1KYOH

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
93
structure length
93
Chain Sequence
GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
total genus 13
structure length 93
sequence length 93
chains with identical sequence S
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1kyoH00
1SQQG 1NTZG 3TGUG 4U3FG 3H1HG 1KB9H 2FYUG 3H1LG 1SQPG 3H1IG 1NTMG 2BCCG 5KLVG 1L0LG 2A06G 1PP9G 1BCCG 1KYOH 3L73G 3CX5H 1NTKG 1P84H 3L74G 1L0NG 3L75G 3L70G 1BE3G 4D6TG 3CWBG 3BCCG 4PD4H 1BGYG 3L72G 1SQBG 1EZVG 3L71G 1SQXG 3H1KG 2IBZG 1SQVG 1PPJG 3CXHH 3H1JG 1NU1G
chains in the Genus database with same CATH superfamily
4I7ZB 1VQ9P 3U1CA 3H1LD 3G6EP 3AE8C 4ZNCA 2FBWC 1FZCB 4PD4E 1HVVA 3BCCJ 3G4SP 2CPSA 2ZXEB 1Y8AA 3H25A 2KXPB 5CJ4A 4U3FD 3H1LJ 1LWUC 5KLVD 1AFOA 3VMYA 3M9QA 4NPEA 5KJ7D 2JKVA 3GMAA 2WSEJ 1EZVG 2RN0A 2AEFA 3CXHE 2UWJE 1OW7A 4JPZB 4U3FJ 3CCJP 3MUDC 5KLVJ 5E79E 4RKUJ 5B66H 3IFMA 2QJKB 2R44A 4PD4I 1KFMA 1NKZB 1KQFB 2O3JA 3JSVC 1ZR2A 2WPSA 2R3CA 2BCCE 4CPGA 1YITP 3RGUA 3MZWB 2D2CD 3B5ND 1N73B 3RK2B 5APTA 4NPFX 1AVYA 2E76B 1KC8Q 3CXHI 1Q86Q 1CSBA 1SFCA 1Q81Q 1QX8A 3L73E 1NHLA 4UB6H 1VL2A 2ZYDA 2FYUK 1ZOYC 2ZVNB 1BGYG 4U7JA 2VRSA 2OYHA 2KZJA 2FFDA 3HRNA 3RK3C 2KK7A 1E79H 4HYTB 2FKWB 4RJTA 5APWA 1LT1A 2P10A 1VQNP 1GD2E 1NTMD 1S5LE 3AEAC 4WY4A 5GTHH 2QVAA 1KQGB 3P7KA 2Y0DA 4W7YA 1H0TB 5APVA 4XA4A 1RE3A 3SWKA 2WSCH 2BEQD 1PP9E 1TU3F 1NTMJ 3CX5H 3L75G 5H2FE 3L71E 2H88C 2KP8A 1NAFA 4H0LB 2V7QJ 2I8DA 4BXLA 1KYOE 2G3AA 4TLFA 4Y99B 3SWYA 4OGQD 4PD4H 3II6A 1H88A 1N86A 3H1KD 2C0XA 1AVOA 4H44B 2B89A 3L4FA 1H8AA 4IFMA 1JCCA 2LXCB 4I6MC 2ZT9B 2A06G 2IZ1A 1T6AA 3P8MC 3AE7C 1EZVE 5APXA 1N8RQ 5AVZB 3H1KJ 1E5WA 5AVSB 4EYYQ 3HE4A 4LC1A 1LT9A 1RQUA 3A0BE 2DW3A 3D6YA 1IFJA 1KYOI 3P8CE 2Z4EA 1BE3D 2B87B 1X22A 4HB1A 1DD4A 1RF1B 2P1JA 2FYUG 1M1JA 4TT3H 5APQA 4HJGH 1RHZB 2N1TA 4BRYB 3W67A 5CCGC 1J1EB 1GK4A 1JY3P 1U7JA 2ZVOB 1BE3J 1EZVI 3FX0A 3KQGA 2YKPA 5GTIE 2O01N 2JWDA 2E75C 1IFDA 1ZV8A 4GOFA 1S9KD 1LTJA 4JYBA 3RL0C 1BGYE 2ZJSE 1NTKD 1R5SA 4D6TD 2Z5IA 4PV1B 2JP3A 3L72D 4XFJA 2YO2A 3FWNA 2H43A 1ZLLA 5KKZC 5APUA 3JCUE 3TF5A 3PLNA 4GODA 1M1JC 1NTKJ 4GOEA 1GZLA 1N7SA 4D6TJ 2N1TC 1HBWA 3L72J 5BVZA 1S2EA 3HD7A 3S9OA 4PJ0E 1IZNB 1URQA 3L75E 2ITAA 3L74G 4L74A 2YMKA 1JB0J 1OVVA 3H32B 4M3LA 3AEEC 3OJAB 1EC5A 4GT1A 2NPSA 1QVGO 2E76D 1KYOH 2M3EA 5AW8B 2HODA 1OWAA 4R4LA 1PIXA 2ZYAA 2OYIA 1YHQP 1NKNA 3D71A 5KJ7A 2A06E 2ZXXA 3HE5A 4RESB 1Y9BA 3HD7C 1KFNA 1J1DB 3GHGA 5KLVK 2KI7B 2M0BA 5CCGD 2P7JA 3H1JG 3I56P 3E7KA 2L5GB 1L0LD 4I2LC 2IFNA 1PGPA 3A0BH 5B66E 2QEXP 1FZFA 2E75D 5AVUB 2HFED 3I5CA 3RL0D 4GIFA 2QJYC 2FYUE 3MIWA 2E74B 2IFMA 3IF4A 2OTKE 1PGJA 3G9RA 4KT0J 5AVRB 4RO0A 1A02J 1KB9D 2BCCG 2WITA 3USSA 2MKVA 2WT7A 1L0LJ 1WMKA 1W2BO 1FDIA 1L0ND 3O6QB 1Q82Q 1KZUB 2IBZI 1VQ5P 1MFZA 2WSSH 1LTBC 3GHGC 1K9MQ 3H1HD 1Q7YQ 4UB6E 3L70E 3CWBE 1AQ5A 1LTSC 1GL2B 3BRTB 3D6ZA 4EI2A 3CMEP 4H13C 1L0NJ 2ZT9D 2V7QH 3M9BA 2C9LY 3VMAA 1NU1D 5DJTB 3WU2H 1NYHA 3H1HJ 3CCSP 4EIJA 3B5NC 3BRVB 1IC2A 5GTHE 3R2PA 3KPEA 4WVZA 1SQBD 1KMIZ 2W83C 3NXSA 1PPJD 1LWUA 1EDIA 1NU1J 3HUSB 3L74E 1IFMA 3CX5E 1LGHB 1S5LX 5TJHA 1QL2A 3SWFA 1HUCA 1SQBJ 1AQTA 2ZYGA 4ZKUA 3VN0A 3MUDA 2XNDH 3AE3C 1JNMA 3D70A 1R5LA 1HWTC 4OVNF 3Q5SA 2KUBA 1GW4A 2GUVA 3BVHA 2P58A 3Q2YA 3AE4C 1MUUA 3HTKA 3P32A 3PJSK 3W68A 1PP9D 1FU1A 1FDOA 1SP4A 2J58A 1P84I 3CX5I 1S72P 3H1JE 3L71D 2Z5HA 1VQOP 1JTHA 2E5YA 2YXRB 2B88A 2Q7CA 3CC4P 1X8YA 4N78E 4OGQC 2HLOA 1G1IA 1PP9J 1KILE 4IFFA 3V4QA 5AW0B 2SPZA 3L71J 4NPDA 4H13D 1QVFO 2RMZA 5KAIH 2OYHB 1QGKB 2FFDB 1SQPD 3NFQA 2O01J 2QJPC 3C1LA 1BCCG 3F5HA 1T2KC 3M9HA 2YIUC 2YO3A 2WWWA 3VP9A 2JDIH 1EZVD 1JO5A 4WY4B 1LTGC 2A45H 2POHA 2WZ7A 1SQQD 5KLIC 1WRGA 1SQPJ 2FYNC 2W8ZA 4ASWA 4AUWA 4LGDE 1VQPP 4IOIH 3U1AA 5CBNA 1KTMA 1L4AB 1YBKA 1NTKK 1YJNP 3RL0g 1NO4A 1M1KQ 1ZRTE 4I7ZC 1SQQJ 2C9NY 1IFPA 2PRRA 2Q9IA 1NTZK 2W6JH 2I1JA 3V2PA 2XZRA 1FZCC 1X79B 3CCQP 3M91A 1M8OB 2E74D 1P84H 2XV5A 3PTZA 2M5AB 2L91A 3LW5J 2M3BA 2W90A 3TNUA 1SQVD 1AJYA 5KLVE 3E1RA 3EFGA 3H1IG 4EOTA 3MGNA 3CCVP 2R3SA 1FS0E 2WSFH 3HE4B 1LT9B 3FGAD 2KNCB 2QJKC 1GL2D 4IL6X 1SQVJ 1GMJA 1FBMA 3CCUP 2M8RA 3CMAP 3M06A 2IX7C 5CCGA 1H0TA 3V2NA 1EQ7A 1KILB 3UIAA 1BE3G 1JM0A 1XTGB 2OTJP 2KZIA 1N73C 1OXZA 2IBZG 3PHLA 3RK2C 1N7LA 1T2KD 1SQXD 5AVWB 2K1AA 5AW2B 1GDTA 1KB9H 2E76C 2KS1A 5KAFH 2KSEA 3IR9A 4DJGA 1JMMA 3TDKA 1LTJB 4XE5B 1L0LK 1HF9A 1SQXJ 2QA4P 3TSIA 1BCCE 2A06D 1IFIA 1W2EA 3F89A 1PFIA 1D7MA 3EQ2A 2LXBA 5CBOA 4B86A 1L0NK 1N7SB 1NTZG 4HKZH 2FY8A 5CCHC 1IFNA 3L70G 1FZAA 3CWBG 1HJ0A 2NRGA 1A02F 4WWIA 3WU2E 4H0LC 3CCLP 2AEMA 2FYUD 3AE6C 4KJMA 2K9YA 1NU1K 1Z56A 2AXCA 2NPSB 4Y99C 1FOSF 3CCEP 5L8RJ 1RF1A 5AW5B 3WUVA 2YKQA 4C7RA 1CI6B 2HODB 3S4RA 1VF5B 4H44C 2H89C 3CC7P 1JMBA 1SLQA 2OYIB 1SQBK 5KTBA 1IO4A 2IPPA 2JEEA 2FYUJ 1DEEG 3PRJA 5BU5A 2ZT9C 3Q3DA 2K9JA 2WSEH 4ZMDA 1S4XA 1VDFA 3H1KE 3HE5B 3T97A 4HH2A 2W6AA 3Q5PA 2KIKA 3H1IE 4ASVA 2KYVA 3RK2D 2IYPA 4WY4D 1FZEA 4DOJA 3CPWO 3VYIA 5BU8B 1EDJA 2IYOA 4ZKPA 1X9VA 3GF3A 2ZFCA 3VMZA 1LJ2A 4KHXA 4K35A 1DX7A 2QM8A 1OFCX 5AVTB 2IDBA 1M90Q 2PAJA 4K3AA 1RF1C 1L4AD 3TGUD 4L76A 2D2CB 3WMM0 1ZP0C 1JY2N 4LLHA 3OA7A 1BE3E 3L36A 3M0DA 3L74D 1R8EA 2IBZE 4DCKA 2WT7B 1KD1Q 1J1EC 3L35A 3SFEC 3GF7A 2HPCA 3RK3E 2Q6QA 2WSCJ 3TGUJ 3RBXA 1LP1B 1GU5A 2HR3A 2Y9ZA 2NZ2A 5CCHD 4AQRD 1IK7A 3H6PA 1L0NG 3L74J 1YJ9P 2MJZA 1VQ7P 4PV1C 4PD4D 4A7PA 5AW9B 1Q90D 2WPRA 1GTWA 5AW3B 1RF0C 5KAIE 3B5NA 1S9KE 3GG2A 1NTKE 3OW2O 1EXIA 4H0LD 1K73Q 1UIXA 1SQPK 3C8VA 3M0DC 1NTZE 1DD3A 2JO1A 2CPBA 1JY2O 2XU6A 1Y47A 3CXHD 1KV4A 1LWUB 2QSIA 4H44D 2WPQA 3CL3D 1SQQK 2Q3IA 3CLQA 1VQMP 1Q2NA 3PP5A 4YXWH 1SQBG 1GK6A 1KILD 5AVVB 1L2PA 2WVRA 1PGOA 1PPJG 3Q1MA 1YYCA 4L73A 1WT6A 5B5EH 2BCCD 2FYZA 4C7NA 3BCCG 1NTMK 2J5UA 4Y28J 1T8ZA 3VMXA 1JCDA 2YXQB 3KZIE 3H1LG 3KDPB 2JWAA 2A45I 3SFDC 2Q1KA 1P84E 2BCCJ 4BWNA 4MN4C 3L73D 2KLVA 3LIDA 2PFXA 1J1DC 1HTLC 1FZGA 1ZMEC 3A0HH 5CMZA 1OW6A 1CZQA 1MV8A 1BDDA 4U3FG 5AW6B 2WMMA 2Q3EA 1SQVK 4O9BA 5KLVG 3R4YA 3MTUE 1USEA 3L73J 2B9BA 2GA1A 1YJWP 5APYA 2WPVB 2OQQA 4IL6H 1YIJP 3EWKA 3RK3B 1KQLA 1NWQA 4PV1D 1L0LE 2E74C 3N4XA 3FXDA 3Q5RA 5EFWB 1FOSE 3BATA 2NPSD 1LTIC 2QIWA 1G2CA 1OX3A 3HUSA 1KB9E 3VTPC 1NGMB 1DH3A 5KAFE 1VQ6P 1SQPG 1SQXK 1U57A 2K3RA 1VF5D 3NMDA 1L0NE 1OVRA 2W6BA 3C9IA 3AE2C 4GDOA 1SFCB 1KYOD 1GL2C 2H7HA 3U59A 1MKMA 3MP7B 3LIEA 3H1HE 3ZDMA 1KQSO 1SQQG 3V4WA 4UB8E 1KN7A 1FZCA 1FC2C 1SS1A 5DJUB 3PH0A 2AXTH 3AECC 1BSHA 1NU1E 3IAOA 4R4MA 1U7MA 2R5DA 3AEFC 3SSUA 3MD0A 2ZAEB 3FWLA 1NTMG 1KB9I 2H8PD 3HUSC 2OTLP 2HYNA 1SQBE 1OVUA 2AEJA 1S1CX 1PPJE 3GW6A 4YXDC 3P8CD 3FXEA 2YKOA 1NH4A 3TNUB 1FDMA 5AW1B 3AEGC 4JYCA 3BCCE 4JBZA 1BCCD 2C0WA 1SVFA 1HGVA 1NAYA 2K88A 1G1JA 1SQVG 2FXOA 1EDLA 2LKMA 3H1LE 3KZIH 1QEXA 1N73A 1BCCJ 3KHUA 3H1KG 1BGYD 5AVXB 4U3FE 1OIPA 2P67A 5CHXA 2PGDA 5TISH 2E75B 1FJKA 2QE7H 3RL0B 2KS1B 1L4AA 1SFCC 5AVYB 1VQKP 2GM4A 1SQXG 1UIIA 1BGYJ 5C39A 1DIPA 5KKZB 2OYHC 1MZ9A 2FFDC 1MFTA 1M1JB 3KYQA 1OMIA 3AE1C 3L75D 3A5TA 2N1TB 5AW4B 3V6IA 1H89A 5CCHA 4JF7A 3OAKA 4WY4C 1YTZI 5K5GB 1VPCA 1SQPE 3M0AA 3NTNA 1X0TA 3B8EB 1RE3C 3H1ID 2Y0EA 3VOPA 2M5AA 4YPCA 1YTZT 2J59M 2N9YB 2JJLA 2E43A 2G8YA 3L75J 2WTYA 1KORA 1BDCA 1JY3N 1GW3A 1SQQE 1L4AC 3CXHH 2LR2A 1ZW0A 3V2RA 3WUTA 4UB8H 2IZ0A 3H1IJ 2KNCA 1NTKG 1FJPA 1OW8A 5E79H 1AA0A 4D6TG 2GUSA 5AW7B 1QL1A 3L72G 2IBZD 1PGQA 1IJDB 4YTPC 4I1LA 2QG4A 1NTME 2OYOA 2A45G 1KILA 4WB4A 2P2UA 3HD7B 3RK3D 1RE4A 3A2AA 1IK9A 2V4HA 1URQB 2Y9YA 2KB7P 1LTAC 2KLUA 2K9JB 3T97B 2QM7A 3A7OA 1S3JA 2R5BA 5B5EE 1AV1A 1JEKA 3ITKA 3A3YB 4GKGA 1NOHA 1FZBA 3E1IA 1JY3O 1M56D 3AEBC 2B87A 1VQ4P 3V5BA 1SQVE 1LNQA 5APSA 1LT9C 2QJYB 1SFCD 4DT0A 1VQLP 3I55P 1NTZD 2JR8A 1M7LA 1HH0A 4BRYA 3CCMP 2HG5D 2OGUA 2XKMA 2FXPA 1JUNA 1NJIQ 1S5LH 1KILC 4JQ0D 3L70D 3JC22 3A0HE 3CWBD 1CW5A 1RE4C 3TK1A 4DZOA 2Q5UA 3GHGB 1EXJA 3TGUG 3B4SA 1NTZJ 2KOGA 1FAVA 1RQVA 2HPCB 1K04A 4C46A 4N6JA 2E42A 3TYYA 1DEBA 4H13B 1SQXE 3AE5C 5H2FH 3RBZA 3B71A 3L70J 3CWBJ 1RF0A 1LTJC 4IL6E 4OWFA 5CJ0A 1HJBA 2OARA 2KSJA 3VP8A 3ABVC 2O01H 3AE9C 1ZXGA 3EFFK 1FE6A 3B5NB 1L0LG 2BASA 4N3YB 3L37A 1CI6A 1P84D 3CX5D 2BEZF 3CD6P 4IFDK 1N7SC 3S1KA 1XTCC 2YMYA 3BASA 5AVQB 2XNXA 1RY3A 3KXDA 2RKLA 3O8ZA 1K05A 2O1JA 3H32A 3MHVA 1VQ8P 4EDFA 1URQC 1NVOA 1T3JA 2Y0CA 1YQ4C 1QLED 3H1HG 2XDJA 1OZHA 3G3ZA 1GU4A 1JY2P 1BSNA 2CK3H 1W5CE 4D6TE 2AXTE 2NPSC 3L72E 2WSFJ 2RH0A 2N9BA 3CI9A 5M1BA 2PP6A 3AEDC 4C7NB 4L75A 1NU1G 2E5TA 1VF5C 3H1JD 2OYIC 1USDA 5KJ7C 1M57D 3QWOC 3LW5H 4N78D 3CC2P 1ZR4A 1JOCA 2QRXA 2I1KA 1LP1A 3WUUA 4AYCA 3N7NA 2N1TD 4WBAA 3H1JJ 5GTIH 4Z1MH 4OGQB 2O1KA 3GLMA 3K5BA 3L73G 1YI2P 1N2DC 1PZQA 3QH9A 3IN6A 2R32A 1HGZA 3V2QA 2D2CC 1LTTC 2QJPB 2WQYC 1EDKA 3O6QA 3JCUH 1PL5A 2YIUB 1K8AQ 3HTKB 1J2JB 3TGUE 1RH5B 1T3UA 2FXMA 3G71P 1G2CB 5TISE 5KLIB 2W27A 1JTHB 2K37A 4W7ZA 1GL2A 1ZRTD 2FYNB 4PJ0H 1YQ3C 1N7SD 1PP9G 4QMAA 3CCRP 1PV3A 3HD7D 3BCCD 4W80A 3L71G 1ZN5A 2YNYA 4OH8B 1URQD
chains in the Genus database with same CATH topology
1SQQG 1NTZG 3TGUG 4U3FG 3H1HG 1KB9H 2FYUG 3H1LG 1SQPG 3H1IG 1NTMG 2BCCG 5KLVG 1L0LG 2A06G 1PP9G 1BCCG 1KYOH 3L73G 3CX5H 1NTKG 1P84H 3L74G 1L0NG 3L75G 3L70G 1BE3G 4D6TG 3CWBG 3BCCG 4PD4H 1BGYG 3L72G 1SQBG 1EZVG 3L71G 1SQXG 3H1KG 2IBZG 1SQVG 1PPJG 3CXHH 3H1JG 1NU1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQQ G;  1NTZ G;  3TGU G;  4U3F G;  3H1H G;  1KB9 H;  2FYU G;  3H1L G;  1SQP G;  3H1I G;  1NTM G;  2BCC G;  5KLV G;  1L0L G;  2A06 G;  1PP9 G;  1BCC G;  1KYO H;  3L73 G;  3CX5 H;  1NTK G;  1P84 H;  3L74 G;  1L0N G;  3L75 G;  3L70 G;  1BE3 G;  4D6T G;  3CWB G;  3BCC G;  4PD4 H;  1BGY G;  3L72 G;  1SQB G;  1EZV G;  3L71 G;  1SQX G;  3H1K G;  2IBZ G;  1SQV G;  1PPJ G;  3CXH H;  3H1J G;  1NU1 G; 
#chains in the Genus database with same CATH topology
 4I7Z B;  1VQ9 P;  3U1C A;  3H1L D;  3G6E P;  3AE8 C;  4ZNC A;  2FBW C;  1FZC B;  4PD4 E;  1HVV A;  3BCC J;  3G4S P;  2CPS A;  2ZXE B;  1Y8A A;  3H25 A;  2KXP B;  5CJ4 A;  4U3F D;  3H1L J;  1LWU C;  5KLV D;  1AFO A;  3VMY A;  3M9Q A;  4NPE A;  5KJ7 D;  2JKV A;  3GMA A;  2WSE J;  1EZV G;  2RN0 A;  2AEF A;  3CXH E;  2UWJ E;  1OW7 A;  4JPZ B;  4U3F J;  3CCJ P;  3MUD C;  5KLV J;  5E79 E;  4RKU J;  5B66 H;  3IFM A;  2QJK B;  2R44 A;  4PD4 I;  1KFM A;  1NKZ B;  1KQF B;  2O3J A;  3JSV C;  1ZR2 A;  2WPS A;  2R3C A;  2BCC E;  4CPG A;  1YIT P;  3RGU A;  3MZW B;  2D2C D;  3B5N D;  1N73 B;  3RK2 B;  5APT A;  4NPF X;  1AVY A;  2E76 B;  1KC8 Q;  3CXH I;  1Q86 Q;  1CSB A;  1SFC A;  1Q81 Q;  1QX8 A;  3L73 E;  1NHL A;  4UB6 H;  1VL2 A;  2ZYD A;  2FYU K;  1ZOY C;  2ZVN B;  1BGY G;  4U7J A;  2VRS A;  2OYH A;  2KZJ A;  2FFD A;  3HRN A;  3RK3 C;  2KK7 A;  1E79 H;  4HYT B;  2FKW B;  4RJT A;  5APW A;  1LT1 A;  2P10 A;  1VQN P;  1GD2 E;  1NTM D;  1S5L E;  3AEA C;  4WY4 A;  5GTH H;  2QVA A;  1KQG B;  3P7K A;  2Y0D A;  4W7Y A;  1H0T B;  5APV A;  4XA4 A;  1RE3 A;  3SWK A;  2WSC H;  2BEQ D;  1PP9 E;  1TU3 F;  1NTM J;  3CX5 H;  3L75 G;  5H2F E;  3L71 E;  2H88 C;  2KP8 A;  1NAF A;  4H0L B;  2V7Q J;  2I8D A;  4BXL A;  1KYO E;  2G3A A;  4TLF A;  4Y99 B;  3SWY A;  4OGQ D;  4PD4 H;  3II6 A;  1H88 A;  1N86 A;  3H1K D;  2C0X A;  1AVO A;  4H44 B;  2B89 A;  3L4F A;  1H8A A;  4IFM A;  1JCC A;  2LXC B;  4I6M C;  2ZT9 B;  2A06 G;  2IZ1 A;  1T6A A;  3P8M C;  3AE7 C;  1EZV E;  5APX A;  1N8R Q;  5AVZ B;  3H1K J;  1E5W A;  5AVS B;  4EYY Q;  3HE4 A;  4LC1 A;  1LT9 A;  1RQU A;  3A0B E;  2DW3 A;  3D6Y A;  1IFJ A;  1KYO I;  3P8C E;  2Z4E A;  1BE3 D;  2B87 B;  1X22 A;  4HB1 A;  1DD4 A;  1RF1 B;  2P1J A;  2FYU G;  1M1J A;  4TT3 H;  5APQ A;  4HJG H;  1RHZ B;  2N1T A;  4BRY B;  3W67 A;  5CCG C;  1J1E B;  1GK4 A;  1JY3 P;  1U7J A;  2ZVO B;  1BE3 J;  1EZV I;  3FX0 A;  3KQG A;  2YKP A;  5GTI E;  2O01 N;  2JWD A;  2E75 C;  1IFD A;  1ZV8 A;  4GOF A;  1S9K D;  1LTJ A;  4JYB A;  3RL0 C;  1BGY E;  2ZJS E;  1NTK D;  1R5S A;  4D6T D;  2Z5I A;  4PV1 B;  2JP3 A;  3L72 D;  4XFJ A;  2YO2 A;  3FWN A;  2H43 A;  1ZLL A;  5KKZ C;  5APU A;  3JCU E;  3TF5 A;  3PLN A;  4GOD A;  1M1J C;  1NTK J;  4GOE A;  1GZL A;  1N7S A;  4D6T J;  2N1T C;  1HBW A;  3L72 J;  5BVZ A;  1S2E A;  3HD7 A;  3S9O A;  4PJ0 E;  1IZN B;  1URQ A;  3L75 E;  2ITA A;  3L74 G;  4L74 A;  2YMK A;  1JB0 J;  1OVV A;  3H32 B;  4M3L A;  3AEE C;  3OJA B;  1EC5 A;  4GT1 A;  2NPS A;  1QVG O;  2E76 D;  1KYO H;  2M3E A;  5AW8 B;  2HOD A;  1OWA A;  4R4L A;  1PIX A;  2ZYA A;  2OYI A;  1YHQ P;  1NKN A;  3D71 A;  5KJ7 A;  2A06 E;  2ZXX A;  3HE5 A;  4RES B;  1Y9B A;  3HD7 C;  1KFN A;  1J1D B;  3GHG A;  5KLV K;  2KI7 B;  2M0B A;  5CCG D;  2P7J A;  3H1J G;  3I56 P;  3E7K A;  2L5G B;  1L0L D;  4I2L C;  2IFN A;  1PGP A;  3A0B H;  5B66 E;  2QEX P;  1FZF A;  2E75 D;  5AVU B;  2HFE D;  3I5C A;  3RL0 D;  4GIF A;  2QJY C;  2FYU E;  3MIW A;  2E74 B;  2IFM A;  3IF4 A;  2OTK E;  1PGJ A;  3G9R A;  4KT0 J;  5AVR B;  4RO0 A;  1A02 J;  1KB9 D;  2BCC G;  2WIT A;  3USS A;  2MKV A;  2WT7 A;  1L0L J;  1WMK A;  1W2B O;  1FDI A;  1L0N D;  3O6Q B;  1Q82 Q;  1KZU B;  2IBZ I;  1VQ5 P;  1MFZ A;  2WSS H;  1LTB C;  3GHG C;  1K9M Q;  3H1H D;  1Q7Y Q;  4UB6 E;  3L70 E;  3CWB E;  1AQ5 A;  1LTS C;  1GL2 B;  3BRT B;  3D6Z A;  4EI2 A;  3CME P;  4H13 C;  1L0N J;  2ZT9 D;  2V7Q H;  3M9B A;  2C9L Y;  3VMA A;  1NU1 D;  5DJT B;  3WU2 H;  1NYH A;  3H1H J;  3CCS P;  4EIJ A;  3B5N C;  3BRV B;  1IC2 A;  5GTH E;  3R2P A;  3KPE A;  4WVZ A;  1SQB D;  1KMI Z;  2W83 C;  3NXS A;  1PPJ D;  1LWU A;  1EDI A;  1NU1 J;  3HUS B;  3L74 E;  1IFM A;  3CX5 E;  1LGH B;  1S5L X;  5TJH A;  1QL2 A;  3SWF A;  1HUC A;  1SQB J;  1AQT A;  2ZYG A;  4ZKU A;  3VN0 A;  3MUD A;  2XND H;  3AE3 C;  1JNM A;  3D70 A;  1R5L A;  1HWT C;  4OVN F;  3Q5S A;  2KUB A;  1GW4 A;  2GUV A;  3BVH A;  2P58 A;  3Q2Y A;  3AE4 C;  1MUU A;  3HTK A;  3P32 A;  3PJS K;  3W68 A;  1PP9 D;  1FU1 A;  1FDO A;  1SP4 A;  2J58 A;  1P84 I;  3CX5 I;  1S72 P;  3H1J E;  3L71 D;  2Z5H A;  1VQO P;  1JTH A;  2E5Y A;  2YXR B;  2B88 A;  2Q7C A;  3CC4 P;  1X8Y A;  4N78 E;  4OGQ C;  2HLO A;  1G1I A;  1PP9 J;  1KIL E;  4IFF A;  3V4Q A;  5AW0 B;  2SPZ A;  3L71 J;  4NPD A;  4H13 D;  1QVF O;  2RMZ A;  5KAI H;  2OYH B;  1QGK B;  2FFD B;  1SQP D;  3NFQ A;  2O01 J;  2QJP C;  3C1L A;  1BCC G;  3F5H A;  1T2K C;  3M9H A;  2YIU C;  2YO3 A;  2WWW A;  3VP9 A;  2JDI H;  1EZV D;  1JO5 A;  4WY4 B;  1LTG C;  2A45 H;  2POH A;  2WZ7 A;  1SQQ D;  5KLI C;  1WRG A;  1SQP J;  2FYN C;  2W8Z A;  4ASW A;  4AUW A;  4LGD E;  1VQP P;  4IOI H;  3U1A A;  5CBN A;  1KTM A;  1L4A B;  1YBK A;  1NTK K;  1YJN P;  3RL0 g;  1NO4 A;  1M1K Q;  1ZRT E;  4I7Z C;  1SQQ J;  2C9N Y;  1IFP A;  2PRR A;  2Q9I A;  1NTZ K;  2W6J H;  2I1J A;  3V2P A;  2XZR A;  1FZC C;  1X79 B;  3CCQ P;  3M91 A;  1M8O B;  2E74 D;  1P84 H;  2XV5 A;  3PTZ A;  2M5A B;  2L91 A;  3LW5 J;  2M3B A;  2W90 A;  3TNU A;  1SQV D;  1AJY A;  5KLV E;  3E1R A;  3EFG A;  3H1I G;  4EOT A;  3MGN A;  3CCV P;  2R3S A;  1FS0 E;  2WSF H;  3HE4 B;  1LT9 B;  3FGA D;  2KNC B;  2QJK C;  1GL2 D;  4IL6 X;  1SQV J;  1GMJ A;  1FBM A;  3CCU P;  2M8R A;  3CMA P;  3M06 A;  2IX7 C;  5CCG A;  1H0T A;  3V2N A;  1EQ7 A;  1KIL B;  3UIA A;  1BE3 G;  1JM0 A;  1XTG B;  2OTJ P;  2KZI A;  1N73 C;  1OXZ A;  2IBZ G;  3PHL A;  3RK2 C;  1N7L A;  1T2K D;  1SQX D;  5AVW B;  2K1A A;  5AW2 B;  1GDT A;  1KB9 H;  2E76 C;  2KS1 A;  5KAF H;  2KSE A;  3IR9 A;  4DJG A;  1JMM A;  3TDK A;  1LTJ B;  4XE5 B;  1L0L K;  1HF9 A;  1SQX J;  2QA4 P;  3TSI A;  1BCC E;  2A06 D;  1IFI A;  1W2E A;  3F89 A;  1PFI A;  1D7M A;  3EQ2 A;  2LXB A;  5CBO A;  4B86 A;  1L0N K;  1N7S B;  1NTZ G;  4HKZ H;  2FY8 A;  5CCH C;  1IFN A;  3L70 G;  1FZA A;  3CWB G;  1HJ0 A;  2NRG A;  1A02 F;  4WWI A;  3WU2 E;  4H0L C;  3CCL P;  2AEM A;  2FYU D;  3AE6 C;  4KJM A;  2K9Y A;  1NU1 K;  1Z56 A;  2AXC A;  2NPS B;  4Y99 C;  1FOS F;  3CCE P;  5L8R J;  1RF1 A;  5AW5 B;  3WUV A;  2YKQ A;  4C7R A;  1CI6 B;  2HOD B;  3S4R A;  1VF5 B;  4H44 C;  2H89 C;  3CC7 P;  1JMB A;  1SLQ A;  2OYI B;  1SQB K;  5KTB A;  1IO4 A;  2IPP A;  2JEE A;  2FYU J;  1DEE G;  3PRJ A;  5BU5 A;  2ZT9 C;  3Q3D A;  2K9J A;  2WSE H;  4ZMD A;  1S4X A;  1VDF A;  3H1K E;  3HE5 B;  3T97 A;  4HH2 A;  2W6A A;  3Q5P A;  2KIK A;  3H1I E;  4ASV A;  2KYV A;  3RK2 D;  2IYP A;  4WY4 D;  1FZE A;  4DOJ A;  3CPW O;  3VYI A;  5BU8 B;  1EDJ A;  2IYO A;  4ZKP A;  1X9V A;  3GF3 A;  2ZFC A;  3VMZ A;  1LJ2 A;  4KHX A;  4K35 A;  1DX7 A;  2QM8 A;  1OFC X;  5AVT B;  2IDB A;  1M90 Q;  2PAJ A;  4K3A A;  1RF1 C;  1L4A D;  3TGU D;  4L76 A;  2D2C B;  3WMM 0;  1ZP0 C;  1JY2 N;  4LLH A;  3OA7 A;  1BE3 E;  3L36 A;  3M0D A;  3L74 D;  1R8E A;  2IBZ E;  4DCK A;  2WT7 B;  1KD1 Q;  1J1E C;  3L35 A;  3SFE C;  3GF7 A;  2HPC A;  3RK3 E;  2Q6Q A;  2WSC J;  3TGU J;  3RBX A;  1LP1 B;  1GU5 A;  2HR3 A;  2Y9Z A;  2NZ2 A;  5CCH D;  4AQR D;  1IK7 A;  3H6P A;  1L0N G;  3L74 J;  1YJ9 P;  2MJZ A;  1VQ7 P;  4PV1 C;  4PD4 D;  4A7P A;  5AW9 B;  1Q90 D;  2WPR A;  1GTW A;  5AW3 B;  1RF0 C;  5KAI E;  3B5N A;  1S9K E;  3GG2 A;  1NTK E;  3OW2 O;  1EXI A;  4H0L D;  1K73 Q;  1UIX A;  1SQP K;  3C8V A;  3M0D C;  1NTZ E;  1DD3 A;  2JO1 A;  2CPB A;  1JY2 O;  2XU6 A;  1Y47 A;  3CXH D;  1KV4 A;  1LWU B;  2QSI A;  4H44 D;  2WPQ A;  3CL3 D;  1SQQ K;  2Q3I A;  3CLQ A;  1VQM P;  1Q2N A;  3PP5 A;  4YXW H;  1SQB G;  1GK6 A;  1KIL D;  5AVV B;  1L2P A;  2WVR A;  1PGO A;  1PPJ G;  3Q1M A;  1YYC A;  4L73 A;  1WT6 A;  5B5E H;  2BCC D;  2FYZ A;  4C7N A;  3BCC G;  1NTM K;  2J5U A;  4Y28 J;  1T8Z A;  3VMX A;  1JCD A;  2YXQ B;  3KZI E;  3H1L G;  3KDP B;  2JWA A;  2A45 I;  3SFD C;  2Q1K A;  1P84 E;  2BCC J;  4BWN A;  4MN4 C;  3L73 D;  2KLV A;  3LID A;  2PFX A;  1J1D C;  1HTL C;  1FZG A;  1ZME C;  3A0H H;  5CMZ A;  1OW6 A;  1CZQ A;  1MV8 A;  1BDD A;  4U3F G;  5AW6 B;  2WMM A;  2Q3E A;  1SQV K;  4O9B A;  5KLV G;  3R4Y A;  3MTU E;  1USE A;  3L73 J;  2B9B A;  2GA1 A;  1YJW P;  5APY A;  2WPV B;  2OQQ A;  4IL6 H;  1YIJ P;  3EWK A;  3RK3 B;  1KQL A;  1NWQ A;  4PV1 D;  1L0L E;  2E74 C;  3N4X A;  3FXD A;  3Q5R A;  5EFW B;  1FOS E;  3BAT A;  2NPS D;  1LTI C;  2QIW A;  1G2C A;  1OX3 A;  3HUS A;  1KB9 E;  3VTP C;  1NGM B;  1DH3 A;  5KAF E;  1VQ6 P;  1SQP G;  1SQX K;  1U57 A;  2K3R A;  1VF5 D;  3NMD A;  1L0N E;  1OVR A;  2W6B A;  3C9I A;  3AE2 C;  4GDO A;  1SFC B;  1KYO D;  1GL2 C;  2H7H A;  3U59 A;  1MKM A;  3MP7 B;  3LIE A;  3H1H E;  3ZDM A;  1KQS O;  1SQQ G;  3V4W A;  4UB8 E;  1KN7 A;  1FZC A;  1FC2 C;  1SS1 A;  5DJU B;  3PH0 A;  2AXT H;  3AEC C;  1BSH A;  1NU1 E;  3IAO A;  4R4M A;  1U7M A;  2R5D A;  3AEF C;  3SSU A;  3MD0 A;  2ZAE B;  3FWL A;  1NTM G;  1KB9 I;  2H8P D;  3HUS C;  2OTL P;  2HYN A;  1SQB E;  1OVU A;  2AEJ A;  1S1C X;  1PPJ E;  3GW6 A;  4YXD C;  3P8C D;  3FXE A;  2YKO A;  1NH4 A;  3TNU B;  1FDM A;  5AW1 B;  3AEG C;  4JYC A;  3BCC E;  4JBZ A;  1BCC D;  2C0W A;  1SVF A;  1HGV A;  1NAY A;  2K88 A;  1G1J A;  1SQV G;  2FXO A;  1EDL A;  2LKM A;  3H1L E;  3KZI H;  1QEX A;  1N73 A;  1BCC J;  3KHU A;  3H1K G;  1BGY D;  5AVX B;  4U3F E;  1OIP A;  2P67 A;  5CHX A;  2PGD A;  5TIS H;  2E75 B;  1FJK A;  2QE7 H;  3RL0 B;  2KS1 B;  1L4A A;  1SFC C;  5AVY B;  1VQK P;  2GM4 A;  1SQX G;  1UII A;  1BGY J;  5C39 A;  1DIP A;  5KKZ B;  2OYH C;  1MZ9 A;  2FFD C;  1MFT A;  1M1J B;  3KYQ A;  1OMI A;  3AE1 C;  3L75 D;  3A5T A;  2N1T B;  5AW4 B;  3V6I A;  1H89 A;  5CCH A;  4JF7 A;  3OAK A;  4WY4 C;  1YTZ I;  5K5G B;  1VPC A;  1SQP E;  3M0A A;  3NTN A;  1X0T A;  3B8E B;  1RE3 C;  3H1I D;  2Y0E A;  3VOP A;  2M5A A;  4YPC A;  1YTZ T;  2J59 M;  2N9Y B;  2JJL A;  2E43 A;  2G8Y A;  3L75 J;  2WTY A;  1KOR A;  1BDC A;  1JY3 N;  1GW3 A;  1SQQ E;  1L4A C;  3CXH H;  2LR2 A;  1ZW0 A;  3V2R A;  3WUT A;  4UB8 H;  2IZ0 A;  3H1I J;  2KNC A;  1NTK G;  1FJP A;  1OW8 A;  5E79 H;  1AA0 A;  4D6T G;  2GUS A;  5AW7 B;  1QL1 A;  3L72 G;  2IBZ D;  1PGQ A;  1IJD B;  4YTP C;  4I1L A;  2QG4 A;  1NTM E;  2OYO A;  2A45 G;  1KIL A;  4WB4 A;  2P2U A;  3HD7 B;  3RK3 D;  1RE4 A;  3A2A A;  1IK9 A;  2V4H A;  1URQ B;  2Y9Y A;  2KB7 P;  1LTA C;  2KLU A;  2K9J B;  3T97 B;  2QM7 A;  3A7O A;  1S3J A;  2R5B A;  5B5E E;  1AV1 A;  1JEK A;  3ITK A;  3A3Y B;  4GKG A;  1NOH A;  1FZB A;  3E1I A;  1JY3 O;  1M56 D;  3AEB C;  2B87 A;  1VQ4 P;  3V5B A;  1SQV E;  1LNQ A;  5APS A;  1LT9 C;  2QJY B;  1SFC D;  4DT0 A;  1VQL P;  3I55 P;  1NTZ D;  2JR8 A;  1M7L A;  1HH0 A;  4BRY A;  3CCM P;  2HG5 D;  2OGU A;  2XKM A;  2FXP A;  1JUN A;  1NJI Q;  1S5L H;  1KIL C;  4JQ0 D;  3L70 D;  3JC2 2;  3A0H E;  3CWB D;  1CW5 A;  1RE4 C;  3TK1 A;  4DZO A;  2Q5U A;  3GHG B;  1EXJ A;  3TGU G;  3B4S A;  1NTZ J;  2KOG A;  1FAV A;  1RQV A;  2HPC B;  1K04 A;  4C46 A;  4N6J A;  2E42 A;  3TYY A;  1DEB A;  4H13 B;  1SQX E;  3AE5 C;  5H2F H;  3RBZ A;  3B71 A;  3L70 J;  3CWB J;  1RF0 A;  1LTJ C;  4IL6 E;  4OWF A;  5CJ0 A;  1HJB A;  2OAR A;  2KSJ A;  3VP8 A;  3ABV C;  2O01 H;  3AE9 C;  1ZXG A;  3EFF K;  1FE6 A;  3B5N B;  1L0L G;  2BAS A;  4N3Y B;  3L37 A;  1CI6 A;  1P84 D;  3CX5 D;  2BEZ F;  3CD6 P;  4IFD K;  1N7S C;  3S1K A;  1XTC C;  2YMY A;  3BAS A;  5AVQ B;  2XNX A;  1RY3 A;  3KXD A;  2RKL A;  3O8Z A;  1K05 A;  2O1J A;  3H32 A;  3MHV A;  1VQ8 P;  4EDF A;  1URQ C;  1NVO A;  1T3J A;  2Y0C A;  1YQ4 C;  1QLE D;  3H1H G;  2XDJ A;  1OZH A;  3G3Z A;  1GU4 A;  1JY2 P;  1BSN A;  2CK3 H;  1W5C E;  4D6T E;  2AXT E;  2NPS C;  3L72 E;  2WSF J;  2RH0 A;  2N9B A;  3CI9 A;  5M1B A;  2PP6 A;  3AED C;  4C7N B;  4L75 A;  1NU1 G;  2E5T A;  1VF5 C;  3H1J D;  2OYI C;  1USD A;  5KJ7 C;  1M57 D;  3QWO C;  3LW5 H;  4N78 D;  3CC2 P;  1ZR4 A;  1JOC A;  2QRX A;  2I1K A;  1LP1 A;  3WUU A;  4AYC A;  3N7N A;  2N1T D;  4WBA A;  3H1J J;  5GTI H;  4Z1M H;  4OGQ B;  2O1K A;  3GLM A;  3K5B A;  3L73 G;  1YI2 P;  1N2D C;  1PZQ A;  3QH9 A;  3IN6 A;  2R32 A;  1HGZ A;  3V2Q A;  2D2C C;  1LTT C;  2QJP B;  2WQY C;  1EDK A;  3O6Q A;  3JCU H;  1PL5 A;  2YIU B;  1K8A Q;  3HTK B;  1J2J B;  3TGU E;  1RH5 B;  1T3U A;  2FXM A;  3G71 P;  1G2C B;  5TIS E;  5KLI B;  2W27 A;  1JTH B;  2K37 A;  4W7Z A;  1GL2 A;  1ZRT D;  2FYN B;  4PJ0 H;  1YQ3 C;  1N7S D;  1PP9 G;  4QMA A;  3CCR P;  1PV3 A;  3HD7 D;  3BCC D;  4W80 A;  3L71 G;  1ZN5 A;  2YNY A;  4OH8 B;  1URQ D; 
#chains in the Genus database with same CATH homology
 1SQQ G;  1NTZ G;  3TGU G;  4U3F G;  3H1H G;  1KB9 H;  2FYU G;  3H1L G;  1SQP G;  3H1I G;  1NTM G;  2BCC G;  5KLV G;  1L0L G;  2A06 G;  1PP9 G;  1BCC G;  1KYO H;  3L73 G;  3CX5 H;  1NTK G;  1P84 H;  3L74 G;  1L0N G;  3L75 G;  3L70 G;  1BE3 G;  4D6T G;  3CWB G;  3BCC G;  4PD4 H;  1BGY G;  3L72 G;  1SQB G;  1EZV G;  3L71 G;  1SQX G;  3H1K G;  2IBZ G;  1SQV G;  1PPJ G;  3CXH H;  3H1J G;  1NU1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...