1KYOH

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
93
structure length
93
Chain Sequence
b'GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
total genus 13
structure length 93
sequence length 93
chains with identical sequence S
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1kyoH00
1KYOH 1NTMG 1BGYG 3H1LG 3CX5H 1L0LG 1PPJG 1KB9H 3L70G 1NTZG 1BCCG 2IBZG 3L75G 3CXHH 3TGUG 5KLVG 1SQQG 2FYUG 1SQBG 3H1HG 2BCCG 1SQXG 3L71G 1NTKG 3CWBG 3H1KG 1EZVG 1BE3G 3H1JG 1L0NG 3L72G 1P84H 4D6TG 1SQPG 4PD4H 4U3FG 3L73G 1PP9G 3H1IG 2A06G 3L74G 1NU1G 1SQVG 3BCCG
chains in the Genus database with same CATH superfamily
1FZCA 2M5AA 5CCGD 5KAIH 5KLIC 4OVNF 2W90A 1SQBJ 4C7NB 2KLVA 1L4AC 1X0TA 3RK3C 5AVZB 2PGDA 1SFCD 1NTKK 1LWUC 1GL2C 3H1LE 3W68A 2PAJA 4UB8E 2KB7P 1KTMA 2AXTE 4U3FD 2KZIA 4RO0A 2N1TC 2KK7A 1K04A 3HUSA 2KNCA 1SQBK 2LXBA 4C7RA 2OYHB 2ZXXA 2K9JA 1BDCA 3GMAA 3KXDA 4YXWH 3O8ZA 3V2NA 2E74D 2BCCE 1L0LJ 4XFJA 1G2CA 3M9HA 2B89A 2D2CD 2YKQA 5CCGC 4OGQD 3PP5A 2YXRB 1KMIZ 1CI6A 2ZT9D 4U3FG 2LKMA 4ZKUA 5CCHA 5TJHA 1SFCC 3CXHE 2WTYA 2IFNA 3V5BA 3H25A 3H1KE 1L0LK 1HH0A 5GTHH 3MP7B 2K37A 1PGQA 3B5NC 1H0TB 1SQPE 3M91A 3II6A 2N9BA 1HUCA 1KB9E 1FC2C 2C0XA 2E74C 4PJ0E 2D2CC 3TYYA 1KV4A 4HJGH 2ZJSE 2XKMA 3H1LD 1Y9BA 2I1KA 4UB6H 1K9MQ 2ZT9C 3CC4P 1RY3A 1YJ9P 1OVRA 2GM4A 3H1LJ 1P84D 2BEQD 1SQVK 1EZVE 4BRYB 1M1KQ 3G3ZA 1S4XA 3H1LG 1Y8AA 2QG4A 4TT3H 2KYVA 3MTUE 2BCCJ 3CMAP 2FXOA 3GF3A 1Y47A 3L36A 2KIKA 1EXIA 1JEKA 4N3YB 3C1LA 3H1KD 1NO4A 3TGUE 1SQXE 2YMKA 2QSIA 2P67A 4D6TE 2R32A 3H1KJ 1KB9D 2QJYB 4H13D 2ZYGA 1N8RQ 1J1EB 4N78E 3CL3D 3LW5J 1SQPJ 2B88A 5APQA 3KZIE 4UB8H 5KJ7C 1WRGA 4LGDE 2AXTH 3M06A 1HF9A 3CWBE 2H7HA 3H1KG 2QE7H 3P32A 1LNQA 2P1JA 2GUSA 3H32A 1EZVD 5AW0B 2I8DA 1SQPK 1N7SB 1P84I 2P7JA 3USSA 1S72P 1IFJA 5CBOA 1BE3J 2WVRA 4DT0A 1FZAA 4H13C 3IR9A 5TISE 3N4XA 1EC5A 4ZMDA 3P7KA 4JPZB 2E43A 1JNMA 2WSFJ 3VN0A 5CBNA 1VQMP 1EZVG 1M1JB 3HD7A 2H89C 2BASA 3TNUA 3TGUD 5KLIB 4EOTA 2R3SA 3LW5H 5AW9B 3NXSA 3M9QA 3AE4C 1URQA 1L4AB 3C8VA 4D6TD 1KB9H 3RK3B 1Q81Q 1U7MA 5DJUB 1LWUB 1SQXJ 4PJ0H 3JC22 4N78D 3V2PA 2HPCA 3LIEA 2IX7C 1AV1A 2W6AA 1LTTC 2N1TB 3RK2B 2UWJE 1KB9I 3BCCE 1L2PA 1JM0A 3MUDA 1NU1J 3CWBD 2NPSB 2YMYA 3E1IA 3TGUG 1JY2P 1UIIA 1FDMA 4D6TG 2DW3A 3CMEP 1SQXK 5AW2B 1DH3A 4K3AA 1H89A 1IZNB 1NYHA 2OTKE 2V7QJ 2Y0CA 1BGYJ 1NTZE 3PLNA 3SFDC 1VQOP 4EYYQ 1OW7A 1EZVI 1NU1K 1NJIQ 1NWQA 5BU5A 1RF1A 3CWBG 3VTPC 1DIPA 3AECC 3U1AA 5KKZC 3WU2E 2HG5D 3L75E 5K5GB 1GTWA 4U7JA 2IYOA 3L37A 1SLQA 1PP9E 1VQ6P 3HE4B 4Y99C 2E74B 1NTME 2FKWB 2YKOA 1DD4A 3CI9A 1T8ZA 1FDOA 4OGQB 3HE5A 2ZT9B 3KZIH 2JDIH 1BDDA 3P8MC 4DJGA 1T3UA 5M1BA 5APXA 3BCCD 1HBWA 2C0WA 3EFGA 2JEEA 2P2UA 3IN6A 1S5LX 3RBXA 5CCHD 2QM7A 1SQQE 1S5LE 3L71E 1NTKE 1ZV8A 4CPGA 1NTZD 3H1IE 4HYTB 1SS1A 1J1DC 3PH0A 1W5CE 4PV1D 1EDJA 3BCCG 2KOGA 3AE8C 5TISH 2HLOA 1ZR2A 1SQBE 1NTZJ 3F89A 3CLQA 3WUVA 2IBZD 3L75D 3NMDA 2Z4EA 2FFDA 3I56P 2HFED 4JF7A 3CC2P 1YITP 1VQNP 2Q6QA 1NTZG 1PP9D 1YJWP 3IAOA 1J1EC 3B8EB 4WVZA 4Y28J 1NTMD 2FYNB 3EFFK 2JR8A 4GOFA 3SWYA 1OVVA 4W80A 3HRNA 1PP9J 5APSA 1L0LE 1NTMJ 1Q86Q 3AE7C 2AEJA 2IBZG 3L75G 1FZGA 2AEFA 1JMBA 1K05A 1JTHA 3H1HJ 3AEEC 3WUTA 1TU3F 1IFNA 2OARA 3R2PA 1SQQD 3V2QA 4M3LA 1DD3A 3L71D 3HE5B 3GHGA 2WT7A 4IOIH 1NTKD 1LTAC 1RQUA 2R5DA 1R5LA 2LXCB 1OFCX 1W2EA 1SQQJ 1NTMK 3CCEP 3H1ID 3FXEA 1DX7A 1WMKA 3T97B 1LTIC 3L71J 1HJBA 1KQLA 5KAFE 4LC1A 1SQBD 1SQVE 4R4LA 3E1RA 1ZR4A 2JWAA 2MJZA 1QVFO 2IYPA 2H8PD 1M1JC 3WU2H 5APUA 1T2KD 1LT9A 3L71G 3VMAA 1NTKG 2E5YA 4GT1A 2O01N 2C9LY 1SQQK 4DZOA 3CCLP 1MFTA 3H1IG 3WUUA 2IBZI 3L74J 1RHZB 3A3YB 1GZLA 1A02F 1PPJE 1YTZI 2O01J 5E79E 1SQBG 3RK2C 2C9NY 3P8CE 3CC7P 1PFIA 1LTBC 1L0LD 2NPSC 2GA1A 4I6MC 3HTKA 5BU8B 4TLFA 1GK4A 4GKGA 1S5LH 2R3CA 3VYIA 3H1JE 4AYCA 1T2KC 3A2AA 1JB0J 1IFIA 3HD7D 3LIDA 1L0LG 5APWA 1URQD 2XZRA 5BVZA 2H43A 1ZXGA 1SQVD 1LP1A 3BASA 4PD4E 5KKZB 1MFZA 2Y9YA 1KILA 3GHGB 4EI2A 3MD0A 1SQVJ 2LR2A 4IFFA 3FWLA 1ZW0A 2HODB 4Y99B 3SWKA 1K8AQ 2Q3EA 5AW1B 4OGQC 1DEBA 3QWOC 1IFDA 1PPJD 1SVFA 1SP4A 3A0HE 1FZCB 1RE4A 3GW6A 2M5AB 1SQVG 2WSCJ 1A02J 3HD7C 2OYIA 1Q2NA 1BSNA 1URQC 1NKZB 1BE3E 2XU6A 1OWAA 2B87A 1N73A 1VF5D 3G6EP 1LJ2A 2WPRA 3CPWO 2Y9ZA 1IO4A 2BCCD 2ZVNB 2O1KA 3H1JD 2NZ2A 2IZ0A 1YBKA 1PPJG 1J1DB 1X22A 3HUSB 2KNCB 2KUBA 1FOSE 5APTA 5B66E 3H1JJ 3CXHD 5KAFH 1FOSF 1LGHB 2K9JB 1ZOYC 1DEEG 1G2CB 2AXCA 4JYCA 1LT1A 4PD4D 2OYOA 2BCCG 1CI6B 1SQPD 1VQ9P 1ZMEC 1GL2A 3H1JG 2FY8A 1RF1C 1VF5C 2HYNA 3AEFC 1NU1E 2WSEJ 4EDFA 2J5UA 1YYCA 2FYNC 1HVVA 1IFPA 3RL0g 1GK6A 3M0AA 1BCCJ 1JOCA 2HR3A 2FYUJ 2ZVOB 2JKVA 3OAKA 1GU5A 4PV1B 4YTPC 2QVAA 2M0BA 5AVRB 1EDKA 1SQPG 1BGYE 3CCVP 1FAVA 1BE3D 1QL1A 3A7OA 1N2DC 2FYZA 1KQGB 1N7LA 4AUWA 3S4RA 1KN7A 1SFCA 1PV3A 1USEA 5L8RJ 2FYUK 1VQPP 3VP8A 2K9YA 5AW5B 1OMIA 5APVA 3Q3DA 2J58A 3I55P 2Q7CA 2QRXA 1KZUB 3Q5RA 2XV5A 2JWDA 3CXHH 2OGUA 3B5NA 1D7MA 4NPDA 3OA7A 1ZRTE 1BE3G 1EXJA 4PD4H 2W83C 5AW8B 1PGPA 1RF0A 1KORA 1SQXD 3CXHI 1YI2P 5AVXB 2V4HA 4PD4I 4IFDK 3D70A 1NU1D 2KSJA 1PGOA 1JMMA 2QIWA 3MGNA 1VPCA 4KT0J 1AA0A 2YKPA 1RE3C 2FFDC 2Q3IA 1FE6A 4W7ZA 1KQSO 1SQXG 4WY4A 1BGYD 2KS1A 2E75B 1NH4A 1PGJA 1VQ5P 2CPSA 1NU1G 2RKLA 3D6YA 1VQ8P 2M3BA 5H2FE 3GF7A 1HGVA 3L70J 4I7ZC 3KDPB 2YO3A 2WSFH 3CCUP 3B71A 1KILE 3D71A 3O6QA 1AVYA 1PIXA 2WZ7A 2H88C 3AE5C 1H88A 5B66H 5GTIE 2A06E 4A7PA 2SPZA 3CCSP 3H32B 1E5WA 1BGYG 1ZRTD 4JYBA 1WT6A 3GHGC 3OJAB 3FWNA 2KZJA 1ZLLA 1G1JA 4EIJA 3PJSK 5KJ7A 1GU4A 4YPCA 2RMZA 5CJ4A 3H1HE 2XNDH 4RESB 3EWKA 3I5CA 1FZCC 2YXQB 3VMZA 2ZXEB 3HD7B 3TNUB 1LTJA 1LT9C 3B4SA 2V7QH 3MHVA 1URQB 3RL0D 3G71P 1QL2A 3JCUE 2M3EA 1FS0E 3KHUA 3NTNA 1U7JA 2HPCB 4HH2A 1GDTA 3A0BE 3L73J 4DCKA 1KILD 2CK3H 3HUSC 5AVVB 1BSHA 1JY2O 4HB1A 3CD6P 2A06D 2W6JH 4DOJA 3U59A 3L74E 1YHQP 4GODA 3Q5SA 1FU1A 4H44D 1HGZA 2WPSA 3G9RA 5CCHC 3O6QB 1RF1B 1VF5B 1J2JB 3ZDMA 2WPVB 3CCJP 3V4QA 3MIWA 1OW6A 2JJLA 3JSVC 5AVQB 1AFOA 3H1HD 2A06G 1JCDA 2OYHA 1KILC 4PV1C 3E7KA 4ZNCA 1S3JA 2O3JA 1YJNP 1JY2N 1IK9A 1YQ4C 1OXZA 3R4YA 4B86A 1PP9G 4R4MA 1VQKP 1NTMG 3ITKA 2KP8A 3TDKA 4NPFX 4H0LD 5H2FH 2WSSH 3H1HG 3KQGA 2MKVA 3PRJA 3TSIA 4JQ0D 2CPBA 1LTJB 3Q1MA 5KLVK 3S9OA 3MZWB 2Y0EA 5GTIH 3A5TA 4QMAA 1H0TA 1N73C 2E75D 1GW4A 2GUVA 2OTJP 1E79H 1SQQG 1ZN5A 1X9VA 3IF4A 1FBMA 3L74D 1FDIA 2JO1A 1M8OB 2ITAA 1IJDB 4WBAA 2FBWC 3FGAD 1X79B 1M56D 4RJTA 2OQQA 2WPQA 5CHXA 3AEGC 5APYA 4H0LC 4BRYA 3PHLA 3SWFA 2FFDB 4HKZH 1KFMA 4GDOA 3L74G 5AVTB 1JY3P 2QJPC 3JCUH 2E75C 3V6IA 5AVYB 4OWFA 1FZEA 3V4WA 1P84E 3B5ND 2P58A 4U3FJ 4I7ZB 3A0BH 1NOHA 1EQ7A 3RBZA 1MKMA 2QA4P 2QJKC 1GD2E 1JTHB 1YTZT 4L75A 1XTGB 3NFQA 3M9BA 2K3RA 2ZYDA 2WT7B 1R8EA 3CCMP 3TK1A 1KD1Q 4MN4C 1BCCE 2Q5UA 2YIUB 2FYUE 2O01H 1NAFA 1LTSC 2E76D 4WY4D 4KJMA 3AE2C 2K1AA 1X8YA 2IZ1A 4KHXA 1H8AA 3CX5E 1Q82Q 1G1IA 2G3AA 1RF0C 3P8CD 1T3JA 3N7NA 1GW3A 1K73Q 1LT9B 3C9IA 1NHLA 3SFEC 2W8ZA 1N7SA 1LTGC 4L74A 2QEXP 2N9YB 2IFMA 1VQ7P 3M0DA 1QEXA 1FJKA 3MUDC 1S9KE 1OVUA 1R5SA 1UIXA 3K5BA 3VOPA 2E76C 2ZYAA 1N86A 1M1JA 4L73A 1M90Q 3RGUA 1JY3O 4WY4C 3HTKB 2R5BA 5KJ7D 3V2RA 3AEBC 1L4AA 3KYQA 3FXDA 1NAYA 1CW5A 2JP3A 2KSEA 1LWUA 1VQLP 3RL0B 1HTLC 4BWNA 5AW6B 2OTLP 1BCCD 3Q5PA 2FYUD 2N1TA 2WSCH 2QM8A 1IFMA 5AVWB 3L35A 2NPSA 1LP1B 4GIFA 5E79H 2PFXA 1KILB 3CX5D 1FZBA 3AE1C 2Z5IA 1JY3N 3GLMA 5CCGA 3CCRP 2B9BA 3L70E 2K88A 2YO2A 1HJ0A 1JO5A 1BCCG 4C46A 2FYUG 1OIPA 1AVOA 2XDJA 3L72E 4Z1MH 1P84H 1ZP0C 1QX8A 4H44B 2RN0A 2OYIB 5AW4B 1EDLA 2YNYA 1S9KD 1LTJC 1NKNA 1JCCA 1VDFA 3U1CA 2B87B 5CMZA 1N73B 1L0NE 2M8RA 3WMM0 1NVOA 4GOEA 1HWTC 4OH8B 1XTCC 2WSEH 4NPEA 1AQTA 3HE4A 1CZQA 1QLED 4YXDC 3IFMA 2ZAEB 3EQ2A 1VL2A 2WITA 4XE5B 4XA4A 5B5EE 2AEMA 4H0LB 3A0HH 2FXMA 3CX5H 2O1JA 2Q9IA 3TGUJ 1GL2B 4IL6X 4JBZA 2QJPB 3L73E 4LLHA 1IC2A 4D6TJ 5KTBA 3L70D 2Z5HA 3CX5I 4IL6E 2E5TA 5CJ0A 1MUUA 1OW8A 2WQYC 3FX0A 3GG2A 3D6ZA 3L72D 1M7LA 1U57A 2OYHC 1AQ5A 2PP6A 1FZFA 3CWBJ 4WB4A 2QJKB 1S2EA 3L72J 1W2BO 1KYOE 2A45G 1EDIA 2Y0DA 3AEDC 4ASVA 2RH0A 1S1CX 1L0ND 1RQVA 3OW2O 3L70G 2R44A 2KLUA 2WMMA 1SFCB 5AVUB 1VQ4P 3L72G 3AE3C 4AQRD 1L0NJ 2YIUC 2BEZF 3BRVB 2KXPB 1QGKB 2IBZE 4I2LC 5KAIE 5KLVE 3B5NB 2KI7B 4RKUJ 2W27A 3SSUA 2NRGA 2Q1KA 1L0NG 5DJTB 2D2CB 1Z56A 2A45H 3BATA 1L0NK 3W67A 2G8YA 4W7YA 1Q7YQ 3L73D 3CCQP 4IFMA 5EFWB 2A45I 3T97A 1OX3A 2VRSA 3RK3E 3PTZA 3BCCJ 2IPPA 1YQ3C 2E76B 1RH5B 2ZFCA 4WY4B 2KS1B 1KYOD 5AW7B 2PRRA 1M57D 1AJYA 3AE6C 4C7NA 5AW3B 1JUNA 3L73G 1IK7A 2WWWA 5AVSB 1MV8A 1MZ9A 1GMJA 1NGMB 4ZKPA 3RL0C 2POHA 4WWIA 1OZHA 3VP9A 4O9BA 1KQFB 1T6AA 5GTHE 1CSBA 1N7SD 1PZQA 1RE3A 5KLVD 1USDA 5C39A 1KC8Q 3BVHA 5B5EH 4BXLA 2L5GB 3VMYA 2J59M 3F5HA 2QJYC 2W6BA 3L75J 2I1JA 5KLVJ 3VMXA 1NTZK 3S1KA 3TF5A 1Q90D 4U3FE 4UB6E 4N6JA 2L91A 2E42A 4IL6H 2FXPA 3AE9C 3UIAA 4L76A 1QVGO 5KLVG 4H44C 1RE4C 3AEAC 2OYIC 1L4AD 3QH9A 3ABVC 3RK3D 3H6PA 1GL2D 1N7SC 2IDBA 1PL5A 3G4SP 1KYOH 3KPEA 2N1TD 3RK2D 3L4FA 2P10A 3Q2YA 3M0DC 2XNXA 4H13B 2HODA 1YIJP 2NPSD 1NTKJ 4K35A 4I1LA 1FJPA 1KYOI 3BRTB 4ASWA 1KFNA 3H1IJ
chains in the Genus database with same CATH topology
1KYOH 1NTMG 1BGYG 3H1LG 3CX5H 1L0LG 1PPJG 1KB9H 3L70G 1NTZG 1BCCG 2IBZG 3L75G 3CXHH 3TGUG 5KLVG 1SQQG 2FYUG 1SQBG 3H1HG 2BCCG 1SQXG 3L71G 1NTKG 3CWBG 3H1KG 1EZVG 1BE3G 3H1JG 1L0NG 3L72G 1P84H 4D6TG 1SQPG 4PD4H 4U3FG 3L73G 1PP9G 3H1IG 2A06G 3L74G 1NU1G 1SQVG 3BCCG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYO H;  1NTM G;  1BGY G;  3H1L G;  3CX5 H;  1L0L G;  1PPJ G;  1KB9 H;  3L70 G;  1NTZ G;  1BCC G;  2IBZ G;  3L75 G;  3CXH H;  3TGU G;  5KLV G;  1SQQ G;  2FYU G;  1SQB G;  3H1H G;  2BCC G;  1SQX G;  3L71 G;  1NTK G;  3CWB G;  3H1K G;  1EZV G;  1BE3 G;  3H1J G;  1L0N G;  3L72 G;  1P84 H;  4D6T G;  1SQP G;  4PD4 H;  4U3F G;  3L73 G;  1PP9 G;  3H1I G;  2A06 G;  3L74 G;  1NU1 G;  1SQV G;  3BCC G; 
#chains in the Genus database with same CATH topology
 1FZC A;  2M5A A;  5CCG D;  5KAI H;  5KLI C;  4OVN F;  2W90 A;  1SQB J;  4C7N B;  2KLV A;  1L4A C;  1X0T A;  3RK3 C;  5AVZ B;  2PGD A;  1SFC D;  1NTK K;  1LWU C;  1GL2 C;  3H1L E;  3W68 A;  2PAJ A;  4UB8 E;  2KB7 P;  1KTM A;  2AXT E;  4U3F D;  2KZI A;  4RO0 A;  2N1T C;  2KK7 A;  1K04 A;  3HUS A;  2KNC A;  1SQB K;  2LXB A;  4C7R A;  2OYH B;  2ZXX A;  2K9J A;  1BDC A;  3GMA A;  3KXD A;  4YXW H;  3O8Z A;  3V2N A;  2E74 D;  2BCC E;  1L0L J;  4XFJ A;  1G2C A;  3M9H A;  2B89 A;  2D2C D;  2YKQ A;  5CCG C;  4OGQ D;  3PP5 A;  2YXR B;  1KMI Z;  1CI6 A;  2ZT9 D;  4U3F G;  2LKM A;  4ZKU A;  5CCH A;  5TJH A;  1SFC C;  3CXH E;  2WTY A;  2IFN A;  3V5B A;  3H25 A;  3H1K E;  1L0L K;  1HH0 A;  5GTH H;  3MP7 B;  2K37 A;  1PGQ A;  3B5N C;  1H0T B;  1SQP E;  3M91 A;  3II6 A;  2N9B A;  1HUC A;  1KB9 E;  1FC2 C;  2C0X A;  2E74 C;  4PJ0 E;  2D2C C;  3TYY A;  1KV4 A;  4HJG H;  2ZJS E;  2XKM A;  3H1L D;  1Y9B A;  2I1K A;  4UB6 H;  1K9M Q;  2ZT9 C;  3CC4 P;  1RY3 A;  1YJ9 P;  1OVR A;  2GM4 A;  3H1L J;  1P84 D;  2BEQ D;  1SQV K;  1EZV E;  4BRY B;  1M1K Q;  3G3Z A;  1S4X A;  3H1L G;  1Y8A A;  2QG4 A;  4TT3 H;  2KYV A;  3MTU E;  2BCC J;  3CMA P;  2FXO A;  3GF3 A;  1Y47 A;  3L36 A;  2KIK A;  1EXI A;  1JEK A;  4N3Y B;  3C1L A;  3H1K D;  1NO4 A;  3TGU E;  1SQX E;  2YMK A;  2QSI A;  2P67 A;  4D6T E;  2R32 A;  3H1K J;  1KB9 D;  2QJY B;  4H13 D;  2ZYG A;  1N8R Q;  1J1E B;  4N78 E;  3CL3 D;  3LW5 J;  1SQP J;  2B88 A;  5APQ A;  3KZI E;  4UB8 H;  5KJ7 C;  1WRG A;  4LGD E;  2AXT H;  3M06 A;  1HF9 A;  3CWB E;  2H7H A;  3H1K G;  2QE7 H;  3P32 A;  1LNQ A;  2P1J A;  2GUS A;  3H32 A;  1EZV D;  5AW0 B;  2I8D A;  1SQP K;  1N7S B;  1P84 I;  2P7J A;  3USS A;  1S72 P;  1IFJ A;  5CBO A;  1BE3 J;  2WVR A;  4DT0 A;  1FZA A;  4H13 C;  3IR9 A;  5TIS E;  3N4X A;  1EC5 A;  4ZMD A;  3P7K A;  4JPZ B;  2E43 A;  1JNM A;  2WSF J;  3VN0 A;  5CBN A;  1VQM P;  1EZV G;  1M1J B;  3HD7 A;  2H89 C;  2BAS A;  3TNU A;  3TGU D;  5KLI B;  4EOT A;  2R3S A;  3LW5 H;  5AW9 B;  3NXS A;  3M9Q A;  3AE4 C;  1URQ A;  1L4A B;  3C8V A;  4D6T D;  1KB9 H;  3RK3 B;  1Q81 Q;  1U7M A;  5DJU B;  1LWU B;  1SQX J;  4PJ0 H;  3JC2 2;  4N78 D;  3V2P A;  2HPC A;  3LIE A;  2IX7 C;  1AV1 A;  2W6A A;  1LTT C;  2N1T B;  3RK2 B;  2UWJ E;  1KB9 I;  3BCC E;  1L2P A;  1JM0 A;  3MUD A;  1NU1 J;  3CWB D;  2NPS B;  2YMY A;  3E1I A;  3TGU G;  1JY2 P;  1UII A;  1FDM A;  4D6T G;  2DW3 A;  3CME P;  1SQX K;  5AW2 B;  1DH3 A;  4K3A A;  1H89 A;  1IZN B;  1NYH A;  2OTK E;  2V7Q J;  2Y0C A;  1BGY J;  1NTZ E;  3PLN A;  3SFD C;  1VQO P;  4EYY Q;  1OW7 A;  1EZV I;  1NU1 K;  1NJI Q;  1NWQ A;  5BU5 A;  1RF1 A;  3CWB G;  3VTP C;  1DIP A;  3AEC C;  3U1A A;  5KKZ C;  3WU2 E;  2HG5 D;  3L75 E;  5K5G B;  1GTW A;  4U7J A;  2IYO A;  3L37 A;  1SLQ A;  1PP9 E;  1VQ6 P;  3HE4 B;  4Y99 C;  2E74 B;  1NTM E;  2FKW B;  2YKO A;  1DD4 A;  3CI9 A;  1T8Z A;  1FDO A;  4OGQ B;  3HE5 A;  2ZT9 B;  3KZI H;  2JDI H;  1BDD A;  3P8M C;  4DJG A;  1T3U A;  5M1B A;  5APX A;  3BCC D;  1HBW A;  2C0W A;  3EFG A;  2JEE A;  2P2U A;  3IN6 A;  1S5L X;  3RBX A;  5CCH D;  2QM7 A;  1SQQ E;  1S5L E;  3L71 E;  1NTK E;  1ZV8 A;  4CPG A;  1NTZ D;  3H1I E;  4HYT B;  1SS1 A;  1J1D C;  3PH0 A;  1W5C E;  4PV1 D;  1EDJ A;  3BCC G;  2KOG A;  3AE8 C;  5TIS H;  2HLO A;  1ZR2 A;  1SQB E;  1NTZ J;  3F89 A;  3CLQ A;  3WUV A;  2IBZ D;  3L75 D;  3NMD A;  2Z4E A;  2FFD A;  3I56 P;  2HFE D;  4JF7 A;  3CC2 P;  1YIT P;  1VQN P;  2Q6Q A;  1NTZ G;  1PP9 D;  1YJW P;  3IAO A;  1J1E C;  3B8E B;  4WVZ A;  4Y28 J;  1NTM D;  2FYN B;  3EFF K;  2JR8 A;  4GOF A;  3SWY A;  1OVV A;  4W80 A;  3HRN A;  1PP9 J;  5APS A;  1L0L E;  1NTM J;  1Q86 Q;  3AE7 C;  2AEJ A;  2IBZ G;  3L75 G;  1FZG A;  2AEF A;  1JMB A;  1K05 A;  1JTH A;  3H1H J;  3AEE C;  3WUT A;  1TU3 F;  1IFN A;  2OAR A;  3R2P A;  1SQQ D;  3V2Q A;  4M3L A;  1DD3 A;  3L71 D;  3HE5 B;  3GHG A;  2WT7 A;  4IOI H;  1NTK D;  1LTA C;  1RQU A;  2R5D A;  1R5L A;  2LXC B;  1OFC X;  1W2E A;  1SQQ J;  1NTM K;  3CCE P;  3H1I D;  3FXE A;  1DX7 A;  1WMK A;  3T97 B;  1LTI C;  3L71 J;  1HJB A;  1KQL A;  5KAF E;  4LC1 A;  1SQB D;  1SQV E;  4R4L A;  3E1R A;  1ZR4 A;  2JWA A;  2MJZ A;  1QVF O;  2IYP A;  2H8P D;  1M1J C;  3WU2 H;  5APU A;  1T2K D;  1LT9 A;  3L71 G;  3VMA A;  1NTK G;  2E5Y A;  4GT1 A;  2O01 N;  2C9L Y;  1SQQ K;  4DZO A;  3CCL P;  1MFT A;  3H1I G;  3WUU A;  2IBZ I;  3L74 J;  1RHZ B;  3A3Y B;  1GZL A;  1A02 F;  1PPJ E;  1YTZ I;  2O01 J;  5E79 E;  1SQB G;  3RK2 C;  2C9N Y;  3P8C E;  3CC7 P;  1PFI A;  1LTB C;  1L0L D;  2NPS C;  2GA1 A;  4I6M C;  3HTK A;  5BU8 B;  4TLF A;  1GK4 A;  4GKG A;  1S5L H;  2R3C A;  3VYI A;  3H1J E;  4AYC A;  1T2K C;  3A2A A;  1JB0 J;  1IFI A;  3HD7 D;  3LID A;  1L0L G;  5APW A;  1URQ D;  2XZR A;  5BVZ A;  2H43 A;  1ZXG A;  1SQV D;  1LP1 A;  3BAS A;  4PD4 E;  5KKZ B;  1MFZ A;  2Y9Y A;  1KIL A;  3GHG B;  4EI2 A;  3MD0 A;  1SQV J;  2LR2 A;  4IFF A;  3FWL A;  1ZW0 A;  2HOD B;  4Y99 B;  3SWK A;  1K8A Q;  2Q3E A;  5AW1 B;  4OGQ C;  1DEB A;  3QWO C;  1IFD A;  1PPJ D;  1SVF A;  1SP4 A;  3A0H E;  1FZC B;  1RE4 A;  3GW6 A;  2M5A B;  1SQV G;  2WSC J;  1A02 J;  3HD7 C;  2OYI A;  1Q2N A;  1BSN A;  1URQ C;  1NKZ B;  1BE3 E;  2XU6 A;  1OWA A;  2B87 A;  1N73 A;  1VF5 D;  3G6E P;  1LJ2 A;  2WPR A;  3CPW O;  2Y9Z A;  1IO4 A;  2BCC D;  2ZVN B;  2O1K A;  3H1J D;  2NZ2 A;  2IZ0 A;  1YBK A;  1PPJ G;  1J1D B;  1X22 A;  3HUS B;  2KNC B;  2KUB A;  1FOS E;  5APT A;  5B66 E;  3H1J J;  3CXH D;  5KAF H;  1FOS F;  1LGH B;  2K9J B;  1ZOY C;  1DEE G;  1G2C B;  2AXC A;  4JYC A;  1LT1 A;  4PD4 D;  2OYO A;  2BCC G;  1CI6 B;  1SQP D;  1VQ9 P;  1ZME C;  1GL2 A;  3H1J G;  2FY8 A;  1RF1 C;  1VF5 C;  2HYN A;  3AEF C;  1NU1 E;  2WSE J;  4EDF A;  2J5U A;  1YYC A;  2FYN C;  1HVV A;  1IFP A;  3RL0 g;  1GK6 A;  3M0A A;  1BCC J;  1JOC A;  2HR3 A;  2FYU J;  2ZVO B;  2JKV A;  3OAK A;  1GU5 A;  4PV1 B;  4YTP C;  2QVA A;  2M0B A;  5AVR B;  1EDK A;  1SQP G;  1BGY E;  3CCV P;  1FAV A;  1BE3 D;  1QL1 A;  3A7O A;  1N2D C;  2FYZ A;  1KQG B;  1N7L A;  4AUW A;  3S4R A;  1KN7 A;  1SFC A;  1PV3 A;  1USE A;  5L8R J;  2FYU K;  1VQP P;  3VP8 A;  2K9Y A;  5AW5 B;  1OMI A;  5APV A;  3Q3D A;  2J58 A;  3I55 P;  2Q7C A;  2QRX A;  1KZU B;  3Q5R A;  2XV5 A;  2JWD A;  3CXH H;  2OGU A;  3B5N A;  1D7M A;  4NPD A;  3OA7 A;  1ZRT E;  1BE3 G;  1EXJ A;  4PD4 H;  2W83 C;  5AW8 B;  1PGP A;  1RF0 A;  1KOR A;  1SQX D;  3CXH I;  1YI2 P;  5AVX B;  2V4H A;  4PD4 I;  4IFD K;  3D70 A;  1NU1 D;  2KSJ A;  1PGO A;  1JMM A;  2QIW A;  3MGN A;  1VPC A;  4KT0 J;  1AA0 A;  2YKP A;  1RE3 C;  2FFD C;  2Q3I A;  1FE6 A;  4W7Z A;  1KQS O;  1SQX G;  4WY4 A;  1BGY D;  2KS1 A;  2E75 B;  1NH4 A;  1PGJ A;  1VQ5 P;  2CPS A;  1NU1 G;  2RKL A;  3D6Y A;  1VQ8 P;  2M3B A;  5H2F E;  3GF7 A;  1HGV A;  3L70 J;  4I7Z C;  3KDP B;  2YO3 A;  2WSF H;  3CCU P;  3B71 A;  1KIL E;  3D71 A;  3O6Q A;  1AVY A;  1PIX A;  2WZ7 A;  2H88 C;  3AE5 C;  1H88 A;  5B66 H;  5GTI E;  2A06 E;  4A7P A;  2SPZ A;  3CCS P;  3H32 B;  1E5W A;  1BGY G;  1ZRT D;  4JYB A;  1WT6 A;  3GHG C;  3OJA B;  3FWN A;  2KZJ A;  1ZLL A;  1G1J A;  4EIJ A;  3PJS K;  5KJ7 A;  1GU4 A;  4YPC A;  2RMZ A;  5CJ4 A;  3H1H E;  2XND H;  4RES B;  3EWK A;  3I5C A;  1FZC C;  2YXQ B;  3VMZ A;  2ZXE B;  3HD7 B;  3TNU B;  1LTJ A;  1LT9 C;  3B4S A;  2V7Q H;  3MHV A;  1URQ B;  3RL0 D;  3G71 P;  1QL2 A;  3JCU E;  2M3E A;  1FS0 E;  3KHU A;  3NTN A;  1U7J A;  2HPC B;  4HH2 A;  1GDT A;  3A0B E;  3L73 J;  4DCK A;  1KIL D;  2CK3 H;  3HUS C;  5AVV B;  1BSH A;  1JY2 O;  4HB1 A;  3CD6 P;  2A06 D;  2W6J H;  4DOJ A;  3U59 A;  3L74 E;  1YHQ P;  4GOD A;  3Q5S A;  1FU1 A;  4H44 D;  1HGZ A;  2WPS A;  3G9R A;  5CCH C;  3O6Q B;  1RF1 B;  1VF5 B;  1J2J B;  3ZDM A;  2WPV B;  3CCJ P;  3V4Q A;  3MIW A;  1OW6 A;  2JJL A;  3JSV C;  5AVQ B;  1AFO A;  3H1H D;  2A06 G;  1JCD A;  2OYH A;  1KIL C;  4PV1 C;  3E7K A;  4ZNC A;  1S3J A;  2O3J A;  1YJN P;  1JY2 N;  1IK9 A;  1YQ4 C;  1OXZ A;  3R4Y A;  4B86 A;  1PP9 G;  4R4M A;  1VQK P;  1NTM G;  3ITK A;  2KP8 A;  3TDK A;  4NPF X;  4H0L D;  5H2F H;  2WSS H;  3H1H G;  3KQG A;  2MKV A;  3PRJ A;  3TSI A;  4JQ0 D;  2CPB A;  1LTJ B;  3Q1M A;  5KLV K;  3S9O A;  3MZW B;  2Y0E A;  5GTI H;  3A5T A;  4QMA A;  1H0T A;  1N73 C;  2E75 D;  1GW4 A;  2GUV A;  2OTJ P;  1E79 H;  1SQQ G;  1ZN5 A;  1X9V A;  3IF4 A;  1FBM A;  3L74 D;  1FDI A;  2JO1 A;  1M8O B;  2ITA A;  1IJD B;  4WBA A;  2FBW C;  3FGA D;  1X79 B;  1M56 D;  4RJT A;  2OQQ A;  2WPQ A;  5CHX A;  3AEG C;  5APY A;  4H0L C;  4BRY A;  3PHL A;  3SWF A;  2FFD B;  4HKZ H;  1KFM A;  4GDO A;  3L74 G;  5AVT B;  1JY3 P;  2QJP C;  3JCU H;  2E75 C;  3V6I A;  5AVY B;  4OWF A;  1FZE A;  3V4W A;  1P84 E;  3B5N D;  2P58 A;  4U3F J;  4I7Z B;  3A0B H;  1NOH A;  1EQ7 A;  3RBZ A;  1MKM A;  2QA4 P;  2QJK C;  1GD2 E;  1JTH B;  1YTZ T;  4L75 A;  1XTG B;  3NFQ A;  3M9B A;  2K3R A;  2ZYD A;  2WT7 B;  1R8E A;  3CCM P;  3TK1 A;  1KD1 Q;  4MN4 C;  1BCC E;  2Q5U A;  2YIU B;  2FYU E;  2O01 H;  1NAF A;  1LTS C;  2E76 D;  4WY4 D;  4KJM A;  3AE2 C;  2K1A A;  1X8Y A;  2IZ1 A;  4KHX A;  1H8A A;  3CX5 E;  1Q82 Q;  1G1I A;  2G3A A;  1RF0 C;  3P8C D;  1T3J A;  3N7N A;  1GW3 A;  1K73 Q;  1LT9 B;  3C9I A;  1NHL A;  3SFE C;  2W8Z A;  1N7S A;  1LTG C;  4L74 A;  2QEX P;  2N9Y B;  2IFM A;  1VQ7 P;  3M0D A;  1QEX A;  1FJK A;  3MUD C;  1S9K E;  1OVU A;  1R5S A;  1UIX A;  3K5B A;  3VOP A;  2E76 C;  2ZYA A;  1N86 A;  1M1J A;  4L73 A;  1M90 Q;  3RGU A;  1JY3 O;  4WY4 C;  3HTK B;  2R5B A;  5KJ7 D;  3V2R A;  3AEB C;  1L4A A;  3KYQ A;  3FXD A;  1NAY A;  1CW5 A;  2JP3 A;  2KSE A;  1LWU A;  1VQL P;  3RL0 B;  1HTL C;  4BWN A;  5AW6 B;  2OTL P;  1BCC D;  3Q5P A;  2FYU D;  2N1T A;  2WSC H;  2QM8 A;  1IFM A;  5AVW B;  3L35 A;  2NPS A;  1LP1 B;  4GIF A;  5E79 H;  2PFX A;  1KIL B;  3CX5 D;  1FZB A;  3AE1 C;  2Z5I A;  1JY3 N;  3GLM A;  5CCG A;  3CCR P;  2B9B A;  3L70 E;  2K88 A;  2YO2 A;  1HJ0 A;  1JO5 A;  1BCC G;  4C46 A;  2FYU G;  1OIP A;  1AVO A;  2XDJ A;  3L72 E;  4Z1M H;  1P84 H;  1ZP0 C;  1QX8 A;  4H44 B;  2RN0 A;  2OYI B;  5AW4 B;  1EDL A;  2YNY A;  1S9K D;  1LTJ C;  1NKN A;  1JCC A;  1VDF A;  3U1C A;  2B87 B;  5CMZ A;  1N73 B;  1L0N E;  2M8R A;  3WMM 0;  1NVO A;  4GOE A;  1HWT C;  4OH8 B;  1XTC C;  2WSE H;  4NPE A;  1AQT A;  3HE4 A;  1CZQ A;  1QLE D;  4YXD C;  3IFM A;  2ZAE B;  3EQ2 A;  1VL2 A;  2WIT A;  4XE5 B;  4XA4 A;  5B5E E;  2AEM A;  4H0L B;  3A0H H;  2FXM A;  3CX5 H;  2O1J A;  2Q9I A;  3TGU J;  1GL2 B;  4IL6 X;  4JBZ A;  2QJP B;  3L73 E;  4LLH A;  1IC2 A;  4D6T J;  5KTB A;  3L70 D;  2Z5H A;  3CX5 I;  4IL6 E;  2E5T A;  5CJ0 A;  1MUU A;  1OW8 A;  2WQY C;  3FX0 A;  3GG2 A;  3D6Z A;  3L72 D;  1M7L A;  1U57 A;  2OYH C;  1AQ5 A;  2PP6 A;  1FZF A;  3CWB J;  4WB4 A;  2QJK B;  1S2E A;  3L72 J;  1W2B O;  1KYO E;  2A45 G;  1EDI A;  2Y0D A;  3AED C;  4ASV A;  2RH0 A;  1S1C X;  1L0N D;  1RQV A;  3OW2 O;  3L70 G;  2R44 A;  2KLU A;  2WMM A;  1SFC B;  5AVU B;  1VQ4 P;  3L72 G;  3AE3 C;  4AQR D;  1L0N J;  2YIU C;  2BEZ F;  3BRV B;  2KXP B;  1QGK B;  2IBZ E;  4I2L C;  5KAI E;  5KLV E;  3B5N B;  2KI7 B;  4RKU J;  2W27 A;  3SSU A;  2NRG A;  2Q1K A;  1L0N G;  5DJT B;  2D2C B;  1Z56 A;  2A45 H;  3BAT A;  1L0N K;  3W67 A;  2G8Y A;  4W7Y A;  1Q7Y Q;  3L73 D;  3CCQ P;  4IFM A;  5EFW B;  2A45 I;  3T97 A;  1OX3 A;  2VRS A;  3RK3 E;  3PTZ A;  3BCC J;  2IPP A;  1YQ3 C;  2E76 B;  1RH5 B;  2ZFC A;  4WY4 B;  2KS1 B;  1KYO D;  5AW7 B;  2PRR A;  1M57 D;  1AJY A;  3AE6 C;  4C7N A;  5AW3 B;  1JUN A;  3L73 G;  1IK7 A;  2WWW A;  5AVS B;  1MV8 A;  1MZ9 A;  1GMJ A;  1NGM B;  4ZKP A;  3RL0 C;  2POH A;  4WWI A;  1OZH A;  3VP9 A;  4O9B A;  1KQF B;  1T6A A;  5GTH E;  1CSB A;  1N7S D;  1PZQ A;  1RE3 A;  5KLV D;  1USD A;  5C39 A;  1KC8 Q;  3BVH A;  5B5E H;  4BXL A;  2L5G B;  3VMY A;  2J59 M;  3F5H A;  2QJY C;  2W6B A;  3L75 J;  2I1J A;  5KLV J;  3VMX A;  1NTZ K;  3S1K A;  3TF5 A;  1Q90 D;  4U3F E;  4UB6 E;  4N6J A;  2L91 A;  2E42 A;  4IL6 H;  2FXP A;  3AE9 C;  3UIA A;  4L76 A;  1QVG O;  5KLV G;  4H44 C;  1RE4 C;  3AEA C;  2OYI C;  1L4A D;  3QH9 A;  3ABV C;  3RK3 D;  3H6P A;  1GL2 D;  1N7S C;  2IDB A;  1PL5 A;  3G4S P;  1KYO H;  3KPE A;  2N1T D;  3RK2 D;  3L4F A;  2P10 A;  3Q2Y A;  3M0D C;  2XNX A;  4H13 B;  2HOD A;  1YIJ P;  2NPS D;  1NTK J;  4K35 A;  4I1L A;  1FJP A;  1KYO I;  3BRT B;  4ASW A;  1KFN A;  3H1I J; 
#chains in the Genus database with same CATH homology
 1KYO H;  1NTM G;  1BGY G;  3H1L G;  3CX5 H;  1L0L G;  1PPJ G;  1KB9 H;  3L70 G;  1NTZ G;  1BCC G;  2IBZ G;  3L75 G;  3CXH H;  3TGU G;  5KLV G;  1SQQ G;  2FYU G;  1SQB G;  3H1H G;  2BCC G;  1SQX G;  3L71 G;  1NTK G;  3CWB G;  3H1K G;  1EZV G;  1BE3 G;  3H1J G;  1L0N G;  3L72 G;  1P84 H;  4D6T G;  1SQP G;  4PD4 H;  4U3F G;  3L73 G;  1PP9 G;  3H1I G;  2A06 G;  3L74 G;  1NU1 G;  1SQV G;  3BCC G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...