1KYOH

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
93
structure length
93
Chain Sequence
GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 13
structure length 93
sequence length 93
chains with identical sequence S
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1kyoH00
5KLVG 1EZVG 1NTMG 1BGYG 1P84H 1L0LG 1SQQG 1L0NG 3L73G 1SQXG 2IBZG 1KB9H 3BCCG 4PD4H 3CXHH 2BCCG 1PPJG 3L74G 3H1IG 1BE3G 3H1KG 1NTKG 1SQBG 1SQVG 3CWBG 3H1LG 3L71G 4D6TG 3L70G 1PP9G 3L72G 3CX5H 3H1HG 1SQPG 3H1JG 1KYOH 4U3FG 1NU1G 3TGUG 1NTZG 3L75G 1BCCG 2FYUG 2A06G
chains in the Genus database with same CATH superfamily
2N9BA 4ZKPA 1SQQD 3ABVC 2BCCD 2IFNA 2Z5HA 3L73D 3WU2E 2OYIA 3AE4C 3HTKA 1RF1A 2KNCB 1JY2N 4JQ0D 3AEEC 1AVOA 1JY2O 2L91A 1YBKA 3IAOA 2P58A 3P8CE 2WSSH 2WWWA 4I2LC 4IFDK 2KK7A 2BEQD 1FAVA 4L74A 3WU2H 3AE5C 1JCDA 2B89A 2YKOA 3H1JD 3HE5B 4GDOA 4H0LD 1YJ9P 1KC8Q 3L72D 1M57D 1PGQA 2Q3EA 1S2EA 2R5DA 2E75D 1K8AQ 1IFNA 2E43A 3OAKA 1YQ4C 2D2CC 1ZW0A 5KJ7A 1LTJA 2WSEH 2V7QH 3SWKA 1GL2D 2IX7C 2KUBA 3GF7A 2N9YB 2KLUA 3H1JG 1BSNA 2P10A 1NTMK 1FE6A 1GW3A 4U7JA 1BCCG 2M3EA 2QJPC 1JMMA 1VPCA 1YYCA 3M91A 1G1JA 4H13D 1FZCC 3GHGB 1P84E 1X79B 2K1AA 2KLVA 3R4YA 3UIAA 5CJ4A 2PFXA 4DZOA 1QGKB 3HRNA 5EFWB 2Q6QA 2IBZI 3GHGC 3NTNA 4GOFA 4ASWA 1BCCD 2WTYA 2KI7B 3BVHA 1SQBD 3H1LD 2JWAA 1DEBA 1NTMJ 1SQXG 1URQC 1VDFA 2YKQA 1NO4A 1KB9H 1N2DC 2Y0EA 1NAFA 2ZXXA 3JCUH 4JBZA 2FYUE 1EDKA 1VQNP 1NKNA 2E74D 2YXQB 4HB1A 3H1IG 4RKUJ 2IYPA 4ZMDA 2HODA 5KAIE 2QSIA 1FOSF 1YTZI 3M06A 4U3FJ 3CCMP 4KHXA 1OW6A 1M1JC 4L76A 1H89A 1RF1B 2ZJSE 2P7JA 4W7ZA 2QEXP 3H1HG 4HYTB 3A0BH 2YXRB 4GKGA 1QVFO 1WRGA 1GW4A 1EZVI 3FGAD 4OGQC 5AVVB 4DOJA 3L75G 3CCVP 3TYYA 4AUWA 3PJSK 1LWUB 3SFEC 1LT9B 2QM8A 4UB6E 1VQKP 1NU1D 2JWDA 1OX3A 1QEXA 2YMYA 4OGQD 4DJGA 1VQ9P 4PD4I 2AEFA 1NTZK 2NRGA 5KLVD 2YKPA 3LIDA 4GIFA 1SP4A 2K9YA 3PP5A 3M9BA 4K3AA 3TGUJ 2QJYB 1D7MA 2OARA 1MUUA 1H8AA 2JR8A 1SQVK 1HGZA 2M0BA 2KSEA 3H1JE 1HJ0A 2BCCE 2KIKA 1SQXK 2G8YA 1E79H 1L0LJ 3B4SA 2HLOA 3PRJA 3EQ2A 3RL0C 1K9MQ 3H1HE 1HBWA 2AXTH 4PD4D 1PP9D 2WT7B 1KQLA 1SQVJ 1W2EA 2FKWB 3HD7D 1SQQE 3L73E 4N78E 3Q3DA 1JUNA 1LWUA 2LXCB 4LC1A 1SVFA 1K04A 2JKVA 2W6AA 3CLQA 3CXHI 1N7SD 3CC4P 3MD0A 3H6PA 1KD1Q 4D6TJ 3CMEP 2IDBA 2QJPB 3BCCD 5APTA 2H88C 4NPDA 4ZNCA 1YQ3C 3P32A 1Z56A 1M1JB 2ZYGA 3AEGC 3KPEA 1U7MA 1L4AB 4BRYA 1FDMA 5CMZA 1PPJG 3BRVB 2ZVOB 2C0XA 3Q2YA 1J1EC 1BGYJ 1N86A 3H1KG 4OGQB 1RQUA 3V5BA 4ASVA 1SS1A 3RBZA 4DCKA 3KHUA 1QL1A 3H1ID 1LT9C 1RE3C 5B5EE 3VMYA 1NTKD 3BCCE 1OVRA 2RMZA 3JCUE 4IL6X 5CCGC 1IZNB 3QH9A 3L71D 2W90A 3TGUD 5KLIC 1LTIC 1BDCA 1J1DB 3H1KD 1USEA 1L0LE 1P84I 3KZIE 1L0ND 1Q86Q 1VQ5P 3D6YA 2ZYDA 1JY2P 4H44D 4PJ0H 1IFIA 4LGDE 2QJYC 1HUCA 4YPCA 4C7NB 2CPBA 3V2QA 1OW8A 4PJ0E 1OWAA 1YJWP 4XE5B 1A02F 1ZMEC 2AXCA 2JO1A 3M0DA 3HD7A 2A45I 4Y28J 3V4WA 2RN0A 3NXSA 1L0NG 1LTSC 3PHLA 5AVRB 1PP9J 1XTGB 1YIJP 1KZUB 1BE3J 1IFMA 3H1HJ 1Y8AA 2P2UA 2Q1KA 3HD7B 3SFDC 3EFFK 2H8PD 5AW0B 3CPWO 1AQTA 4IL6H 1VF5B 2M5AB 3L74G 5CCGA 2HPCA 3GF3A 1AV1A 1H0TA 3RL0g 3H25A 1SLQA 3BATA 1LTBC 2K88A 3TDKA 2M5AA 4IFMA 3CX5H 1IJDB 2Y0DA 3CX5I 2AEJA 2Y0CA 1HGVA 2FXMA 4HH2A 2E74B 3OW2O 3USSA 5AVZB 1L4AD 1YHQP 1NU1E 1AQ5A 2WSFJ 1MV8A 5AW1B 1S3JA 2J5UA 2Q7CA 1CSBA 1LTJC 1NAYA 1LTAC 5DJTB 3Q5PA 5BVZA 2Y9YA 4YXWH 3Q5SA 4I6MC 1NTME 1VQ7P 1GL2A 3HTKB 2JJLA 2O01H 2Q3IA 3L36A 4N3YB 4AYCA 2B87A 4XA4A 2ZYAA 3VTPC 4BWNA 2IPPA 2NPSC 1RE4A 3VP8A 1LP1A 1DX7A 3R2PA 2H89C 2W27A 1JMBA 3CWBE 3WMM0 1P84D 5BU5A 3G9RA 2ZVNB 2I1KA 3N7NA 1GU5A 1KILA 1LP1B 1R5LA 4JPZB 1RF1C 3VYIA 1GD2E 3T97B 3CL3D 2WPRA 1SQXJ 1KILE 1VQLP 2V4HA 1NTMD 2M3BA 5E79E 1LWUC 2KYVA 1KILB 2OGUA 4PV1D 2K9JA 4XFJA 1OFCX 1YTZT 4UB8E 5AW6B 3TGUG 1FJKA 1S1CX 5APYA 2OYOA 1NH4A 2HYNA 3A0HE 4NPFX 3CCUP 4L73A 1ZR2A 3A3YB 3GW6A 4H44B 1ZXGA 1VQ6P 2B9BA 5BU8B 1FZAA 5KLIB 1BGYG 3AE8C 3CX5D 3L74E 3FWNA 2WQYC 1RHZB 2E5YA 2ITAA 1HWTC 5B5EH 3CC7P 5KKZC 2B87B 2OQQA 1Q81Q 1BSHA 2XNDH 1G2CA 3KXDA 3V6IA 3KYQA 2WITA 2FFDC 2P1JA 4HKZH 2ZAEB 3PLNA 2P67A 2E76D 3HUSB 3GLMA 2WSFH 1CZQA 3MUDC 4C7RA 2FFDB 5CBNA 2XZRA 2K37A 1GK6A 5AW3B 1Q90D 3WUTA 5C39A 1S9KE 1NTKK 3KQGA 3RK2C 1JY3O 4K35A 5AVWB 2FYZA 5L8RJ 3T97A 1R8EA 3CMAP 1GDTA 1KMIZ 2IBZE 3AEBC 1X0TA 2E76B 2W83C 3H32A 1KV4A 4DT0A 4B86A 1NTZG 1J2JB 3ITKA 3LIEA 2RH0A 2KS1B 3W67A 1W5CE 2BCCJ 2FYUG 1K73Q 5TJHA 3JC22 3RK3D 1NU1J 3S1KA 1QLED 2R3CA 1ZV8A 2J59M 2AXTE 1R5SA 1VL2A 5APSA 1CW5A 3MHVA 1SQXD 4I1LA 1LGHB 3E1IA 1PGOA 5CJ0A 3SSUA 1KB9E 2KNCA 3TGUE 2H43A 3S4RA 3M0AA 3L70D 2YO3A 1IK9A 1NOHA 1JY3N 5TISH 2XKMA 4GODA 1FZCB 3RK3B 1Y47A 1TU3F 2IYOA 2KXPB 1PIXA 3L72J 1DIPA 4WY4A 3RK3E 4YXDC 1N7SA 1BE3G 4C7NA 2M8RA 4C46A 3CWBG 5APQA 2E75B 4Z1MH 5KLVJ 1SFCA 1JB0J 1NTZJ 2YIUC 2Z5IA 4KT0J 1RF0A 4H44C 4I7ZB 2AEMA 1IK7A 1LNQA 4N78D 4OVNF 2OTKE 1SQPG 4PD4E 4WB4A 4LLHA 2QM7A 1VF5D 3HE4A 4U3FG 4WY4C 1KQSO 3TF5A 4H13C 3I5CA 1FZBA 1GMJA 2KS1A 2QG4A 4RO0A 3IN6A 3EWKA 4PV1B 4UB6H 1IC2A 5AW4B 5M1BA 1DD3A 1KQFB 3D70A 1ZLLA 4H13B 5KLVG 3GG2A 3GHGA 5KLVK 1GL2C 4W7YA 2FY8A 2GM4A 1L0LK 2IBZD 1KFNA 3C1LA 2PAJA 3L71J 1KTMA 1N7SC 2JDIH 1S5LH 2JP3A 3H1KJ 3RL0B 3NMDA 2MKVA 2K3RA 3P8MC 2CPSA 2BCCG 1AFOA 4KJMA 5CCHA 3HD7C 1JEKA 3QWOC 3WUUA 1FDOA 1U57A 4CPGA 5AW7B 3E7KA 1XTCC 2O01J 2KZJA 1K05A 1PP9G 2E74C 3AE1C 3RL0D 1HH0A 2NPSD 1HJBA 1DH3A 1EZVD 4EYYQ 1EDLA 3AEFC 2WPVB 3CX5E 1VQOP 5H2FH 2FBWC 4Y99B 5CCGD 3L74J 1GK4A 2W6BA 3V2RA 1VQ8P 4TLFA 1MFTA 1S5LX 3A7OA 1ZRTD 2ZXEB 3CXHD 1EZVG 3RK3C 1H0TB 1LTTC 2FYUD 3F5HA 5AW9B 1JNMA 1SQVE 1KILD 1URQB 4N6JA 5APUA 1W2BO 1CI6B 5APWA 1FZFA 3C9IA 3O6QA 2R44A 3B8EB 1FOSE 2HODB 3AE7C 4PD4H 2R3SA 2O1KA 4JF7A 5E79H 3TNUB 3PH0A 2D2CD 5CHXA 3LW5J 2POHA 1ZRTE 1EQ7A 3I56P 1NTKG 3RK2D 4OWFA 1HF9A 1SQBG 3H1LG 1PFIA 3L71G 1BDDA 1BCCJ 2LXBA 3TK1A 5K5GB 1N73B 1NTZE 2E42A 4MN4C 1KORA 2IZ1A 1RH5B 4A7PA 2IFMA 2MJZA 1OXZA 2WPSA 3AEDC 3L72E 4I7ZC 2ZT9B 1LT1A 4WY4B 1NHLA 3FXEA 1LT9A 1RE3A 3KDPB 1SQQG 3L73G 3L75D 3H32B 4NPEA 2O3JA 2YO2A 5B66E 1X22A 3CCJP 1FJPA 3HUSC 3MZWB 2IBZG 5APXA 3VP9A 2PRRA 1SQPJ 3B71A 3MIWA 4IOIH 3GMAA 1IO4A 3E1RA 2Q9IA 5GTIE 4RESB 3VMXA 3K5BA 2VRSA 1Q7YQ 5GTIH 3B5NC 1EXIA 1SFCC 1WMKA 3P8CD 2JEEA 3U1CA 1RF0C 3Q1MA 2OYIC 2CK3H 3RBXA 4R4MA 3FX0A 3L72G 1BE3E 1X8YA 1N73A 3IR9A 2OYIB 1OZHA 1VF5C 2G3AA 2KZIA 1SQPK 3BCCJ 3M9QA 1PPJE 3AECC 1EC5A 4H0LC 5AVSB 1NTKE 1S72P 2C9NY 4JYCA 1T3UA 1BGYE 3CCEP 3HUSA 2GA1A 1L0LD 3M0DC 4WY4D 3V2NA 4AQRD 1M1JA 2GUSA 4W80A 1M8OB 2SPZA 1SQQK 1P84H 1KYOE 2K9JB 3CCQP 3L70E 1L4AC 3L70J 3BASA 1UIIA 1IFDA 1FBMA 1URQD 2HFED 3B5NA 1DD4A 2FXPA 3G3ZA 3CC2P 3A0HH 1LTJB 1YJNP 3AE9C 1FZGA 4RJTA 4EDFA 1E5WA 3U59A 2GUVA 3CI9A 4UB8H 1ZP0C 1YI2P 1JM0A 3D6ZA 1ZR4A 1L4AA 2Z4EA 1SQQJ 1SQVG 3L73J 1Q82Q 2WSEJ 1ZN5A 1KB9D 2E5TA 1NJIQ 1PPJD 3FXDA 1SQXE 2KP8A 2XNXA 3BRTB 4PV1C 1NKZB 3P7KA 1T8ZA 2O01N 1URQA 1X9VA 3H1HD 3HE5A 1CI6A 3MUDA 3MP7B 4BXLA 4WWIA 1MZ9A 1BGYD 3OA7A 1M7LA 3CWBJ 4IL6E 5CCHD 3MGNA 3TNUA 1N7SB 3CCRP 1GU4A 1NTKJ 1KILC 1USDA 3U1AA 2QA4P 1SQBJ 3H1LJ 4EIJA 1RQVA 3G6EP 3F89A 1GL2B 1JCCA 1L0NK 5CBOA 1M1KQ 4D6TD 2BASA 2NPSA 1N7LA 2A45G 2WVRA 1QVGO 3JSVC 5KLVE 3G4SP 2ZT9C 5KJ7D 3CD6P 2E76C 1NYHA 4H0LB 1G1IA 1L2PA 2FYNC 2YMKA 3CCLP 2N1TB 1GZLA 1U7JA 2A06E 4O9BA 5AW8B 3ZDMA 4D6TG 1NU1K 1PZQA 1VQPP 2OTJP 5AW2B 1FZCA 1FC2C 2N1TC 2R32A 2KSJA 3L75E 3Q5RA 1KYOI 1NTZD 1JY3P 3L74D 1KYOH 1WT6A 2D2CB 2Q5UA 2WSCH 3VMAA 5CCHC 2A45H 4U3FE 2KOGA 3RK2B 3O8ZA 1HVVA 3TSIA 5TISE 4Y99C 4ZKUA 4M3LA 2WSCJ 3I55P 1FDIA 3CCSP 5GTHE 4WBAA 1A02J 1EXJA 2YNYA 1OIPA 5DJUB 1UIXA 2HG5D 3II6A 1M90Q 3OJAB 4GOEA 1L0LG 1NVOA 2B88A 2C9LY 1FU1A 2NPSB 1PV3A 1SQBE 2QJKC 3H1LE 3KZIH 3A5TA 2XDJA 1YITP 1BCCE 1G2CB 2YIUB 2BEZF 3BCCG 1OVVA 5H2FE 3A0BE 2Y9ZA 2HPCB 2ZT9D 2PGDA 1HTLC 1DEEG 2I8DA 3CWBD 4HJGH 3CXHE 4R4LA 5KJ7C 5KTBA 4EI2A 2DW3A 1PGJA 2O1JA 2RKLA 4OH8B 3D71A 1T2KC 2FYUJ 1N73C 1NGMB 4U3FD 1KB9I 5KAIH 1S4XA 1ZOYC 3PTZA 1SQVD 4WVZA 1KN7A 1T2KD 1J1EB 1T3JA 3G71P 1QX8A 1Q2NA 3V4QA 1H88A 5KAFE 3IF4A 4YTPC 2LKMA 2A06G 2FYUK 3V2PA 1AA0A 1GTWA 2XU6A 1NTMG 1Y9BA 3LW5H 3AEAC 2KB7P 5KKZB 3M9HA 3FWLA 1LTGC 1EZVE 1T6AA 2WT7A 1KFMA 1M56D 4D6TE 1NWQA 4L75A 1SFCD 2A06D 3WUVA 3VMZA 4QMAA 1EDJA 1QL2A 4EOTA 4GT1A 5GTHH 3AE2C 2PP6A 2IZ0A 3O6QB 2QRXA 5AVYB 2V7QJ 2N1TD 4JYBA 5AVUB 2WPQA 2WZ7A 3B5NB 1SFCB 3H1KE 5AVXB 4BRYB 3L71E 3A2AA 3AE6C 3VOPA 2FYNB 3C8VA 3EFGA 3VN0A 2QIWA 1MFZA 3W68A 2QJKB 1JO5A 1JOCA 1JTHB 1FS0E 1OW7A 2L5GB 3H1JJ 3NFQA 1L0NE 2UWJE 1AJYA 2OTLP 1SQPE 3L35A 2WMMA 2OYHC 2I1JA 2C0WA 3L37A 5AVQB 3AE3C 3L75J 3H1IE 1N8RQ 1RY3A 1EDIA 2FXOA 3RGUA 1KYOD 1SQBK 3CXHH 2W6JH 2XV5A 2OYHB 2QE7H 1L0NJ 5APVA 4IFFA 1SQPD 2FFDA 4TT3H 2H7HA 1AVYA 2E75C 2QVAA 3SWFA 2ZFCA 5KAFH 1VQMP 3L4FA 2J58A 2R5BA 3B5ND 2OYHA 3HE4B 1PL5A 3L70G 1IFJA 5B66H 1J1DC 1LJ2A 1KQGB 1PGPA 1S5LE 3H1IJ 2LR2A 1OMIA 1OVUA 1PP9E 2W8ZA 3SWYA 1FZEA 5AW5B 1MKMA 1VQ4P 1BE3D 1NU1G 3IFMA 5AVTB 1IFPA 1RE4C 3S9OA 1JTHA 2NZ2A 2N1TA 2HR3A 3N4XA 1S9KD 3MTUE
chains in the Genus database with same CATH topology
5KLVG 1EZVG 1NTMG 1BGYG 1P84H 1L0LG 1SQQG 1L0NG 3L73G 1SQXG 2IBZG 1KB9H 3BCCG 4PD4H 3CXHH 2BCCG 1PPJG 3L74G 3H1IG 1BE3G 3H1KG 1NTKG 1SQBG 1SQVG 3CWBG 3H1LG 3L71G 4D6TG 3L70G 1PP9G 3L72G 3CX5H 3H1HG 1SQPG 3H1JG 1KYOH 4U3FG 1NU1G 3TGUG 1NTZG 3L75G 1BCCG 2FYUG 2A06G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KLV G;  1EZV G;  1NTM G;  1BGY G;  1P84 H;  1L0L G;  1SQQ G;  1L0N G;  3L73 G;  1SQX G;  2IBZ G;  1KB9 H;  3BCC G;  4PD4 H;  3CXH H;  2BCC G;  1PPJ G;  3L74 G;  3H1I G;  1BE3 G;  3H1K G;  1NTK G;  1SQB G;  1SQV G;  3CWB G;  3H1L G;  3L71 G;  4D6T G;  3L70 G;  1PP9 G;  3L72 G;  3CX5 H;  3H1H G;  1SQP G;  3H1J G;  1KYO H;  4U3F G;  1NU1 G;  3TGU G;  1NTZ G;  3L75 G;  1BCC G;  2FYU G;  2A06 G; 
#chains in the Genus database with same CATH topology
 2N9B A;  4ZKP A;  1SQQ D;  3ABV C;  2BCC D;  2IFN A;  2Z5H A;  3L73 D;  3WU2 E;  2OYI A;  3AE4 C;  3HTK A;  1RF1 A;  2KNC B;  1JY2 N;  4JQ0 D;  3AEE C;  1AVO A;  1JY2 O;  2L91 A;  1YBK A;  3IAO A;  2P58 A;  3P8C E;  2WSS H;  2WWW A;  4I2L C;  4IFD K;  2KK7 A;  2BEQ D;  1FAV A;  4L74 A;  3WU2 H;  3AE5 C;  1JCD A;  2B89 A;  2YKO A;  3H1J D;  3HE5 B;  4GDO A;  4H0L D;  1YJ9 P;  1KC8 Q;  3L72 D;  1M57 D;  1PGQ A;  2Q3E A;  1S2E A;  2R5D A;  2E75 D;  1K8A Q;  1IFN A;  2E43 A;  3OAK A;  1YQ4 C;  2D2C C;  1ZW0 A;  5KJ7 A;  1LTJ A;  2WSE H;  2V7Q H;  3SWK A;  1GL2 D;  2IX7 C;  2KUB A;  3GF7 A;  2N9Y B;  2KLU A;  3H1J G;  1BSN A;  2P10 A;  1NTM K;  1FE6 A;  1GW3 A;  4U7J A;  1BCC G;  2M3E A;  2QJP C;  1JMM A;  1VPC A;  1YYC A;  3M91 A;  1G1J A;  4H13 D;  1FZC C;  3GHG B;  1P84 E;  1X79 B;  2K1A A;  2KLV A;  3R4Y A;  3UIA A;  5CJ4 A;  2PFX A;  4DZO A;  1QGK B;  3HRN A;  5EFW B;  2Q6Q A;  2IBZ I;  3GHG C;  3NTN A;  4GOF A;  4ASW A;  1BCC D;  2WTY A;  2KI7 B;  3BVH A;  1SQB D;  3H1L D;  2JWA A;  1DEB A;  1NTM J;  1SQX G;  1URQ C;  1VDF A;  2YKQ A;  1NO4 A;  1KB9 H;  1N2D C;  2Y0E A;  1NAF A;  2ZXX A;  3JCU H;  4JBZ A;  2FYU E;  1EDK A;  1VQN P;  1NKN A;  2E74 D;  2YXQ B;  4HB1 A;  3H1I G;  4RKU J;  2IYP A;  4ZMD A;  2HOD A;  5KAI E;  2QSI A;  1FOS F;  1YTZ I;  3M06 A;  4U3F J;  3CCM P;  4KHX A;  1OW6 A;  1M1J C;  4L76 A;  1H89 A;  1RF1 B;  2ZJS E;  2P7J A;  4W7Z A;  2QEX P;  3H1H G;  4HYT B;  3A0B H;  2YXR B;  4GKG A;  1QVF O;  1WRG A;  1GW4 A;  1EZV I;  3FGA D;  4OGQ C;  5AVV B;  4DOJ A;  3L75 G;  3CCV P;  3TYY A;  4AUW A;  3PJS K;  1LWU B;  3SFE C;  1LT9 B;  2QM8 A;  4UB6 E;  1VQK P;  1NU1 D;  2JWD A;  1OX3 A;  1QEX A;  2YMY A;  4OGQ D;  4DJG A;  1VQ9 P;  4PD4 I;  2AEF A;  1NTZ K;  2NRG A;  5KLV D;  2YKP A;  3LID A;  4GIF A;  1SP4 A;  2K9Y A;  3PP5 A;  3M9B A;  4K3A A;  3TGU J;  2QJY B;  1D7M A;  2OAR A;  1MUU A;  1H8A A;  2JR8 A;  1SQV K;  1HGZ A;  2M0B A;  2KSE A;  3H1J E;  1HJ0 A;  2BCC E;  2KIK A;  1SQX K;  2G8Y A;  1E79 H;  1L0L J;  3B4S A;  2HLO A;  3PRJ A;  3EQ2 A;  3RL0 C;  1K9M Q;  3H1H E;  1HBW A;  2AXT H;  4PD4 D;  1PP9 D;  2WT7 B;  1KQL A;  1SQV J;  1W2E A;  2FKW B;  3HD7 D;  1SQQ E;  3L73 E;  4N78 E;  3Q3D A;  1JUN A;  1LWU A;  2LXC B;  4LC1 A;  1SVF A;  1K04 A;  2JKV A;  2W6A A;  3CLQ A;  3CXH I;  1N7S D;  3CC4 P;  3MD0 A;  3H6P A;  1KD1 Q;  4D6T J;  3CME P;  2IDB A;  2QJP B;  3BCC D;  5APT A;  2H88 C;  4NPD A;  4ZNC A;  1YQ3 C;  3P32 A;  1Z56 A;  1M1J B;  2ZYG A;  3AEG C;  3KPE A;  1U7M A;  1L4A B;  4BRY A;  1FDM A;  5CMZ A;  1PPJ G;  3BRV B;  2ZVO B;  2C0X A;  3Q2Y A;  1J1E C;  1BGY J;  1N86 A;  3H1K G;  4OGQ B;  1RQU A;  3V5B A;  4ASV A;  1SS1 A;  3RBZ A;  4DCK A;  3KHU A;  1QL1 A;  3H1I D;  1LT9 C;  1RE3 C;  5B5E E;  3VMY A;  1NTK D;  3BCC E;  1OVR A;  2RMZ A;  3JCU E;  4IL6 X;  5CCG C;  1IZN B;  3QH9 A;  3L71 D;  2W90 A;  3TGU D;  5KLI C;  1LTI C;  1BDC A;  1J1D B;  3H1K D;  1USE A;  1L0L E;  1P84 I;  3KZI E;  1L0N D;  1Q86 Q;  1VQ5 P;  3D6Y A;  2ZYD A;  1JY2 P;  4H44 D;  4PJ0 H;  1IFI A;  4LGD E;  2QJY C;  1HUC A;  4YPC A;  4C7N B;  2CPB A;  3V2Q A;  1OW8 A;  4PJ0 E;  1OWA A;  1YJW P;  4XE5 B;  1A02 F;  1ZME C;  2AXC A;  2JO1 A;  3M0D A;  3HD7 A;  2A45 I;  4Y28 J;  3V4W A;  2RN0 A;  3NXS A;  1L0N G;  1LTS C;  3PHL A;  5AVR B;  1PP9 J;  1XTG B;  1YIJ P;  1KZU B;  1BE3 J;  1IFM A;  3H1H J;  1Y8A A;  2P2U A;  2Q1K A;  3HD7 B;  3SFD C;  3EFF K;  2H8P D;  5AW0 B;  3CPW O;  1AQT A;  4IL6 H;  1VF5 B;  2M5A B;  3L74 G;  5CCG A;  2HPC A;  3GF3 A;  1AV1 A;  1H0T A;  3RL0 g;  3H25 A;  1SLQ A;  3BAT A;  1LTB C;  2K88 A;  3TDK A;  2M5A A;  4IFM A;  3CX5 H;  1IJD B;  2Y0D A;  3CX5 I;  2AEJ A;  2Y0C A;  1HGV A;  2FXM A;  4HH2 A;  2E74 B;  3OW2 O;  3USS A;  5AVZ B;  1L4A D;  1YHQ P;  1NU1 E;  1AQ5 A;  2WSF J;  1MV8 A;  5AW1 B;  1S3J A;  2J5U A;  2Q7C A;  1CSB A;  1LTJ C;  1NAY A;  1LTA C;  5DJT B;  3Q5P A;  5BVZ A;  2Y9Y A;  4YXW H;  3Q5S A;  4I6M C;  1NTM E;  1VQ7 P;  1GL2 A;  3HTK B;  2JJL A;  2O01 H;  2Q3I A;  3L36 A;  4N3Y B;  4AYC A;  2B87 A;  4XA4 A;  2ZYA A;  3VTP C;  4BWN A;  2IPP A;  2NPS C;  1RE4 A;  3VP8 A;  1LP1 A;  1DX7 A;  3R2P A;  2H89 C;  2W27 A;  1JMB A;  3CWB E;  3WMM 0;  1P84 D;  5BU5 A;  3G9R A;  2ZVN B;  2I1K A;  3N7N A;  1GU5 A;  1KIL A;  1LP1 B;  1R5L A;  4JPZ B;  1RF1 C;  3VYI A;  1GD2 E;  3T97 B;  3CL3 D;  2WPR A;  1SQX J;  1KIL E;  1VQL P;  2V4H A;  1NTM D;  2M3B A;  5E79 E;  1LWU C;  2KYV A;  1KIL B;  2OGU A;  4PV1 D;  2K9J A;  4XFJ A;  1OFC X;  1YTZ T;  4UB8 E;  5AW6 B;  3TGU G;  1FJK A;  1S1C X;  5APY A;  2OYO A;  1NH4 A;  2HYN A;  3A0H E;  4NPF X;  3CCU P;  4L73 A;  1ZR2 A;  3A3Y B;  3GW6 A;  4H44 B;  1ZXG A;  1VQ6 P;  2B9B A;  5BU8 B;  1FZA A;  5KLI B;  1BGY G;  3AE8 C;  3CX5 D;  3L74 E;  3FWN A;  2WQY C;  1RHZ B;  2E5Y A;  2ITA A;  1HWT C;  5B5E H;  3CC7 P;  5KKZ C;  2B87 B;  2OQQ A;  1Q81 Q;  1BSH A;  2XND H;  1G2C A;  3KXD A;  3V6I A;  3KYQ A;  2WIT A;  2FFD C;  2P1J A;  4HKZ H;  2ZAE B;  3PLN A;  2P67 A;  2E76 D;  3HUS B;  3GLM A;  2WSF H;  1CZQ A;  3MUD C;  4C7R A;  2FFD B;  5CBN A;  2XZR A;  2K37 A;  1GK6 A;  5AW3 B;  1Q90 D;  3WUT A;  5C39 A;  1S9K E;  1NTK K;  3KQG A;  3RK2 C;  1JY3 O;  4K35 A;  5AVW B;  2FYZ A;  5L8R J;  3T97 A;  1R8E A;  3CMA P;  1GDT A;  1KMI Z;  2IBZ E;  3AEB C;  1X0T A;  2E76 B;  2W83 C;  3H32 A;  1KV4 A;  4DT0 A;  4B86 A;  1NTZ G;  1J2J B;  3ITK A;  3LIE A;  2RH0 A;  2KS1 B;  3W67 A;  1W5C E;  2BCC J;  2FYU G;  1K73 Q;  5TJH A;  3JC2 2;  3RK3 D;  1NU1 J;  3S1K A;  1QLE D;  2R3C A;  1ZV8 A;  2J59 M;  2AXT E;  1R5S A;  1VL2 A;  5APS A;  1CW5 A;  3MHV A;  1SQX D;  4I1L A;  1LGH B;  3E1I A;  1PGO A;  5CJ0 A;  3SSU A;  1KB9 E;  2KNC A;  3TGU E;  2H43 A;  3S4R A;  3M0A A;  3L70 D;  2YO3 A;  1IK9 A;  1NOH A;  1JY3 N;  5TIS H;  2XKM A;  4GOD A;  1FZC B;  3RK3 B;  1Y47 A;  1TU3 F;  2IYO A;  2KXP B;  1PIX A;  3L72 J;  1DIP A;  4WY4 A;  3RK3 E;  4YXD C;  1N7S A;  1BE3 G;  4C7N A;  2M8R A;  4C46 A;  3CWB G;  5APQ A;  2E75 B;  4Z1M H;  5KLV J;  1SFC A;  1JB0 J;  1NTZ J;  2YIU C;  2Z5I A;  4KT0 J;  1RF0 A;  4H44 C;  4I7Z B;  2AEM A;  1IK7 A;  1LNQ A;  4N78 D;  4OVN F;  2OTK E;  1SQP G;  4PD4 E;  4WB4 A;  4LLH A;  2QM7 A;  1VF5 D;  3HE4 A;  4U3F G;  4WY4 C;  1KQS O;  3TF5 A;  4H13 C;  3I5C A;  1FZB A;  1GMJ A;  2KS1 A;  2QG4 A;  4RO0 A;  3IN6 A;  3EWK A;  4PV1 B;  4UB6 H;  1IC2 A;  5AW4 B;  5M1B A;  1DD3 A;  1KQF B;  3D70 A;  1ZLL A;  4H13 B;  5KLV G;  3GG2 A;  3GHG A;  5KLV K;  1GL2 C;  4W7Y A;  2FY8 A;  2GM4 A;  1L0L K;  2IBZ D;  1KFN A;  3C1L A;  2PAJ A;  3L71 J;  1KTM A;  1N7S C;  2JDI H;  1S5L H;  2JP3 A;  3H1K J;  3RL0 B;  3NMD A;  2MKV A;  2K3R A;  3P8M C;  2CPS A;  2BCC G;  1AFO A;  4KJM A;  5CCH A;  3HD7 C;  1JEK A;  3QWO C;  3WUU A;  1FDO A;  1U57 A;  4CPG A;  5AW7 B;  3E7K A;  1XTC C;  2O01 J;  2KZJ A;  1K05 A;  1PP9 G;  2E74 C;  3AE1 C;  3RL0 D;  1HH0 A;  2NPS D;  1HJB A;  1DH3 A;  1EZV D;  4EYY Q;  1EDL A;  3AEF C;  2WPV B;  3CX5 E;  1VQO P;  5H2F H;  2FBW C;  4Y99 B;  5CCG D;  3L74 J;  1GK4 A;  2W6B A;  3V2R A;  1VQ8 P;  4TLF A;  1MFT A;  1S5L X;  3A7O A;  1ZRT D;  2ZXE B;  3CXH D;  1EZV G;  3RK3 C;  1H0T B;  1LTT C;  2FYU D;  3F5H A;  5AW9 B;  1JNM A;  1SQV E;  1KIL D;  1URQ B;  4N6J A;  5APU A;  1W2B O;  1CI6 B;  5APW A;  1FZF A;  3C9I A;  3O6Q A;  2R44 A;  3B8E B;  1FOS E;  2HOD B;  3AE7 C;  4PD4 H;  2R3S A;  2O1K A;  4JF7 A;  5E79 H;  3TNU B;  3PH0 A;  2D2C D;  5CHX A;  3LW5 J;  2POH A;  1ZRT E;  1EQ7 A;  3I56 P;  1NTK G;  3RK2 D;  4OWF A;  1HF9 A;  1SQB G;  3H1L G;  1PFI A;  3L71 G;  1BDD A;  1BCC J;  2LXB A;  3TK1 A;  5K5G B;  1N73 B;  1NTZ E;  2E42 A;  4MN4 C;  1KOR A;  2IZ1 A;  1RH5 B;  4A7P A;  2IFM A;  2MJZ A;  1OXZ A;  2WPS A;  3AED C;  3L72 E;  4I7Z C;  2ZT9 B;  1LT1 A;  4WY4 B;  1NHL A;  3FXE A;  1LT9 A;  1RE3 A;  3KDP B;  1SQQ G;  3L73 G;  3L75 D;  3H32 B;  4NPE A;  2O3J A;  2YO2 A;  5B66 E;  1X22 A;  3CCJ P;  1FJP A;  3HUS C;  3MZW B;  2IBZ G;  5APX A;  3VP9 A;  2PRR A;  1SQP J;  3B71 A;  3MIW A;  4IOI H;  3GMA A;  1IO4 A;  3E1R A;  2Q9I A;  5GTI E;  4RES B;  3VMX A;  3K5B A;  2VRS A;  1Q7Y Q;  5GTI H;  3B5N C;  1EXI A;  1SFC C;  1WMK A;  3P8C D;  2JEE A;  3U1C A;  1RF0 C;  3Q1M A;  2OYI C;  2CK3 H;  3RBX A;  4R4M A;  3FX0 A;  3L72 G;  1BE3 E;  1X8Y A;  1N73 A;  3IR9 A;  2OYI B;  1OZH A;  1VF5 C;  2G3A A;  2KZI A;  1SQP K;  3BCC J;  3M9Q A;  1PPJ E;  3AEC C;  1EC5 A;  4H0L C;  5AVS B;  1NTK E;  1S72 P;  2C9N Y;  4JYC A;  1T3U A;  1BGY E;  3CCE P;  3HUS A;  2GA1 A;  1L0L D;  3M0D C;  4WY4 D;  3V2N A;  4AQR D;  1M1J A;  2GUS A;  4W80 A;  1M8O B;  2SPZ A;  1SQQ K;  1P84 H;  1KYO E;  2K9J B;  3CCQ P;  3L70 E;  1L4A C;  3L70 J;  3BAS A;  1UII A;  1IFD A;  1FBM A;  1URQ D;  2HFE D;  3B5N A;  1DD4 A;  2FXP A;  3G3Z A;  3CC2 P;  3A0H H;  1LTJ B;  1YJN P;  3AE9 C;  1FZG A;  4RJT A;  4EDF A;  1E5W A;  3U59 A;  2GUV A;  3CI9 A;  4UB8 H;  1ZP0 C;  1YI2 P;  1JM0 A;  3D6Z A;  1ZR4 A;  1L4A A;  2Z4E A;  1SQQ J;  1SQV G;  3L73 J;  1Q82 Q;  2WSE J;  1ZN5 A;  1KB9 D;  2E5T A;  1NJI Q;  1PPJ D;  3FXD A;  1SQX E;  2KP8 A;  2XNX A;  3BRT B;  4PV1 C;  1NKZ B;  3P7K A;  1T8Z A;  2O01 N;  1URQ A;  1X9V A;  3H1H D;  3HE5 A;  1CI6 A;  3MUD A;  3MP7 B;  4BXL A;  4WWI A;  1MZ9 A;  1BGY D;  3OA7 A;  1M7L A;  3CWB J;  4IL6 E;  5CCH D;  3MGN A;  3TNU A;  1N7S B;  3CCR P;  1GU4 A;  1NTK J;  1KIL C;  1USD A;  3U1A A;  2QA4 P;  1SQB J;  3H1L J;  4EIJ A;  1RQV A;  3G6E P;  3F89 A;  1GL2 B;  1JCC A;  1L0N K;  5CBO A;  1M1K Q;  4D6T D;  2BAS A;  2NPS A;  1N7L A;  2A45 G;  2WVR A;  1QVG O;  3JSV C;  5KLV E;  3G4S P;  2ZT9 C;  5KJ7 D;  3CD6 P;  2E76 C;  1NYH A;  4H0L B;  1G1I A;  1L2P A;  2FYN C;  2YMK A;  3CCL P;  2N1T B;  1GZL A;  1U7J A;  2A06 E;  4O9B A;  5AW8 B;  3ZDM A;  4D6T G;  1NU1 K;  1PZQ A;  1VQP P;  2OTJ P;  5AW2 B;  1FZC A;  1FC2 C;  2N1T C;  2R32 A;  2KSJ A;  3L75 E;  3Q5R A;  1KYO I;  1NTZ D;  1JY3 P;  3L74 D;  1KYO H;  1WT6 A;  2D2C B;  2Q5U A;  2WSC H;  3VMA A;  5CCH C;  2A45 H;  4U3F E;  2KOG A;  3RK2 B;  3O8Z A;  1HVV A;  3TSI A;  5TIS E;  4Y99 C;  4ZKU A;  4M3L A;  2WSC J;  3I55 P;  1FDI A;  3CCS P;  5GTH E;  4WBA A;  1A02 J;  1EXJ A;  2YNY A;  1OIP A;  5DJU B;  1UIX A;  2HG5 D;  3II6 A;  1M90 Q;  3OJA B;  4GOE A;  1L0L G;  1NVO A;  2B88 A;  2C9L Y;  1FU1 A;  2NPS B;  1PV3 A;  1SQB E;  2QJK C;  3H1L E;  3KZI H;  3A5T A;  2XDJ A;  1YIT P;  1BCC E;  1G2C B;  2YIU B;  2BEZ F;  3BCC G;  1OVV A;  5H2F E;  3A0B E;  2Y9Z A;  2HPC B;  2ZT9 D;  2PGD A;  1HTL C;  1DEE G;  2I8D A;  3CWB D;  4HJG H;  3CXH E;  4R4L A;  5KJ7 C;  5KTB A;  4EI2 A;  2DW3 A;  1PGJ A;  2O1J A;  2RKL A;  4OH8 B;  3D71 A;  1T2K C;  2FYU J;  1N73 C;  1NGM B;  4U3F D;  1KB9 I;  5KAI H;  1S4X A;  1ZOY C;  3PTZ A;  1SQV D;  4WVZ A;  1KN7 A;  1T2K D;  1J1E B;  1T3J A;  3G71 P;  1QX8 A;  1Q2N A;  3V4Q A;  1H88 A;  5KAF E;  3IF4 A;  4YTP C;  2LKM A;  2A06 G;  2FYU K;  3V2P A;  1AA0 A;  1GTW A;  2XU6 A;  1NTM G;  1Y9B A;  3LW5 H;  3AEA C;  2KB7 P;  5KKZ B;  3M9H A;  3FWL A;  1LTG C;  1EZV E;  1T6A A;  2WT7 A;  1KFM A;  1M56 D;  4D6T E;  1NWQ A;  4L75 A;  1SFC D;  2A06 D;  3WUV A;  3VMZ A;  4QMA A;  1EDJ A;  1QL2 A;  4EOT A;  4GT1 A;  5GTH H;  3AE2 C;  2PP6 A;  2IZ0 A;  3O6Q B;  2QRX A;  5AVY B;  2V7Q J;  2N1T D;  4JYB A;  5AVU B;  2WPQ A;  2WZ7 A;  3B5N B;  1SFC B;  3H1K E;  5AVX B;  4BRY B;  3L71 E;  3A2A A;  3AE6 C;  3VOP A;  2FYN B;  3C8V A;  3EFG A;  3VN0 A;  2QIW A;  1MFZ A;  3W68 A;  2QJK B;  1JO5 A;  1JOC A;  1JTH B;  1FS0 E;  1OW7 A;  2L5G B;  3H1J J;  3NFQ A;  1L0N E;  2UWJ E;  1AJY A;  2OTL P;  1SQP E;  3L35 A;  2WMM A;  2OYH C;  2I1J A;  2C0W A;  3L37 A;  5AVQ B;  3AE3 C;  3L75 J;  3H1I E;  1N8R Q;  1RY3 A;  1EDI A;  2FXO A;  3RGU A;  1KYO D;  1SQB K;  3CXH H;  2W6J H;  2XV5 A;  2OYH B;  2QE7 H;  1L0N J;  5APV A;  4IFF A;  1SQP D;  2FFD A;  4TT3 H;  2H7H A;  1AVY A;  2E75 C;  2QVA A;  3SWF A;  2ZFC A;  5KAF H;  1VQM P;  3L4F A;  2J58 A;  2R5B A;  3B5N D;  2OYH A;  3HE4 B;  1PL5 A;  3L70 G;  1IFJ A;  5B66 H;  1J1D C;  1LJ2 A;  1KQG B;  1PGP A;  1S5L E;  3H1I J;  2LR2 A;  1OMI A;  1OVU A;  1PP9 E;  2W8Z A;  3SWY A;  1FZE A;  5AW5 B;  1MKM A;  1VQ4 P;  1BE3 D;  1NU1 G;  3IFM A;  5AVT B;  1IFP A;  1RE4 C;  3S9O A;  1JTH A;  2NZ2 A;  2N1T A;  2HR3 A;  3N4X A;  1S9K D;  3MTU E; 
#chains in the Genus database with same CATH homology
 5KLV G;  1EZV G;  1NTM G;  1BGY G;  1P84 H;  1L0L G;  1SQQ G;  1L0N G;  3L73 G;  1SQX G;  2IBZ G;  1KB9 H;  3BCC G;  4PD4 H;  3CXH H;  2BCC G;  1PPJ G;  3L74 G;  3H1I G;  1BE3 G;  3H1K G;  1NTK G;  1SQB G;  1SQV G;  3CWB G;  3H1L G;  3L71 G;  4D6T G;  3L70 G;  1PP9 G;  3L72 G;  3CX5 H;  3H1H G;  1SQP G;  3H1J G;  1KYO H;  4U3F G;  1NU1 G;  3TGU G;  1NTZ G;  3L75 G;  1BCC G;  2FYU G;  2A06 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...