  1BSH A;  1LTB C;  1M1J A;  1P84 H;  2AEF A;  2D2C D;  2PRR A;  2QJP C;  2FFD A;  1SQQ J;  1X9V A;  4IFD K;  2M3B A;  2BEZ F;  2O01 H;  2WWW A;  3L71 G;  3L71 D;  2Q9I A;  1PP9 G;  1BCC D;  2BCC E;  3AE6 C;  5KLI B;  3GHG C;  4IL6 X;  3RBX A;  1M90 Q;  2WVR A;  2FFD B;  4UB8 H;  1SQP K;  3KYQ A;  1NTK E;  2WPR A;  1NJI Q;  1GMJ A;  3TGU G;  3C8V A;  1IK9 A;  1P84 D;  2ZVO B;  3HTK B;  1RE4 C;  5CBO A;  3CCL P;  1HTL C;  3CX5 H;  3WMM 0;  4WVZ A;  4C7R A;  3AE1 C;  3QH9 A;  1VQK P;  3A0H H;  1HF9 A;  1T8Z A;  1WT6 A;  5AVV B;  2XNX A;  2Y0C A;  3IF4 A;  3I5C A;  4H0L C;  3S4R A;  3V5B A;  1Q7Y Q;  2ITA A;  1NTM J;  2WPS A;  2Y9Y A;  2QJY B;  4XFJ A;  1JY2 P;  2AXT H;  2QVA A;  4L73 A;  1HJB A;  1BGY E;  2KS1 B;  1G1J A;  2A45 G;  1UIX A;  2JP3 A;  4PD4 I;  3U1C A;  1S1C X;  5AVT B;  5CHX A;  1D7M A;  2N9B A;  2NRG A;  3V2N A;  5KLV G;  1DD4 A;  1ZV8 A;  3H1I D;  1M7L A;  2QEX P;  1NOH A;  1KYO H;  3PHL A;  4N78 E;  2GA1 A;  1SP4 A;  3CI9 A;  1K8A Q;  1FDO A;  5KLI C;  1SQX G;  2YMY A;  1T6A A;  5CCG A;  2E76 D;  3VP8 A;  3KHU A;  2D2C C;  1YIJ P;  1YJW P;  3VYI A;  3HUS C;  4Y99 C;  1MV8 A;  2W83 C;  1U7M A;  2IZ1 A;  2HOD A;  3CCU P;  2FYU K;  3VMX A;  3TYY A;  1JO5 A;  3SWY A;  3SFE C;  2JDI H;  1VF5 D;  5AVX B;  3CL3 D;  3KXD A;  5GTI E;  2I1K A;  4PV1 B;  3CPW O;  3LW5 H;  1KYO I;  5B5E H;  1PGQ A;  1RQU A;  1T3U A;  3M0D A;  1K04 A;  2M5A B;  4OH8 B;  1VL2 A;  5AVW B;  1PGP A;  2GUV A;  1BE3 E;  2W27 A;  1PFI A;  1S2E A;  4PD4 H;  1CZQ A;  3L72 E;  1ZME C;  1SQB D;  3KZI E;  3H1J G;  1IFI A;  1SQX K;  4EI2 A;  1LT9 A;  1AQT A;  1JEK A;  2B87 A;  2NPS A;  1RF1 A;  2O01 N;  5AW8 B;  3W68 A;  2WSE H;  1Q81 Q;  2KS1 A;  1FZE A;  4JYC A;  2XZR A;  1N8R Q;  1OMI A;  2A06 G;  4N3Y B;  2CPS A;  2C9L Y;  3UIA A;  1S5L X;  1IFD A;  2OYO A;  1PIX A;  1DIP A;  4WBA A;  4C46 A;  3O6Q B;  3RL0 B;  3CCJ P;  3VTP C;  1RQV A;  4OGQ D;  5KTB A;  5AVS B;  3CCV P;  2G8Y A;  1W2B O;  1BCC J;  1YTZ I;  4DT0 A;  1KIL D;  1KIL E;  2FY8 A;  2JWD A;  3AE9 C;  2I8D A;  3AED C;  3BCC J;  2KUB A;  3EWK A;  4D6T E;  3L72 G;  2QA4 P;  1KN7 A;  1DD3 A;  1OWA A;  2OAR A;  3L73 E;  3V2Q A;  4ZMD A;  3B5N A;  1M56 D;  5CCG D;  1FZC B;  1PPJ D;  1N7L A;  3TGU J;  1T2K D;  3Q3D A;  1T2K C;  1URQ D;  3L74 D;  1VQ9 P;  1QEX A;  2FXM A;  1SQP G;  1GZL A;  1YTZ T;  2K9J B;  2WZ7 A;  2XKM A;  3PTZ A;  2ZVN B;  2J5U A;  5APT A;  1YYC A;  4H13 B;  5CCG C;  2WTY A;  1L0L D;  1VQL P;  5AW9 B;  3WU2 H;  4KT0 J;  1FAV A;  4AQR D;  1NTZ D;  1ZRT D;  4MN4 C;  2N1T C;  2L91 A;  4JPZ B;  5KKZ B;  2POH A;  2R5D A;  3JC2 2;  3L75 D;  1NTM D;  1Y9B A;  2P1J A;  2PFX A;  2W6J H;  4PV1 D;  4C7N B;  1NGM B;  1GDT A;  1J1D C;  1VQP P;  5KJ7 C;  1FZG A;  1YQ3 C;  3GG2 A;  1NU1 E;  2FYU J;  3CCR P;  1FZC C;  3M9B A;  2E74 C;  2XDJ A;  5AW0 B;  2IZ0 A;  4L75 A;  2RN0 A;  1LTA C;  1MFT A;  1SQV K;  1QLE D;  1LTJ B;  1ZXG A;  3P32 A;  2KXP B;  2YNY A;  1SQX J;  1NTZ E;  2HG5 D;  2Q3E A;  4IL6 H;  5C39 A;  1K9M Q;  3D70 A;  1SQV G;  1MFZ A;  1LT9 C;  1JTH B;  2A06 E;  2CPB A;  2NPS C;  3L70 E;  1NU1 K;  1SVF A;  3GMA A;  3R4Y A;  2OQQ A;  4I1L A;  1W2E A;  4HB1 A;  5KAF E;  1DX7 A;  1JY3 P;  2H88 C;  2WIT A;  2PAJ A;  3BCC D;  3K5B A;  4D6T J;  3L73 D;  2FYN C;  1QL1 A;  1X0T A;  2Q6Q A;  3AEF C;  2OYI B;  1AFO A;  1NU1 G;  2KK7 A;  1M8O B;  1QGK B;  1J1E B;  1UII A;  3FWN A;  3KPE A;  3OW2 O;  1S3J A;  1NVO A;  2BEQ D;  3A0B E;  4HYT B;  4EYY Q;  2ZT9 B;  4NPE A;  4NPD A;  4UB6 H;  1NTM E;  1PP9 E;  3MIW A;  4AUW A;  1LTJ C;  1KV4 A;  3A3Y B;  4RKU J;  3VN0 A;  1MZ9 A;  4R4L A;  3NFQ A;  1IO4 A;  3CX5 E;  2QM7 A;  2N9Y B;  2R3C A;  5AW4 B;  3TSI A;  2KSE A;  3B5N C;  3BRV B;  1OVU A;  1SQQ D;  2K9Y A;  2QM8 A;  2ZAE B;  3AEB C;  5DJU B;  3M0A A;  1SFC A;  4WY4 C;  2W6A A;  2IBZ D;  3ITK A;  5AW5 B;  1SS1 A;  3L74 E;  4QMA A;  5H2F E;  4EDF A;  1LT1 A;  1OW8 A;  1U7J A;  1ZN5 A;  3RL0 D;  2E75 B;  1FJP A;  3E7K A;  3HD7 A;  1GL2 D;  4ASV A;  3G4S P;  3H1J D;  1H8A A;  3RK2 C;  2HPC B;  2ZT9 C;  3E1I A;  2DW3 A;  2N1T A;  5KLV D;  5KLV E;  1SLQ A;  2K88 A;  2E76 B;  5AW6 B;  1LTS C;  2BCC J;  2R32 A;  2WSF H;  1IZN B;  1SQB G;  3IFM A;  1BGY G;  1NU1 D;  3GF3 A;  2V4H A;  3HTK A;  2YKO A;  1SQB K;  1N2D C;  2LKM A;  5M1B A;  1VQM P;  3CMA P;  1NTZ G;  5B66 H;  3E1R A;  1NWQ A;  1IFJ A;  2A45 H;  3AE3 C;  1SQP J;  3H1K D;  3IAO A;  4LC1 A;  2LXB A;  3S1K A;  1ZLL A;  3M9H A;  1IK7 A;  2FBW C;  2I1J A;  2QE7 H;  3PLN A;  4IFM A;  1SQV D;  2Z5H A;  1EDJ A;  2O3J A;  5B66 E;  1YJN P;  3CC7 P;  1GL2 B;  3ABV C;  2ZT9 D;  2JWA A;  3VMY A;  2R5B A;  4Y28 J;  3GW6 A;  3L75 J;  3Q2Y A;  1SQQ K;  2IFN A;  2ZXX A;  1Y8A A;  2J58 A;  3LW5 J;  1EDK A;  3PJS K;  4DCK A;  4BRY A;  2FYU G;  3RK3 D;  1EZV I;  5TIS H;  3CME P;  3H1H D;  2PP6 A;  2E74 D;  4BWN A;  1J1D B;  3B5N B;  4K3A A;  1T3J A;  5APY A;  1OZH A;  4Y99 B;  1BDD A;  5APV A;  3FWL A;  1S5L H;  3RK2 B;  1U57 A;  3MZW B;  3FGA D;  1IC2 A;  3I56 P;  1N86 A;  1LTJ A;  2A06 D;  3CXH I;  1L0L G;  3QWO C;  1S9K E;  2K3R A;  1OVV A;  2H43 A;  1HUC A;  1ZP0 C;  3BAS A;  3H1L D;  3HD7 D;  5GTH H;  1NTK J;  1AQ5 A;  3EFF K;  2XU6 A;  2E75 D;  1JCC A;  2E5T A;  5AW3 B;  3H1H E;  3MP7 B;  4D6T D;  5KLV J;  1NTK K;  1SFC D;  2B88 A;  1H89 A;  2IDB A;  2JEE A;  1P84 I;  2Y0D A;  1ZR4 A;  1NHL A;  1LTG C;  5GTH E;  1JTH A;  1NU1 J;  2FYU E;  2L5G B;  2SPZ A;  3H6P A;  3L72 D;  1LTI C;  1JNM A;  2Z4E A;  2B87 B;  2E42 A;  4L76 A;  1Z56 A;  2P2U A;  1KIL C;  1J1E C;  1FJK A;  5H2F H;  2B89 A;  2NPS D;  1L0N K;  3L35 A;  1AJY A;  1L4A C;  3M06 A;  2J59 M;  1FBM A;  1VF5 B;  1G2C A;  1PV3 A;  2YIU B;  1JY3 O;  5AVQ B;  1KOR A;  1K73 Q;  1OW6 A;  3W67 A;  3D6Y A;  2O1J A;  1K05 A;  2JKV A;  3BAT A;  3MGN A;  4XE5 B;  5KLV K;  3L70 G;  4M3L A;  1LP1 A;  3M0D C;  1M57 D;  4OVN F;  3TK1 A;  1EZV G;  1PPJ E;  5E79 H;  2NZ2 A;  4B86 A;  4ZKP A;  3HRN A;  1IFN A;  3WUV A;  2RH0 A;  1KIL B;  1CW5 A;  2W90 A;  1KYO D;  2YKQ A;  3G71 P;  3H1J J;  2E5Y A;  4O9B A;  1IFM A;  3Q5S A;  3U59 A;  1JY3 N;  1AA0 A;  1E5W A;  1KB9 E;  4EIJ A;  3H25 A;  3B5N D;  3CCQ P;  3HE4 B;  2OYH A;  2IBZ E;  5APX A;  3H1L E;  4W7Y A;  5E79 E;  1FZA A;  3AE8 C;  4H44 C;  4L74 A;  3V6I A;  3G6E P;  2N1T B;  5KKZ C;  1NTZ J;  1GW4 A;  3LID A;  4GOD A;  5B5E E;  2ZYA A;  4NPF X;  1NTM K;  2D2C B;  3SWF A;  2QG4 A;  1GL2 A;  3H1K J;  3HD7 B;  3FX0 A;  4GKG A;  1BCC G;  2HFE D;  1L2P A;  3P8C E;  3TF5 A;  3Q5R A;  1QVF O;  3H1L G;  2K1A A;  3L72 J;  3MHV A;  2KI7 B;  2QSI A;  1VQ4 P;  2AXC A;  3RK3 B;  3CWB J;  2R3S A;  4KHX A;  1E79 H;  1VQ7 P;  4GDO A;  2WPV B;  3I55 P;  1KTM A;  1URQ A;  1XTG B;  1SQX D;  1FDM A;  2YKP A;  3RK2 D;  1FU1 A;  1IFP A;  1L0N D;  2C0W A;  1L0N G;  2KLV A;  2E76 C;  2ZYG A;  3F5H A;  3H1K E;  3M9Q A;  4GIF A;  4IFF A;  5CMZ A;  3RL0 C;  4U3F J;  1KIL A;  2ZFC A;  1VPC A;  2N1T D;  5TIS E;  1HGV A;  3TGU E;  1L4A A;  2V7Q J;  4RO0 A;  1S72 P;  1LWU C;  1A02 F;  4HH2 A;  5CBN A;  5KJ7 A;  3L73 J;  3SFD C;  1VQN P;  2KNC B;  4WB4 A;  1L0N E;  1KQG B;  2OTJ P;  4PV1 C;  1GW3 A;  3D6Z A;  1JY2 N;  3AEE C;  1VQ5 P;  2ZYD A;  3SWK A;  1L0L K;  1L4A B;  3H1I E;  4YTP C;  3KQG A;  4N6J A;  2YMK A;  1KFM A;  3T97 B;  2Q1K A;  2W6B A;  3L71 E;  4GOF A;  3HUS B;  1AVY A;  1MUU A;  2R44 A;  1ZOY C;  2YO3 A;  3P8C D;  2XV5 A;  4H44 D;  1KQF B;  1ZR2 A;  1KMI Z;  2YO2 A;  1PL5 A;  1YJ9 P;  3PP5 A;  2OTL P;  3T97 A;  3TDK A;  1GTW A;  2OYI C;  2OYH C;  2RMZ A;  2Y9Z A;  3CX5 D;  1S4X A;  5APQ A;  1YI2 P;  2WSC J;  4HKZ H;  3A0B H;  1N73 C;  1OFC X;  1BE3 J;  1G2C B;  2IBZ G;  3CWB D;  4OGQ C;  1QVG O;  3JSV C;  2HPC A;  2P7J A;  4LGD E;  1GL2 C;  2IBZ I;  2P58 A;  1HGZ A;  3AE5 C;  3H1I G;  1FZF A;  1KYO E;  3A2A A;  1KZU B;  3MUD A;  2VRS A;  4TT3 H;  1KB9 I;  1NTZ K;  4WY4 D;  2GUS A;  1FS0 E;  1KFN A;  4W7Z A;  2C0X A;  2Q5U A;  2M5A A;  3L70 D;  4I6M C;  3OJA B;  2KP8 A;  5CCH A;  2Z5I A;  2JJL A;  4LLH A;  4WY4 A;  1YHQ P;  1GK6 A;  1JOC A;  3NTN A;  2WSC H;  1Q82 Q;  1A02 J;  4BXL A;  1URQ C;  3L74 J;  1RF0 A;  3M91 A;  3AE2 C;  1EQ7 A;  4RES B;  1VF5 C;  2YIU C;  3RL0 g;  5K5G B;  4AYC A;  1EC5 A;  2FYZ A;  2V7Q H;  5AVU B;  1FOS F;  1KB9 H;  3A5T A;  3CX5 I;  3V2P A;  2KIK A;  3AEG C;  4C7N A;  3D71 A;  1VQ6 P;  1X79 B;  3H1K G;  1PP9 J;  1LWU A;  2AEJ A;  2O1K A;  4XA4 A;  5BVZ A;  4UB6 E;  2HYN A;  1X8Y A;  3GHG A;  4OGQ B;  4PD4 E;  2E75 C;  1SQB J;  2YXR B;  1BGY J;  4GT1 A;  4H44 B;  3EFG A;  4PD4 D;  3BVH A;  2QJP B;  2C9N Y;  3ZDM A;  2E74 B;  2HLO A;  3CWB G;  3EQ2 A;  3G9R A;  4JBZ A;  3RK3 C;  1VDF A;  2OYH B;  3L4F A;  5GTI H;  3HE4 A;  3GHG B;  1RE4 A;  1L0N J;  1PGO A;  3LIE A;  1SQP E;  5APS A;  4ASW A;  5CJ4 A;  1X22 A;  2LR2 A;  1JY2 O;  1YQ4 C;  4U3F G;  1H88 A;  1TU3 F;  2BAS A;  3CXH D;  3PRJ A;  1EXJ A;  1EZV D;  1NTM G;  4YXW H;  2OGU A;  1PGJ A;  3L75 G;  1H0T A;  2XND H;  1VQO P;  3N7N A;  4HJG H;  5KJ7 D;  1XTC C;  3V4Q A;  3CD6 P;  3VOP A;  3V2R A;  3VMZ A;  1KQL A;  3AEC C;  3RK3 E;  4YXD C;  1LP1 B;  1RE3 C;  4N78 D;  3JCU H;  3F89 A;  1N73 A;  1R8E A;  3II6 A;  3CWB E;  2GM4 A;  3H32 A;  2FXO A;  3KDP B;  1EZV E;  1PPJ G;  3VMA A;  1N7S A;  1LT9 B;  2NPS B;  1NYH A;  2Y0E A;  4H0L B;  1LNQ A;  3MUD C;  1SQV E;  2W8Z A;  2WT7 B;  1IJD B;  1L0L J;  4K35 A;  1AV1 A;  1BSN A;  1GU5 A;  2O01 J;  2P10 A;  2B9B A;  5KAI E;  3CCM P;  3WU2 E;  2WMM A;  1NTK G;  1M1K Q;  1JMM A;  5CJ0 A;  5AW1 B;  1SQB E;  3Q1M A;  5APW A;  1PP9 D;  3RGU A;  5AW7 B;  2KNC A;  2H7H A;  5KAI H;  1OX3 A;  1HJ0 A;  2YXQ B;  2QJY C;  3H1H G;  1RHZ B;  1P84 E;  1BE3 G;  5AW2 B;  1BE3 D;  1NAF A;  1DEB A;  2JR8 A;  4RJT A;  1RH5 B;  1KD1 Q;  2KSJ A;  2WQY C;  3H1I J;  3H32 B;  3N4X A;  3O8Z A;  4UB8 E;  3CC4 P;  3CCE P;  1NAY A;  1BCC E;  1LTT C;  2BCC D;  3GLM A;  3H1J E;  1USD A;  3IN6 A;  1DEE G;  3NXS A;  4H13 C;  3TNU A;  1GU4 A;  1DH3 A;  2E43 A;  1FZB A;  3CXH E;  3HE5 B;  4JQ0 D;  4GOE A;  1H0T B;  1LJ2 A;  3KZI H;  2KLU A;  3L70 J;  3B4S A;  1RF1 C;  2WSE J;  4DJG A;  3WUU A;  1CI6 A;  2KOG A;  4DZO A;  3L74 G;  4BRY B;  1RF1 B;  1OW7 A;  4U3F E;  1SQX E;  3GF7 A;  5APU A;  1KQS O;  4YPC A;  1WRG A;  1FOS E;  1Q90 D;  3CLQ A;  2PGD A;  3CCS P;  4ZKU A;  4CPG A;  1FC2 C;  3R2P A;  1HWT C;  2WT7 A;  2OTK E;  3CXH H;  1CSB A;  3JCU E;  1M1J B;  2ZJS E;  3BCC G;  2M0B A;  2QIW A;  5BU8 B;  4KJM A;  1N7S D;  2Q3I A;  1BGY D;  4IL6 E;  1RE3 A; 
#chains in the Genus database with same CATH homology
 3HE5 A;  3MD0 A;  2ZXE B;  1LWU B;  4JF7 A;  2IPP A;  3MTU E;  1N7S C;  3IR9 A;  1LGH B;  1HBW A;  1NH4 A;  3NMD A;  3U1A A;  3BRT B;  3P8M C;  5BU5 A;  4I2L C;  3P7K A;  4WY4 B;  1CI6 B;  1NKN A;  1L4A D;  5AVZ B;  1FZC A;  1M1J C;  1HVV A;  1GK4 A;  2FFD C;  3C9I A;  1J2J B;  1RY3 A;  3VP9 A;  1S9K D;  3OA7 A;  5AVY B;  2M8R A;  1N73 B;  1SFC B;  4W80 A;  2Q7C A;  4EOT A;  4DOJ A;  2HOD B;  1HH0 A;  3B8E B;  2KYV A;  2A45 I;  2FKW B;  5CCH D;  1NKZ B;  2MJZ A;  1JUN A;  1N7S B;  1OXZ A;  2OYI A;  2IFM A;  3L37 A;  3G3Z A;  3L36 A;  1GD2 E;  1G1I A;  2P67 A;  1URQ B;  2KB7 P;  5AVR B;  2WPQ A;  1SFC C;  1NO4 A;  3TNU B;  3V4W A;  2IX7 C;  4JYB A;  3HD7 C;  3A7O A;  1QL2 A;  5CCH C;  1JCD A;  3HUS A;  1RF0 C;  3OAK A;  2H8P D;  1LTB C;  1M1J A;  2FFD A;  1X9V A;  4IFD K;  2M3B A;  2O01 H;  2WWW A;  2Q9I A;  3GHG C;  2FFD B;  1SQP K;  3KYQ A;  2WPR A;  1IK9 A;  3HTK B;  1RE4 C;  1HTL C;  3WMM 0;  4C7R A;  1T8Z A;  1WT6 A;  5AVV B;  2XNX A;  3I5C A;  3V5B A;  2WPS A;  1JY2 P;  1HJB A;  1G1J A;  2A45 G;  3U1C A;  5AVT B;  5CHX A;  2N9B A;  3V2N A;  1ZV8 A;  1M7L A;  1NOH A;  4N78 E;  1SP4 A;  3CI9 A;  2YMY A;  5CCG A;  3VP8 A;  3VYI A;  3HUS C;  4Y99 C;  1MV8 A;  2HOD A;  2FYU K;  3VMX A;  1JO5 A;  3SWY A;  5AVX B;  3CL3 D;  2I1K A;  3LW5 H;  1T3U A;  3M0D A;  4OH8 B;  5AVW B;  2GUV A;  2W27 A;  1CZQ A;  1IFI A;  1SQX K;  1LT9 A;  2NPS A;  1RF1 A;  5AW8 B;  2WSE H;  1FZE A;  4JYC A;  2XZR A;  4N3Y B;  2CPS A;  2C9L Y;  3UIA A;  1IFD A;  4WBA A;  4C46 A;  3RL0 B;  3VTP C;  5KTB A;  5AVS B;  1YTZ I;  1KIL D;  3V2Q A;  1OWA A;  2OAR A;  5CCG D;  1FZC B;  3B5N A;  1N7L A;  1T2K D;  1T2K C;  1URQ D;  2FXM A;  1YTZ T;  1GZL A;  2WZ7 A;  2XKM A;  5CCG C;  5APT A;  1YYC A;  2WTY A;  5AW9 B;  1FAV A;  4AQR D;  2N1T C;  2POH A;  2R5D A;  4C7N B;  2P1J A;  1GDT A;  1J1D C;  5KJ7 C;  1FZG A;  1FZC C;  3M9B A;  2XDJ A;  5AW0 B;  1LTA C;  1SQV K;  3P32 A;  1LTJ B;  2YNY A;  2HG5 D;  1MFZ A;  1LT9 C;  1JTH B;  2CPB A;  2NPS C;  1NU1 K;  1SVF A;  4I1L A;  1W2E A;  1DX7 A;  1JY3 P;  2WIT A;  2PAJ A;  1QL1 A;  2OYI B;  1AFO A;  1J1E B;  3KPE A;  4HYT B;  3MIW A;  4AUW A;  1LTJ C;  3A3Y B;  1IO4 A;  1MZ9 A;  3NFQ A;  2QM7 A;  2R3C A;  5AW4 B;  3VN0 A;  3TSI A;  3B5N C;  3BRV B;  2QM8 A;  3M0A A;  1SFC A;  4WY4 C;  2W6A A;  5AW5 B;  1S9K E;  1ZN5 A;  3RL0 D;  3HD7 A;  1GL2 D;  1H8A A;  2HPC B;  3RK2 C;  3E1I A;  2N1T A;  1SLQ A;  5AW6 B;  1LTS C;  2WSF H;  2R32 A;  3IFM A;  3HTK A;  2YKO A;  1SQB K;  1N2D C;  2LKM A;  1NWQ A;  1IFJ A;  2A45 H;  4LC1 A;  1PFI A;  1ZLL A;  3M9H A;  2I1J A;  4IFM A;  2Z5H A;  1GL2 B;  3VMY A;  2R5B A;  1SQQ K;  2IFN A;  2J58 A;  3RK3 D;  2PP6 A;  1J1D B;  3B5N B;  1T3J A;  5APY A;  4Y99 B;  5APV A;  3RK2 B;  1IC2 A;  1N86 A;  1LTJ A;  2H43 A;  1HUC A;  3BAS A;  3HD7 D;  2XU6 A;  1JCC A;  1H89 A;  5AW3 B;  1NTK K;  1SFC D;  2JEE A;  1ZR4 A;  1NHL A;  1LTG C;  1JTH A;  3H6P A;  2L5G B;  1JNM A;  2Z4E A;  2E42 A;  1LTI C;  1Z56 A;  2P2U A;  1KIL C;  1J1E C;  1FJK A;  2NPS D;  1L0N K;  3L35 A;  1L4A C;  3M06 A;  2J59 M;  1FBM A;  1G2C A;  5AVQ B;  1JY3 O;  2O1J A;  3BAT A;  4XE5 B;  3MGN A;  5KLV K;  4M3L A;  3M0D C;  3TK1 A;  4B86 A;  4ZKP A;  3HRN A;  1IFN A;  1KIL B;  1CW5 A;  2YKQ A;  4O9B A;  1IFM A;  3U59 A;  1JY3 N;  4EIJ A;  1E5W A;  3B5N D;  3HE4 B;  2OYH A;  5APX A;  4W7Y A;  1FZA A;  2N1T B;  1GW4 A;  3LID A;  1NTM K;  3SWF A;  3HD7 B;  1GL2 A;  4GKG A;  2HFE D;  3P8C E;  3RK3 B;  4KHX A;  1URQ A;  1XTG B;  1FDM A;  2YKP A;  3RK2 D;  1FU1 A;  2C0W A;  3TYY A;  2KLV A;  4IFF A;  3M9Q A;  4GIF A;  5CMZ A;  3RL0 C;  1KIL A;  2ZFC A;  1VPC A;  2N1T D;  1HGV A;  1L4A A;  1LWU C;  1A02 F;  4HH2 A;  5KJ7 A;  4WB4 A;  1GW3 A;  1JY2 N;  1L0L K;  1L4A B;  3KQG A;  4N6J A;  1KFM A;  2W6B A;  3HUS B;  3P8C D;  1MUU A;  2YO3 A;  2XV5 A;  1ZR2 A;  2YO2 A;  3PP5 A;  3T97 A;  2OYI C;  1GTW A;  2OYH C;  5APQ A;  1N73 C;  1G2C B;  2HPC A;  2P7J A;  4LGD E;  1GL2 C;  1HGZ A;  1FZF A;  3A2A A;  1KZU B;  3MUD A;  2VRS A;  1NTZ K;  4WY4 D;  2GUS A;  1KFN A;  4W7Z A;  2C0X A;  2Q5U A;  4I6M C;  3OJA B;  2KP8 A;  5CCH A;  2Z5I A;  2JJL A;  4LLH A;  4WY4 A;  1GK6 A;  1JOC A;  3NTN A;  2WSC H;  1A02 J;  1URQ C;  1RF0 A;  3M91 A;  1EQ7 A;  4RES B;  4AYC A;  5AVU B;  2FYZ A;  1FOS F;  3A5T A;  3V2P A;  4C7N A;  1X79 B;  1LWU A;  2O1K A;  4XA4 A;  5BVZ A;  2HYN A;  1X8Y A;  3GHG A;  3BVH A;  4GT1 A;  2C9N Y;  3EFG A;  2HLO A;  3EQ2 A;  3RK3 C;  1VDF A;  2OYH B;  3L4F A;  3HE4 A;  3GHG B;  1RE4 A;  5APS A;  5CJ4 A;  3LIE A;  1JY2 O;  1H88 A;  2BAS A;  3N7N A;  5KJ7 D;  3V4Q A;  1XTC C;  3VOP A;  3V2R A;  3VMZ A;  1KQL A;  1RE3 C;  4N78 D;  1N73 A;  3II6 A;  2GM4 A;  3H32 A;  3KDP B;  1N7S A;  1LT9 B;  2NPS B;  2WT7 B;  1IJD B;  1GU5 A;  1JMM A;  5CJ0 A;  5AW1 B;  5APW A;  5AW7 B;  2H7H A;  5AW2 B;  1NAF A;  1DEB A;  1FJP A;  1AQ5 A;  2KSJ A;  3H32 B;  3N4X A;  3O8Z A;  1LTT C;  2E43 A;  3NXS A;  3TNU A;  1GU4 A;  1DH3 A;  1FZB A;  3HE5 B;  1RF1 C;  1CI6 A;  2KOG A;  4DZO A;  1RF1 B;  5APU A;  1WRG A;  1FOS E;  3CLQ A;  4ZKU A;  3R2P A;  1HWT C;  2WT7 A;  1CSB A;  1M1J B;  5BU8 B;  1N7S D;  2Q3I A;  1RE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...