1KYOH

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
93
structure length
93
Chain Sequence
GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 13
structure length 93
sequence length 93
chains with identical sequence S
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1kyoH00
3L75G 1PPJG 1BE3G 1SQPG 1SQVG 4PD4H 1NTKG 1P84H 3H1IG 1L0LG 3H1KG 5KLVG 3BCCG 3H1HG 3H1JG 1BCCG 2A06G 1KYOH 1NTMG 2FYUG 3H1LG 3CX5H 4U3FG 3TGUG 2IBZG 4D6TG 1NTZG 1EZVG 1BGYG 1L0NG 3CXHH 3L72G 2BCCG 3L70G 3CWBG 1KB9H 1PP9G 3L74G 1SQXG 3L71G 1NU1G 1SQBG 3L73G 1SQQG
chains in the Genus database with same CATH superfamily
1SP4A 1PPJG 1BE3G 1JMMA 3L75G 3SWKA 4DOJA 4BXLA 3CD6P 1J1EC 4NPFX 2LR2A 2Q5UA 5TJHA 2AXTE 3H1IG 2WPRA 1MKMA 4HH2A 3B71A 1MZ9A 1ZRTE 2XU6A 1BCCG 1SS1A 2FYNB 1L0LE 1BCCE 2N1TA 3KZIE 1J1EB 1G1JA 2V7QH 2W6JH 3JSVC 2RN0A 2QJYC 4BRYB 5GTIE 2FKWB 4EI2A 1KTMA 1BDDA 3O6QB 4AUWA 2IDBA 1NTZG 2QM7A 1QGKB 3L35A 1CI6B 2PP6A 5KJ7A 3RK3E 1S5LH 5AVTB 2GM4A 1HJBA 1VF5C 2H43A 5E79H 1VQ4P 1RE4A 5APYA 4WY4A 2XNDH 1E5WA 2JWDA 2QA4P 2Q1KA 3L70J 2A45H 3L71D 2XZRA 3KHUA 3P8CD 5DJUB 3SSUA 1VQNP 2BEZF 2N9BA 2XKMA 2IZ0A 2B89A 1KILA 1LTSC 1RF0A 2R3SA 4WBAA 2IYOA 2OQQA 3VYIA 3WU2E 4D6TJ 1Q2NA 3Q5SA 3CCEP 2PRRA 1LT1A 3H1LJ 1N7LA 3UIAA 3TF5A 1X9VA 1RHZB 4Y99C 1S9KD 1FDOA 3AEEC 3H1JE 5DJTB 4AYCA 1BSHA 2AXCA 1J1DC 1PP9D 1ZLLA 1L0ND 1NTMG 2QE7H 1LGHB 2OGUA 3P8MC 3TGUE 1NKZB 3KZIH 5L8RJ 3RL0D 2FYUE 3N4XA 5KLIB 4IOIH 3O8ZA 3CC7P 1YTZI 2G8YA 3GF7A 4R4LA 1VQ8P 1AQTA 1GK4A 1A02F 2P2UA 3I5CA 1KV4A 4M3LA 2G3AA 3CXHE 1S5LE 1S9KE 1M7LA 1LT9A 3USSA 1VQ7P 1SQBE 1N86A 1KMIZ 2CK3H 1GW4A 2DW3A 1RH5B 1S2EA 1URQB 1RQUA 2CPSA 2KNCB 2KUBA 3F89A 4GDOA 4PD4D 1NWQA 2PFXA 2Q7CA 1YHQP 1OW6A 5KLVK 3TGUD 3LIEA 4GIFA 1JY3P 4RJTA 1NTKD 3A0HE 3H1IE 1AV1A 3SWFA 3WU2H 1URQA 3V2QA 1FOSE 2NPSA 1Q82Q 1DD3A 4PD4I 1FZCB 3BCCE 1GDTA 3JCUH 4B86A 2E75D 4Y28J 3G6EP 3RK3C 2L5GB 1CSBA 4IFMA 5CBNA 1OMIA 1RY3A 2C0WA 3CMEP 1GW3A 2M0BA 3GW6A 1BGYG 2I1JA 3MZWB 3OAKA 5AW7B 3CCQP 5H2FE 2FYUD 4ZNCA 5CBOA 2HR3A 3RK3B 4L76A 3L74G 2Q3EA 2C0XA 3L74J 3CWBJ 2P1JA 2W6AA 2WSEJ 1NU1G 4OGQD 4PD4E 5CJ4A 1N73B 3N7NA 1GZLA 4ASVA 1SQVG 4PJ0H 3RGUA 2IX7C 2ITAA 1NTMK 5CHXA 1N7SC 1LTGC 1IFIA 2O01N 1NTME 4H44C 4KT0J 5KLVE 2OYHB 1LTJB 1ZV8A 1Y9BA 2FXOA 2QJPC 3RL0B 3A0HH 3FXEA 3H1JG 3A0BH 4N78D 1VQPP 3CXHI 3AEAC 1RE4C 2A06D 2J59M 2ZT9B 3GF3A 3L37A 4WY4C 3EQ2A 3WUUA 1ZR4A 3ZDMA 3HTKA 3LW5J 4GOFA 1T8ZA 3BRVB 2R5BA 3F5HA 3MIWA 3E7KA 2KI7B 4GT1A 1GL2D 1QL1A 1QVFO 3Q3DA 2OYIC 2FXMA 1KD1Q 1YJWP 2KS1A 1U7JA 2J5UA 3HUSA 3BASA 1FZFA 4C7RA 1N73A 1M1JA 1QLED 2FFDA 3MGNA 4H13B 1VPCA 1ZOYC 1L0LK 5AW1B 1LNQA 3GLMA 3HE5A 1YBKA 5AW8B 5AW9B 3TNUA 4PD4H 5AVWB 1D7MA 3BATA 3E1RA 2YNYA 1SQPE 3B5NC 1EDIA 1GL2B 2AEMA 3A7OA 5APSA 2QSIA 3CPWO 1PIXA 1NU1E 1OX3A 1L0LG 1R5SA 1SFCB 1LTBC 2AEFA 1J1DB 2B88A 3T97A 1VQMP 2Y0DA 1VL2A 3V2PA 1NH4A 1VDFA 2KLVA 2O1JA 3HTKB 1DH3A 5TISE 5CCHC 4L75A 1L4AA 1EZVI 2BEQD 2YMKA 1KORA 5KLVJ 1LP1B 5AVSB 3VP9A 1KILD 2E74C 3VP8A 3PLNA 1ZW0A 4L74A 2IZ1A 1NTMD 2O3JA 1L0NG 1KB9E 1H88A 3MHVA 3G9RA 3TNUB 2Q3IA 1SQBK 2E43A 2N9YB 1OVVA 3CX5D 3KQGA 1XTGB 1KFNA 1DEEG 3S9OA 5APQA 1HH0A 1PGPA 2OYOA 1CW5A 3T97B 3BCCD 1RF1A 2XV5A 1S4XA 3U1AA 5AVUB 3Q5PA 4DZOA 2Z4EA 3H1KG 1IZNB 2IBZE 2KNCA 2GUSA 3HD7C 5KKZB 2JKVA 2W83C 2YXRB 1IFPA 1N8RQ 1BCCJ 3AEDC 1LTIC 2WSFH 2CPBA 4H0LC 4EIJA 1BSNA 3CX5E 4IL6H 1R8EA 4C7NA 3RL0g 1RE3A 4JYCA 3Q2YA 3H1IJ 1LWUC 2H89C 3A5TA 3M91A 5APVA 1L0LD 5KKZC 3L73D 2QVAA 2YO3A 1DIPA 1PGOA 1S1CX 2GUVA 3AE9C 4N6JA 1ZMEC 1SQBJ 3KXDA 2ZYAA 3NFQA 1OZHA 4I7ZC 4WVZA 1KB9H 1CZQA 1JY2P 1SQXG 2IFNA 2HPCB 2E76D 1IFMA 2FYZA 1FC2C 3S1KA 1NO4A 2BCCJ 2E76C 2W90A 3M06A 2H7HA 1PP9E 3L73G 1SQXE 3IF4A 3PTZA 1KQGB 4JF7A 3LIDA 1EXIA 3IR9A 4IFDK 4N3YB 2M3EA 3M0DC 1P84H 2Y9YA 1S3JA 2E5YA 3TGUJ 1ZXGA 1JCCA 1G2CA 2POHA 4RESB 3VOPA 2OYIA 3RK2B 3V4WA 1FZAA 1USDA 1H89A 3GHGC 1KYOE 3L74D 3G3ZA 3TDKA 5BU8B 1T2KC 1N73C 2VRSA 2W6BA 1ZR2A 3H1KD 2PGDA 3BRTB 4H44D 5AW5B 4DJGA 3S4RA 2OYIB 4EOTA 3H1JD 1L2PA 3C8VA 4HJGH 1PFIA 3CC2P 3RL0C 2ZYDA 1YYCA 1X8YA 3RK2C 3H32A 2JDIH 3BVHA 1SQPJ 2O01J 1MFTA 1PL5A 1LP1A 1NU1K 3CI9A 4YXDC 1FJKA 3B5ND 1FZEA 1AFOA 3JC22 2I1KA 1IC2A 3M0AA 1QX8A 1BGYE 2WSCH 5B5EH 5CCHA 1GL2C 1KYOI 1E79H 1SQXD 2HG5D 3CCLP 2KS1B 1SVFA 1SQQG 2HYNA 1KILE 1G2CB 1Q90D 3H1HD 1ZRTD 2LXCB 5AW3B 3LW5H 5AW6B 2QEXP 3VN0A 1FZGA 2JJLA 1CI6A 1OVRA 3G4SP 3SWYA 4U3FJ 3PJSK 3BCCG 2V4HA 3HE4B 3HE5B 1KZUB 1KILC 1PGQA 2E74D 1H0TA 1SQVE 1OVUA 3AE4C 3L70D 3L72E 2WSSH 5GTHE 1SFCA 5KLIC 3HRNA 5CJ0A 1EZVE 1NGMB 3IN6A 3JCUE 3HE4A 5APXA 2E42A 2B87A 2R32A 2NZ2A 3CX5I 4UB6E 1KN7A 1KILB 1YIJP 4C7NB 2P10A 3MD0A 4NPDA 1HTLC 1N7SD 4OVNF 4OWFA 1KC8Q 2YKPA 2OTKE 4N78E 2BASA 3CMAP 2C9NY 2LKMA 2YMYA 1JUNA 1JO5A 1BDCA 1GK6A 5B5EE 3P7KA 3Q1MA 2WVRA 2JP3A 2P67A 4KJMA 4QMAA 1LWUA 4PJ0E 3TYYA 1KQSO 2KZIA 2QM8A 3R4YA 3V5BA 1OW7A 3AE7C 3II6A 4HB1A 1SQQD 3H1HG 2FXPA 1NAYA 1GD2E 5BVZA 1FAVA 1LT9B 1K73Q 4TT3H 1VQKP 1OIPA 3A0BE 1M56D 1URQC 4RKUJ 4RO0A 2NPSC 2E75C 2P58A 4OH8B 5GTHH 2K9JA 2MKVA 3AE2C 1NTZD 3M9QA 1BE3D 2QIWA 3E1IA 3PHLA 4W80A 1S5LX 1VQ5P 1SQQJ 3M0DA 1FZCA 2A45G 2O1KA 2Y0EA 4JPZB 5K5GB 2NPSB 1EDLA 2BCCD 3RBZA 3GHGA 4OGQC 3L71G 1QL2A 2J58A 1L4AD 1FE6A 1M57D 1PGJA 2N1TD 2WSEH 5BU5A 1IFJA 1NHLA 3K5BA 4K35A 1EZVD 3W67A 2K88A 1PV3A 1WRGA 2OTJP 4PV1B 2O01H 5AW0B 2FBWC 1FOSF 5AVYB 4OGQB 4TLFA 3HD7B 3CCVP 1N7SA 2YIUC 4JYBA 2H88C 1YTZT 3CLQA 1EXJA 1AVOA 1MFZA 1T3JA 2A06G 1OW8A 3AE3C 1T2KD 5TISH 1H8AA 1N2DC 4LC1A 3D70A 2FYUG 3FWLA 1HBWA 3TGUG 5KAIH 1BGYD 2OYHA 2JEEA 2RH0A 2W27A 2KOGA 2YXQB 3PP5A 3V2RA 4PV1D 2QJPB 4ZKPA 3CCMP 2IFMA 3B8EB 2B87B 1GU5A 4H13C 3L73J 2NPSD 1SQVD 3AEGC 4AQRD 2B9BA 4I7ZB 1OFCX 2WMMA 4LLHA 1NU1D 4WY4B 1AQ5A 2N1TB 4BRYA 3G71P 1SQBG 1NYHA 2FYNC 2XNXA 3HUSC 3L72J 2K3RA 1M1JC 1EQ7A 2FFDC 4JQ0D 1YJ9P 1NTKG 1Z56A 2WSFJ 3O6QA 3QH9A 3VMAA 2M5AA 3EFGA 3L4FA 4HYTB 4MN4C 5APWA 4GKGA 3L71E 1NJIQ 1IO4A 1VF5B 2N1TC 3RBXA 1VQ9P 3MTUE 3B5NA 1P84D 2FY8A 2Y9ZA 1FJPA 2K37A 1JEKA 1M1JB 2QG4A 3IFMA 3L72D 3VMZA 2R44A 3ITKA 1YQ4C 3TSIA 3CX5H 3H1KJ 4IL6E 5AVQB 1JY2N 3V4QA 2OTLP 2HFED 1SQPK 1P84I 5KAIE 3SFDC 4YPCA 2WT7A 2C9LY 1QEXA 4ASWA 3GG2A 5CCGC 5KTBA 1FBMA 1PP9G 3L73E 4GODA 3NXSA 2I8DA 1PP9J 2ZVNB 4UB8E 4Y99B 1OWAA 5CCGD 2WPSA 3AECC 5KAFH 4GOEA 2ZXXA 1LTAC 1L0NJ 3GMAA 1YI2P 1VQLP 2WPVB 4BWNA 1JM0A 2YO2A 2ZAEB 2AXTH 3L75E 3CCJP 1PZQA 3MUDC 3H25A 3D71A 5KLVG 2WTYA 4LGDE 5APUA 3MP7B 3I56P 1P84E 1RF1C 4U3FD 1T6AA 3TK1A 1SQQE 2ZVOB 4H0LD 4W7ZA 5GTIH 4HKZH 2V7QJ 1L4AB 1SQQK 1KYOH 2JWAA 5CCHD 1NTKE 2KSJA 1TU3F 3AEBC 3H1ID 3HD7A 1SLQA 3KPEA 1KYOD 1L0LJ 3L74E 3OJAB 3V6IA 2E74B 2IBZG 2ZYGA 3L70E 1NTKJ 2E75B 2ZFCA 4I6MC 4C46A 2K9YA 1ZP0C 2QRXA 1RF1B 2WSCJ 3PRJA 1DD4A 2MJZA 2D2CB 1GMJA 3B4SA 3L72G 5E79E 3CXHD 1YJNP 2QJKC 2Z5IA 1BCCD 1G1IA 1Y47A 3I55P 1HVVA 1YITP 1FS0E 3EFFK 3P32A 1HGZA 1IK9A 1XTCC 2D2CD 5KAFE 3W68A 1NVOA 2D2CC 1LWUB 2GA1A 1KQFB 1IFDA 1T3UA 2M3BA 4H44B 2OYHC 1HGVA 4EDFA 1QVGO 2FYUJ 3Q5RA 4XE5B 4DT0A 2KB7P 3AE6C 3NTNA 2P7JA 4WY4D 1M1KQ 4H0LB 3H1JJ 2A45I 1KFMA 1WT6A 3KDPB 1NTKK 1N7SB 1SQXK 2WWWA 3H1LE 3OA7A 4WWIA 3RK2D 3V2NA 1LTTC 5AVZB 1K05A 1LTJA 2NRGA 3EWKA 4UB6H 1RQVA 1M8OB 1SQVJ 4EYYQ 1J2JB 3CXHH 1UIXA 2W8ZA 1GTWA 3CWBE 1EDJA 1NU1J 1PPJD 1BE3E 3CWBG 3WUTA 3L71J 2L91A 2FFDB 2R3CA 3M9BA 4K3AA 1JNMA 1HF9A 1SFCD 2E76B 2HODB 1U57A 2KIKA 2LXBA 2ZT9C 3HD7D 3AE5C 4I2LC 2E5TA 5AVRB 1AJYA 1BGYJ 1OXZA 2IBZD 2WITA 1MUUA 3D6YA 3WUVA 3M9HA 1GL2A 2QJYB 3H1KE 2OARA 1M90Q 2Z5HA 1JY2O 3H1HE 3HUSB 3VMYA 1X79B 1W5CE 2SPZA 1NOHA 2ZXEB 5CCGA 4H13D 1DEBA 1YQ3C 5AW4B 4L73A 3H1HJ 2JR8A 3IAOA 1VF5D 3CL3D 3KYQA 5M1BA 4ZKUA 3A2AA 4A7PA 3B5NB 4WB4A 1HWTC 1DX7A 3NMDA 1SFCC 5H2FH 3CCSP 3C1LA 1R5LA 1JB0J 3MUDA 4D6TD 4O9BA 1K9MQ 1JTHB 2A06E 2KZJA 2HODA 3H1LD 1SQPD 1UIIA 4JBZA 2PAJA 3ABVC 3OW2O 1USEA 2KXPB 3FX0A 2UWJE 3VTPC 1SQVK 3R2PA 2ZT9D 5CMZA 3FGAD 5KLVD 2WT7B 1Q7YQ 1KQLA 1IK7A 1NKNA 1HUCA 2JO1A 2KSEA 2Q6QA 2M8RA 1JCDA 5KJ7C 2M5AB 3AE1C 1NTZK 5B66H 2RKLA 5EFWB 1L4AC 1NTMJ 4Z1MH 1L0NK 1H0TB 1PPJE 1WMKA 1IJDB 1FZBA 1L0NE 1MV8A 1AA0A 1X0TA 2XDJA 5AVVB 2WPQA 1U7MA 2YKQA 3P8CE 3BCCJ 3H1LG 1RF0C 2IYPA 3FWNA 2BCCE 4U3FG 5AW2B 3VMXA 1EC5A 3L36A 2WZ7A 1JOCA 5C39A 4D6TG 2K1AA 1GU4A 2FYUK 3CCRP 3AE8C 1JY3O 3PH0A 3AEFC 1A02J 1URQD 1K8AQ 2KK7A 3L70G 5AVXB 3CWBD 1Q86Q 4KHXA 2KYVA 1AVYA 2AEJA 2R5DA 1JY3N 3QWOC 2WQYC 1FZCC 2H8PD 4W7YA 4IL6X 3U59A 1VQ6P 3U1CA 4I1LA 1SQPG 1FU1A 4U7JA 4YTPC 4CPGA 1FDMA 2K9JB 1IFNA 2YIUB 1NTZJ 1W2EA 1NAFA 1W2BO 1JMBA 1LTJC 2QJKB 5KJ7D 1SQBD 1KB9I 4IFFA 3L75D 4XFJA 1K04A 1NTZE 1HJ0A 1X22A 1RE3C 2HLOA 1LT9C 2YKOA 3GHGB 5B66E 2HPCA 3A3YB 3C9IA 3CCUP 1Q81Q 4YXWH 2ZJSE 4XA4A 1LJ2A 1FDIA 3H6PA 2RMZA 1ZN5A 1KB9D 4NPEA 4ZMDA 1EZVG 1EDKA 3H32B 2Q9IA 1BE3J 2KLUA 3L75J 4PV1C 2IBZI 4D6TE 1S72P 2BCCG 3RK3D 3WMM0 4DCKA 2IPPA 2KP8A 3FXDA 4U3FE 1SQXJ 2Y0CA 3SFEC 1JTHA 4R4MA 3D6ZA 4UB8H 5APTA 1VQOP 1Y8AA 3CC4P
chains in the Genus database with same CATH topology
3L75G 1PPJG 1BE3G 1SQPG 1SQVG 4PD4H 1NTKG 1P84H 3H1IG 1L0LG 3H1KG 5KLVG 3BCCG 3H1HG 3H1JG 1BCCG 2A06G 1KYOH 1NTMG 2FYUG 3H1LG 3CX5H 4U3FG 3TGUG 2IBZG 4D6TG 1NTZG 1EZVG 1BGYG 1L0NG 3CXHH 3L72G 2BCCG 3L70G 3CWBG 1KB9H 1PP9G 3L74G 1SQXG 3L71G 1NU1G 1SQBG 3L73G 1SQQG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L75 G;  1PPJ G;  1BE3 G;  1SQP G;  1SQV G;  4PD4 H;  1NTK G;  1P84 H;  3H1I G;  1L0L G;  3H1K G;  5KLV G;  3BCC G;  3H1H G;  3H1J G;  1BCC G;  2A06 G;  1KYO H;  1NTM G;  2FYU G;  3H1L G;  3CX5 H;  4U3F G;  3TGU G;  2IBZ G;  4D6T G;  1NTZ G;  1EZV G;  1BGY G;  1L0N G;  3CXH H;  3L72 G;  2BCC G;  3L70 G;  3CWB G;  1KB9 H;  1PP9 G;  3L74 G;  1SQX G;  3L71 G;  1NU1 G;  1SQB G;  3L73 G;  1SQQ G; 
#chains in the Genus database with same CATH topology
 1SP4 A;  1PPJ G;  1BE3 G;  1JMM A;  3L75 G;  3SWK A;  4DOJ A;  4BXL A;  3CD6 P;  1J1E C;  4NPF X;  2LR2 A;  2Q5U A;  5TJH A;  2AXT E;  3H1I G;  2WPR A;  1MKM A;  4HH2 A;  3B71 A;  1MZ9 A;  1ZRT E;  2XU6 A;  1BCC G;  1SS1 A;  2FYN B;  1L0L E;  1BCC E;  2N1T A;  3KZI E;  1J1E B;  1G1J A;  2V7Q H;  2W6J H;  3JSV C;  2RN0 A;  2QJY C;  4BRY B;  5GTI E;  2FKW B;  4EI2 A;  1KTM A;  1BDD A;  3O6Q B;  4AUW A;  2IDB A;  1NTZ G;  2QM7 A;  1QGK B;  3L35 A;  1CI6 B;  2PP6 A;  5KJ7 A;  3RK3 E;  1S5L H;  5AVT B;  2GM4 A;  1HJB A;  1VF5 C;  2H43 A;  5E79 H;  1VQ4 P;  1RE4 A;  5APY A;  4WY4 A;  2XND H;  1E5W A;  2JWD A;  2QA4 P;  2Q1K A;  3L70 J;  2A45 H;  3L71 D;  2XZR A;  3KHU A;  3P8C D;  5DJU B;  3SSU A;  1VQN P;  2BEZ F;  2N9B A;  2XKM A;  2IZ0 A;  2B89 A;  1KIL A;  1LTS C;  1RF0 A;  2R3S A;  4WBA A;  2IYO A;  2OQQ A;  3VYI A;  3WU2 E;  4D6T J;  1Q2N A;  3Q5S A;  3CCE P;  2PRR A;  1LT1 A;  3H1L J;  1N7L A;  3UIA A;  3TF5 A;  1X9V A;  1RHZ B;  4Y99 C;  1S9K D;  1FDO A;  3AEE C;  3H1J E;  5DJT B;  4AYC A;  1BSH A;  2AXC A;  1J1D C;  1PP9 D;  1ZLL A;  1L0N D;  1NTM G;  2QE7 H;  1LGH B;  2OGU A;  3P8M C;  3TGU E;  1NKZ B;  3KZI H;  5L8R J;  3RL0 D;  2FYU E;  3N4X A;  5KLI B;  4IOI H;  3O8Z A;  3CC7 P;  1YTZ I;  2G8Y A;  3GF7 A;  4R4L A;  1VQ8 P;  1AQT A;  1GK4 A;  1A02 F;  2P2U A;  3I5C A;  1KV4 A;  4M3L A;  2G3A A;  3CXH E;  1S5L E;  1S9K E;  1M7L A;  1LT9 A;  3USS A;  1VQ7 P;  1SQB E;  1N86 A;  1KMI Z;  2CK3 H;  1GW4 A;  2DW3 A;  1RH5 B;  1S2E A;  1URQ B;  1RQU A;  2CPS A;  2KNC B;  2KUB A;  3F89 A;  4GDO A;  4PD4 D;  1NWQ A;  2PFX A;  2Q7C A;  1YHQ P;  1OW6 A;  5KLV K;  3TGU D;  3LIE A;  4GIF A;  1JY3 P;  4RJT A;  1NTK D;  3A0H E;  3H1I E;  1AV1 A;  3SWF A;  3WU2 H;  1URQ A;  3V2Q A;  1FOS E;  2NPS A;  1Q82 Q;  1DD3 A;  4PD4 I;  1FZC B;  3BCC E;  1GDT A;  3JCU H;  4B86 A;  2E75 D;  4Y28 J;  3G6E P;  3RK3 C;  2L5G B;  1CSB A;  4IFM A;  5CBN A;  1OMI A;  1RY3 A;  2C0W A;  3CME P;  1GW3 A;  2M0B A;  3GW6 A;  1BGY G;  2I1J A;  3MZW B;  3OAK A;  5AW7 B;  3CCQ P;  5H2F E;  2FYU D;  4ZNC A;  5CBO A;  2HR3 A;  3RK3 B;  4L76 A;  3L74 G;  2Q3E A;  2C0X A;  3L74 J;  3CWB J;  2P1J A;  2W6A A;  2WSE J;  1NU1 G;  4OGQ D;  4PD4 E;  5CJ4 A;  1N73 B;  3N7N A;  1GZL A;  4ASV A;  1SQV G;  4PJ0 H;  3RGU A;  2IX7 C;  2ITA A;  1NTM K;  5CHX A;  1N7S C;  1LTG C;  1IFI A;  2O01 N;  1NTM E;  4H44 C;  4KT0 J;  5KLV E;  2OYH B;  1LTJ B;  1ZV8 A;  1Y9B A;  2FXO A;  2QJP C;  3RL0 B;  3A0H H;  3FXE A;  3H1J G;  3A0B H;  4N78 D;  1VQP P;  3CXH I;  3AEA C;  1RE4 C;  2A06 D;  2J59 M;  2ZT9 B;  3GF3 A;  3L37 A;  4WY4 C;  3EQ2 A;  3WUU A;  1ZR4 A;  3ZDM A;  3HTK A;  3LW5 J;  4GOF A;  1T8Z A;  3BRV B;  2R5B A;  3F5H A;  3MIW A;  3E7K A;  2KI7 B;  4GT1 A;  1GL2 D;  1QL1 A;  1QVF O;  3Q3D A;  2OYI C;  2FXM A;  1KD1 Q;  1YJW P;  2KS1 A;  1U7J A;  2J5U A;  3HUS A;  3BAS A;  1FZF A;  4C7R A;  1N73 A;  1M1J A;  1QLE D;  2FFD A;  3MGN A;  4H13 B;  1VPC A;  1ZOY C;  1L0L K;  5AW1 B;  1LNQ A;  3GLM A;  3HE5 A;  1YBK A;  5AW8 B;  5AW9 B;  3TNU A;  4PD4 H;  5AVW B;  1D7M A;  3BAT A;  3E1R A;  2YNY A;  1SQP E;  3B5N C;  1EDI A;  1GL2 B;  2AEM A;  3A7O A;  5APS A;  2QSI A;  3CPW O;  1PIX A;  1NU1 E;  1OX3 A;  1L0L G;  1R5S A;  1SFC B;  1LTB C;  2AEF A;  1J1D B;  2B88 A;  3T97 A;  1VQM P;  2Y0D A;  1VL2 A;  3V2P A;  1NH4 A;  1VDF A;  2KLV A;  2O1J A;  3HTK B;  1DH3 A;  5TIS E;  5CCH C;  4L75 A;  1L4A A;  1EZV I;  2BEQ D;  2YMK A;  1KOR A;  5KLV J;  1LP1 B;  5AVS B;  3VP9 A;  1KIL D;  2E74 C;  3VP8 A;  3PLN A;  1ZW0 A;  4L74 A;  2IZ1 A;  1NTM D;  2O3J A;  1L0N G;  1KB9 E;  1H88 A;  3MHV A;  3G9R A;  3TNU B;  2Q3I A;  1SQB K;  2E43 A;  2N9Y B;  1OVV A;  3CX5 D;  3KQG A;  1XTG B;  1KFN A;  1DEE G;  3S9O A;  5APQ A;  1HH0 A;  1PGP A;  2OYO A;  1CW5 A;  3T97 B;  3BCC D;  1RF1 A;  2XV5 A;  1S4X A;  3U1A A;  5AVU B;  3Q5P A;  4DZO A;  2Z4E A;  3H1K G;  1IZN B;  2IBZ E;  2KNC A;  2GUS A;  3HD7 C;  5KKZ B;  2JKV A;  2W83 C;  2YXR B;  1IFP A;  1N8R Q;  1BCC J;  3AED C;  1LTI C;  2WSF H;  2CPB A;  4H0L C;  4EIJ A;  1BSN A;  3CX5 E;  4IL6 H;  1R8E A;  4C7N A;  3RL0 g;  1RE3 A;  4JYC A;  3Q2Y A;  3H1I J;  1LWU C;  2H89 C;  3A5T A;  3M91 A;  5APV A;  1L0L D;  5KKZ C;  3L73 D;  2QVA A;  2YO3 A;  1DIP A;  1PGO A;  1S1C X;  2GUV A;  3AE9 C;  4N6J A;  1ZME C;  1SQB J;  3KXD A;  2ZYA A;  3NFQ A;  1OZH A;  4I7Z C;  4WVZ A;  1KB9 H;  1CZQ A;  1JY2 P;  1SQX G;  2IFN A;  2HPC B;  2E76 D;  1IFM A;  2FYZ A;  1FC2 C;  3S1K A;  1NO4 A;  2BCC J;  2E76 C;  2W90 A;  3M06 A;  2H7H A;  1PP9 E;  3L73 G;  1SQX E;  3IF4 A;  3PTZ A;  1KQG B;  4JF7 A;  3LID A;  1EXI A;  3IR9 A;  4IFD K;  4N3Y B;  2M3E A;  3M0D C;  1P84 H;  2Y9Y A;  1S3J A;  2E5Y A;  3TGU J;  1ZXG A;  1JCC A;  1G2C A;  2POH A;  4RES B;  3VOP A;  2OYI A;  3RK2 B;  3V4W A;  1FZA A;  1USD A;  1H89 A;  3GHG C;  1KYO E;  3L74 D;  3G3Z A;  3TDK A;  5BU8 B;  1T2K C;  1N73 C;  2VRS A;  2W6B A;  1ZR2 A;  3H1K D;  2PGD A;  3BRT B;  4H44 D;  5AW5 B;  4DJG A;  3S4R A;  2OYI B;  4EOT A;  3H1J D;  1L2P A;  3C8V A;  4HJG H;  1PFI A;  3CC2 P;  3RL0 C;  2ZYD A;  1YYC A;  1X8Y A;  3RK2 C;  3H32 A;  2JDI H;  3BVH A;  1SQP J;  2O01 J;  1MFT A;  1PL5 A;  1LP1 A;  1NU1 K;  3CI9 A;  4YXD C;  1FJK A;  3B5N D;  1FZE A;  1AFO A;  3JC2 2;  2I1K A;  1IC2 A;  3M0A A;  1QX8 A;  1BGY E;  2WSC H;  5B5E H;  5CCH A;  1GL2 C;  1KYO I;  1E79 H;  1SQX D;  2HG5 D;  3CCL P;  2KS1 B;  1SVF A;  1SQQ G;  2HYN A;  1KIL E;  1G2C B;  1Q90 D;  3H1H D;  1ZRT D;  2LXC B;  5AW3 B;  3LW5 H;  5AW6 B;  2QEX P;  3VN0 A;  1FZG A;  2JJL A;  1CI6 A;  1OVR A;  3G4S P;  3SWY A;  4U3F J;  3PJS K;  3BCC G;  2V4H A;  3HE4 B;  3HE5 B;  1KZU B;  1KIL C;  1PGQ A;  2E74 D;  1H0T A;  1SQV E;  1OVU A;  3AE4 C;  3L70 D;  3L72 E;  2WSS H;  5GTH E;  1SFC A;  5KLI C;  3HRN A;  5CJ0 A;  1EZV E;  1NGM B;  3IN6 A;  3JCU E;  3HE4 A;  5APX A;  2E42 A;  2B87 A;  2R32 A;  2NZ2 A;  3CX5 I;  4UB6 E;  1KN7 A;  1KIL B;  1YIJ P;  4C7N B;  2P10 A;  3MD0 A;  4NPD A;  1HTL C;  1N7S D;  4OVN F;  4OWF A;  1KC8 Q;  2YKP A;  2OTK E;  4N78 E;  2BAS A;  3CMA P;  2C9N Y;  2LKM A;  2YMY A;  1JUN A;  1JO5 A;  1BDC A;  1GK6 A;  5B5E E;  3P7K A;  3Q1M A;  2WVR A;  2JP3 A;  2P67 A;  4KJM A;  4QMA A;  1LWU A;  4PJ0 E;  3TYY A;  1KQS O;  2KZI A;  2QM8 A;  3R4Y A;  3V5B A;  1OW7 A;  3AE7 C;  3II6 A;  4HB1 A;  1SQQ D;  3H1H G;  2FXP A;  1NAY A;  1GD2 E;  5BVZ A;  1FAV A;  1LT9 B;  1K73 Q;  4TT3 H;  1VQK P;  1OIP A;  3A0B E;  1M56 D;  1URQ C;  4RKU J;  4RO0 A;  2NPS C;  2E75 C;  2P58 A;  4OH8 B;  5GTH H;  2K9J A;  2MKV A;  3AE2 C;  1NTZ D;  3M9Q A;  1BE3 D;  2QIW A;  3E1I A;  3PHL A;  4W80 A;  1S5L X;  1VQ5 P;  1SQQ J;  3M0D A;  1FZC A;  2A45 G;  2O1K A;  2Y0E A;  4JPZ B;  5K5G B;  2NPS B;  1EDL A;  2BCC D;  3RBZ A;  3GHG A;  4OGQ C;  3L71 G;  1QL2 A;  2J58 A;  1L4A D;  1FE6 A;  1M57 D;  1PGJ A;  2N1T D;  2WSE H;  5BU5 A;  1IFJ A;  1NHL A;  3K5B A;  4K35 A;  1EZV D;  3W67 A;  2K88 A;  1PV3 A;  1WRG A;  2OTJ P;  4PV1 B;  2O01 H;  5AW0 B;  2FBW C;  1FOS F;  5AVY B;  4OGQ B;  4TLF A;  3HD7 B;  3CCV P;  1N7S A;  2YIU C;  4JYB A;  2H88 C;  1YTZ T;  3CLQ A;  1EXJ A;  1AVO A;  1MFZ A;  1T3J A;  2A06 G;  1OW8 A;  3AE3 C;  1T2K D;  5TIS H;  1H8A A;  1N2D C;  4LC1 A;  3D70 A;  2FYU G;  3FWL A;  1HBW A;  3TGU G;  5KAI H;  1BGY D;  2OYH A;  2JEE A;  2RH0 A;  2W27 A;  2KOG A;  2YXQ B;  3PP5 A;  3V2R A;  4PV1 D;  2QJP B;  4ZKP A;  3CCM P;  2IFM A;  3B8E B;  2B87 B;  1GU5 A;  4H13 C;  3L73 J;  2NPS D;  1SQV D;  3AEG C;  4AQR D;  2B9B A;  4I7Z B;  1OFC X;  2WMM A;  4LLH A;  1NU1 D;  4WY4 B;  1AQ5 A;  2N1T B;  4BRY A;  3G71 P;  1SQB G;  1NYH A;  2FYN C;  2XNX A;  3HUS C;  3L72 J;  2K3R A;  1M1J C;  1EQ7 A;  2FFD C;  4JQ0 D;  1YJ9 P;  1NTK G;  1Z56 A;  2WSF J;  3O6Q A;  3QH9 A;  3VMA A;  2M5A A;  3EFG A;  3L4F A;  4HYT B;  4MN4 C;  5APW A;  4GKG A;  3L71 E;  1NJI Q;  1IO4 A;  1VF5 B;  2N1T C;  3RBX A;  1VQ9 P;  3MTU E;  3B5N A;  1P84 D;  2FY8 A;  2Y9Z A;  1FJP A;  2K37 A;  1JEK A;  1M1J B;  2QG4 A;  3IFM A;  3L72 D;  3VMZ A;  2R44 A;  3ITK A;  1YQ4 C;  3TSI A;  3CX5 H;  3H1K J;  4IL6 E;  5AVQ B;  1JY2 N;  3V4Q A;  2OTL P;  2HFE D;  1SQP K;  1P84 I;  5KAI E;  3SFD C;  4YPC A;  2WT7 A;  2C9L Y;  1QEX A;  4ASW A;  3GG2 A;  5CCG C;  5KTB A;  1FBM A;  1PP9 G;  3L73 E;  4GOD A;  3NXS A;  2I8D A;  1PP9 J;  2ZVN B;  4UB8 E;  4Y99 B;  1OWA A;  5CCG D;  2WPS A;  3AEC C;  5KAF H;  4GOE A;  2ZXX A;  1LTA C;  1L0N J;  3GMA A;  1YI2 P;  1VQL P;  2WPV B;  4BWN A;  1JM0 A;  2YO2 A;  2ZAE B;  2AXT H;  3L75 E;  3CCJ P;  1PZQ A;  3MUD C;  3H25 A;  3D71 A;  5KLV G;  2WTY A;  4LGD E;  5APU A;  3MP7 B;  3I56 P;  1P84 E;  1RF1 C;  4U3F D;  1T6A A;  3TK1 A;  1SQQ E;  2ZVO B;  4H0L D;  4W7Z A;  5GTI H;  4HKZ H;  2V7Q J;  1L4A B;  1SQQ K;  1KYO H;  2JWA A;  5CCH D;  1NTK E;  2KSJ A;  1TU3 F;  3AEB C;  3H1I D;  3HD7 A;  1SLQ A;  3KPE A;  1KYO D;  1L0L J;  3L74 E;  3OJA B;  3V6I A;  2E74 B;  2IBZ G;  2ZYG A;  3L70 E;  1NTK J;  2E75 B;  2ZFC A;  4I6M C;  4C46 A;  2K9Y A;  1ZP0 C;  2QRX A;  1RF1 B;  2WSC J;  3PRJ A;  1DD4 A;  2MJZ A;  2D2C B;  1GMJ A;  3B4S A;  3L72 G;  5E79 E;  3CXH D;  1YJN P;  2QJK C;  2Z5I A;  1BCC D;  1G1I A;  1Y47 A;  3I55 P;  1HVV A;  1YIT P;  1FS0 E;  3EFF K;  3P32 A;  1HGZ A;  1IK9 A;  1XTC C;  2D2C D;  5KAF E;  3W68 A;  1NVO A;  2D2C C;  1LWU B;  2GA1 A;  1KQF B;  1IFD A;  1T3U A;  2M3B A;  4H44 B;  2OYH C;  1HGV A;  4EDF A;  1QVG O;  2FYU J;  3Q5R A;  4XE5 B;  4DT0 A;  2KB7 P;  3AE6 C;  3NTN A;  2P7J A;  4WY4 D;  1M1K Q;  4H0L B;  3H1J J;  2A45 I;  1KFM A;  1WT6 A;  3KDP B;  1NTK K;  1N7S B;  1SQX K;  2WWW A;  3H1L E;  3OA7 A;  4WWI A;  3RK2 D;  3V2N A;  1LTT C;  5AVZ B;  1K05 A;  1LTJ A;  2NRG A;  3EWK A;  4UB6 H;  1RQV A;  1M8O B;  1SQV J;  4EYY Q;  1J2J B;  3CXH H;  1UIX A;  2W8Z A;  1GTW A;  3CWB E;  1EDJ A;  1NU1 J;  1PPJ D;  1BE3 E;  3CWB G;  3WUT A;  3L71 J;  2L91 A;  2FFD B;  2R3C A;  3M9B A;  4K3A A;  1JNM A;  1HF9 A;  1SFC D;  2E76 B;  2HOD B;  1U57 A;  2KIK A;  2LXB A;  2ZT9 C;  3HD7 D;  3AE5 C;  4I2L C;  2E5T A;  5AVR B;  1AJY A;  1BGY J;  1OXZ A;  2IBZ D;  2WIT A;  1MUU A;  3D6Y A;  3WUV A;  3M9H A;  1GL2 A;  2QJY B;  3H1K E;  2OAR A;  1M90 Q;  2Z5H A;  1JY2 O;  3H1H E;  3HUS B;  3VMY A;  1X79 B;  1W5C E;  2SPZ A;  1NOH A;  2ZXE B;  5CCG A;  4H13 D;  1DEB A;  1YQ3 C;  5AW4 B;  4L73 A;  3H1H J;  2JR8 A;  3IAO A;  1VF5 D;  3CL3 D;  3KYQ A;  5M1B A;  4ZKU A;  3A2A A;  4A7P A;  3B5N B;  4WB4 A;  1HWT C;  1DX7 A;  3NMD A;  1SFC C;  5H2F H;  3CCS P;  3C1L A;  1R5L A;  1JB0 J;  3MUD A;  4D6T D;  4O9B A;  1K9M Q;  1JTH B;  2A06 E;  2KZJ A;  2HOD A;  3H1L D;  1SQP D;  1UII A;  4JBZ A;  2PAJ A;  3ABV C;  3OW2 O;  1USE A;  2KXP B;  3FX0 A;  2UWJ E;  3VTP C;  1SQV K;  3R2P A;  2ZT9 D;  5CMZ A;  3FGA D;  5KLV D;  2WT7 B;  1Q7Y Q;  1KQL A;  1IK7 A;  1NKN A;  1HUC A;  2JO1 A;  2KSE A;  2Q6Q A;  2M8R A;  1JCD A;  5KJ7 C;  2M5A B;  3AE1 C;  1NTZ K;  5B66 H;  2RKL A;  5EFW B;  1L4A C;  1NTM J;  4Z1M H;  1L0N K;  1H0T B;  1PPJ E;  1WMK A;  1IJD B;  1FZB A;  1L0N E;  1MV8 A;  1AA0 A;  1X0T A;  2XDJ A;  5AVV B;  2WPQ A;  1U7M A;  2YKQ A;  3P8C E;  3BCC J;  3H1L G;  1RF0 C;  2IYP A;  3FWN A;  2BCC E;  4U3F G;  5AW2 B;  3VMX A;  1EC5 A;  3L36 A;  2WZ7 A;  1JOC A;  5C39 A;  4D6T G;  2K1A A;  1GU4 A;  2FYU K;  3CCR P;  3AE8 C;  1JY3 O;  3PH0 A;  3AEF C;  1A02 J;  1URQ D;  1K8A Q;  2KK7 A;  3L70 G;  5AVX B;  3CWB D;  1Q86 Q;  4KHX A;  2KYV A;  1AVY A;  2AEJ A;  2R5D A;  1JY3 N;  3QWO C;  2WQY C;  1FZC C;  2H8P D;  4W7Y A;  4IL6 X;  3U59 A;  1VQ6 P;  3U1C A;  4I1L A;  1SQP G;  1FU1 A;  4U7J A;  4YTP C;  4CPG A;  1FDM A;  2K9J B;  1IFN A;  2YIU B;  1NTZ J;  1W2E A;  1NAF A;  1W2B O;  1JMB A;  1LTJ C;  2QJK B;  5KJ7 D;  1SQB D;  1KB9 I;  4IFF A;  3L75 D;  4XFJ A;  1K04 A;  1NTZ E;  1HJ0 A;  1X22 A;  1RE3 C;  2HLO A;  1LT9 C;  2YKO A;  3GHG B;  5B66 E;  2HPC A;  3A3Y B;  3C9I A;  3CCU P;  1Q81 Q;  4YXW H;  2ZJS E;  4XA4 A;  1LJ2 A;  1FDI A;  3H6P A;  2RMZ A;  1ZN5 A;  1KB9 D;  4NPE A;  4ZMD A;  1EZV G;  1EDK A;  3H32 B;  2Q9I A;  1BE3 J;  2KLU A;  3L75 J;  4PV1 C;  2IBZ I;  4D6T E;  1S72 P;  2BCC G;  3RK3 D;  3WMM 0;  4DCK A;  2IPP A;  2KP8 A;  3FXD A;  4U3F E;  1SQX J;  2Y0C A;  3SFE C;  1JTH A;  4R4M A;  3D6Z A;  4UB8 H;  5APT A;  1VQO P;  1Y8A A;  3CC4 P; 
#chains in the Genus database with same CATH homology
 3L75 G;  1PPJ G;  1BE3 G;  1SQP G;  1SQV G;  4PD4 H;  1NTK G;  1P84 H;  3H1I G;  1L0L G;  3H1K G;  5KLV G;  3BCC G;  3H1H G;  3H1J G;  1BCC G;  2A06 G;  1KYO H;  1NTM G;  2FYU G;  3H1L G;  3CX5 H;  4U3F G;  3TGU G;  2IBZ G;  4D6T G;  1NTZ G;  1EZV G;  1BGY G;  1L0N G;  3CXH H;  3L72 G;  2BCC G;  3L70 G;  3CWB G;  1KB9 H;  1PP9 G;  3L74 G;  1SQX G;  3L71 G;  1NU1 G;  1SQB G;  3L73 G;  1SQQ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...