1KYOH

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
93
structure length
93
Chain Sequence
GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
total genus 13
structure length 93
sequence length 93
chains with identical sequence S
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1kyoH00
1NTKG 3BCCG 1BCCG 1SQXG 1P84H 1SQVG 3H1IG 1BGYG 3CX5H 1PPJG 1SQPG 3CWBG 2IBZG 3L74G 3H1KG 5KLVG 1BE3G 3L70G 1SQBG 2A06G 3H1LG 1NTMG 3TGUG 3H1HG 3L75G 2BCCG 1KB9H 1SQQG 3L71G 4U3FG 1KYOH 3CXHH 2FYUG 3L72G 1PP9G 1L0LG 3L73G 4PD4H 1NTZG 4D6TG 1EZVG 1L0NG 1NU1G 3H1JG
chains in the Genus database with same CATH superfamily
1QGKB 1SS1A 1SQBE 1YTZT 2RMZA 1SQPK 3HD7D 3KXDA 3CC2P 2W6AA 3AECC 2KS1B 2HLOA 3C9IA 2YMKA 1LTSC 2QJYC 2PAJA 1N86A 2KZIA 1PGQA 3FX0A 1SQQD 1VQOP 2AEJA 2AXCA 1BCCJ 5CCGA 5AW2B 3VYIA 1NU1E 3BVHA 1N7SA 3KQGA 4DOJA 2KIKA 2HPCB 2XNXA 1U7JA 2BEQD 4I6MC 3RK2B 1FAVA 5AW1B 5AVYB 3Q1MA 1AVYA 2IFMA 3MTUE 4XA4A 1E79H 1AQTA 2XKMA 4I7ZB 1M57D 1HGVA 1BDDA 2PGDA 3RL0B 4H0LD 1LTJB 2QSIA 2WPRA 2Z5HA 2ZT9B 2E74D 3CXHE 1M90Q 2Q7CA 5B66E 3RL0g 1NTMG 2ZVNB 3L74J 2QJPB 4RESB 2KLUA 3CL3D 3EWKA 1AVOA 3L73G 3M9HA 2B87B 1H88A 1P84I 1GZLA 3IN6A 1PV3A 3VOPA 1EXJA 2B89A 4GOFA 1SQQK 1NTKD 4WVZA 1DD3A 5B5EH 4LC1A 1SFCC 2Y0DA 1IFMA 2YMYA 3E7KA 1GW3A 4WBAA 2E5YA 3MGNA 1SQBG 1X8YA 3L71D 3TYYA 1Y47A 4IL6H 1VPCA 1PP9D 2Q1KA 2QEXP 2M8RA 1FDOA 2W8ZA 5TISE 3H1HJ 1OVUA 4C7NB 3HE5B 1NOHA 2WWWA 3K5BA 3IF4A 3KZIE 3RK3E 3A0HE 1S5LX 2R44A 3AE9C 2N1TB 1QL1A 2LXBA 1NHLA 1NU1G 1IK7A 5AVWB 1FZCB 3U1CA 3AE4C 1LTAC 1S1CX 4W7ZA 2IZ1A 4PD4D 4Y99C 1IJDB 1L0NJ 5KLVK 5AVSB 3SWKA 2YIUB 1EDIA 3HD7A 3RL0D 1N7SB 3H1KJ 3H1LD 2WITA 3UIAA 1GMJA 3N4XA 4W80A 1CSBA 3OW2O 3BATA 3VMZA 3WMM0 3V2RA 2C0XA 1QX8A 1SQVJ 2OYOA 3V2PA 1KILC 1FBMA 3CWBJ 2QJKB 5KLIC 2L91A 3SSUA 1JY2P 2KK7A 5CHXA 1GL2B 1UIIA 2HG5D 1BE3E 1GK6A 2A06E 1R8EA 1NGMB 3TSIA 2E76C 3S4RA 2LXCB 2JEEA 1FDMA 1PGJA 2IYPA 1DD4A 3L74D 3RGUA 3W68A 2FYUJ 1HVVA 3P7KA 3WUUA 1JY3O 2IFNA 1SLQA 1AJYA 1JNMA 2ITAA 3CX5E 1NTZD 2KI7B 2Q6QA 1J1EB 4O9BA 2V4HA 3VN0A 4XE5B 2WSCJ 1T2KD 1LGHB 2P67A 1T8ZA 3G9RA 2W6JH 2YXQB 2ZXXA 5BU8B 1JMBA 3H1JD 2JKVA 3CD6P 2N1TD 1LP1B 3Q5SA 4H0LC 3CCMP 1VL2A 2JWDA 4PD4I 4OGQB 4C46A 2V7QJ 4N3YB 1SVFA 1PZQA 2E74C 3FXDA 2SPZA 2C9LY 1KFNA 1KFMA 1HUCA 1L0LE 2AXTE 1L4AC 1JCDA 2QG4A 2M0BA 3NMDA 2QE7H 2FYNC 2K9JA 4JYCA 2H88C 3RBZA 4DT0A 4H13D 2GUVA 1Q90D 4ZMDA 1QEXA 1N7SD 2O01J 3BCCD 1KMIZ 3FXEA 5AW5B 1NTMJ 3A2AA 1ZOYC 1KD1Q 2NRGA 1S72P 3L73J 3WUVA 1DEEG 2OQQA 2OTKE 1BE3G 1N8RQ 3AEDC 1LWUB 2A06G 1PGPA 1OW6A 1FU1A 1YIJP 1KB9H 1ZP0C 3PP5A 2E42A 2Q3IA 2JR8A 4IFFA 2XV5A 1SQPE 1GL2D 2IBZE 3NFQA 2HPCA 4A7PA 2UWJE 5KJ7D 1NAYA 1Q81Q 3A3YB 3AEFC 2YXRB 3HTKA 3TF5A 2O3JA 2K9YA 3H32A 1SQBJ 1AQ5A 3FWNA 3CPWO 4UB6H 2W6BA 5CCHD 1LTJA 1PPJE 1N2DC 4CPGA 4ZKPA 3A0BH 1A02J 3VP8A 5DJTB 4ASVA 5APSA 3SWFA 4JYBA 4BXLA 4GIFA 1HBWA 3MP7B 2CK3H 3L75E 1FS0E 1HWTC 1UIXA 3L72E 3AE1C 4D6TE 2R3CA 1TU3F 2FXPA 2IYOA 1SQXD 1CI6A 1M8OB 2XU6A 4ASWA 2Y0EA 4PJ0E 1BGYE 1EDKA 1VQ5P 1USDA 3MHVA 5AVTB 3GHGC 2B87A 1FJPA 1KILE 3RK2C 1GK4A 1NJIQ 4U3FD 1NTKJ 3AEEC 2G8YA 4I7ZC 2Q9IA 3KDPB 3O6QB 2YO2A 2YKQA 1L0LG 3RL0C 4HH2A 5AVRB 1L0NK 2OYIC 2POHA 3KYQA 3L71J 1XTCC 4OGQD 1PP9J 2ZT9C 1RF0A 3S9OA 4MN4C 3HE4A 3PLNA 3MZWB 5AVZB 1T6AA 3VMXA 3V4QA 4H44D 1ZW0A 2YKOA 1AA0A 1KYOD 1SQVK 3GLMA 5B5EE 4I2LC 1NKNA 3NTNA 4C7NA 2WSFJ 2Q5UA 1K9MQ 2A45G 1M1JB 1ZXGA 3AE2C 2NPSD 5APTA 3Q5PA 3HRNA 4IL6E 1S5LH 2J5UA 4DJGA 2N1TA 1PL5A 2HYNA 3L70E 5K5GB 2BASA 1SQPG 5CJ4A 2IBZG 2JP3A 4C7RA 1FZCA 3WU2H 1YYCA 1NAFA 1EZVE 2BCCE 3M0AA 2LR2A 2FYUK 4DCKA 1M56D 1PFIA 4OH8B 3AE5C 1EDLA 2WVRA 1NTMD 1PPJG 5H2FH 3H1LJ 3AE3C 3L73D 3L75G 3CCSP 1JY2O 3PHLA 3L72G 1ZMEC 4D6TG 3EFFK 2E75B 2A45I 3D6YA 1SP4A 2WSCH 1BGYG 3HTKB 1U57A 1VF5B 1FZCC 2K1AA 3H32B 1X22A 5GTIH 1KYOH 1VQ8P 1CZQA 2KLVA 3CCJP 5KLVE 1SQBD 1P84H 1FZBA 1GL2A 2V7QH 3RK3B 3MD0A 4NPDA 1VQKP 2H89C 5KJ7A 5CCGC 1CI6B 2J58A 1OFCX 1IK9A 4Z1MH 2DW3A 4TLFA 1KYOI 4WY4D 1N7SC 4GDOA 1KTMA 1T3UA 5CCHA 4W7YA 2IDBA 1NTZJ 1G1JA 1IC2A 2B9BA 1NTMK 3P8CE 2K37A 1GTWA 1NU1D 3R4YA 2KYVA 2O01H 3MUDA 2CPSA 4PV1B 1LT9B 3KPEA 3HE4B 3H1JJ 3L70G 3Q2YA 2AEMA 5AW7B 5KJ7C 2P58A 4EDFA 1BE3J 5KAFH 4RJTA 5CJ0A 1EZVG 2BCCG 2QIWA 3CXHD 3GF7A 2C0WA 1KQSO 1LP1A 1N7LA 2QVAA 1SQBK 1AV1A 1QLED 2KOGA 2OYHB 1YI2P 1H0TA 2ZXEB 4EI2A 1BCCE 3JC22 1J1EC 1S9KE 2MKVA 1FE6A 1RH5B 2FXOA 2HODB 5KAIH 3NXSA 3BCCJ 1N73A 2NPSA 2KNCA 2E75D 2FXMA 1BSHA 3FGAD 3PJSK 1NTKK 2KXPB 4H13B 5KLVG 2ZVOB 1MKMA 2R3SA 1VQPP 1VF5D 1EZVI 4OGQC 1RHZB 2H43A 1LWUA 2ZYAA 3N7NA 1OXZA 1RF1A 1FOSF 3L37A 1YQ3C 2Y9YA 1S3JA 3USSA 3RK3D 2ZAEB 1DH3A 2WPVB 1IFDA 5EFWB 2KUBA 3D6ZA 1JMMA 2IX7C 1G2CB 1KB9E 1IFIA 2I1KA 3PH0A 5APXA 2HFED 4IFMA 2P7JA 2M3BA 2WSFH 1LT1A 2K88A 2FBWC 1SQXJ 1ZR2A 3HD7C 1LWUC 5E79H 2WSEH 3CXHI 4U3FJ 4PV1D 3CMEP 2KSJA 4L75A 3TGUE 3H1HE 3G3ZA 3ABVC 2RKLA 3A0BE 2D2CD 2VRSA 1VQ9P 2W83C 4HKZH 2M5AB 4PD4H 2OARA 3GF3A 3O6QA 1BCCG 3A7OA 4WY4A 3F89A 5AVUB 4YPCA 1BDCA 3V5BA 1X0TA 1Q86Q 1JO5A 5CBOA 1HJBA 3SWYA 3A5TA 3AEBC 1HJ0A 1S2EA 1BE3D 1OW8A 2A06D 3L72J 3Q3DA 2HR3A 1H0TB 2Z5IA 1IFJA 2XNDH 1QVGO 1H8AA 1PIXA 1L0NE 1ZLLA 4YXWH 2O1KA 3E1IA 1R5LA 2QRXA 4H44B 1M1JA 3ITKA 1Q82Q 3H1KE 1GW4A 2KSEA 1N73B 2P1JA 3CX5D 2IPPA 1YQ4C 3CC7P 1A02F 2NPSB 2KNCB 1IO4A 1RY3A 2KP8A 5KKZB 1QL2A 2YNYA 1SQVE 1NTZK 3JCUH 3CWBE 2M3EA 1S5LE 5L8RJ 2LKMA 3CCRP 5KLIB 3I56P 5BU5A 5AVXB 1RF1B 1OX3A 4GT1A 3C8VA 4YXDC 4N78E 1M1JC 2WPSA 2Y9ZA 1VDFA 1E5WA 1G1IA 3QH9A 5TJHA 3GG2A 1Y9BA 3TGUG 3AEAC 1FOSE 3H1HG 2FYUE 1L0LD 1ZRTE 5GTHH 2WPQA 1SFCD 4NPFX 3L70J 2W90A 1KZUB 4R4LA 2H7HA 1VQLP 1T3JA 1BSNA 3SFDC 1HGZA 2N9YB 2FFDA 1U7MA 3E1RA 3H1IE 1DX7A 3CC4P 1FZEA 1K04A 1M1KQ 4XFJA 1W2EA 2E75C 4LGDE 1NU1J 3IAOA 1P84E 3V2QA 2P10A 1AFOA 1VF5C 4EIJA 1L0NG 2XDJA 4WY4B 1SQPD 2IBZD 2PRRA 1LTJC 3GMAA 4DZOA 1JOCA 5AW0B 5CMZA 4JPZB 1FJKA 3CX5I 1LTIC 1LT9A 4GOEA 3RK3C 1DIPA 2JJLA 3PRJA 1CW5A 3V6IA 1PPJD 2YKPA 2QJPC 1SQVG 4KT0J 3CWBG 2AXTH 5AVVB 3L75D 1JUNA 1M7LA 1SQQE 1WRGA 3L72D 4D6TD 3CI9A 2OYHA 4AUWA 4M3LA 2WSEJ 5AW8B 1BGYD 2GA1A 5KAFE 4K3AA 2BEZF 1SQXK 1QVFO 2G3AA 1KILD 2Z4EA 3B5NB 4PV1C 1LT9C 1RF0C 2HODA 1DEBA 4ZNCA 1WMKA 2FYUG 3B71A 3IFMA 1IFNA 2A45H 1WT6A 3AE7C 1R5SA 1HH0A 3GW6A 3MIWA 1GU4A 1Y8AA 2E76D 1OVVA 1KN7A 4AQRD 3OAKA 1YJWP 1JM0A 1T2KC 3D70A 5KAIE 1YTZI 4JBZA 2OYHC 1EC5A 1J1DB 3H1IG 1FZAA 2L5GB 2H8PD 4BRYB 3TK1A 1OMIA 2WT7A 2N1TC 4QMAA 4LLHA 2OTLP 1VQ6P 5CBNA 2J59M 1LTGC 1FDIA 1KC8Q 1JEKA 3KHUA 3WUTA 1NTKE 1LTBC 2P2UA 3GHGB 2IBZI 2QM7A 1G2CA 4OVNF 3L70D 2GUSA 3M9BA 2FFDB 2N9BA 3QWOC 3L71E 2AEFA 2E5TA 4H13C 4PJ0H 1PP9E 1EZVD 3PTZA 2OYIB 2BCCD 2YIUC 1IFPA 1OW7A 1SFCA 2Q3EA 4EYYQ 3JSVC 1VQ7P 4KHXA 3LIDA 4JQ0D 1L4AD 1OIPA 3B8EB 2ZYGA 2RN0A 3T97B 3I55P 3AEGC 4L74A 3M06A 1SQQG 4GKGA 1KQLA 3CLQA 3U1AA 1X79B 2PFXA 5E79E 2QJKC 5KTBA 2GM4A 3BRTB 2M5AA 4UB8H 3AE6C 3FWLA 1USEA 1GL2C 3HUSB 2D2CB 1URQB 3CCUP 1FZFA 5KLVD 4GODA 2ZJSE 2IZ0A 3VTPC 1MV8A 3G71P 1YBKA 4PD4E 5CCHC 3B5ND 1JB0J 3H6PA 1FZGA 3H1LE 1VQMP 3TGUJ 2QJYB 2KB7P 1W5CE 5C39A 1W2BO 1NKZB 3MUDC 3P8CD 1RE3A 1MFTA 1NTKG 1NU1K 2R5DA 5APWA 3W67A 2JO1A 1JY3N 2FY8A 5AW6B 1KILA 1HTLC 3P8MC 3L71G 3O8ZA 1PP9G 2CPBA 3LW5J 1Q7YQ 2WT7B 3RK2D 3L74E 4H44C 2QA4P 2XZRA 1GD2E 1EQ7A 1L0LJ 2I1JA 3JCUE 2K3RA 1N73C 1RE3C 3CCEP 1NTZE 1VQNP 3CXHH 1BCCD 1PGOA 5B66H 2ZT9D 3C1LA 3G4SP 2NPSC 3BRVB 1S9KD 5KKZC 5BVZA 5AVQB 1K8AQ 3ZDMA 3CCQP 4B86A 1NVOA 4HJGH 1SFCB 3H1JE 2R32A 1RF1C 1S4XA 5GTHE 2MJZA 2PP6A 1NWQA 2WTYA 3L4FA 1RE4A 4TT3H 4UB6E 4HB1A 3B4SA 1URQD 3LIEA 1D7MA 1SQPJ 3CMAP 1JTHA 3H1LG 1XTGB 4OWFA 3TDKA 1J2JB 2WMMA 2KZJA 2C9NY 5TISH 4I1LA 1L4AA 2ZFCA 1YITP 3BCCE 3VMYA 1KB9D 3L75J 2RH0A 1EXIA 3KZIH 4BWNA 4IL6X 1RE4C 3A0HH 3V4WA 3II6A 3H1IJ 4D6TJ 1Q2NA 2OGUA 1BGYJ 2WQYC 1MUUA 1KORA 4Y99B 1K05A 2R5BA 1X9VA 5DJUB 3Q5RA 3TGUD 4WY4C 1ZN5A 3H1HD 1NYHA 3L74G 3CCVP 1JCCA 3TNUA 2E43A 5AW3B 1ZR4A 2NZ2A 3B5NA 1LNQA 1RQVA 5APUA 3F5HA 1K73Q 1NTZG 1NO4A 3V2NA 2FYZA 1YJ9P 3OA7A 1LJ2A 5CCGD 1KILB 1MFZA 4NPEA 4WB4A 3EFGA 3M91A 1RQUA 1SQXE 3WU2E 2OTJP 2KS1A 3H1JG 4K35A 1SQQJ 4EOTA 5APVA 2E76B 3HD7B 4BRYA 4L76A 4U3FE 3P32A 3BASA 3B5NC 5H2FE 1L0ND 4KJMA 1KV4A 2O01N 3H1KD 3OJAB 3GHGA 4AYCA 2ZYDA 5AW9B 2I8DA 2BCCJ 1H89A 2QM8A 3M0DA 3L35A 1HF9A 1IZNB 1FC2C 4IOIH 1OVRA 2FKWB 1YHQP 1KB9I 3U59A 1VQ4P 1SQVD 3SFEC 3EQ2A 3L36A 3R2PA 2OYIA 1KQGB 3CWBD 5GTIE 2JWAA 3BCCG 1KYOE 2WSSH 1GU5A 4IFDK 2YO3A 1J1DC 3CX5H 3CCLP 4N6JA 1ZV8A 3IR9A 1OWAA 1JTHB 1GDTA 1MZ9A 4L73A 1NH4A 4H0LB 3T97A 4N78D 3D71A 4R4MA 2Y0CA 2E74B 3H1KG 1Z56A 1L4AB 2FYUD 2B88A 4YTPC 3M0DC 2FFDC 1ZRTD 3S1KA 2FYNB 3HUSA 5KLVJ 1URQA 3M9QA 5APYA 3I5CA 1L0LK 1JY2N 3LW5H 1L2PA 4WWIA 1LTTC 5AW4B 4Y28J 5M1BA 2O1JA 1NTME 3AE8C 1JY3P 3RBXA 4UB8E 3H25A 3G6EP 3L73E 3H1ID 4RO0A 1OZHA 2JDIH 1SQXG 4ZKUA 3TNUB 3VP9A 4HYTB 1YJNP 3HE5A 1P84D 5APQA 3VMAA 2W27A 4RKUJ 4U3FG 2K9JB 3HUSC 2D2CC 1KQFB 1EDJA 1URQC 2WZ7A 4JF7A 4U7JA
chains in the Genus database with same CATH topology
1NTKG 3BCCG 1BCCG 1SQXG 1P84H 1SQVG 3H1IG 1BGYG 3CX5H 1PPJG 1SQPG 3CWBG 2IBZG 3L74G 3H1KG 5KLVG 1BE3G 3L70G 1SQBG 2A06G 3H1LG 1NTMG 3TGUG 3H1HG 3L75G 2BCCG 1KB9H 1SQQG 3L71G 4U3FG 1KYOH 3CXHH 2FYUG 3L72G 1PP9G 1L0LG 3L73G 4PD4H 1NTZG 4D6TG 1EZVG 1L0NG 1NU1G 3H1JG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTK G;  3BCC G;  1BCC G;  1SQX G;  1P84 H;  1SQV G;  3H1I G;  1BGY G;  3CX5 H;  1PPJ G;  1SQP G;  3CWB G;  2IBZ G;  3L74 G;  3H1K G;  5KLV G;  1BE3 G;  3L70 G;  1SQB G;  2A06 G;  3H1L G;  1NTM G;  3TGU G;  3H1H G;  3L75 G;  2BCC G;  1KB9 H;  1SQQ G;  3L71 G;  4U3F G;  1KYO H;  3CXH H;  2FYU G;  3L72 G;  1PP9 G;  1L0L G;  3L73 G;  4PD4 H;  1NTZ G;  4D6T G;  1EZV G;  1L0N G;  1NU1 G;  3H1J G; 
#chains in the Genus database with same CATH topology
 1QGK B;  1SS1 A;  1SQB E;  1YTZ T;  2RMZ A;  1SQP K;  3HD7 D;  3KXD A;  3CC2 P;  2W6A A;  3AEC C;  2KS1 B;  2HLO A;  3C9I A;  2YMK A;  1LTS C;  2QJY C;  2PAJ A;  1N86 A;  2KZI A;  1PGQ A;  3FX0 A;  1SQQ D;  1VQO P;  2AEJ A;  2AXC A;  1BCC J;  5CCG A;  5AW2 B;  3VYI A;  1NU1 E;  3BVH A;  1N7S A;  3KQG A;  4DOJ A;  2KIK A;  2HPC B;  2XNX A;  1U7J A;  2BEQ D;  4I6M C;  3RK2 B;  1FAV A;  5AW1 B;  5AVY B;  3Q1M A;  1AVY A;  2IFM A;  3MTU E;  4XA4 A;  1E79 H;  1AQT A;  2XKM A;  4I7Z B;  1M57 D;  1HGV A;  1BDD A;  2PGD A;  3RL0 B;  4H0L D;  1LTJ B;  2QSI A;  2WPR A;  2Z5H A;  2ZT9 B;  2E74 D;  3CXH E;  1M90 Q;  2Q7C A;  5B66 E;  3RL0 g;  1NTM G;  2ZVN B;  3L74 J;  2QJP B;  4RES B;  2KLU A;  3CL3 D;  3EWK A;  1AVO A;  3L73 G;  3M9H A;  2B87 B;  1H88 A;  1P84 I;  1GZL A;  3IN6 A;  1PV3 A;  3VOP A;  1EXJ A;  2B89 A;  4GOF A;  1SQQ K;  1NTK D;  4WVZ A;  1DD3 A;  5B5E H;  4LC1 A;  1SFC C;  2Y0D A;  1IFM A;  2YMY A;  3E7K A;  1GW3 A;  4WBA A;  2E5Y A;  3MGN A;  1SQB G;  1X8Y A;  3L71 D;  3TYY A;  1Y47 A;  4IL6 H;  1VPC A;  1PP9 D;  2Q1K A;  2QEX P;  2M8R A;  1FDO A;  2W8Z A;  5TIS E;  3H1H J;  1OVU A;  4C7N B;  3HE5 B;  1NOH A;  2WWW A;  3K5B A;  3IF4 A;  3KZI E;  3RK3 E;  3A0H E;  1S5L X;  2R44 A;  3AE9 C;  2N1T B;  1QL1 A;  2LXB A;  1NHL A;  1NU1 G;  1IK7 A;  5AVW B;  1FZC B;  3U1C A;  3AE4 C;  1LTA C;  1S1C X;  4W7Z A;  2IZ1 A;  4PD4 D;  4Y99 C;  1IJD B;  1L0N J;  5KLV K;  5AVS B;  3SWK A;  2YIU B;  1EDI A;  3HD7 A;  3RL0 D;  1N7S B;  3H1K J;  3H1L D;  2WIT A;  3UIA A;  1GMJ A;  3N4X A;  4W80 A;  1CSB A;  3OW2 O;  3BAT A;  3VMZ A;  3WMM 0;  3V2R A;  2C0X A;  1QX8 A;  1SQV J;  2OYO A;  3V2P A;  1KIL C;  1FBM A;  3CWB J;  2QJK B;  5KLI C;  2L91 A;  3SSU A;  1JY2 P;  2KK7 A;  5CHX A;  1GL2 B;  1UII A;  2HG5 D;  1BE3 E;  1GK6 A;  2A06 E;  1R8E A;  1NGM B;  3TSI A;  2E76 C;  3S4R A;  2LXC B;  2JEE A;  1FDM A;  1PGJ A;  2IYP A;  1DD4 A;  3L74 D;  3RGU A;  3W68 A;  2FYU J;  1HVV A;  3P7K A;  3WUU A;  1JY3 O;  2IFN A;  1SLQ A;  1AJY A;  1JNM A;  2ITA A;  3CX5 E;  1NTZ D;  2KI7 B;  2Q6Q A;  1J1E B;  4O9B A;  2V4H A;  3VN0 A;  4XE5 B;  2WSC J;  1T2K D;  1LGH B;  2P67 A;  1T8Z A;  3G9R A;  2W6J H;  2YXQ B;  2ZXX A;  5BU8 B;  1JMB A;  3H1J D;  2JKV A;  3CD6 P;  2N1T D;  1LP1 B;  3Q5S A;  4H0L C;  3CCM P;  1VL2 A;  2JWD A;  4PD4 I;  4OGQ B;  4C46 A;  2V7Q J;  4N3Y B;  1SVF A;  1PZQ A;  2E74 C;  3FXD A;  2SPZ A;  2C9L Y;  1KFN A;  1KFM A;  1HUC A;  1L0L E;  2AXT E;  1L4A C;  1JCD A;  2QG4 A;  2M0B A;  3NMD A;  2QE7 H;  2FYN C;  2K9J A;  4JYC A;  2H88 C;  3RBZ A;  4DT0 A;  4H13 D;  2GUV A;  1Q90 D;  4ZMD A;  1QEX A;  1N7S D;  2O01 J;  3BCC D;  1KMI Z;  3FXE A;  5AW5 B;  1NTM J;  3A2A A;  1ZOY C;  1KD1 Q;  2NRG A;  1S72 P;  3L73 J;  3WUV A;  1DEE G;  2OQQ A;  2OTK E;  1BE3 G;  1N8R Q;  3AED C;  1LWU B;  2A06 G;  1PGP A;  1OW6 A;  1FU1 A;  1YIJ P;  1KB9 H;  1ZP0 C;  3PP5 A;  2E42 A;  2Q3I A;  2JR8 A;  4IFF A;  2XV5 A;  1SQP E;  1GL2 D;  2IBZ E;  3NFQ A;  2HPC A;  4A7P A;  2UWJ E;  5KJ7 D;  1NAY A;  1Q81 Q;  3A3Y B;  3AEF C;  2YXR B;  3HTK A;  3TF5 A;  2O3J A;  2K9Y A;  3H32 A;  1SQB J;  1AQ5 A;  3FWN A;  3CPW O;  4UB6 H;  2W6B A;  5CCH D;  1LTJ A;  1PPJ E;  1N2D C;  4CPG A;  4ZKP A;  3A0B H;  1A02 J;  3VP8 A;  5DJT B;  4ASV A;  5APS A;  3SWF A;  4JYB A;  4BXL A;  4GIF A;  1HBW A;  3MP7 B;  2CK3 H;  3L75 E;  1FS0 E;  1HWT C;  1UIX A;  3L72 E;  3AE1 C;  4D6T E;  2R3C A;  1TU3 F;  2FXP A;  2IYO A;  1SQX D;  1CI6 A;  1M8O B;  2XU6 A;  4ASW A;  2Y0E A;  4PJ0 E;  1BGY E;  1EDK A;  1VQ5 P;  1USD A;  3MHV A;  5AVT B;  3GHG C;  2B87 A;  1FJP A;  1KIL E;  3RK2 C;  1GK4 A;  1NJI Q;  4U3F D;  1NTK J;  3AEE C;  2G8Y A;  4I7Z C;  2Q9I A;  3KDP B;  3O6Q B;  2YO2 A;  2YKQ A;  1L0L G;  3RL0 C;  4HH2 A;  5AVR B;  1L0N K;  2OYI C;  2POH A;  3KYQ A;  3L71 J;  1XTC C;  4OGQ D;  1PP9 J;  2ZT9 C;  1RF0 A;  3S9O A;  4MN4 C;  3HE4 A;  3PLN A;  3MZW B;  5AVZ B;  1T6A A;  3VMX A;  3V4Q A;  4H44 D;  1ZW0 A;  2YKO A;  1AA0 A;  1KYO D;  1SQV K;  3GLM A;  5B5E E;  4I2L C;  1NKN A;  3NTN A;  4C7N A;  2WSF J;  2Q5U A;  1K9M Q;  2A45 G;  1M1J B;  1ZXG A;  3AE2 C;  2NPS D;  5APT A;  3Q5P A;  3HRN A;  4IL6 E;  1S5L H;  2J5U A;  4DJG A;  2N1T A;  1PL5 A;  2HYN A;  3L70 E;  5K5G B;  2BAS A;  1SQP G;  5CJ4 A;  2IBZ G;  2JP3 A;  4C7R A;  1FZC A;  3WU2 H;  1YYC A;  1NAF A;  1EZV E;  2BCC E;  3M0A A;  2LR2 A;  2FYU K;  4DCK A;  1M56 D;  1PFI A;  4OH8 B;  3AE5 C;  1EDL A;  2WVR A;  1NTM D;  1PPJ G;  5H2F H;  3H1L J;  3AE3 C;  3L73 D;  3L75 G;  3CCS P;  1JY2 O;  3PHL A;  3L72 G;  1ZME C;  4D6T G;  3EFF K;  2E75 B;  2A45 I;  3D6Y A;  1SP4 A;  2WSC H;  1BGY G;  3HTK B;  1U57 A;  1VF5 B;  1FZC C;  2K1A A;  3H32 B;  1X22 A;  5GTI H;  1KYO H;  1VQ8 P;  1CZQ A;  2KLV A;  3CCJ P;  5KLV E;  1SQB D;  1P84 H;  1FZB A;  1GL2 A;  2V7Q H;  3RK3 B;  3MD0 A;  4NPD A;  1VQK P;  2H89 C;  5KJ7 A;  5CCG C;  1CI6 B;  2J58 A;  1OFC X;  1IK9 A;  4Z1M H;  2DW3 A;  4TLF A;  1KYO I;  4WY4 D;  1N7S C;  4GDO A;  1KTM A;  1T3U A;  5CCH A;  4W7Y A;  2IDB A;  1NTZ J;  1G1J A;  1IC2 A;  2B9B A;  1NTM K;  3P8C E;  2K37 A;  1GTW A;  1NU1 D;  3R4Y A;  2KYV A;  2O01 H;  3MUD A;  2CPS A;  4PV1 B;  1LT9 B;  3KPE A;  3HE4 B;  3H1J J;  3L70 G;  3Q2Y A;  2AEM A;  5AW7 B;  5KJ7 C;  2P58 A;  4EDF A;  1BE3 J;  5KAF H;  4RJT A;  5CJ0 A;  1EZV G;  2BCC G;  2QIW A;  3CXH D;  3GF7 A;  2C0W A;  1KQS O;  1LP1 A;  1N7L A;  2QVA A;  1SQB K;  1AV1 A;  1QLE D;  2KOG A;  2OYH B;  1YI2 P;  1H0T A;  2ZXE B;  4EI2 A;  1BCC E;  3JC2 2;  1J1E C;  1S9K E;  2MKV A;  1FE6 A;  1RH5 B;  2FXO A;  2HOD B;  5KAI H;  3NXS A;  3BCC J;  1N73 A;  2NPS A;  2KNC A;  2E75 D;  2FXM A;  1BSH A;  3FGA D;  3PJS K;  1NTK K;  2KXP B;  4H13 B;  5KLV G;  2ZVO B;  1MKM A;  2R3S A;  1VQP P;  1VF5 D;  1EZV I;  4OGQ C;  1RHZ B;  2H43 A;  1LWU A;  2ZYA A;  3N7N A;  1OXZ A;  1RF1 A;  1FOS F;  3L37 A;  1YQ3 C;  2Y9Y A;  1S3J A;  3USS A;  3RK3 D;  2ZAE B;  1DH3 A;  2WPV B;  1IFD A;  5EFW B;  2KUB A;  3D6Z A;  1JMM A;  2IX7 C;  1G2C B;  1KB9 E;  1IFI A;  2I1K A;  3PH0 A;  5APX A;  2HFE D;  4IFM A;  2P7J A;  2M3B A;  2WSF H;  1LT1 A;  2K88 A;  2FBW C;  1SQX J;  1ZR2 A;  3HD7 C;  1LWU C;  5E79 H;  2WSE H;  3CXH I;  4U3F J;  4PV1 D;  3CME P;  2KSJ A;  4L75 A;  3TGU E;  3H1H E;  3G3Z A;  3ABV C;  2RKL A;  3A0B E;  2D2C D;  2VRS A;  1VQ9 P;  2W83 C;  4HKZ H;  2M5A B;  4PD4 H;  2OAR A;  3GF3 A;  3O6Q A;  1BCC G;  3A7O A;  4WY4 A;  3F89 A;  5AVU B;  4YPC A;  1BDC A;  3V5B A;  1X0T A;  1Q86 Q;  1JO5 A;  5CBO A;  1HJB A;  3SWY A;  3A5T A;  3AEB C;  1HJ0 A;  1S2E A;  1BE3 D;  1OW8 A;  2A06 D;  3L72 J;  3Q3D A;  2HR3 A;  1H0T B;  2Z5I A;  1IFJ A;  2XND H;  1QVG O;  1H8A A;  1PIX A;  1L0N E;  1ZLL A;  4YXW H;  2O1K A;  3E1I A;  1R5L A;  2QRX A;  4H44 B;  1M1J A;  3ITK A;  1Q82 Q;  3H1K E;  1GW4 A;  2KSE A;  1N73 B;  2P1J A;  3CX5 D;  2IPP A;  1YQ4 C;  3CC7 P;  1A02 F;  2NPS B;  2KNC B;  1IO4 A;  1RY3 A;  2KP8 A;  5KKZ B;  1QL2 A;  2YNY A;  1SQV E;  1NTZ K;  3JCU H;  3CWB E;  2M3E A;  1S5L E;  5L8R J;  2LKM A;  3CCR P;  5KLI B;  3I56 P;  5BU5 A;  5AVX B;  1RF1 B;  1OX3 A;  4GT1 A;  3C8V A;  4YXD C;  4N78 E;  1M1J C;  2WPS A;  2Y9Z A;  1VDF A;  1E5W A;  1G1I A;  3QH9 A;  5TJH A;  3GG2 A;  1Y9B A;  3TGU G;  3AEA C;  1FOS E;  3H1H G;  2FYU E;  1L0L D;  1ZRT E;  5GTH H;  2WPQ A;  1SFC D;  4NPF X;  3L70 J;  2W90 A;  1KZU B;  4R4L A;  2H7H A;  1VQL P;  1T3J A;  1BSN A;  3SFD C;  1HGZ A;  2N9Y B;  2FFD A;  1U7M A;  3E1R A;  3H1I E;  1DX7 A;  3CC4 P;  1FZE A;  1K04 A;  1M1K Q;  4XFJ A;  1W2E A;  2E75 C;  4LGD E;  1NU1 J;  3IAO A;  1P84 E;  3V2Q A;  2P10 A;  1AFO A;  1VF5 C;  4EIJ A;  1L0N G;  2XDJ A;  4WY4 B;  1SQP D;  2IBZ D;  2PRR A;  1LTJ C;  3GMA A;  4DZO A;  1JOC A;  5AW0 B;  5CMZ A;  4JPZ B;  1FJK A;  3CX5 I;  1LTI C;  1LT9 A;  4GOE A;  3RK3 C;  1DIP A;  2JJL A;  3PRJ A;  1CW5 A;  3V6I A;  1PPJ D;  2YKP A;  2QJP C;  1SQV G;  4KT0 J;  3CWB G;  2AXT H;  5AVV B;  3L75 D;  1JUN A;  1M7L A;  1SQQ E;  1WRG A;  3L72 D;  4D6T D;  3CI9 A;  2OYH A;  4AUW A;  4M3L A;  2WSE J;  5AW8 B;  1BGY D;  2GA1 A;  5KAF E;  4K3A A;  2BEZ F;  1SQX K;  1QVF O;  2G3A A;  1KIL D;  2Z4E A;  3B5N B;  4PV1 C;  1LT9 C;  1RF0 C;  2HOD A;  1DEB A;  4ZNC A;  1WMK A;  2FYU G;  3B71 A;  3IFM A;  1IFN A;  2A45 H;  1WT6 A;  3AE7 C;  1R5S A;  1HH0 A;  3GW6 A;  3MIW A;  1GU4 A;  1Y8A A;  2E76 D;  1OVV A;  1KN7 A;  4AQR D;  3OAK A;  1YJW P;  1JM0 A;  1T2K C;  3D70 A;  5KAI E;  1YTZ I;  4JBZ A;  2OYH C;  1EC5 A;  1J1D B;  3H1I G;  1FZA A;  2L5G B;  2H8P D;  4BRY B;  3TK1 A;  1OMI A;  2WT7 A;  2N1T C;  4QMA A;  4LLH A;  2OTL P;  1VQ6 P;  5CBN A;  2J59 M;  1LTG C;  1FDI A;  1KC8 Q;  1JEK A;  3KHU A;  3WUT A;  1NTK E;  1LTB C;  2P2U A;  3GHG B;  2IBZ I;  2QM7 A;  1G2C A;  4OVN F;  3L70 D;  2GUS A;  3M9B A;  2FFD B;  2N9B A;  3QWO C;  3L71 E;  2AEF A;  2E5T A;  4H13 C;  4PJ0 H;  1PP9 E;  1EZV D;  3PTZ A;  2OYI B;  2BCC D;  2YIU C;  1IFP A;  1OW7 A;  1SFC A;  2Q3E A;  4EYY Q;  3JSV C;  1VQ7 P;  4KHX A;  3LID A;  4JQ0 D;  1L4A D;  1OIP A;  3B8E B;  2ZYG A;  2RN0 A;  3T97 B;  3I55 P;  3AEG C;  4L74 A;  3M06 A;  1SQQ G;  4GKG A;  1KQL A;  3CLQ A;  3U1A A;  1X79 B;  2PFX A;  5E79 E;  2QJK C;  5KTB A;  2GM4 A;  3BRT B;  2M5A A;  4UB8 H;  3AE6 C;  3FWL A;  1USE A;  1GL2 C;  3HUS B;  2D2C B;  1URQ B;  3CCU P;  1FZF A;  5KLV D;  4GOD A;  2ZJS E;  2IZ0 A;  3VTP C;  1MV8 A;  3G71 P;  1YBK A;  4PD4 E;  5CCH C;  3B5N D;  1JB0 J;  3H6P A;  1FZG A;  3H1L E;  1VQM P;  3TGU J;  2QJY B;  2KB7 P;  1W5C E;  5C39 A;  1W2B O;  1NKZ B;  3MUD C;  3P8C D;  1RE3 A;  1MFT A;  1NTK G;  1NU1 K;  2R5D A;  5APW A;  3W67 A;  2JO1 A;  1JY3 N;  2FY8 A;  5AW6 B;  1KIL A;  1HTL C;  3P8M C;  3L71 G;  3O8Z A;  1PP9 G;  2CPB A;  3LW5 J;  1Q7Y Q;  2WT7 B;  3RK2 D;  3L74 E;  4H44 C;  2QA4 P;  2XZR A;  1GD2 E;  1EQ7 A;  1L0L J;  2I1J A;  3JCU E;  2K3R A;  1N73 C;  1RE3 C;  3CCE P;  1NTZ E;  1VQN P;  3CXH H;  1BCC D;  1PGO A;  5B66 H;  2ZT9 D;  3C1L A;  3G4S P;  2NPS C;  3BRV B;  1S9K D;  5KKZ C;  5BVZ A;  5AVQ B;  1K8A Q;  3ZDM A;  3CCQ P;  4B86 A;  1NVO A;  4HJG H;  1SFC B;  3H1J E;  2R32 A;  1RF1 C;  1S4X A;  5GTH E;  2MJZ A;  2PP6 A;  1NWQ A;  2WTY A;  3L4F A;  1RE4 A;  4TT3 H;  4UB6 E;  4HB1 A;  3B4S A;  1URQ D;  3LIE A;  1D7M A;  1SQP J;  3CMA P;  1JTH A;  3H1L G;  1XTG B;  4OWF A;  3TDK A;  1J2J B;  2WMM A;  2KZJ A;  2C9N Y;  5TIS H;  4I1L A;  1L4A A;  2ZFC A;  1YIT P;  3BCC E;  3VMY A;  1KB9 D;  3L75 J;  2RH0 A;  1EXI A;  3KZI H;  4BWN A;  4IL6 X;  1RE4 C;  3A0H H;  3V4W A;  3II6 A;  3H1I J;  4D6T J;  1Q2N A;  2OGU A;  1BGY J;  2WQY C;  1MUU A;  1KOR A;  4Y99 B;  1K05 A;  2R5B A;  1X9V A;  5DJU B;  3Q5R A;  3TGU D;  4WY4 C;  1ZN5 A;  3H1H D;  1NYH A;  3L74 G;  3CCV P;  1JCC A;  3TNU A;  2E43 A;  5AW3 B;  1ZR4 A;  2NZ2 A;  3B5N A;  1LNQ A;  1RQV A;  5APU A;  3F5H A;  1K73 Q;  1NTZ G;  1NO4 A;  3V2N A;  2FYZ A;  1YJ9 P;  3OA7 A;  1LJ2 A;  5CCG D;  1KIL B;  1MFZ A;  4NPE A;  4WB4 A;  3EFG A;  3M91 A;  1RQU A;  1SQX E;  3WU2 E;  2OTJ P;  2KS1 A;  3H1J G;  4K35 A;  1SQQ J;  4EOT A;  5APV A;  2E76 B;  3HD7 B;  4BRY A;  4L76 A;  4U3F E;  3P32 A;  3BAS A;  3B5N C;  5H2F E;  1L0N D;  4KJM A;  1KV4 A;  2O01 N;  3H1K D;  3OJA B;  3GHG A;  4AYC A;  2ZYD A;  5AW9 B;  2I8D A;  2BCC J;  1H89 A;  2QM8 A;  3M0D A;  3L35 A;  1HF9 A;  1IZN B;  1FC2 C;  4IOI H;  1OVR A;  2FKW B;  1YHQ P;  1KB9 I;  3U59 A;  1VQ4 P;  1SQV D;  3SFE C;  3EQ2 A;  3L36 A;  3R2P A;  2OYI A;  1KQG B;  3CWB D;  5GTI E;  2JWA A;  3BCC G;  1KYO E;  2WSS H;  1GU5 A;  4IFD K;  2YO3 A;  1J1D C;  3CX5 H;  3CCL P;  4N6J A;  1ZV8 A;  3IR9 A;  1OWA A;  1JTH B;  1GDT A;  1MZ9 A;  4L73 A;  1NH4 A;  4H0L B;  3T97 A;  4N78 D;  3D71 A;  4R4M A;  2Y0C A;  2E74 B;  3H1K G;  1Z56 A;  1L4A B;  2FYU D;  2B88 A;  4YTP C;  3M0D C;  2FFD C;  1ZRT D;  3S1K A;  2FYN B;  3HUS A;  5KLV J;  1URQ A;  3M9Q A;  5APY A;  3I5C A;  1L0L K;  1JY2 N;  3LW5 H;  1L2P A;  4WWI A;  1LTT C;  5AW4 B;  4Y28 J;  5M1B A;  2O1J A;  1NTM E;  3AE8 C;  1JY3 P;  3RBX A;  4UB8 E;  3H25 A;  3G6E P;  3L73 E;  3H1I D;  4RO0 A;  1OZH A;  2JDI H;  1SQX G;  4ZKU A;  3TNU B;  3VP9 A;  4HYT B;  1YJN P;  3HE5 A;  1P84 D;  5APQ A;  3VMA A;  2W27 A;  4RKU J;  4U3F G;  2K9J B;  3HUS C;  2D2C C;  1KQF B;  1EDJ A;  1URQ C;  2WZ7 A;  4JF7 A;  4U7J A; 
#chains in the Genus database with same CATH homology
 1NTK G;  3BCC G;  1BCC G;  1SQX G;  1P84 H;  1SQV G;  3H1I G;  1BGY G;  3CX5 H;  1PPJ G;  1SQP G;  3CWB G;  2IBZ G;  3L74 G;  3H1K G;  5KLV G;  1BE3 G;  3L70 G;  1SQB G;  2A06 G;  3H1L G;  1NTM G;  3TGU G;  3H1H G;  3L75 G;  2BCC G;  1KB9 H;  1SQQ G;  3L71 G;  4U3F G;  1KYO H;  3CXH H;  2FYU G;  3L72 G;  1PP9 G;  1L0L G;  3L73 G;  4PD4 H;  1NTZ G;  4D6T G;  1EZV G;  1L0N G;  1NU1 G;  3H1J G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...