2L5GB

Co-ordinates and 1h, 13c and 15n chemical shift assignments for the complex of gps2 53-90 and smrt 167-207
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
42
structure length
42
Chain Sequence
b'GLSKEELIQNMDRVDREITMVEQQISKLKKKQQQLEEEAAKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords G protein pathway suppressor 2
publication title Structural basis for the assembly of the SMRT/NCoR core transcriptional repression machinery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 13
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2010-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.430 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2l5gB00
4DOJA 4C7RA 1G1JA 4HH2A 3CI9A 4WB4A 2O1JA 3MIWA 2O1KA 4LLHA 2L5GB 1G1IA 4WBAA 2WITA
chains in the Genus database with same CATH superfamily
1FOSF 5KLVK 2I8DA 3G4SP 4KT0J 3CCEP 1M8OB 4H0LD 1BGYE 1NU1D 1J1EB 1CSBA 2O1JA 4EOTA 1PGOA 3GF3A 4JYCA 1SQQG 2WMMA 2B9BA 2FKWB 5AVZB 3CWBE 2V7QH 1S9KE 1T2KD 1K8AQ 3IR9A 2E76C 2N9YB 5CCHA 1YIJP 1JMBA 3RBXA 1LT9B 1NTZD 3MTUE 3CXHI 1DH3A 3LIEA 1PGQA 2ZXEB 1FZAA 2HFED 4PD4E 1NH4A 2N1TC 1LJ2A 2Y0EA 1MFZA 3L73E 1NVOA 1SQXD 4IL6E 1RF1A 1KFMA 1ZOYC 2IDBA 4N78E 5BU8B 3BCCE 1KILD 3RL0B 1S72P 2C9NY 2L5GB 4I7ZB 3H1HE 3AE5C 1FAVA 3QH9A 1GMJA 1EDJA 1A02F 1NU1K 1JEKA 1N73B 3BCCG 4D6TD 3M9HA 1Q81Q 2HPCB 5AW4B 1L0NJ 3H1HG 1SQBE 4JBZA 3H1JJ 2HG5D 2FXPA 2W90A 2W6JH 4NPEA 2A06E 2HODB 3KDPB 3OJAB 2KLUA 4ZKUA 4U3FJ 1VQ5P 4L73A 3AEAC 1FJKA 1SQBG 2BCCE 4WBAA 4HYTB 1L2PA 1ZMEC 1IK9A 5CCHD 1AJYA 1LWUB 4PJ0E 2FBWC 2CPBA 1VQ8P 3H1ID 4GOFA 2CPSA 2BCCG 1UIXA 1GK6A 3F89A 2NPSB 1VQ7P 3MUDA 3HTKB 2AXTH 1EXJA 2WSFH 4Y28J 1RF0A 1IFNA 1LTBC 1RQUA 2ITAA 1EZVE 3L74E 3L72E 1URQC 1DEBA 2OYIC 3A7OA 3VP8A 2O01N 1HF9A 3WUUA 1DD3A 1X8YA 2KZIA 5KAFH 1LGHB 4TT3H 2ZVOB 2KNCB 1KB9E 3CX5H 4PV1D 3NMDA 3OW2O 1EZVG 4I2LC 3L72G 4MN4C 3VN0A 5AVXB 2G3AA 1EQ7A 1JOCA 4YPCA 2QJPC 1VQOP 1G2CB 3CCSP 1ZR2A 4DJGA 1L0LJ 2KOGA 2I1KA 3C1LA 1RHZB 2YKOA 3L36A 1Q7YQ 1R5SA 2E74B 1Q82Q 4H0LB 2FYUJ 3KHUA 3AE2C 1J1EC 2A45I 3KPEA 1N2DC 1VQNP 1SQQD 3L75E 2IBZG 2KS1B 3TNUB 1FE6A 3Q5SA 3R4YA 2OGUA 3CX5E 1JCCA 3I5CA 1LT9C 1R5LA 3L71J 2OYHA 1IJDB 3L75G 1LP1B 4M3LA 5M1BA 1JM0A 1JY3P 3EFGA 2KK7A 1ZW0A 1NTME 1M1JA 5CHXA 3CCLP 4IL6X 5KLIB 3RL0C 2O01H 4I7ZC 3TGUJ 3S4RA 4PD4D 1NAFA 1OVVA 5CCGC 4LC1A 1VPCA 3L73D 3VYIA 5CBOA 1SQPE 4R4MA 4ASVA 4N78D 3BCCD 2IYOA 1N73C 4JF7A 4BRYB 1GTWA 1X79B 5APXA 1IFDA 3AEFC 3H1HD 1HJBA 1USDA 3HD7B 5AW9B 4JPZB 3JCUH 2XU6A 2WSEH 4RESB 1SQPG 1KYOE 3B5NB 5APVA 1ZN5A 1N7SB 3EQ2A 1VF5B 2SPZA 3W67A 1SQBD 3M9QA 2MJZA 3WU2E 1FZCA 1NU1J 1LTTC 4H13B 1MZ9A 1KV4A 2B87B 2C0WA 2KB7P 1BCCG 1LWUC 1N7LA 3AEEC 2XZRA 2BCCD 4HH2A 1KD1Q 1NTZJ 2NPSC 3KQGA 2PRRA 2WSCJ 2WTYA 1GW4A 1RE4A 3C9IA 3HUSB 2HR3A 2V4HA 1H88A 1RF1B 3M06A 2ZJSE 1GU5A 3V4QA 2K1AA 1SQXJ 1GU4A 3JCUE 3BATA 3P7KA 1YJWP 3CXHE 2H89C 1LT1A 1KQGB 3N7NA 3G3ZA 2XKMA 2QE7H 2FFDA 4I6MC 1BE3J 4EDFA 1OWAA 2QM7A 3GHGC 1SQBK 2LR2A 3E1IA 1EZVD 3CC2P 3L72D 2R44A 3MP7B 5KKZB 4D6TJ 1GD2E 2M0BA 3A0HH 3G9RA 1FZGA 3AE8C 3CX5I 3K5BA 4ASWA 3RGUA 2QJKB 2O3JA 1NHLA 1HTLC 1JO5A 1KB9D 5B5EH 1X22A 1DEEG 3B4SA 1L4AA 3AEBC 2WITA 2OTLP 3V2NA 4B86A 2J5UA 3VMYA 4WY4B 2ZXXA 2E74C 3GF7A 1E5WA 4OVNF 3L37A 5APSA 4K3AA 1HGVA 4GIFA 1VQMP 2IBZD 5B66H 2R5BA 1FZBA 3LW5J 1YTZT 3H1IJ 2K37A 1QX8A 1OFCX 3PTZA 3CLQA 2YXQB 3L70E 3L75D 3HRNA 1NJIQ 1FZFA 3V4WA 3A0HE 2IFNA 1FC2C 1OVUA 2HLOA 2POHA 5B5EE 1E79H 1SQVE 1YBKA 4I1LA 5KLIC 1BDDA 2YNYA 3L70G 1U57A 1VQ9P 4C7RA 1JY2O 1P84H 4EIJA 2GUSA 2Q7CA 3H1LG 3AEDC 1G1IA 3ZDMA 2W6BA 5B66E 4AUWA 1JTHA 1SQVG 1YQ3C 1VQ6P 3G6EP 1FDOA 4C7NA 3Q5RA 5AW5B 5GTIH 1OW7A 3PHLA 1L4AD 5APWA 3T97A 3LIDA 3HD7C 2K9JB 1SQPD 3B5NC 3VMAA 4QMAA 2BEQD 1N7SC 1SFCC 4EYYQ 2Y0CA 1YTZI 4OWFA 1VF5C 4H13C 4N3YB 2K9YA 1BGYG 4H44D 1SQQJ 1RH5B 4O9BA 1KYOD 1GZLA 3AECC 2QRXA 5K5GB 1BCCD 3U1AA 3CWBG 1VQ4P 3CCRP 2N1TA 1NTMK 3ITKA 3M0DC 3SFEC 2KP8A 2IZ0A 4AQRD 1RY3A 3CD6P 1EDKA 3H32B 5GTIE 2FXMA 3HUSC 3RK2D 2XNDH 2D2CD 1R8EA 1S5LX 2N9BA 3L73G 4GOEA 3TDKA 1LTJB 1SQPK 2A45G 2L91A 2E75B 2Z5IA 3VMXA 1AFOA 3AE6C 2GUVA 1OXZA 3BCCJ 3CXHD 5KKZC 5BU5A 1VDFA 3H1HJ 2H43A 4OGQB 1JY2N 4L74A 2Q3EA 2QJKC 3V6IA 3MZWB 2I1JA 5AW2B 1YYCA 1T3UA 1PIXA 3UIAA 1WT6A 3HE5B 2E5TA 3NFQA 3CMAP 1ZXGA 2A06G 4WY4C 1NGMB 4K35A 1SP4A 2E76D 1IFJA 1PL5A 5KTBA 1EDLA 4RKUJ 5KJ7C 3CMEP 2W27A 1IFPA 1VQPP 2IX7C 3D70A 3L4FA 2N1TD 5AVYB 2PGDA 1KQSO 1OZHA 5CBNA 3P8CE 3P32A 2BCCJ 2M3BA 1LTSC 2YMYA 2P2UA 1QEXA 2ZT9B 3A2AA 2B88A 1QVFO 2WPVB 1Y47A 1S3JA 4IFMA 1RE3C 1KMIZ 1URQA 3VMZA 2OYIA 1L0LE 2QEXP 1AV1A 3RK3B 1PGJA 3L74G 2E42A 3L70D 2P7JA 2ZYDA 2OQQA 5L8RJ 1HWTC 2YXRB 2O1KA 1GW3A 1J2JB 1UIIA 1H0TA 1CI6A 1MKMA 3H1LD 2JEEA 3JC22 4BWNA 4DT0A 1SQVD 3L72J 4NPDA 2E5YA 2AXTE 5C39A 2M5AA 1H8AA 2Q1KA 3A3YB 4TLFA 2XV5A 3S9OA 2P1JA 3H1KE 4HJGH 1SLQA 4IFFA 3L35A 1U7JA 5KAFE 2W8ZA 4GDOA 2P67A 2P10A 5AW1B 2VRSA 1BGYD 3V2PA 1SVFA 3H1KG 1LT9A 5KLVJ 2YKPA 2WPSA 3CWBD 3KXDA 4YTPC 1S9KD 1U7MA 3JSVC 4R4LA 1SS1A 5APYA 1S2EA 2WWWA 1URQD 1SQVK 5AVVB 1KILB 2WSCH 1CW5A 4UB8H 1PP9E 3RK2B 1AA0A 3ABVC 5AW7B 1NTMG 5CCGA 4UB6H 2BASA 5AVTB 2JJLA 1LTJC 3MGNA 1GL2A 2E75C 2JKVA 2BEZF 2WT7B 1N73A 1FJPA 1WMKA 3OAKA 3BRTB 1KQFB 1PP9G 1QGKB 3E7KA 4XA4A 2HYNA 3SFDC 1W2BO 1X0TA 2AEJA 3H6PA 1LTIC 1NAYA 5AW3B 5AW6B 1HGZA 4OGQC 1S5LH 3TK1A 4JYBA 3AEGC 1NTZE 1SQPJ 3PH0A 1HJ0A 2A06D 3U1CA 4CPGA 5H2FH 4DOJA 2DW3A 4AYCA 1YI2P 4UB6E 1SQXE 1LWUA 4W7YA 2NPSA 2J59M 2JWDA 1Q90D 1BCCJ 1BE3E 3HTKA 3Q3DA 2MKVA 5TISH 3LW5H 3M9BA 5TJHA 2PP6A 3AE4C 4KHXA 3V5BA 3RL0D 2ZT9C 1QL1A 1W2EA 2KUBA 1HVVA 3KYQA 1IO4A 5APUA 5E79H 1DX7A 1Q2NA 5CCGD 1VL2A 1DIPA 3B71A 3BASA 1BE3G 1YHQP 2IZ1A 4LGDE 3P8CD 1CZQA 1GL2D 2P58A 4ZMDA 1BSNA 3GHGA 3RK3C 1FU1A 1KC8Q 1MV8A 3L74D 2KNCA 4PV1B 3VOPA 1ZP0C 5H2FE 4WWIA 2QIWA 2JWAA 1AVYA 3CC4P 2ZVNB 1NTKE 1YJNP 3A5TA 1YITP 2FY8A 1PPJE 3EWKA 4KJMA 2KSEA 5EFWB 3H1IE 4H0LC 1LTGC 2R3SA 1N86A 1NTKG 3D6ZA 3KZIH 4JQ0D 4YXDC 2QM8A 1PPJG 1OW6A 4GKGA 2KS1A 1NOHA 3TNUA 1PFIA 4RO0A 2NZ2A 1NYHA 3GG2A 1HUCA 1T2KC 4ZKPA 3GLMA 1IZNB 1AQTA 3A0BH 2K88A 2NPSD 3II6A 2YKQA 3H1KD 3PLNA 2IYPA 1GDTA 2UWJE 1XTCC 1IK7A 3CX5D 3SSUA 1L0LK 5CJ4A 2OTJP 1Y8AA 1KILC 4A7PA 2OYIB 1NTMD 1M1KQ 4DZOA 1OVRA 1TU3F 3CL3D 3L70J 1JCDA 3M91A 3VTPC 2WQYC 2YIUB 4PD4H 1PP9D 4IFDK 3HE4A 1USEA 3H1LJ 2LXBA 1MFTA 1SQQE 4IL6H 1KN7A 1KTMA 1N8RQ 1SQVJ 5CMZA 3HD7A 2M5AB 1G1JA 2E74D 3B5NA 1JY2P 1WRGA 1N7SA 1JNMA 1SFCA 1EC5A 4GT1A 5CJ0A 2W6AA 3CCQP 1M7LA 2QA4P 2YO2A 1P84E 4Y99B 5CCHC 2B87A 3BRVB 3M0AA 3PP5A 2OYHB 1BGYJ 2ZFCA 1K05A 3CI9A 3G71P 1FZEA 3FWNA 3M0DA 3D71A 3Q5PA 1L0NE 3CWBJ 3GMAA 4C46A 1OW8A 1M1JB 1BSHA 2QVAA 1RF1C 3SWFA 3HUSA 3H1JE 3CCJP 2AXCA 3IF4A 3CCVP 2Y0DA 3PRJA 4L76A 3MIWA 2R32A 4U3FE 2Q9IA 1L0NG 1BE3D 4PJ0H 3L73J 1HH0A 2RH0A 3H1JG 1GL2B 1ZRTE 1ZLLA 4N6JA 4PV1C 4BXLA 1KORA 2YO3A 2XNXA 4U3FG 3NXSA 3HD7D 1JB0J 1QL2A 1T6AA 1NTZK 2R3CA 3B5ND 2OARA 3WMM0 2V7QJ 1YJ9P 1N7SD 1J1DB 1SFCD 3FWLA 1VF5D 1FZCB 1AVOA 4WY4A 5GTHH 2W83C 3TF5A 1Y9BA 1PV3A 1SQBJ 4H13D 1SQXK 1NTKD 3D6YA 4W7ZA 1KB9H 3WUTA 1KQLA 3S1KA 3FXEA 5KJ7A 1PPJD 1NKNA 1IC2A 5AVUB 2XDJA 3E1RA 3U59A 2M8RA 5AVRB 3H25A 4WVZA 2FYNB 2LXCB 3N4XA 3O6QA 3MUDC 1BDCA 4DCKA 1GK4A 4GODA 1NO4A 2FYZA 2KSJA 3AE7C 1RF0C 2K3RA 3IFMA 3IN6A 1RE3A 3MHVA 2FFDB 3VP9A 3W68A 2RKLA 5GTHE 3P8MC 4W80A 2FYUE 3GHGB 3Q1MA 3IAOA 1ZV8A 2KXPB 1L0LG 1NTKK 2Z5HA 4RJTA 3L74J 1P84I 2C0XA 2PAJA 1KZUB 3SWYA 2H88C 2YIUC 2GA1A 1FS0E 1OX3A 2FYUG 4IOIH 1L4AB 2IBZE 3L71E 5KLVE 2K9JA 4WY4D 4PD4I 1JY3O 5DJUB 3QWOC 1AQ5A 3OA7A 3AE9C 5KJ7D 1K73Q 2AEFA 4H44B 3L71G 1H89A 3R2PA 5KLVG 3TGUE 5APQA 4Y99C 5AVQB 3USSA 2WSFJ 1S4XA 2QJYB 1W5CE 1IFIA 1K04A 3AE3C 2KZJA 5APTA 2OYHC 3RK3E 2Q5UA 1OMIA 3H1KJ 3B8EB 3I55P 2NRGA 3L75J 1KYOH 4XE5B 1P84D 3TGUG 1M1JC 3H32A 2D2CB 5DJTB 5AW0B 3WU2H 1T3JA 4WB4A 3FGAD 1LTJA 2OTKE 4HKZH 1L0ND 3NTNA 1D7MA 2HPCA 1NTMJ 1JTHB 1NU1E 3H1JD 1GL2C 3AE1C 1K9MQ 3CCUP 4C7NB 1SQQK 1FOSE 1FDIA 1LNQA 2Z4EA 3HE4B 4U3FD 4Z1MH 3T97B 1VQKP 1PP9J 2HODA 2H8PD 2ZAEB 3V2RA 2H7HA 1FDMA 1FBMA 1NU1G 2ZYAA 1ZRTD 2RMZA 3FX0A 4UB8E 3CCMP 3CXHH 4LLHA 2RN0A 3HE5A 1BCCE 1J1DC 1SFCB 1FZCC 2QG4A 2ZYGA 2E76B 2Y9YA 1EZVI 2WPRA 1Z56A 1EXIA 1NTZG 1KILE 2M3EA 1QLED 1LTAC 1NWQA 2C9LY 1XTGB 2N1TB 1JY3N 1L0NK 1ZR4A 2Q6QA 1KB9I 1RQVA 2E43A 1SQXG 2FYNC 1DD4A 3BVHA 1RE4C 3O8ZA 4D6TE 2O01J 1X9VA 1PGPA 2B89A 1S5LE 3FXDA 1JMMA 2WPQA 2Y9ZA 2IBZI 1VQLP 2E75D 2QSIA 3F5HA 2FFDC 2OYOA 4D6TG 5AVSB 2JP3A 1QVGO 3Q2YA 2KLVA 1L0LD 2WSEJ 3C8VA 4EI2A 2JR8A 1G2CA 2AEMA 2JO1A 4L75A 4OGQD 5TISE 2FYUD 2WZ7A 1L4AC 1A02J 2YMKA 3MD0A 5AW8B 1YQ4C 1IFMA 2WVRA 3PJSK 4ZNCA 5E79E 3CPWO 2IFMA 2G8YA 3I56P 2Q3IA 3GW6A 1KFNA 3H1IG 1NTKJ 1HBWA 3L71D 4H44C 5KAIH 2J58A 1S1CX 5KLVD 1M56D 2KYVA 2KI7B 1LP1A 4OH8B 2QJYC 3RBZA 3O6QB 4XFJA 1OIPA 4YXWH 2PFXA 3RL0g 3TSIA 3WUVA 2GM4A 2KIKA 2ZT9D 2LKMA 1URQB 3SWKA 1PZQA 1MUUA 5BVZA 3TGUD 2CK3H 2IPPA 1KILA 3RK2C 1Q86Q 2R5DA 3H1LE 2D2CC 1T8ZA 3V2QA 2FXOA 2FYUK 4NPFX 1JUNA 3RK3D 3KZIE 1KYOI 2JDIH 3TYYA 3CC7P 4HB1A 1H0TB 1CI6B 4BRYA 2WT7A 2QJPB 1M57D 1M90Q 5AVWB 1NKZB 4U7JA 1EDIA 3A0BE 3EFFK 5KAIE 2WSSH 2A45H
chains in the Genus database with same CATH topology
1FOSF 1KQLA 5KLVK 5KJ7A 1OWAA 2QM7A 3GHGC 1NKNA 1SQBK 5APYA 1IC2A 2WWWA 1URQD 5AVUB 1SQVK 5AVVB 1KILB 2WSCH 2XDJA 3E1IA 3U59A 1CW5A 1J1EB 1CSBA 2O1JA 2M8RA 5AVRB 4EOTA 3RK2B 4JYCA 1GD2E 3N4XA 5AW7B 2FKWB 1FZGA 5AVZB 5CCGA 1GK4A 2BASA 1NO4A 1S9KE 2FYZA 2KSJA 5AVTB 2JJLA 1T2KD 1LTJC 1NHLA 3IR9A 1HTLC 1RF0C 3MGNA 1JO5A 1GL2A 5CCHA 3IFMA 2WT7B 1L4AA 1LT9B 2WITA 1N73A 1RE3A 1FJPA 3MTUE 3V2NA 4B86A 1DH3A 3OAKA 3BRTB 3LIEA 3VMYA 4WY4B 2ZXEB 1FZAA 2HFED 1E5WA 4XA4A 2FFDB 3L37A 2HYNA 1NH4A 2N1TC 5APSA 3H6PA 1MFZA 3VP9A 1HGVA 4GIFA 1LTIC 5AW3B 3P8MC 4W80A 1RF1A 1KFMA 5AW6B 3GHGB 2R5BA 1HGZA 4N78E 5BU8B 1FZBA 1KILD 1ZV8A 3TK1A 4JYBA 3RL0B 1NTKK 2Z5HA 2C9NY 2L5GB 1YTZT 2C0XA 2PAJA 1KZUB 1FAVA 3SWYA 3U1CA 1A02F 3CLQA 1NU1K 3HRNA 4DOJA 1FZFA 4AYCA 3V4WA 1L4AB 2IFNA 4W7ZA 1N73B 1LWUA 2HLOA 3M9HA 4W7YA 2HPCB 2POHA 5AW4B 4WY4D 1JY3O 1AQ5A 3OA7A 4I1LA 2NPSA 2J59M 2HG5D 2YNYA 5KJ7D 3HTKA 4C7RA 1JY2O 3LW5H 4EIJA 2HODB 3M9BA 2GUSA 3KDPB 3OJAB 2PP6A 1H89A 4ZKUA 2Q7CA 3R2PA 4KHXA 1G1IA 3V5BA 5APQA 3RL0D 4Y99C 5AVQB 1QL1A 1W2EA 1FJKA 1HVVA 2W6BA 3KYQA 1IO4A 1JTHA 5APUA 4AUWA 4WBAA 1DX7A 1IFIA 4HYTB 5CCGD 3BASA 5APTA 4C7NA 2OYHC 2Q5UA 5AW5B 4LGDE 1IK9A 1CZQA 3P8CD 1GL2D 5CCHD 3B8EB 3GHGA 1L4AD 1LWUB 1FU1A 1MV8A 5APWA 3RK3C 3T97A 3LIDA 4XE5B 2CPBA 3HD7C 3VOPA 1M1JC 3H32A 2CPSA 1GK6A 3B5NC 2NPSB 5AW0B 1T3JA 4WB4A 1N7SC 1SFCC 3MUDA 3HTKB 1YTZI 3A5TA 2WSFH 1LTJA 1RF0A 4N3YB 1IFNA 1LTBC 3NTNA 4O9BA 2HPCA 1GZLA 1JTHB 1GL2C 3U1AA 1LTGC 1URQC 1DEBA 4C7NB 1SQQK 1N86A 2OYIC 3A7OA 3VP8A 2N1TA 1FOSE 1NTMK 1X8YA 2Z4EA 3HE4B 2QM8A 1LGHB 3M0DC 2KP8A 4GKGA 2HODA 4AQRD 1RY3A 2H8PD 3TNUA 1NOHA 3V2RA 1PFIA 2H7HA 3NMDA 1FDMA 1FBMA 3H32B 1HUCA 2FXMA 1T2KC 3HUSC 4I2LC 4ZKPA 3RK2D 3VN0A 5AVXB 1EQ7A 1JOCA 2N9BA 2NPSD 3II6A 2YKQA 4LLHA 3HE5A 1J1DC 1G2CB 1GDTA 1SFCB 1ZR2A 1LTJB 1SQPK 1FZCC 1XTCC 2A45G 2Z5IA 2KOGA 2WPRA 2I1KA 1Z56A 3VMXA 2YKOA 3L36A 1AFOA 1LTAC 1L0LK 5CJ4A 1NWQA 2C9LY 2GUVA 1XTGB 2N1TB 1JY3N 1KILC 1L0NK 2OYIB 1J1EC 2A45I 3KPEA 1OXZA 1N2DC 1ZR4A 2E43A 3TNUB 5BU5A 1VDFA 2H43A 3BVHA 1JY2N 4DZOA 1RE4C 3O8ZA 2I1JA 5AW2B 1X9VA 1YYCA 1T3UA 3CL3D 1JCDA 1JCCA 3UIAA 1WT6A 3M91A 3I5CA 3HE5B 3VTPC 1LT9C 3NFQA 1JMMA 2WPQA 4WY4C 4IFDK 2OYHA 1IJDB 3HE4A 4M3LA 1SP4A 1IFJA 5KTBA 1JY3P 2FFDC 3EFGA 5CMZA 3HD7A 5KJ7C 2W27A 5AVSB 1M1JA 1G1JA 2IX7C 5CHXA 3L4FA 3B5NA 1JY2P 1WRGA 2N1TD 2KLVA 5AVYB 3RL0C 1G2CA 1N7SA 1JNMA 1SFCA 2O01H 4GT1A 5CJ0A 1NAFA 3P8CE 3P32A 5CCGC 2W6AA 4LC1A 2M3BA 1VPCA 1LTSC 2YMYA 2P2UA 1M7LA 3VYIA 2YO2A 4Y99B 3A2AA 5CCHC 3BRVB 2WZ7A 1L4AC 4N78D 1A02J 3M0AA 4IFMA 3MD0A 5AW8B 1N73C 1IFMA 1RE3C 4JF7A 1URQA 3PP5A 1GTWA 3VMZA 2OYHB 2OYIA 1X79B 5APXA 2ZFCA 1IFDA 1HJBA 2IFMA 3CI9A 1FZEA 3M0DA 3RK3B 2Q3IA 3HD7B 5AW9B 2E42A 2P7JA 4C46A 1KFNA 2WSEH 1M1JB 2XU6A 4RESB 1RF1C 1HWTC 3SWFA 3HUSA 1HBWA 2O1KA 3B5NB 1GW3A 5APVA 1J2JB 2J58A 1CI6A 1ZN5A 1N7SB 2JEEA 3EQ2A 3M9QA 2MJZA 2KYVA 3MIWA 1FZCA 2R32A 4OH8B 1LTTC 2Q9IA 1MZ9A 3TSIA 2GM4A 1H8AA 1HH0A 2C0WA 2KB7P 2LKMA 3A3YB 1GL2B 1URQB 2XV5A 1LWUC 1N7LA 1ZLLA 4N6JA 1MUUA 2P1JA 5BVZA 2IPPA 1KILA 2XZRA 3RK2C 4HH2A 2R5DA 2YO3A 2XNXA 3V2QA 1T8ZA 1SLQA 2FYUK 4IFFA 1JUNA 2NPSC 3L35A 3KQGA 2WTYA 3NXSA 3RK3D 1GW4A 3HD7D 1RE4A 3C9IA 2P67A 3HUSB 5AW1B 1QL2A 3TYYA 2VRSA 1H88A 1NTZK 2R3CA 1RF1B 3V2PA 1CI6B 3B5ND 2OARA 3M06A 3WMM0 1GU5A 3V4QA 1SVFA 2WT7A 1GU4A 1N7SD 1LT9A 1J1DB 1SFCD 5AVWB 1NKZB 3BATA 2YKPA 3P7KA 1FZCB 4WY4A 2WPSA 1S9KD 3N7NA 1SQXK 3G3ZA 2XKMA 2A45H 2FFDA 4I6MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DOJ A;  4C7R A;  1G1J A;  4HH2 A;  3CI9 A;  4WB4 A;  2O1J A;  3MIW A;  2O1K A;  4LLH A;  2L5G B;  1G1I A;  4WBA A;  2WIT A; 
#chains in the Genus database with same CATH topology
 1FOS F;  5KLV K;  2I8D A;  3G4S P;  4KT0 J;  3CCE P;  1M8O B;  4H0L D;  1BGY E;  1NU1 D;  1J1E B;  1CSB A;  2O1J A;  4EOT A;  1PGO A;  3GF3 A;  4JYC A;  1SQQ G;  2WMM A;  2B9B A;  2FKW B;  5AVZ B;  3CWB E;  2V7Q H;  1S9K E;  1T2K D;  1K8A Q;  3IR9 A;  2E76 C;  2N9Y B;  5CCH A;  1YIJ P;  1JMB A;  3RBX A;  1LT9 B;  1NTZ D;  3MTU E;  3CXH I;  1DH3 A;  3LIE A;  1PGQ A;  2ZXE B;  1FZA A;  2HFE D;  4PD4 E;  1NH4 A;  2N1T C;  1LJ2 A;  2Y0E A;  1MFZ A;  3L73 E;  1NVO A;  1SQX D;  4IL6 E;  1RF1 A;  1KFM A;  1ZOY C;  2IDB A;  4N78 E;  5BU8 B;  3BCC E;  1KIL D;  3RL0 B;  1S72 P;  2C9N Y;  2L5G B;  4I7Z B;  3H1H E;  3AE5 C;  1FAV A;  3QH9 A;  1GMJ A;  1EDJ A;  1A02 F;  1NU1 K;  1JEK A;  1N73 B;  3BCC G;  4D6T D;  3M9H A;  1Q81 Q;  2HPC B;  5AW4 B;  1L0N J;  3H1H G;  1SQB E;  4JBZ A;  3H1J J;  2HG5 D;  2FXP A;  2W90 A;  2W6J H;  4NPE A;  2A06 E;  2HOD B;  3KDP B;  3OJA B;  2KLU A;  4ZKU A;  4U3F J;  1VQ5 P;  4L73 A;  3AEA C;  1FJK A;  1SQB G;  2BCC E;  4WBA A;  4HYT B;  1L2P A;  1ZME C;  1IK9 A;  5CCH D;  1AJY A;  1LWU B;  4PJ0 E;  2FBW C;  2CPB A;  1VQ8 P;  3H1I D;  4GOF A;  2CPS A;  2BCC G;  1UIX A;  1GK6 A;  3F89 A;  2NPS B;  1VQ7 P;  3MUD A;  3HTK B;  2AXT H;  1EXJ A;  2WSF H;  4Y28 J;  1RF0 A;  1IFN A;  1LTB C;  1RQU A;  2ITA A;  1EZV E;  3L74 E;  3L72 E;  1URQ C;  1DEB A;  2OYI C;  3A7O A;  3VP8 A;  2O01 N;  1HF9 A;  3WUU A;  1DD3 A;  1X8Y A;  2KZI A;  5KAF H;  1LGH B;  4TT3 H;  2ZVO B;  2KNC B;  1KB9 E;  3CX5 H;  4PV1 D;  3NMD A;  3OW2 O;  1EZV G;  4I2L C;  3L72 G;  4MN4 C;  3VN0 A;  5AVX B;  2G3A A;  1EQ7 A;  1JOC A;  4YPC A;  2QJP C;  1VQO P;  1G2C B;  3CCS P;  1ZR2 A;  4DJG A;  1L0L J;  2KOG A;  2I1K A;  3C1L A;  1RHZ B;  2YKO A;  3L36 A;  1Q7Y Q;  1R5S A;  2E74 B;  1Q82 Q;  4H0L B;  2FYU J;  3KHU A;  3AE2 C;  1J1E C;  2A45 I;  3KPE A;  1N2D C;  1VQN P;  1SQQ D;  3L75 E;  2IBZ G;  2KS1 B;  3TNU B;  1FE6 A;  3Q5S A;  3R4Y A;  2OGU A;  3CX5 E;  1JCC A;  3I5C A;  1LT9 C;  1R5L A;  3L71 J;  2OYH A;  1IJD B;  3L75 G;  1LP1 B;  4M3L A;  5M1B A;  1JM0 A;  1JY3 P;  3EFG A;  2KK7 A;  1ZW0 A;  1NTM E;  1M1J A;  5CHX A;  3CCL P;  4IL6 X;  5KLI B;  3RL0 C;  2O01 H;  4I7Z C;  3TGU J;  3S4R A;  4PD4 D;  1NAF A;  1OVV A;  5CCG C;  4LC1 A;  1VPC A;  3L73 D;  3VYI A;  5CBO A;  1SQP E;  4R4M A;  4ASV A;  4N78 D;  3BCC D;  2IYO A;  1N73 C;  4JF7 A;  4BRY B;  1GTW A;  1X79 B;  5APX A;  1IFD A;  3AEF C;  3H1H D;  1HJB A;  1USD A;  3HD7 B;  5AW9 B;  4JPZ B;  3JCU H;  2XU6 A;  2WSE H;  4RES B;  1SQP G;  1KYO E;  3B5N B;  5APV A;  1ZN5 A;  1N7S B;  3EQ2 A;  1VF5 B;  2SPZ A;  3W67 A;  1SQB D;  3M9Q A;  2MJZ A;  3WU2 E;  1FZC A;  1NU1 J;  1LTT C;  4H13 B;  1MZ9 A;  1KV4 A;  2B87 B;  2C0W A;  2KB7 P;  1BCC G;  1LWU C;  1N7L A;  3AEE C;  2XZR A;  2BCC D;  4HH2 A;  1KD1 Q;  1NTZ J;  2NPS C;  3KQG A;  2PRR A;  2WSC J;  2WTY A;  1GW4 A;  1RE4 A;  3C9I A;  3HUS B;  2HR3 A;  2V4H A;  1H88 A;  1RF1 B;  3M06 A;  2ZJS E;  1GU5 A;  3V4Q A;  2K1A A;  1SQX J;  1GU4 A;  3JCU E;  3BAT A;  3P7K A;  1YJW P;  3CXH E;  2H89 C;  1LT1 A;  1KQG B;  3N7N A;  3G3Z A;  2XKM A;  2QE7 H;  2FFD A;  4I6M C;  1BE3 J;  4EDF A;  1OWA A;  2QM7 A;  3GHG C;  1SQB K;  2LR2 A;  3E1I A;  1EZV D;  3CC2 P;  3L72 D;  2R44 A;  3MP7 B;  5KKZ B;  4D6T J;  1GD2 E;  2M0B A;  3A0H H;  3G9R A;  1FZG A;  3AE8 C;  3CX5 I;  3K5B A;  4ASW A;  3RGU A;  2QJK B;  2O3J A;  1NHL A;  1HTL C;  1JO5 A;  1KB9 D;  5B5E H;  1X22 A;  1DEE G;  3B4S A;  1L4A A;  3AEB C;  2WIT A;  2OTL P;  3V2N A;  4B86 A;  2J5U A;  3VMY A;  4WY4 B;  2ZXX A;  2E74 C;  3GF7 A;  1E5W A;  4OVN F;  3L37 A;  5APS A;  4K3A A;  1HGV A;  4GIF A;  1VQM P;  2IBZ D;  5B66 H;  2R5B A;  1FZB A;  3LW5 J;  1YTZ T;  3H1I J;  2K37 A;  1QX8 A;  1OFC X;  3PTZ A;  3CLQ A;  2YXQ B;  3L70 E;  3L75 D;  3HRN A;  1NJI Q;  1FZF A;  3V4W A;  3A0H E;  2IFN A;  1FC2 C;  1OVU A;  2HLO A;  2POH A;  5B5E E;  1E79 H;  1SQV E;  1YBK A;  4I1L A;  5KLI C;  1BDD A;  2YNY A;  3L70 G;  1U57 A;  1VQ9 P;  4C7R A;  1JY2 O;  1P84 H;  4EIJ A;  2GUS A;  2Q7C A;  3H1L G;  3AED C;  1G1I A;  3ZDM A;  2W6B A;  5B66 E;  4AUW A;  1JTH A;  1SQV G;  1YQ3 C;  1VQ6 P;  3G6E P;  1FDO A;  4C7N A;  3Q5R A;  5AW5 B;  5GTI H;  1OW7 A;  3PHL A;  1L4A D;  5APW A;  3T97 A;  3LID A;  3HD7 C;  2K9J B;  1SQP D;  3B5N C;  3VMA A;  4QMA A;  2BEQ D;  1N7S C;  1SFC C;  4EYY Q;  2Y0C A;  1YTZ I;  4OWF A;  1VF5 C;  4H13 C;  4N3Y B;  2K9Y A;  1BGY G;  4H44 D;  1SQQ J;  1RH5 B;  4O9B A;  1KYO D;  1GZL A;  3AEC C;  2QRX A;  5K5G B;  1BCC D;  3U1A A;  3CWB G;  1VQ4 P;  3CCR P;  2N1T A;  1NTM K;  3ITK A;  3M0D C;  3SFE C;  2KP8 A;  2IZ0 A;  4AQR D;  1RY3 A;  3CD6 P;  1EDK A;  3H32 B;  5GTI E;  2FXM A;  3HUS C;  3RK2 D;  2XND H;  2D2C D;  1R8E A;  1S5L X;  2N9B A;  3L73 G;  4GOE A;  3TDK A;  1LTJ B;  1SQP K;  2A45 G;  2L91 A;  2E75 B;  2Z5I A;  3VMX A;  1AFO A;  3AE6 C;  2GUV A;  1OXZ A;  3BCC J;  3CXH D;  5KKZ C;  5BU5 A;  1VDF A;  3H1H J;  2H43 A;  4OGQ B;  1JY2 N;  4L74 A;  2Q3E A;  2QJK C;  3V6I A;  3MZW B;  2I1J A;  5AW2 B;  1YYC A;  1T3U A;  1PIX A;  3UIA A;  1WT6 A;  3HE5 B;  2E5T A;  3NFQ A;  3CMA P;  1ZXG A;  2A06 G;  4WY4 C;  1NGM B;  4K35 A;  1SP4 A;  2E76 D;  1IFJ A;  1PL5 A;  5KTB A;  1EDL A;  4RKU J;  5KJ7 C;  3CME P;  2W27 A;  1IFP A;  1VQP P;  2IX7 C;  3D70 A;  3L4F A;  2N1T D;  5AVY B;  2PGD A;  1KQS O;  1OZH A;  5CBN A;  3P8C E;  3P32 A;  2BCC J;  2M3B A;  1LTS C;  2YMY A;  2P2U A;  1QEX A;  2ZT9 B;  3A2A A;  2B88 A;  1QVF O;  2WPV B;  1Y47 A;  1S3J A;  4IFM A;  1RE3 C;  1KMI Z;  1URQ A;  3VMZ A;  2OYI A;  1L0L E;  2QEX P;  1AV1 A;  3RK3 B;  1PGJ A;  3L74 G;  2E42 A;  3L70 D;  2P7J A;  2ZYD A;  2OQQ A;  5L8R J;  1HWT C;  2YXR B;  2O1K A;  1GW3 A;  1J2J B;  1UII A;  1H0T A;  1CI6 A;  1MKM A;  3H1L D;  2JEE A;  3JC2 2;  4BWN A;  4DT0 A;  1SQV D;  3L72 J;  4NPD A;  2E5Y A;  2AXT E;  5C39 A;  2M5A A;  1H8A A;  2Q1K A;  3A3Y B;  4TLF A;  2XV5 A;  3S9O A;  2P1J A;  3H1K E;  4HJG H;  1SLQ A;  4IFF A;  3L35 A;  1U7J A;  5KAF E;  2W8Z A;  4GDO A;  2P67 A;  2P10 A;  5AW1 B;  2VRS A;  1BGY D;  3V2P A;  1SVF A;  3H1K G;  1LT9 A;  5KLV J;  2YKP A;  2WPS A;  3CWB D;  3KXD A;  4YTP C;  1S9K D;  1U7M A;  3JSV C;  4R4L A;  1SS1 A;  5APY A;  1S2E A;  2WWW A;  1URQ D;  1SQV K;  5AVV B;  1KIL B;  2WSC H;  1CW5 A;  4UB8 H;  1PP9 E;  3RK2 B;  1AA0 A;  3ABV C;  5AW7 B;  1NTM G;  5CCG A;  4UB6 H;  2BAS A;  5AVT B;  2JJL A;  1LTJ C;  3MGN A;  1GL2 A;  2E75 C;  2JKV A;  2BEZ F;  2WT7 B;  1N73 A;  1FJP A;  1WMK A;  3OAK A;  3BRT B;  1KQF B;  1PP9 G;  1QGK B;  3E7K A;  4XA4 A;  2HYN A;  3SFD C;  1W2B O;  1X0T A;  2AEJ A;  3H6P A;  1LTI C;  1NAY A;  5AW3 B;  5AW6 B;  1HGZ A;  4OGQ C;  1S5L H;  3TK1 A;  4JYB A;  3AEG C;  1NTZ E;  1SQP J;  3PH0 A;  1HJ0 A;  2A06 D;  3U1C A;  4CPG A;  5H2F H;  4DOJ A;  2DW3 A;  4AYC A;  1YI2 P;  4UB6 E;  1SQX E;  1LWU A;  4W7Y A;  2NPS A;  2J59 M;  2JWD A;  1Q90 D;  1BCC J;  1BE3 E;  3HTK A;  3Q3D A;  2MKV A;  5TIS H;  3LW5 H;  3M9B A;  5TJH A;  2PP6 A;  3AE4 C;  4KHX A;  3V5B A;  3RL0 D;  2ZT9 C;  1QL1 A;  1W2E A;  2KUB A;  1HVV A;  3KYQ A;  1IO4 A;  5APU A;  5E79 H;  1DX7 A;  1Q2N A;  5CCG D;  1VL2 A;  1DIP A;  3B71 A;  3BAS A;  1BE3 G;  1YHQ P;  2IZ1 A;  4LGD E;  3P8C D;  1CZQ A;  1GL2 D;  2P58 A;  4ZMD A;  1BSN A;  3GHG A;  3RK3 C;  1FU1 A;  1KC8 Q;  1MV8 A;  3L74 D;  2KNC A;  4PV1 B;  3VOP A;  1ZP0 C;  5H2F E;  4WWI A;  2QIW A;  2JWA A;  1AVY A;  3CC4 P;  2ZVN B;  1NTK E;  1YJN P;  3A5T A;  1YIT P;  2FY8 A;  1PPJ E;  3EWK A;  4KJM A;  2KSE A;  5EFW B;  3H1I E;  4H0L C;  1LTG C;  2R3S A;  1N86 A;  1NTK G;  3D6Z A;  3KZI H;  4JQ0 D;  4YXD C;  2QM8 A;  1PPJ G;  1OW6 A;  4GKG A;  2KS1 A;  1NOH A;  3TNU A;  1PFI A;  4RO0 A;  2NZ2 A;  1NYH A;  3GG2 A;  1HUC A;  1T2K C;  4ZKP A;  3GLM A;  1IZN B;  1AQT A;  3A0B H;  2K88 A;  2NPS D;  3II6 A;  2YKQ A;  3H1K D;  3PLN A;  2IYP A;  1GDT A;  2UWJ E;  1XTC C;  1IK7 A;  3CX5 D;  3SSU A;  1L0L K;  5CJ4 A;  2OTJ P;  1Y8A A;  1KIL C;  4A7P A;  2OYI B;  1NTM D;  1M1K Q;  4DZO A;  1OVR A;  1TU3 F;  3CL3 D;  3L70 J;  1JCD A;  3M91 A;  3VTP C;  2WQY C;  2YIU B;  4PD4 H;  1PP9 D;  4IFD K;  3HE4 A;  1USE A;  3H1L J;  2LXB A;  1MFT A;  1SQQ E;  4IL6 H;  1KN7 A;  1KTM A;  1N8R Q;  1SQV J;  5CMZ A;  3HD7 A;  2M5A B;  1G1J A;  2E74 D;  3B5N A;  1JY2 P;  1WRG A;  1N7S A;  1JNM A;  1SFC A;  1EC5 A;  4GT1 A;  5CJ0 A;  2W6A A;  3CCQ P;  1M7L A;  2QA4 P;  2YO2 A;  1P84 E;  4Y99 B;  5CCH C;  2B87 A;  3BRV B;  3M0A A;  3PP5 A;  2OYH B;  1BGY J;  2ZFC A;  1K05 A;  3CI9 A;  3G71 P;  1FZE A;  3FWN A;  3M0D A;  3D71 A;  3Q5P A;  1L0N E;  3CWB J;  3GMA A;  4C46 A;  1OW8 A;  1M1J B;  1BSH A;  2QVA A;  1RF1 C;  3SWF A;  3HUS A;  3H1J E;  3CCJ P;  2AXC A;  3IF4 A;  3CCV P;  2Y0D A;  3PRJ A;  4L76 A;  3MIW A;  2R32 A;  4U3F E;  2Q9I A;  1L0N G;  1BE3 D;  4PJ0 H;  3L73 J;  1HH0 A;  2RH0 A;  3H1J G;  1GL2 B;  1ZRT E;  1ZLL A;  4N6J A;  4PV1 C;  4BXL A;  1KOR A;  2YO3 A;  2XNX A;  4U3F G;  3NXS A;  3HD7 D;  1JB0 J;  1QL2 A;  1T6A A;  1NTZ K;  2R3C A;  3B5N D;  2OAR A;  3WMM 0;  2V7Q J;  1YJ9 P;  1N7S D;  1J1D B;  1SFC D;  3FWL A;  1VF5 D;  1FZC B;  1AVO A;  4WY4 A;  5GTH H;  2W83 C;  3TF5 A;  1Y9B A;  1PV3 A;  1SQB J;  4H13 D;  1SQX K;  1NTK D;  3D6Y A;  4W7Z A;  1KB9 H;  3WUT A;  1KQL A;  3S1K A;  3FXE A;  5KJ7 A;  1PPJ D;  1NKN A;  1IC2 A;  5AVU B;  2XDJ A;  3E1R A;  3U59 A;  2M8R A;  5AVR B;  3H25 A;  4WVZ A;  2FYN B;  2LXC B;  3N4X A;  3O6Q A;  3MUD C;  1BDC A;  4DCK A;  1GK4 A;  4GOD A;  1NO4 A;  2FYZ A;  2KSJ A;  3AE7 C;  1RF0 C;  2K3R A;  3IFM A;  3IN6 A;  1RE3 A;  3MHV A;  2FFD B;  3VP9 A;  3W68 A;  2RKL A;  5GTH E;  3P8M C;  4W80 A;  2FYU E;  3GHG B;  3Q1M A;  3IAO A;  1ZV8 A;  2KXP B;  1L0L G;  1NTK K;  2Z5H A;  4RJT A;  3L74 J;  1P84 I;  2C0X A;  2PAJ A;  1KZU B;  3SWY A;  2H88 C;  2YIU C;  2GA1 A;  1FS0 E;  1OX3 A;  2FYU G;  4IOI H;  1L4A B;  2IBZ E;  3L71 E;  5KLV E;  2K9J A;  4WY4 D;  4PD4 I;  1JY3 O;  5DJU B;  3QWO C;  1AQ5 A;  3OA7 A;  3AE9 C;  5KJ7 D;  1K73 Q;  2AEF A;  4H44 B;  3L71 G;  1H89 A;  3R2P A;  5KLV G;  3TGU E;  5APQ A;  4Y99 C;  5AVQ B;  3USS A;  2WSF J;  1S4X A;  2QJY B;  1W5C E;  1IFI A;  1K04 A;  3AE3 C;  2KZJ A;  5APT A;  2OYH C;  3RK3 E;  2Q5U A;  1OMI A;  3H1K J;  3B8E B;  3I55 P;  2NRG A;  3L75 J;  1KYO H;  4XE5 B;  1P84 D;  3TGU G;  1M1J C;  3H32 A;  2D2C B;  5DJT B;  5AW0 B;  3WU2 H;  1T3J A;  4WB4 A;  3FGA D;  1LTJ A;  2OTK E;  4HKZ H;  1L0N D;  3NTN A;  1D7M A;  2HPC A;  1NTM J;  1JTH B;  1NU1 E;  3H1J D;  1GL2 C;  3AE1 C;  1K9M Q;  3CCU P;  4C7N B;  1SQQ K;  1FOS E;  1FDI A;  1LNQ A;  2Z4E A;  3HE4 B;  4U3F D;  4Z1M H;  3T97 B;  1VQK P;  1PP9 J;  2HOD A;  2H8P D;  2ZAE B;  3V2R A;  2H7H A;  1FDM A;  1FBM A;  1NU1 G;  2ZYA A;  1ZRT D;  2RMZ A;  3FX0 A;  4UB8 E;  3CCM P;  3CXH H;  4LLH A;  2RN0 A;  3HE5 A;  1BCC E;  1J1D C;  1SFC B;  1FZC C;  2QG4 A;  2ZYG A;  2E76 B;  2Y9Y A;  1EZV I;  2WPR A;  1Z56 A;  1EXI A;  1NTZ G;  1KIL E;  2M3E A;  1QLE D;  1LTA C;  1NWQ A;  2C9L Y;  1XTG B;  2N1T B;  1JY3 N;  1L0N K;  1ZR4 A;  2Q6Q A;  1KB9 I;  1RQV A;  2E43 A;  1SQX G;  2FYN C;  1DD4 A;  3BVH A;  1RE4 C;  3O8Z A;  4D6T E;  2O01 J;  1X9V A;  1PGP A;  2B89 A;  1S5L E;  3FXD A;  1JMM A;  2WPQ A;  2Y9Z A;  2IBZ I;  1VQL P;  2E75 D;  2QSI A;  3F5H A;  2FFD C;  2OYO A;  4D6T G;  5AVS B;  2JP3 A;  1QVG O;  3Q2Y A;  2KLV A;  1L0L D;  2WSE J;  3C8V A;  4EI2 A;  2JR8 A;  1G2C A;  2AEM A;  2JO1 A;  4L75 A;  4OGQ D;  5TIS E;  2FYU D;  2WZ7 A;  1L4A C;  1A02 J;  2YMK A;  3MD0 A;  5AW8 B;  1YQ4 C;  1IFM A;  2WVR A;  3PJS K;  4ZNC A;  5E79 E;  3CPW O;  2IFM A;  2G8Y A;  3I56 P;  2Q3I A;  3GW6 A;  1KFN A;  3H1I G;  1NTK J;  1HBW A;  3L71 D;  4H44 C;  5KAI H;  2J58 A;  1S1C X;  5KLV D;  1M56 D;  2KYV A;  2KI7 B;  1LP1 A;  4OH8 B;  2QJY C;  3RBZ A;  3O6Q B;  4XFJ A;  1OIP A;  4YXW H;  2PFX A;  3RL0 g;  3TSI A;  3WUV A;  2GM4 A;  2KIK A;  2ZT9 D;  2LKM A;  1URQ B;  3SWK A;  1PZQ A;  1MUU A;  5BVZ A;  3TGU D;  2CK3 H;  2IPP A;  1KIL A;  3RK2 C;  1Q86 Q;  2R5D A;  3H1L E;  2D2C C;  1T8Z A;  3V2Q A;  2FXO A;  2FYU K;  4NPF X;  1JUN A;  3RK3 D;  3KZI E;  1KYO I;  2JDI H;  3TYY A;  3CC7 P;  4HB1 A;  1H0T B;  1CI6 B;  4BRY A;  2WT7 A;  2QJP B;  1M57 D;  1M90 Q;  5AVW B;  1NKZ B;  4U7J A;  1EDI A;  3A0B E;  3EFF K;  5KAI E;  2WSS H;  2A45 H; 
#chains in the Genus database with same CATH homology
 1FOS F;  1KQL A;  5KLV K;  5KJ7 A;  1OWA A;  2QM7 A;  3GHG C;  1NKN A;  1SQB K;  5APY A;  1IC2 A;  2WWW A;  1URQ D;  5AVU B;  1SQV K;  5AVV B;  1KIL B;  2WSC H;  2XDJ A;  3E1I A;  3U59 A;  1CW5 A;  1J1E B;  1CSB A;  2O1J A;  2M8R A;  5AVR B;  4EOT A;  3RK2 B;  4JYC A;  1GD2 E;  3N4X A;  5AW7 B;  2FKW B;  1FZG A;  5AVZ B;  5CCG A;  1GK4 A;  2BAS A;  1NO4 A;  1S9K E;  2FYZ A;  2KSJ A;  5AVT B;  2JJL A;  1T2K D;  1LTJ C;  1NHL A;  3IR9 A;  1HTL C;  1RF0 C;  3MGN A;  1JO5 A;  1GL2 A;  5CCH A;  3IFM A;  2WT7 B;  1L4A A;  1LT9 B;  2WIT A;  1N73 A;  1RE3 A;  1FJP A;  3MTU E;  3V2N A;  4B86 A;  1DH3 A;  3OAK A;  3BRT B;  3LIE A;  3VMY A;  4WY4 B;  2ZXE B;  1FZA A;  2HFE D;  1E5W A;  4XA4 A;  2FFD B;  3L37 A;  2HYN A;  1NH4 A;  2N1T C;  5APS A;  3H6P A;  1MFZ A;  3VP9 A;  1HGV A;  4GIF A;  1LTI C;  5AW3 B;  3P8M C;  4W80 A;  1RF1 A;  1KFM A;  5AW6 B;  3GHG B;  2R5B A;  1HGZ A;  4N78 E;  5BU8 B;  1FZB A;  1KIL D;  1ZV8 A;  3TK1 A;  4JYB A;  3RL0 B;  1NTK K;  2Z5H A;  2C9N Y;  2L5G B;  1YTZ T;  2C0X A;  2PAJ A;  1KZU B;  1FAV A;  3SWY A;  3U1C A;  1A02 F;  3CLQ A;  1NU1 K;  3HRN A;  4DOJ A;  1FZF A;  4AYC A;  3V4W A;  1L4A B;  2IFN A;  4W7Z A;  1N73 B;  1LWU A;  2HLO A;  3M9H A;  4W7Y A;  2HPC B;  2POH A;  5AW4 B;  4WY4 D;  1JY3 O;  1AQ5 A;  3OA7 A;  4I1L A;  2NPS A;  2J59 M;  2HG5 D;  2YNY A;  5KJ7 D;  3HTK A;  4C7R A;  1JY2 O;  3LW5 H;  4EIJ A;  2HOD B;  3M9B A;  2GUS A;  3KDP B;  3OJA B;  2PP6 A;  1H89 A;  4ZKU A;  2Q7C A;  3R2P A;  4KHX A;  1G1I A;  3V5B A;  5APQ A;  3RL0 D;  4Y99 C;  5AVQ B;  1QL1 A;  1W2E A;  1FJK A;  1HVV A;  2W6B A;  3KYQ A;  1IO4 A;  1JTH A;  5APU A;  4AUW A;  4WBA A;  1DX7 A;  1IFI A;  4HYT B;  5CCG D;  3BAS A;  5APT A;  4C7N A;  2OYH C;  2Q5U A;  5AW5 B;  4LGD E;  1IK9 A;  1CZQ A;  3P8C D;  1GL2 D;  5CCH D;  3B8E B;  3GHG A;  1L4A D;  1LWU B;  1FU1 A;  1MV8 A;  5APW A;  3RK3 C;  3T97 A;  3LID A;  4XE5 B;  2CPB A;  3HD7 C;  3VOP A;  1M1J C;  3H32 A;  2CPS A;  1GK6 A;  3B5N C;  2NPS B;  5AW0 B;  1T3J A;  4WB4 A;  1N7S C;  1SFC C;  3MUD A;  3HTK B;  1YTZ I;  3A5T A;  2WSF H;  1LTJ A;  1RF0 A;  4N3Y B;  1IFN A;  1LTB C;  3NTN A;  4O9B A;  2HPC A;  1GZL A;  1JTH B;  1GL2 C;  3U1A A;  1LTG C;  1URQ C;  1DEB A;  4C7N B;  1SQQ K;  1N86 A;  2OYI C;  3A7O A;  3VP8 A;  2N1T A;  1FOS E;  1NTM K;  1X8Y A;  2Z4E A;  3HE4 B;  2QM8 A;  1LGH B;  3M0D C;  2KP8 A;  4GKG A;  2HOD A;  4AQR D;  1RY3 A;  2H8P D;  3TNU A;  1NOH A;  3V2R A;  1PFI A;  2H7H A;  3NMD A;  1FDM A;  1FBM A;  3H32 B;  1HUC A;  2FXM A;  1T2K C;  3HUS C;  4I2L C;  4ZKP A;  3RK2 D;  3VN0 A;  5AVX B;  1EQ7 A;  1JOC A;  2N9B A;  2NPS D;  3II6 A;  2YKQ A;  4LLH A;  3HE5 A;  1J1D C;  1G2C B;  1GDT A;  1SFC B;  1ZR2 A;  1LTJ B;  1SQP K;  1FZC C;  1XTC C;  2A45 G;  2Z5I A;  2KOG A;  2WPR A;  2I1K A;  1Z56 A;  3VMX A;  2YKO A;  3L36 A;  1AFO A;  1LTA C;  1L0L K;  5CJ4 A;  1NWQ A;  2C9L Y;  2GUV A;  1XTG B;  2N1T B;  1JY3 N;  1KIL C;  1L0N K;  2OYI B;  1J1E C;  2A45 I;  3KPE A;  1OXZ A;  1N2D C;  1ZR4 A;  2E43 A;  3TNU B;  5BU5 A;  1VDF A;  2H43 A;  3BVH A;  1JY2 N;  4DZO A;  1RE4 C;  3O8Z A;  2I1J A;  5AW2 B;  1X9V A;  1YYC A;  1T3U A;  3CL3 D;  1JCD A;  1JCC A;  3UIA A;  1WT6 A;  3M91 A;  3I5C A;  3HE5 B;  3VTP C;  1LT9 C;  3NFQ A;  1JMM A;  2WPQ A;  4WY4 C;  4IFD K;  2OYH A;  1IJD B;  3HE4 A;  4M3L A;  1SP4 A;  1IFJ A;  5KTB A;  1JY3 P;  2FFD C;  3EFG A;  5CMZ A;  3HD7 A;  5KJ7 C;  2W27 A;  5AVS B;  1M1J A;  1G1J A;  2IX7 C;  5CHX A;  3L4F A;  3B5N A;  1JY2 P;  1WRG A;  2N1T D;  2KLV A;  5AVY B;  3RL0 C;  1G2C A;  1N7S A;  1JNM A;  1SFC A;  2O01 H;  4GT1 A;  5CJ0 A;  1NAF A;  3P8C E;  3P32 A;  5CCG C;  2W6A A;  4LC1 A;  2M3B A;  1VPC A;  1LTS C;  2YMY A;  2P2U A;  1M7L A;  3VYI A;  2YO2 A;  4Y99 B;  3A2A A;  5CCH C;  3BRV B;  2WZ7 A;  1L4A C;  4N78 D;  1A02 J;  3M0A A;  4IFM A;  3MD0 A;  5AW8 B;  1N73 C;  1IFM A;  1RE3 C;  4JF7 A;  1URQ A;  3PP5 A;  1GTW A;  3VMZ A;  2OYH B;  2OYI A;  1X79 B;  5APX A;  2ZFC A;  1IFD A;  1HJB A;  2IFM A;  3CI9 A;  1FZE A;  3M0D A;  3RK3 B;  2Q3I A;  3HD7 B;  5AW9 B;  2E42 A;  2P7J A;  4C46 A;  1KFN A;  2WSE H;  1M1J B;  2XU6 A;  4RES B;  1RF1 C;  1HWT C;  3SWF A;  3HUS A;  1HBW A;  2O1K A;  3B5N B;  1GW3 A;  5APV A;  1J2J B;  2J58 A;  1CI6 A;  1ZN5 A;  1N7S B;  2JEE A;  3EQ2 A;  3M9Q A;  2MJZ A;  2KYV A;  3MIW A;  1FZC A;  2R32 A;  4OH8 B;  1LTT C;  2Q9I A;  1MZ9 A;  3TSI A;  2GM4 A;  1H8A A;  1HH0 A;  2C0W A;  2KB7 P;  2LKM A;  3A3Y B;  1GL2 B;  1URQ B;  2XV5 A;  1LWU C;  1N7L A;  1ZLL A;  4N6J A;  1MUU A;  2P1J A;  5BVZ A;  2IPP A;  1KIL A;  2XZR A;  3RK2 C;  4HH2 A;  2R5D A;  2YO3 A;  2XNX A;  3V2Q A;  1T8Z A;  1SLQ A;  2FYU K;  4IFF A;  1JUN A;  2NPS C;  3L35 A;  3KQG A;  2WTY A;  3NXS A;  3RK3 D;  1GW4 A;  3HD7 D;  1RE4 A;  3C9I A;  2P67 A;  3HUS B;  5AW1 B;  1QL2 A;  3TYY A;  2VRS A;  1H88 A;  1NTZ K;  2R3C A;  1RF1 B;  3V2P A;  1CI6 B;  3B5N D;  2OAR A;  3M06 A;  3WMM 0;  1GU5 A;  3V4Q A;  1SVF A;  2WT7 A;  1GU4 A;  1N7S D;  1LT9 A;  1J1D B;  1SFC D;  5AVW B;  1NKZ B;  3BAT A;  2YKP A;  3P7K A;  1FZC B;  4WY4 A;  2WPS A;  1S9K D;  3N7N A;  1SQX K;  3G3Z A;  2XKM A;  2A45 H;  2FFD A;  4I6M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...