4N6JA

Crystal structure of human striatin-3 coiled coil domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
49
structure length
49
Chain Sequence
STMDWEVERAELQARIAMLQGERKGQENLKKDLVRRIKMLEMALKQERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Striatin-3
publication title Striatins Contain a Noncanonical Coiled Coil That Binds PP2A A to Form a 2:2 Heterotetrameric Core of Striatin-interacting Phosphatase and Kinase (STRIPAK) Complex
doi rcsb
source organism Homo sapiens
total genus 17
structure length 49
sequence length 49
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.300 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4n6jA00
1SVFA 4N6JA 1G2CA 3EFGA 2FYZA 4EIJA 3KPEA 3SWYA 1ZV8A
chains in the Genus database with same CATH superfamily
1L0LE 1XTCC 2HODB 2FKWB 2Q9IA 3FXEA 1USEA 1RH5B 3CC7P 3CMEP 4DJGA 1BCCD 1X22A 4IL6H 1LJ2A 1T6AA 1MFZA 1ZR4A 2QVAA 3B4SA 2PP6A 5APWA 1LWUC 1DEEG 2E76B 1P84I 2J58A 3A3YB 2PRRA 2O1JA 1NKZB 1IFMA 2IZ1A 2YKPA 1SQVD 3H1LJ 3GF7A 5APUA 5APYA 1KC8Q 1LWUA 3H6PA 1HVVA 4RJTA 5AW5B 2BCCJ 3F5HA 2AXTE 1A02J 4XFJA 2RH0A 2QJPB 5AW4B 3CWBD 2B9BA 1HBWA 2KXPB 3CXHE 4EIJA 1RF1C 1J2JB 1BDDA 1HGVA 1NTKG 5E79H 5CBNA 1U7MA 2Y0DA 4EDFA 3M9HA 3HD7D 1NTZE 1BE3E 3RBZA 3VMZA 1EDJA 2XDJA 3SWFA 3KXDA 3WU2E 1RF1A 1HUCA 2WPSA 4PD4D 1U7JA 1SQVK 4IFDK 2K1AA 1Q81Q 2KNCA 2N9YB 2W83C 4I7ZC 3SFDC 1YBKA 3WUVA 2J59M 2P67A 4H0LB 1EDIA 1SQBJ 1LWUB 1SQXG 1AVYA 2IBZD 5GTHE 1JCDA 1KILD 3AE5C 1VF5C 1FDOA 2E43A 5KLVG 3CX5I 1GZLA 4UB6E 4N3YB 2ZT9D 4NPEA 1G1JA 1MFTA 2ZYAA 2AEJA 3TDKA 3TGUE 3L36A 4U3FE 3P8MC 1OW8A 1VQ9P 2YNYA 5GTIE 3R4YA 3KHUA 2WSSH 4L76A 5AVTB 1NU1D 3L75E 2XNXA 1LTJC 1SQXJ 1GD2E 4KT0J 3W67A 2KNCB 3L72G 2SPZA 1JMMA 1GK4A 2R3SA 1RQUA 3ITKA 1M8OB 3QH9A 1LTSC 2Z5IA 1LTAC 3SWKA 1EQ7A 2AEMA 1LTJA 1DD3A 4JYCA 2P2UA 2XKMA 5CCGD 3CXHH 1R5SA 3VYIA 2I8DA 2FXPA 1VPCA 2QA4P 3H1IG 4C7RA 1VF5B 1BSHA 3OJAB 3L74D 1NU1K 1NTMG 5AW0B 2JWAA 3WU2H 3B8EB 3ZDMA 3H25A 3HE5A 2P7JA 3VP9A 3HD7C 1NGMB 3D6YA 3L70D 1EZVG 1SS1A 3M06A 3H1JG 3MHVA 3TK1A 1KB9H 2AEFA 4M3LA 3U1CA 1HGZA 5KLIC 1Z56A 5AW1B 1ZP0C 1LTJB 3HD7A 4WB4A 1AA0A 2O01N 2NZ2A 2BEQD 2O01H 3H1IJ 2M0BA 2KUBA 1Q90D 3MD0A 1GL2B 1L4AD 3SSUA 1OIPA 2KYVA 1KILC 1L0LJ 1ZRTD 1KQFB 4R4LA 1NTMJ 5GTIH 3U1AA 1AFOA 3IFMA 5AW9B 1SQQK 3CC4P 1YJ9P 3H1JJ 3PHLA 4IFMA 3RL0D 1FZAA 2JR8A 1KFNA 2K9YA 1KILA 1OVVA 1M56D 1H88A 1Y8AA 4OGQD 2Q3EA 3AEGC 4I2LC 1OVRA 5CCHD 3M9QA 4KJMA 4C7NA 1S72P 5AVWB 2OYOA 4RO0A 1VQ6P 2ZVNB 2XZRA 1KZUB 4WVZA 3HD7B 3H1HG 4PV1C 1DH3A 2E5YA 3E1IA 3NMDA 3RK2D 3E7KA 2IFNA 3P7KA 2Y0CA 1IFIA 5KLIB 1VQ7P 5AW7B 5KKZC 3AE3C 3BCCD 1QGKB 4ASWA 3HE4A 4LGDE 3AEEC 5CCGC 2L91A 1VQKP 1J1EB 1KILB 1KB9D 2OTLP 1ZMEC 1JB0J 2YMYA 5AVVB 1D7MA 2ZT9B 1NTZJ 3LW5J 2LR2A 1K73Q 3H1HJ 4C7NB 3KYQA 1PGPA 5CCGA 4YXDC 1BGYG 1VQ4P 1NTKE 3D71A 1W2EA 3VTPC 3RGUA 2KSEA 1IJDB 2M3BA 1NKNA 2C0XA 1MZ9A 3GLMA 1JO5A 3BRTB 3AEFC 2GUSA 2R5DA 1PP9D 3PTZA 3M91A 2QJKC 3HE4B 1NHLA 1NO4A 2M5AA 2A06D 2C0WA 1PPJG 1L4AC 2FYUJ 4H0LD 3IN6A 1W2BO 1KFMA 1DX7A 1SQXE 3N4XA 2K3RA 1KYOD 2JO1A 1IK7A 2WQYC 1FOSF 4H13C 3L71G 1BGYJ 4U3FJ 5B66E 4B86A 3V2NA 3RL0C 1JM0A 1RY3A 1L4AA 2IZ0A 1K04A 4W80A 3CCJP 4XA4A 2B88A 2ITAA 4OGQC 1WT6A 1PGQA 1JY2O 2WTYA 2N1TD 3AE9C 3CL3D 1GU4A 1NAFA 3JSVC 2BEZF 1JEKA 4D6TD 4KHXA 4GT1A 3G9RA 5DJTB 1IZNB 5K5GB 2M5AB 3L72E 5CCHA 3JC22 2E74D 4HB1A 1LTTC 3A5TA 1OW7A 3RK3E 1N8RQ 2QJKB 1SVFA 3KDPB 3MIWA 3W68A 3L73D 1G1IA 1USDA 1SQPG 2FXMA 1YQ3C 1LT9C 3LIDA 3H1IE 1M1JC 3FX0A 2QJPC 2ZYDA 2R5BA 2FXOA 3TSIA 3RL0B 2KLVA 2R44A 4ZKUA 1NTME 1MKMA 1VQPP 4N6JA 1FDIA 2PGDA 2Y9YA 4OGQB 1OZHA 2R32A 1LT9A 1LT1A 3VMYA 1EZVE 3H1JE 1QL1A 2O1KA 1M1JA 3S9OA 2IYPA 1FU1A 1KB9I 1BSNA 3RBXA 1EXIA 1KD1Q 4RESB 3H1LD 4N78D 4GOEA 2ZXEB 1BCCG 2JJLA 1SQPJ 4EOTA 2BCCD 2V7QJ 3U59A 5B66H 4OH8B 3RK2B 4H0LC 4GKGA 5H2FE 1GL2D 1NAYA 1IFJA 2JEEA 2W8ZA 1UIIA 1HH0A 1LGHB 1VQ5P 1AQ5A 1LTIC 3Q5PA 2WVRA 2H43A 1SQVG 1S4XA 3EFFK 2KOGA 5CBOA 4H44D 3RL0g 4Z1MH 2OTJP 2W6AA 1LT9B 2Z5HA 1M1JB 2B89A 2CK3H 5B5EE 1KYOI 1VL2A 3V2RA 1W5CE 2FYNB 3CWBG 1EC5A 1S5LH 1SQBD 2WSCJ 3P8CD 5KAIH 3CCQP 3H1HE 2RMZA 1IK9A 4QMAA 2E74C 2N1TA 3V4QA 2XU6A 1JUNA 2QRXA 1NJIQ 4BWNA 1FAVA 1YTZT 2GUVA 4GDOA 2E42A 2OQQA 4IOIH 3BVHA 1JY3O 4EI2A 1AV1A 3CPWO 4WWIA 2XNDH 3AECC 1X8YA 2CPSA 2IBZG 3CWBJ 1NTKJ 1YIJP 1T2KD 3T97A 2FYUE 2GA1A 3VN0A 1SQBK 3GHGB 5APTA 1Q7YQ 1PGJA 1BGYE 3AE6C 3BASA 2Q5UA 3H1KD 2N1TB 1P84E 5H2FH 3A0BE 1N73A 2G3AA 1PGOA 1H89A 2KB7P 1NU1G 2POHA 3L35A 1E79H 5KAFE 1GL2C 1RE3C 2E74B 5KLVJ 1PPJE 5AVQB 2I1KA 1SQXK 3T97B 3L71E 2AXTH 1HJBA 5B5EH 1EDKA 2OYHC 1SLQA 4R4MA 1GL2A 1RE3A 2WT7A 5AVYB 2IX7C 1LP1A 3GF3A 3KQGA 2QEXP 3MTUE 3O8ZA 3Q2YA 2NRGA 1CZQA 2A45I 3JCUE 1PV3A 3LW5H 1GW4A 1URQD 2JDIH 1S3JA 2WPQA 2HYNA 3IAOA 2P58A 1ZXGA 3UIAA 1N73B 1SQQD 3L72J 2OYHA 1L0ND 1VDFA 3L74G 3CCRP 2WMMA 1Y47A 3BRVB 1L0LD 2Z4EA 2E5TA 2RN0A 5AVSB 3L70G 2DW3A 3PJSK 2JWDA 5GTHH 1K05A 4PJ0E 4O9BA 4BRYA 3CX5E 3MUDC 4I1LA 1GDTA 2YKOA 4UB6H 2LKMA 2WT7B 1J1EC 1FS0E 3GG2A 1LP1B 5AVZB 4NPFX 1SQPE 3K5BA 4DZOA 2E75D 1FJPA 1T2KC 2NPSD 3MUDA 2ZT9C 2H89C 1L0NK 4PD4I 2B87B 3ABVC 3C8VA 4ASVA 1P84H 2OYHB 1TU3F 1XTGB 1KV4A 3A0BH 2MKVA 3L70J 4H44B 1S9KE 1L0LK 3SWYA 2IDBA 1NTMK 4YTPC 1VQNP 3AE4C 2HG5D 1FZCC 1GK6A 1PFIA 2IBZI 3IR9A 1J1DB 2K88A 2QE7H 1U57A 2H7HA 1FZFA 1RHZB 1FE6A 4BRYB 1AQTA 1BCCE 2W6BA 3CXHD 1FZCA 3F89A 3R2PA 5AVUB 2H8PD 1NTZD 1HTLC 4MN4C 1GU5A 1BE3D 2HPCA 1N7LA 1JY2P 3I5CA 3A0HE 3JCUH 2FBWC 1X79B 3BCCG 2P10A 3FWNA 2RKLA 1SQVE 3G4SP 1VQ8P 3Q1MA 4RKUJ 4LC1A 1URQC 2D2CD 1FDMA 4HKZH 4WY4D 1RF0C 1BDCA 1DEBA 3V5BA 1OMIA 3CCUP 4ZMDA 2FFDC 2L5GB 3CWBE 2YXQB 2FYUD 5APSA 3EQ2A 3Q3DA 4PJ0H 1JNMA 1FZBA 1M1KQ 3CX5H 1FZCB 3TGUD 2WWWA 1NTZK 1GMJA 1URQA 4U3FD 1HWTC 1FJKA 2LXCB 1RF0A 1T8ZA 2HPCB 2FFDA 3O6QA 2V7QH 1PP9G 1QLED 1IC2A 4PD4E 1EDLA 3L75D 3QWOC 3OW2O 3I56P 4I6MC 1UIXA 2YKQA 4OVNF 1M7LA 2A06G 3SFEC 2E75C 4ZNCA 2NPSC 1K9MQ 1E5WA 3CCVP 2IBZE 3PH0A 1KILE 3V4WA 5KLVE 1IO4A 1JTHA 5AW8B 2FYUK 2ZJSE 4LLHA 2R3CA 4GOFA 1Y9BA 1N7SD 1T3JA 2C9NY 2WSFJ 2NPSA 2YIUC 5CCHC 2ZYGA 3M9BA 1URQB 5TISE 1DD4A 1YJNP 1WMKA 5M1BA 1OW6A 1PP9J 1FBMA 3HUSC 1YI2P 1NH4A 2FFDB 2WSCH 2O3JA 4A7PA 2WSEJ 5EFWB 3I55P 3O6QB 4D6TG 1NU1E 3A0HH 1L2PA 3MGNA 3RK2C 3L71J 3HUSA 2VRSA 1QVGO 4TLFA 4UB8E 3TNUA 2PAJA 1JTHB 1DIPA 2KI7B 3OAKA 1PL5A 3CX5D 3CXHI 3PRJA 1YHQP 1YYCA 3L73G 2HLOA 4JF7A 2E75B 2NPSB 3E1RA 1YITP 1S1CX 4WY4C 4JYBA 4W7YA 4BXLA 3CMAP 2KK7A 2FYNC 3FGAD 5C39A 1MV8A 3HRNA 3L74E 2ZFCA 3GW6A 2YIUB 3BATA 4AQRD 3L4FA 3L70E 4WY4A 1KTMA 1JY3P 2W27A 2QG4A 3HUSB 4OWFA 1RQVA 2J5UA 2AXCA 1CSBA 3B5ND 3H1LG 1WRGA 5CHXA 3TNUB 2IFMA 3L73J 1H0TA 3G6EP 2BCCG 2A45G 3AEBC 2MJZA 1JMBA 1SFCD 1SQPK 1ZRTE 2WZ7A 2KLUA 1X0TA 5TISH 1N86A 4L75A 3GHGC 1IFDA 1IFNA 1OFCX 1N7SC 2QM8A 3TYYA 2WPVB 4NPDA 2N1TC 4L74A 2D2CB 1BCCJ 2W6JH 4WY4B 1HF9A 2QJYC 3GHGA 1CI6A 3VP8A 4JQ0D 1N7SA 3D70A 4W7ZA 4UB8H 1H0TB 1SQBG 3M0DC 1JCCA 1NTKD 1ZV8A 3MP7B 4L73A 3OA7A 3AE7C 4YXWH 3AE8C 1OX3A 1SQVJ 3M0AA 2ZXXA 2W90A 3M0DA 1EXJA 1Q86Q 3BCCE 1MUUA 2YMKA 2V4HA 5APXA 1ZOYC 1KB9E 1SQXD 1NVOA 1K8AQ 1NYHA 1N73C 3Q5SA 1CI6B 2M3EA 1FZEA 5AVXB 1PIXA 3FXDA 1JOCA 2LXBA 2N9BA 5KLVD 3D6ZA 1N7SB 1NTKK 1VQMP 1KQLA 4K3AA 1KN7A 1R5LA 1OXZA 2OARA 3PP5A 2XV5A 4XE5B 3H1KG 1GTWA 5L8RJ 2QJYB 1ZN5A 3B5NC 3C9IA 3G71P 2KP8A 1SP4A 4DCKA 2HR3A 1PP9E 2Q7CA 1QEXA 1RF1B 1T3UA 3VOPA 1AVOA 1SFCC 2A06E 5TJHA 1IFPA 2FY8A 3L72D 3B5NA 3V2QA 2QSIA 4DT0A 2KZJA 1KYOE 4PV1D 1CW5A 2YO2A 3RK3D 5KLVK 1JY2N 4H44C 2Q3IA 3H1KJ 3C1LA 1SFCA 3LIEA 3AE1C 4EYYQ 4AYCA 1J1DC 2KS1A 4I7ZB 1NU1J 2B87A 1RE4C 1LNQA 3H1ID 1KQGB 3CCLP 3CLQA 5AW2B 1M90Q 1SQQG 2I1JA 1L0NG 2FYZA 3PLNA 3FWLA 1NTMD 1QL2A 4D6TE 2Y0EA 1L0LG 2BASA 1EZVD 1RE4A 3NFQA 3H1JD 4Y99C 3B5NB 2KZIA 3EFGA 3S4RA 4Y28J 5CJ4A 5BU5A 4YPCA 2Y9ZA 1M57D 1FOSE 4ZKPA 1GW3A 5DJUB 1SFCB 3L73E 3CC2P 3CD6P 5CMZA 1KORA 3L74J 2ZVOB 1S2EA 1SQQJ 2KS1B 5KJ7D 3VMAA 1L0NJ 3MZWB 1QX8A 2WSFH 4H13D 2JKVA 1OVUA 5KAFH 2G8YA 2WSEH 3CCSP 3HE5B 3KZIE 4IFFA 3H1LE 4IL6X 4N78E 1KYOH 2KIKA 3P32A 1FZGA 3H32A 4JBZA 2BCCE 1YTZI 1ZLLA 3H1HD 1NOHA 1VQLP 1NTZG 2YXRB 4Y99B 1BE3G 1N2DC 2P1JA 3WMM0 2IYOA 3V2PA 2HFED 3RK3C 2QM7A 1R8EA 2E76D 4HH2A 5KTBA 2H88C 2YO3A 3B71A 3USSA 3GMAA 2Q6QA 4JPZB 3A2AA 2WITA 2FYUG 3WUUA 1S5LX 4CPGA 3NXSA 1AJYA 1SQBE 2CPBA 2Q1KA 4U7JA 4GIFA 3P8CE 2OYIC 1BE3J 1BGYD 3H32B 3TGUG 1Q2NA 4U3FG 4C46A 3BCCJ 3HTKA 3Q5RA 5AW3B 2QIWA 1P84D 1JY3N 5APQA 1KMIZ 1LTGC 1YJWP 2OYIA 2ZAEB 1G2CA 5APVA 2KSJA 3L75G 3V6IA 1PPJD 3L37A 4PV1B 5KJ7C 1KQSO 1EZVI 1PZQA 1YQ4C 2O01J 4AUWA 1HJ0A 3RK3B 2JP3A 1OWAA 4IL6E 2K9JA 3L71D 4DOJA 1VQOP 1Q82Q 4HJGH 3TGUJ 5KKZB 3KZIH 3G3ZA 3CCEP 1H8AA 5KJ7A 2M8RA 4GODA 2IPPA 3H1KE 5BVZA 1X9VA 4WBAA 3N7NA 3HTKB 3AEAC 3VMXA 2A45H 3EWKA 3L75J 1QVFO 2OYIB 3CCMP 1G2CB 2HODA 2PFXA 5BU8B 5CJ0A 2OGUA 3WUTA 3AEDC 3CI9A 1A02F 3II6A 3IF4A 3NTNA 1LTBC 5AVRB 2C9LY 2E76C 5E79E 2K9JB 1S5LE 2UWJE 3A7OA 1ZW0A 5KAIE 3AE2C 2GM4A 2D2CC 1SQPD 1L4AB 4D6TJ 3TF5A 1FC2C 5AW6B 3KPEA 4HYTB 2WPRA 1SQQE 4K35A 1VF5D 4H13B 1L0NE 3S1KA 2OTKE 2K37A 4TT3H 4PD4H 1ZR2A 1S9KD 1NWQA
chains in the Genus database with same CATH topology
1N73C 1J1EC 1XTCC 2HODB 1CI6B 1JO5A 5AVZB 3BRTB 1FZEA 5AVXB 2GUSA 2R5DA 1JOCA 2N9BA 4DZOA 1N7SB 1FJPA 2FKWB 1T2KC 1NTKK 1KQLA 2NPSD 3M91A 3HE4B 2Q9IA 1NHLA 3MUDA 1NO4A 1OXZA 2OARA 3PP5A 1L0NK 2XV5A 4XE5B 2C0WA 1L4AC 1GTWA 2OYHB 1XTGB 1KFMA 1DX7A 1S9KE 3N4XA 1L0LK 1ZN5A 3B5NC 3C9IA 3SWYA 1NTMK 1FOSF 1MFZA 2KP8A 1SP4A 2HG5D 1ZR4A 1FZCC 1GK6A 1PFIA 2Q7CA 3IR9A 2PP6A 4B86A 1J1DB 3V2NA 3RL0C 5APWA 1LWUC 1RY3A 1RF1B 1L4AA 2H7HA 1T3UA 4W80A 1FZFA 3VOPA 4XA4A 2J58A 3A3YB 1SFCC 2O1JA 3B5NA 3V2QA 2W6BA 1WT6A 1JY2O 1NKZB 2WTYA 1IFMA 2YKPA 2N1TD 1FZCA 5APUA 1CW5A 3CL3D 5APYA 3R2PA 2YO2A 5AVUB 3RK3D 5KLVK 1GU4A 2H8PD 1NAFA 1HTLC 1JY2N 2Q3IA 1GU5A 1LWUA 3H6PA 1HVVA 2HPCA 1N7LA 5AW5B 4KHXA 1SFCA 4GT1A 3LIEA 1JY2P 3I5CA 1A02J 1X79B 4AYCA 5AW4B 5CCHA 1J1DC 1HBWA 4EIJA 1RF1C 1J2JB 1RE4C 1HGVA 3A5TA 1LTTC 3CLQA 5AW2B 4LC1A 2I1JA 3M9HA 3HD7D 2FYZA 3VMZA 2XDJA 1URQC 3SWFA 1SVFA 1FDMA 1QL2A 3KDPB 3MIWA 4WY4D 1RF0C 2BASA 1DEBA 3V5BA 1G1IA 2FFDC 1RF1A 2L5GB 1HUCA 2WPSA 1RE4A 2FXMA 3NFQA 5APSA 4Y99C 1LT9C 3B5NB 3LIDA 3EQ2A 1SQVK 3EFGA 4IFDK 1JNMA 1FZBA 1M1JC 5CJ4A 1FZCB 5BU5A 2WWWA 1NTZK 1URQA 2R5BA 1HWTC 1FJKA 3TSIA 2J59M 2P67A 1RF0A 3RL0B 1LWUB 1T8ZA 2KLVA 4ZKUA 1FOSE 4ZKPA 1GW3A 2HPCB 4N6JA 1JCDA 1KILD 2FFDA 1SFCB 2R32A 1LT9A 2E43A 5CMZA 1IC2A 3VMYA 1GZLA 1QL1A 2O1KA 1M1JA 4N3YB 5KJ7D 1G1JA 1FU1A 4RESB 4I6MC 2YKQA 1M7LA 3L36A 4N78D 3P8MC 2ZXEB 2JJLA 2YNYA 2WSFH 2NPSC 1E5WA 4EOTA 3U59A 3V4WA 1IO4A 4OH8B 1JTHA 5AW8B 3RK2B 2FYUK 4GKGA 1GL2D 1IFJA 2WSEH 2JEEA 3HE5B 5AVTB 4LLHA 2R3CA 2XNXA 1N7SD 1T3JA 1LTJC 1GD2E 4IFFA 1HH0A 1LGHB 4N78E 2C9NY 2NPSA 5CCHC 3M9BA 1URQB 1AQ5A 1LTIC 1JMMA 1GK4A 1FBMA 3HUSC 3P32A 1FZGA 2H43A 3H32A 1NH4A 2KOGA 1YTZI 2FFDB 1ZLLA 2WSCH 1NOHA 2W6AA 1LTSC 4Y99B 1LT9B 2Z5IA 1LTAC 1N2DC 1EQ7A 2Z5HA 1LTJA 1M1JB 2P1JA 3WMM0 3MGNA 3RK2C 4JYCA 3V2PA 2HFED 3RK3C 2P2UA 2XKMA 5CCGD 3V2RA 2QM7A 3VYIA 3HUSA 4HH2A 2VRSA 5KTBA 1VPCA 3P8CD 4C7RA 1IK9A 3TNUA 2YO3A 2PAJA 1JTHB 3OJAB 2N1TA 1NU1K 3V4QA 3OAKA 5AW0B 2XU6A 1JUNA 3B8EB 1YYCA 3HE5A 2HLOA 4JF7A 2P7JA 3VP9A 3HD7C 3A2AA 2WITA 1FAVA 2NPSB 3M06A 3NXSA 1YTZT 3TK1A 2GUVA 2CPBA 4WY4C 2E42A 4GIFA 3P8CE 2OYIC 4JYBA 4W7YA 4M3LA 3H32B 3BVHA 3U1CA 1HGZA 1JY3O 1Z56A 5AW1B 1MV8A 4C46A 3HRNA 2ZFCA 1X8YA 3HTKA 2CPSA 5AW3B 1LTJB 1JY3N 3HD7A 1T2KD 3T97A 5APQA 4WB4A 3BATA 2O01H 4AQRD 3L4FA 1LTGC 4WY4A 3MD0A 1GL2B 1JY3P 2W27A 1L4AD 2OYIA 3VN0A 1SQBK 3GHGB 3HUSB 5APTA 1G2CA 2KYVA 2KSJA 5APVA 1KILC 1CSBA 3BASA 3B5ND 1WRGA 2Q5UA 5CHXA 3TNUB 2IFMA 3U1AA 3L37A 3IFMA 1AFOA 5AW9B 5KJ7C 2N1TB 1SQQK 4AUWA 3RK3B 4IFMA 3RL0D 1OWAA 1FZAA 1N73A 4DOJA 2A45G 2MJZA 1KFNA 1KILA 1SFCD 1H88A 1H89A 2KB7P 1SQPK 2POHA 4I2LC 3L35A 3G3ZA 5CCHD 2WZ7A 1H8AA 3M9QA 5KJ7A 1GL2C 1N86A 1RE3C 2M8RA 3GHGC 2IPPA 4C7NA 5AVWB 1IFDA 5AVQB 5BVZA 1IFNA 2I1KA 1X9VA 4WBAA 3N7NA 3HTKB 2XZRA 3VMXA 1N7SC 2QM8A 3TYYA 1KZUB 2A45H 1SQXK 3HD7B 2N1TC 1DH3A 1HJBA 3E1IA 4WY4B 3NMDA 3RK2D 2OYIB 2OYHC 2IFNA 1SLQA 1G2CB 2WT7A 1GL2A 1RE3A 3P7KA 5AVYB 2HODA 3GHGA 1IFIA 2IX7C 1CI6A 3KQGA 3MTUE 5BU8B 3O8ZA 5CJ0A 3VP8A 5AW7B 3CI9A 1N7SA 1CZQA 2A45I 1A02F 4W7ZA 3LW5H 1GW4A 3M0DC 3II6A 1URQD 3HE4A 3NTNA 1JCCA 2WPQA 1LTBC 1ZV8A 2HYNA 4LGDE 5AVRB 5CCGC 2C9LY 3UIAA 1N73B 3OA7A 1J1EB 2OYHA 1VDFA 1KILB 3A7OA 3BRVB 2GM4A 2YMYA 5AVVB 3M0AA 2Z4EA 5AVSB 3M0DA 4C7NB 3KYQA 1L4AB 5CCGA 1MUUA 5AW6B 3KPEA 1W2EA 4O9BA 3VTPC 4HYTB 2WPRA 1IJDB 4I1LA 5APXA 1GDTA 2M3BA 2YKOA 1S9KD 1NKNA 1ZR2A 2C0XA 1MZ9A 2LKMA 1NWQA 2WT7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SVF A;  4N6J A;  1G2C A;  3EFG A;  2FYZ A;  4EIJ A;  3KPE A;  3SWY A;  1ZV8 A; 
#chains in the Genus database with same CATH topology
 1L0L E;  1XTC C;  2HOD B;  2FKW B;  2Q9I A;  3FXE A;  1USE A;  1RH5 B;  3CC7 P;  3CME P;  4DJG A;  1BCC D;  1X22 A;  4IL6 H;  1LJ2 A;  1T6A A;  1MFZ A;  1ZR4 A;  2QVA A;  3B4S A;  2PP6 A;  5APW A;  1LWU C;  1DEE G;  2E76 B;  1P84 I;  2J58 A;  3A3Y B;  2PRR A;  2O1J A;  1NKZ B;  1IFM A;  2IZ1 A;  2YKP A;  1SQV D;  3H1L J;  3GF7 A;  5APU A;  5APY A;  1KC8 Q;  1LWU A;  3H6P A;  1HVV A;  4RJT A;  5AW5 B;  2BCC J;  3F5H A;  2AXT E;  1A02 J;  4XFJ A;  2RH0 A;  2QJP B;  5AW4 B;  3CWB D;  2B9B A;  1HBW A;  2KXP B;  3CXH E;  4EIJ A;  1RF1 C;  1J2J B;  1BDD A;  1HGV A;  1NTK G;  5E79 H;  5CBN A;  1U7M A;  2Y0D A;  4EDF A;  3M9H A;  3HD7 D;  1NTZ E;  1BE3 E;  3RBZ A;  3VMZ A;  1EDJ A;  2XDJ A;  3SWF A;  3KXD A;  3WU2 E;  1RF1 A;  1HUC A;  2WPS A;  4PD4 D;  1U7J A;  1SQV K;  4IFD K;  2K1A A;  1Q81 Q;  2KNC A;  2N9Y B;  2W83 C;  4I7Z C;  3SFD C;  1YBK A;  3WUV A;  2J59 M;  2P67 A;  4H0L B;  1EDI A;  1SQB J;  1LWU B;  1SQX G;  1AVY A;  2IBZ D;  5GTH E;  1JCD A;  1KIL D;  3AE5 C;  1VF5 C;  1FDO A;  2E43 A;  5KLV G;  3CX5 I;  1GZL A;  4UB6 E;  4N3Y B;  2ZT9 D;  4NPE A;  1G1J A;  1MFT A;  2ZYA A;  2AEJ A;  3TDK A;  3TGU E;  3L36 A;  4U3F E;  3P8M C;  1OW8 A;  1VQ9 P;  2YNY A;  5GTI E;  3R4Y A;  3KHU A;  2WSS H;  4L76 A;  5AVT B;  1NU1 D;  3L75 E;  2XNX A;  1LTJ C;  1SQX J;  1GD2 E;  4KT0 J;  3W67 A;  2KNC B;  3L72 G;  2SPZ A;  1JMM A;  1GK4 A;  2R3S A;  1RQU A;  3ITK A;  1M8O B;  3QH9 A;  1LTS C;  2Z5I A;  1LTA C;  3SWK A;  1EQ7 A;  2AEM A;  1LTJ A;  1DD3 A;  4JYC A;  2P2U A;  2XKM A;  5CCG D;  3CXH H;  1R5S A;  3VYI A;  2I8D A;  2FXP A;  1VPC A;  2QA4 P;  3H1I G;  4C7R A;  1VF5 B;  1BSH A;  3OJA B;  3L74 D;  1NU1 K;  1NTM G;  5AW0 B;  2JWA A;  3WU2 H;  3B8E B;  3ZDM A;  3H25 A;  3HE5 A;  2P7J A;  3VP9 A;  3HD7 C;  1NGM B;  3D6Y A;  3L70 D;  1EZV G;  1SS1 A;  3M06 A;  3H1J G;  3MHV A;  3TK1 A;  1KB9 H;  2AEF A;  4M3L A;  3U1C A;  1HGZ A;  5KLI C;  1Z56 A;  5AW1 B;  1ZP0 C;  1LTJ B;  3HD7 A;  4WB4 A;  1AA0 A;  2O01 N;  2NZ2 A;  2BEQ D;  2O01 H;  3H1I J;  2M0B A;  2KUB A;  1Q90 D;  3MD0 A;  1GL2 B;  1L4A D;  3SSU A;  1OIP A;  2KYV A;  1KIL C;  1L0L J;  1ZRT D;  1KQF B;  4R4L A;  1NTM J;  5GTI H;  3U1A A;  1AFO A;  3IFM A;  5AW9 B;  1SQQ K;  3CC4 P;  1YJ9 P;  3H1J J;  3PHL A;  4IFM A;  3RL0 D;  1FZA A;  2JR8 A;  1KFN A;  2K9Y A;  1KIL A;  1OVV A;  1M56 D;  1H88 A;  1Y8A A;  4OGQ D;  2Q3E A;  3AEG C;  4I2L C;  1OVR A;  5CCH D;  3M9Q A;  4KJM A;  4C7N A;  1S72 P;  5AVW B;  2OYO A;  4RO0 A;  1VQ6 P;  2ZVN B;  2XZR A;  1KZU B;  4WVZ A;  3HD7 B;  3H1H G;  4PV1 C;  1DH3 A;  2E5Y A;  3E1I A;  3NMD A;  3RK2 D;  3E7K A;  2IFN A;  3P7K A;  2Y0C A;  1IFI A;  5KLI B;  1VQ7 P;  5AW7 B;  5KKZ C;  3AE3 C;  3BCC D;  1QGK B;  4ASW A;  3HE4 A;  4LGD E;  3AEE C;  5CCG C;  2L91 A;  1VQK P;  1J1E B;  1KIL B;  1KB9 D;  2OTL P;  1ZME C;  1JB0 J;  2YMY A;  5AVV B;  1D7M A;  2ZT9 B;  1NTZ J;  3LW5 J;  2LR2 A;  1K73 Q;  3H1H J;  4C7N B;  3KYQ A;  1PGP A;  5CCG A;  4YXD C;  1BGY G;  1VQ4 P;  1NTK E;  3D71 A;  1W2E A;  3VTP C;  3RGU A;  2KSE A;  1IJD B;  2M3B A;  1NKN A;  2C0X A;  1MZ9 A;  3GLM A;  1JO5 A;  3BRT B;  3AEF C;  2GUS A;  2R5D A;  1PP9 D;  3PTZ A;  3M91 A;  2QJK C;  3HE4 B;  1NHL A;  1NO4 A;  2M5A A;  2A06 D;  2C0W A;  1PPJ G;  1L4A C;  2FYU J;  4H0L D;  3IN6 A;  1W2B O;  1KFM A;  1DX7 A;  1SQX E;  3N4X A;  2K3R A;  1KYO D;  2JO1 A;  1IK7 A;  2WQY C;  1FOS F;  4H13 C;  3L71 G;  1BGY J;  4U3F J;  5B66 E;  4B86 A;  3V2N A;  3RL0 C;  1JM0 A;  1RY3 A;  1L4A A;  2IZ0 A;  1K04 A;  4W80 A;  3CCJ P;  4XA4 A;  2B88 A;  2ITA A;  4OGQ C;  1WT6 A;  1PGQ A;  1JY2 O;  2WTY A;  2N1T D;  3AE9 C;  3CL3 D;  1GU4 A;  1NAF A;  3JSV C;  2BEZ F;  1JEK A;  4D6T D;  4KHX A;  4GT1 A;  3G9R A;  5DJT B;  1IZN B;  5K5G B;  2M5A B;  3L72 E;  5CCH A;  3JC2 2;  2E74 D;  4HB1 A;  1LTT C;  3A5T A;  1OW7 A;  3RK3 E;  1N8R Q;  2QJK B;  1SVF A;  3KDP B;  3MIW A;  3W68 A;  3L73 D;  1G1I A;  1USD A;  1SQP G;  2FXM A;  1YQ3 C;  1LT9 C;  3LID A;  3H1I E;  1M1J C;  3FX0 A;  2QJP C;  2ZYD A;  2R5B A;  2FXO A;  3TSI A;  3RL0 B;  2KLV A;  2R44 A;  4ZKU A;  1NTM E;  1MKM A;  1VQP P;  4N6J A;  1FDI A;  2PGD A;  2Y9Y A;  4OGQ B;  1OZH A;  2R32 A;  1LT9 A;  1LT1 A;  3VMY A;  1EZV E;  3H1J E;  1QL1 A;  2O1K A;  1M1J A;  3S9O A;  2IYP A;  1FU1 A;  1KB9 I;  1BSN A;  3RBX A;  1EXI A;  1KD1 Q;  4RES B;  3H1L D;  4N78 D;  4GOE A;  2ZXE B;  1BCC G;  2JJL A;  1SQP J;  4EOT A;  2BCC D;  2V7Q J;  3U59 A;  5B66 H;  4OH8 B;  3RK2 B;  4H0L C;  4GKG A;  5H2F E;  1GL2 D;  1NAY A;  1IFJ A;  2JEE A;  2W8Z A;  1UII A;  1HH0 A;  1LGH B;  1VQ5 P;  1AQ5 A;  1LTI C;  3Q5P A;  2WVR A;  2H43 A;  1SQV G;  1S4X A;  3EFF K;  2KOG A;  5CBO A;  4H44 D;  3RL0 g;  4Z1M H;  2OTJ P;  2W6A A;  1LT9 B;  2Z5H A;  1M1J B;  2B89 A;  2CK3 H;  5B5E E;  1KYO I;  1VL2 A;  3V2R A;  1W5C E;  2FYN B;  3CWB G;  1EC5 A;  1S5L H;  1SQB D;  2WSC J;  3P8C D;  5KAI H;  3CCQ P;  3H1H E;  2RMZ A;  1IK9 A;  4QMA A;  2E74 C;  2N1T A;  3V4Q A;  2XU6 A;  1JUN A;  2QRX A;  1NJI Q;  4BWN A;  1FAV A;  1YTZ T;  2GUV A;  4GDO A;  2E42 A;  2OQQ A;  4IOI H;  3BVH A;  1JY3 O;  4EI2 A;  1AV1 A;  3CPW O;  4WWI A;  2XND H;  3AEC C;  1X8Y A;  2CPS A;  2IBZ G;  3CWB J;  1NTK J;  1YIJ P;  1T2K D;  3T97 A;  2FYU E;  2GA1 A;  3VN0 A;  1SQB K;  3GHG B;  5APT A;  1Q7Y Q;  1PGJ A;  1BGY E;  3AE6 C;  3BAS A;  2Q5U A;  3H1K D;  2N1T B;  1P84 E;  5H2F H;  3A0B E;  1N73 A;  2G3A A;  1PGO A;  1H89 A;  2KB7 P;  1NU1 G;  2POH A;  3L35 A;  1E79 H;  5KAF E;  1GL2 C;  1RE3 C;  2E74 B;  5KLV J;  1PPJ E;  5AVQ B;  2I1K A;  1SQX K;  3T97 B;  3L71 E;  2AXT H;  1HJB A;  5B5E H;  1EDK A;  2OYH C;  1SLQ A;  4R4M A;  1GL2 A;  1RE3 A;  2WT7 A;  5AVY B;  2IX7 C;  1LP1 A;  3GF3 A;  3KQG A;  2QEX P;  3MTU E;  3O8Z A;  3Q2Y A;  2NRG A;  1CZQ A;  2A45 I;  3JCU E;  1PV3 A;  3LW5 H;  1GW4 A;  1URQ D;  2JDI H;  1S3J A;  2WPQ A;  2HYN A;  3IAO A;  2P58 A;  1ZXG A;  3UIA A;  1N73 B;  1SQQ D;  3L72 J;  2OYH A;  1L0N D;  1VDF A;  3L74 G;  3CCR P;  2WMM A;  1Y47 A;  3BRV B;  1L0L D;  2Z4E A;  2E5T A;  2RN0 A;  5AVS B;  3L70 G;  2DW3 A;  3PJS K;  2JWD A;  5GTH H;  1K05 A;  4PJ0 E;  4O9B A;  4BRY A;  3CX5 E;  3MUD C;  4I1L A;  1GDT A;  2YKO A;  4UB6 H;  2LKM A;  2WT7 B;  1J1E C;  1FS0 E;  3GG2 A;  1LP1 B;  5AVZ B;  4NPF X;  1SQP E;  3K5B A;  4DZO A;  2E75 D;  1FJP A;  1T2K C;  2NPS D;  3MUD A;  2ZT9 C;  2H89 C;  1L0N K;  4PD4 I;  2B87 B;  3ABV C;  3C8V A;  4ASV A;  1P84 H;  2OYH B;  1TU3 F;  1XTG B;  1KV4 A;  3A0B H;  2MKV A;  3L70 J;  4H44 B;  1S9K E;  1L0L K;  3SWY A;  2IDB A;  1NTM K;  4YTP C;  1VQN P;  3AE4 C;  2HG5 D;  1FZC C;  1GK6 A;  1PFI A;  2IBZ I;  3IR9 A;  1J1D B;  2K88 A;  2QE7 H;  1U57 A;  2H7H A;  1FZF A;  1RHZ B;  1FE6 A;  4BRY B;  1AQT A;  1BCC E;  2W6B A;  3CXH D;  1FZC A;  3F89 A;  3R2P A;  5AVU B;  2H8P D;  1NTZ D;  1HTL C;  4MN4 C;  1GU5 A;  1BE3 D;  2HPC A;  1N7L A;  1JY2 P;  3I5C A;  3A0H E;  3JCU H;  2FBW C;  1X79 B;  3BCC G;  2P10 A;  3FWN A;  2RKL A;  1SQV E;  3G4S P;  1VQ8 P;  3Q1M A;  4RKU J;  4LC1 A;  1URQ C;  2D2C D;  1FDM A;  4HKZ H;  4WY4 D;  1RF0 C;  1BDC A;  1DEB A;  3V5B A;  1OMI A;  3CCU P;  4ZMD A;  2FFD C;  2L5G B;  3CWB E;  2YXQ B;  2FYU D;  5APS A;  3EQ2 A;  3Q3D A;  4PJ0 H;  1JNM A;  1FZB A;  1M1K Q;  3CX5 H;  1FZC B;  3TGU D;  2WWW A;  1NTZ K;  1GMJ A;  1URQ A;  4U3F D;  1HWT C;  1FJK A;  2LXC B;  1RF0 A;  1T8Z A;  2HPC B;  2FFD A;  3O6Q A;  2V7Q H;  1PP9 G;  1QLE D;  1IC2 A;  4PD4 E;  1EDL A;  3L75 D;  3QWO C;  3OW2 O;  3I56 P;  4I6M C;  1UIX A;  2YKQ A;  4OVN F;  1M7L A;  2A06 G;  3SFE C;  2E75 C;  4ZNC A;  2NPS C;  1K9M Q;  1E5W A;  3CCV P;  2IBZ E;  3PH0 A;  1KIL E;  3V4W A;  5KLV E;  1IO4 A;  1JTH A;  5AW8 B;  2FYU K;  2ZJS E;  4LLH A;  2R3C A;  4GOF A;  1Y9B A;  1N7S D;  1T3J A;  2C9N Y;  2WSF J;  2NPS A;  2YIU C;  5CCH C;  2ZYG A;  3M9B A;  1URQ B;  5TIS E;  1DD4 A;  1YJN P;  1WMK A;  5M1B A;  1OW6 A;  1PP9 J;  1FBM A;  3HUS C;  1YI2 P;  1NH4 A;  2FFD B;  2WSC H;  2O3J A;  4A7P A;  2WSE J;  5EFW B;  3I55 P;  3O6Q B;  4D6T G;  1NU1 E;  3A0H H;  1L2P A;  3MGN A;  3RK2 C;  3L71 J;  3HUS A;  2VRS A;  1QVG O;  4TLF A;  4UB8 E;  3TNU A;  2PAJ A;  1JTH B;  1DIP A;  2KI7 B;  3OAK A;  1PL5 A;  3CX5 D;  3CXH I;  3PRJ A;  1YHQ P;  1YYC A;  3L73 G;  2HLO A;  4JF7 A;  2E75 B;  2NPS B;  3E1R A;  1YIT P;  1S1C X;  4WY4 C;  4JYB A;  4W7Y A;  4BXL A;  3CMA P;  2KK7 A;  2FYN C;  3FGA D;  5C39 A;  1MV8 A;  3HRN A;  3L74 E;  2ZFC A;  3GW6 A;  2YIU B;  3BAT A;  4AQR D;  3L4F A;  3L70 E;  4WY4 A;  1KTM A;  1JY3 P;  2W27 A;  2QG4 A;  3HUS B;  4OWF A;  1RQV A;  2J5U A;  2AXC A;  1CSB A;  3B5N D;  3H1L G;  1WRG A;  5CHX A;  3TNU B;  2IFM A;  3L73 J;  1H0T A;  3G6E P;  2BCC G;  2A45 G;  3AEB C;  2MJZ A;  1JMB A;  1SFC D;  1SQP K;  1ZRT E;  2WZ7 A;  2KLU A;  1X0T A;  5TIS H;  1N86 A;  4L75 A;  3GHG C;  1IFD A;  1IFN A;  1OFC X;  1N7S C;  2QM8 A;  3TYY A;  2WPV B;  4NPD A;  2N1T C;  4L74 A;  2D2C B;  1BCC J;  2W6J H;  4WY4 B;  1HF9 A;  2QJY C;  3GHG A;  1CI6 A;  3VP8 A;  4JQ0 D;  1N7S A;  3D70 A;  4W7Z A;  4UB8 H;  1H0T B;  1SQB G;  3M0D C;  1JCC A;  1NTK D;  1ZV8 A;  3MP7 B;  4L73 A;  3OA7 A;  3AE7 C;  4YXW H;  3AE8 C;  1OX3 A;  1SQV J;  3M0A A;  2ZXX A;  2W90 A;  3M0D A;  1EXJ A;  1Q86 Q;  3BCC E;  1MUU A;  2YMK A;  2V4H A;  5APX A;  1ZOY C;  1KB9 E;  1SQX D;  1NVO A;  1K8A Q;  1NYH A;  1N73 C;  3Q5S A;  1CI6 B;  2M3E A;  1FZE A;  5AVX B;  1PIX A;  3FXD A;  1JOC A;  2LXB A;  2N9B A;  5KLV D;  3D6Z A;  1N7S B;  1NTK K;  1VQM P;  1KQL A;  4K3A A;  1KN7 A;  1R5L A;  1OXZ A;  2OAR A;  3PP5 A;  2XV5 A;  4XE5 B;  3H1K G;  1GTW A;  5L8R J;  2QJY B;  1ZN5 A;  3B5N C;  3C9I A;  3G71 P;  2KP8 A;  1SP4 A;  4DCK A;  2HR3 A;  1PP9 E;  2Q7C A;  1QEX A;  1RF1 B;  1T3U A;  3VOP A;  1AVO A;  1SFC C;  2A06 E;  5TJH A;  1IFP A;  2FY8 A;  3L72 D;  3B5N A;  3V2Q A;  2QSI A;  4DT0 A;  2KZJ A;  1KYO E;  4PV1 D;  1CW5 A;  2YO2 A;  3RK3 D;  5KLV K;  1JY2 N;  4H44 C;  2Q3I A;  3H1K J;  3C1L A;  1SFC A;  3LIE A;  3AE1 C;  4EYY Q;  4AYC A;  1J1D C;  2KS1 A;  4I7Z B;  1NU1 J;  2B87 A;  1RE4 C;  1LNQ A;  3H1I D;  1KQG B;  3CCL P;  3CLQ A;  5AW2 B;  1M90 Q;  1SQQ G;  2I1J A;  1L0N G;  2FYZ A;  3PLN A;  3FWL A;  1NTM D;  1QL2 A;  4D6T E;  2Y0E A;  1L0L G;  2BAS A;  1EZV D;  1RE4 A;  3NFQ A;  3H1J D;  4Y99 C;  3B5N B;  2KZI A;  3EFG A;  3S4R A;  4Y28 J;  5CJ4 A;  5BU5 A;  4YPC A;  2Y9Z A;  1M57 D;  1FOS E;  4ZKP A;  1GW3 A;  5DJU B;  1SFC B;  3L73 E;  3CC2 P;  3CD6 P;  5CMZ A;  1KOR A;  3L74 J;  2ZVO B;  1S2E A;  1SQQ J;  2KS1 B;  5KJ7 D;  3VMA A;  1L0N J;  3MZW B;  1QX8 A;  2WSF H;  4H13 D;  2JKV A;  1OVU A;  5KAF H;  2G8Y A;  2WSE H;  3CCS P;  3HE5 B;  3KZI E;  4IFF A;  3H1L E;  4IL6 X;  4N78 E;  1KYO H;  2KIK A;  3P32 A;  1FZG A;  3H32 A;  4JBZ A;  2BCC E;  1YTZ I;  1ZLL A;  3H1H D;  1NOH A;  1VQL P;  1NTZ G;  2YXR B;  4Y99 B;  1BE3 G;  1N2D C;  2P1J A;  3WMM 0;  2IYO A;  3V2P A;  2HFE D;  3RK3 C;  2QM7 A;  1R8E A;  2E76 D;  4HH2 A;  5KTB A;  2H88 C;  2YO3 A;  3B71 A;  3USS A;  3GMA A;  2Q6Q A;  4JPZ B;  3A2A A;  2WIT A;  2FYU G;  3WUU A;  1S5L X;  4CPG A;  3NXS A;  1AJY A;  1SQB E;  2CPB A;  2Q1K A;  4U7J A;  4GIF A;  3P8C E;  2OYI C;  1BE3 J;  1BGY D;  3H32 B;  3TGU G;  1Q2N A;  4U3F G;  4C46 A;  3BCC J;  3HTK A;  3Q5R A;  5AW3 B;  2QIW A;  1P84 D;  1JY3 N;  5APQ A;  1KMI Z;  1LTG C;  1YJW P;  2OYI A;  2ZAE B;  1G2C A;  5APV A;  2KSJ A;  3L75 G;  3V6I A;  1PPJ D;  3L37 A;  4PV1 B;  5KJ7 C;  1KQS O;  1EZV I;  1PZQ A;  1YQ4 C;  2O01 J;  4AUW A;  1HJ0 A;  3RK3 B;  2JP3 A;  1OWA A;  4IL6 E;  2K9J A;  3L71 D;  4DOJ A;  1VQO P;  1Q82 Q;  4HJG H;  3TGU J;  5KKZ B;  3KZI H;  3G3Z A;  3CCE P;  1H8A A;  5KJ7 A;  2M8R A;  4GOD A;  2IPP A;  3H1K E;  5BVZ A;  1X9V A;  4WBA A;  3N7N A;  3HTK B;  3AEA C;  3VMX A;  2A45 H;  3EWK A;  3L75 J;  1QVF O;  2OYI B;  3CCM P;  1G2C B;  2HOD A;  2PFX A;  5BU8 B;  5CJ0 A;  2OGU A;  3WUT A;  3AED C;  3CI9 A;  1A02 F;  3II6 A;  3IF4 A;  3NTN A;  1LTB C;  5AVR B;  2C9L Y;  2E76 C;  5E79 E;  2K9J B;  1S5L E;  2UWJ E;  3A7O A;  1ZW0 A;  5KAI E;  3AE2 C;  2GM4 A;  2D2C C;  1SQP D;  1L4A B;  4D6T J;  3TF5 A;  1FC2 C;  5AW6 B;  3KPE A;  4HYT B;  2WPR A;  1SQQ E;  4K35 A;  1VF5 D;  4H13 B;  1L0N E;  3S1K A;  2OTK E;  2K37 A;  4TT3 H;  4PD4 H;  1ZR2 A;  1S9K D;  1NWQ A; 
#chains in the Genus database with same CATH homology
 1N73 C;  1J1E C;  1XTC C;  2HOD B;  1CI6 B;  1JO5 A;  5AVZ B;  3BRT B;  1FZE A;  5AVX B;  2GUS A;  2R5D A;  1JOC A;  2N9B A;  4DZO A;  1N7S B;  1FJP A;  2FKW B;  1T2K C;  1NTK K;  1KQL A;  2NPS D;  3M91 A;  3HE4 B;  2Q9I A;  1NHL A;  3MUD A;  1NO4 A;  1OXZ A;  2OAR A;  3PP5 A;  1L0N K;  2XV5 A;  4XE5 B;  2C0W A;  1L4A C;  1GTW A;  2OYH B;  1XTG B;  1KFM A;  1DX7 A;  1S9K E;  3N4X A;  1L0L K;  1ZN5 A;  3B5N C;  3C9I A;  3SWY A;  1NTM K;  1FOS F;  1MFZ A;  2KP8 A;  1SP4 A;  2HG5 D;  1ZR4 A;  1FZC C;  1GK6 A;  1PFI A;  2Q7C A;  3IR9 A;  2PP6 A;  4B86 A;  1J1D B;  3V2N A;  3RL0 C;  5APW A;  1LWU C;  1RY3 A;  1RF1 B;  1L4A A;  2H7H A;  1T3U A;  4W80 A;  1FZF A;  3VOP A;  4XA4 A;  2J58 A;  3A3Y B;  1SFC C;  2O1J A;  3B5N A;  3V2Q A;  2W6B A;  1WT6 A;  1JY2 O;  1NKZ B;  2WTY A;  1IFM A;  2YKP A;  2N1T D;  1FZC A;  5APU A;  1CW5 A;  3CL3 D;  5APY A;  3R2P A;  2YO2 A;  5AVU B;  3RK3 D;  5KLV K;  1GU4 A;  2H8P D;  1NAF A;  1HTL C;  1JY2 N;  2Q3I A;  1GU5 A;  1LWU A;  3H6P A;  1HVV A;  2HPC A;  1N7L A;  5AW5 B;  4KHX A;  1SFC A;  4GT1 A;  3LIE A;  1JY2 P;  3I5C A;  1A02 J;  1X79 B;  4AYC A;  5AW4 B;  5CCH A;  1J1D C;  1HBW A;  4EIJ A;  1RF1 C;  1J2J B;  1RE4 C;  1HGV A;  3A5T A;  1LTT C;  3CLQ A;  5AW2 B;  4LC1 A;  2I1J A;  3M9H A;  3HD7 D;  2FYZ A;  3VMZ A;  2XDJ A;  1URQ C;  3SWF A;  1SVF A;  1FDM A;  1QL2 A;  3KDP B;  3MIW A;  4WY4 D;  1RF0 C;  2BAS A;  1DEB A;  3V5B A;  1G1I A;  2FFD C;  1RF1 A;  2L5G B;  1HUC A;  2WPS A;  1RE4 A;  2FXM A;  3NFQ A;  5APS A;  4Y99 C;  1LT9 C;  3B5N B;  3LID A;  3EQ2 A;  1SQV K;  3EFG A;  4IFD K;  1JNM A;  1FZB A;  1M1J C;  5CJ4 A;  1FZC B;  5BU5 A;  2WWW A;  1NTZ K;  1URQ A;  2R5B A;  1HWT C;  1FJK A;  3TSI A;  2J59 M;  2P67 A;  1RF0 A;  3RL0 B;  1LWU B;  1T8Z A;  2KLV A;  4ZKU A;  1FOS E;  4ZKP A;  1GW3 A;  2HPC B;  4N6J A;  1JCD A;  1KIL D;  2FFD A;  1SFC B;  2R32 A;  1LT9 A;  2E43 A;  5CMZ A;  1IC2 A;  3VMY A;  1GZL A;  1QL1 A;  2O1K A;  1M1J A;  4N3Y B;  5KJ7 D;  1G1J A;  1FU1 A;  4RES B;  4I6M C;  2YKQ A;  1M7L A;  3L36 A;  4N78 D;  3P8M C;  2ZXE B;  2JJL A;  2YNY A;  2WSF H;  2NPS C;  1E5W A;  4EOT A;  3U59 A;  3V4W A;  1IO4 A;  4OH8 B;  1JTH A;  5AW8 B;  3RK2 B;  2FYU K;  4GKG A;  1GL2 D;  1IFJ A;  2WSE H;  2JEE A;  3HE5 B;  5AVT B;  4LLH A;  2R3C A;  2XNX A;  1N7S D;  1T3J A;  1LTJ C;  1GD2 E;  4IFF A;  1HH0 A;  1LGH B;  4N78 E;  2C9N Y;  2NPS A;  5CCH C;  3M9B A;  1URQ B;  1AQ5 A;  1LTI C;  1JMM A;  1GK4 A;  1FBM A;  3HUS C;  3P32 A;  1FZG A;  2H43 A;  3H32 A;  1NH4 A;  2KOG A;  1YTZ I;  2FFD B;  1ZLL A;  2WSC H;  1NOH A;  2W6A A;  1LTS C;  4Y99 B;  1LT9 B;  2Z5I A;  1LTA C;  1N2D C;  1EQ7 A;  2Z5H A;  1LTJ A;  1M1J B;  2P1J A;  3WMM 0;  3MGN A;  3RK2 C;  4JYC A;  3V2P A;  2HFE D;  3RK3 C;  2P2U A;  2XKM A;  5CCG D;  3V2R A;  2QM7 A;  3VYI A;  3HUS A;  4HH2 A;  2VRS A;  5KTB A;  1VPC A;  3P8C D;  4C7R A;  1IK9 A;  3TNU A;  2YO3 A;  2PAJ A;  1JTH B;  3OJA B;  2N1T A;  1NU1 K;  3V4Q A;  3OAK A;  5AW0 B;  2XU6 A;  1JUN A;  3B8E B;  1YYC A;  3HE5 A;  2HLO A;  4JF7 A;  2P7J A;  3VP9 A;  3HD7 C;  3A2A A;  2WIT A;  1FAV A;  2NPS B;  3M06 A;  3NXS A;  1YTZ T;  3TK1 A;  2GUV A;  2CPB A;  4WY4 C;  2E42 A;  4GIF A;  3P8C E;  2OYI C;  4JYB A;  4W7Y A;  4M3L A;  3H32 B;  3BVH A;  3U1C A;  1HGZ A;  1JY3 O;  1Z56 A;  5AW1 B;  1MV8 A;  4C46 A;  3HRN A;  2ZFC A;  1X8Y A;  3HTK A;  2CPS A;  5AW3 B;  1LTJ B;  1JY3 N;  3HD7 A;  1T2K D;  3T97 A;  5APQ A;  4WB4 A;  3BAT A;  2O01 H;  4AQR D;  3L4F A;  1LTG C;  4WY4 A;  3MD0 A;  1GL2 B;  1JY3 P;  2W27 A;  1L4A D;  2OYI A;  3VN0 A;  1SQB K;  3GHG B;  3HUS B;  5APT A;  1G2C A;  2KYV A;  2KSJ A;  5APV A;  1KIL C;  1CSB A;  3BAS A;  3B5N D;  1WRG A;  2Q5U A;  5CHX A;  3TNU B;  2IFM A;  3U1A A;  3L37 A;  3IFM A;  1AFO A;  5AW9 B;  5KJ7 C;  2N1T B;  1SQQ K;  4AUW A;  3RK3 B;  4IFM A;  3RL0 D;  1OWA A;  1FZA A;  1N73 A;  4DOJ A;  2A45 G;  2MJZ A;  1KFN A;  1KIL A;  1SFC D;  1H88 A;  1H89 A;  2KB7 P;  1SQP K;  2POH A;  4I2L C;  3L35 A;  3G3Z A;  5CCH D;  2WZ7 A;  1H8A A;  3M9Q A;  5KJ7 A;  1GL2 C;  1N86 A;  1RE3 C;  2M8R A;  3GHG C;  2IPP A;  4C7N A;  5AVW B;  1IFD A;  5AVQ B;  5BVZ A;  1IFN A;  2I1K A;  1X9V A;  4WBA A;  3N7N A;  3HTK B;  2XZR A;  3VMX A;  1N7S C;  2QM8 A;  3TYY A;  1KZU B;  2A45 H;  1SQX K;  3HD7 B;  2N1T C;  1DH3 A;  1HJB A;  3E1I A;  4WY4 B;  3NMD A;  3RK2 D;  2OYI B;  2OYH C;  2IFN A;  1SLQ A;  1G2C B;  2WT7 A;  1GL2 A;  1RE3 A;  3P7K A;  5AVY B;  2HOD A;  3GHG A;  1IFI A;  2IX7 C;  1CI6 A;  3KQG A;  3MTU E;  5BU8 B;  3O8Z A;  5CJ0 A;  3VP8 A;  5AW7 B;  3CI9 A;  1N7S A;  1CZQ A;  2A45 I;  1A02 F;  4W7Z A;  3LW5 H;  1GW4 A;  3M0D C;  3II6 A;  1URQ D;  3HE4 A;  3NTN A;  1JCC A;  2WPQ A;  1LTB C;  1ZV8 A;  2HYN A;  4LGD E;  5AVR B;  5CCG C;  2C9L Y;  3UIA A;  1N73 B;  3OA7 A;  1J1E B;  2OYH A;  1VDF A;  1KIL B;  3A7O A;  3BRV B;  2GM4 A;  2YMY A;  5AVV B;  3M0A A;  2Z4E A;  5AVS B;  3M0D A;  4C7N B;  3KYQ A;  1L4A B;  5CCG A;  1MUU A;  5AW6 B;  3KPE A;  1W2E A;  4O9B A;  3VTP C;  4HYT B;  2WPR A;  1IJD B;  4I1L A;  5APX A;  1GDT A;  2M3B A;  2YKO A;  1S9K D;  1NKN A;  1ZR2 A;  2C0X A;  1MZ9 A;  2LKM A;  1NWQ A;  2WT7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...