2L5GB

Co-ordinates and 1h, 13c and 15n chemical shift assignments for the complex of gps2 53-90 and smrt 167-207
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
42
structure length
42
Chain Sequence
GLSKEELIQNMDRVDREITMVEQQISKLKKKQQQLEEEAAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulator
molecule keywords G protein pathway suppressor 2
publication title Structural basis for the assembly of the SMRT/NCoR core transcriptional repression machinery.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2010-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.430 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2l5gB00
1G1IA 1G1JA 2O1KA 2L5GB 4HH2A 2O1JA 4WB4A 4DOJA 3MIWA 4LLHA 2WITA 4C7RA 3CI9A 4WBAA
chains in the Genus database with same CATH superfamily
1XTGB 2Z4EA 1BCCJ 4DCKA 3EWKA 1SFCB 5APWA 1VDFA 5GTIH 3AE8C 2DW3A 1VQNP 4HYTB 3IR9A 2J59M 2KNCB 2BEZF 1LT9C 3A5TA 3D71A 3H1LJ 3L70G 3F89A 1FBMA 3RL0C 5CJ0A 4H0LC 3V4WA 1RQUA 5APVA 2WT7A 5KJ7C 1NAYA 4H13D 3CWBG 2IDBA 1DEBA 2HODB 1BGYG 3KXDA 1KC8Q 5KKZC 2YO2A 2W8ZA 2HYNA 1PP9G 2J58A 1DD4A 4JPZB 2B9BA 1OW6A 1N7LA 1NTZD 3AEBC 4OGQD 1LTBC 4UB6E 1N73B 2IPPA 4L76A 4O9BA 4ASWA 1PPJD 4W80A 3SFDC 1LTSC 2MJZA 3BRVB 1M1JC 3QH9A 4GDOA 1PPJE 1Z56A 2NPSC 1SFCD 4NPDA 1HTLC 1KTMA 4I7ZC 5H2FE 1NTMD 1OVVA 1PGJA 2M0BA 1RE4C 1Q7YQ 1YBKA 2KLVA 4I1LA 4PV1B 3E7KA 1NTME 1NKNA 2QJKB 2LXCB 3H1HD 5KLIC 1R8EA 3Q5RA 1FZAA 1RE4A 4OH8B 5CJ4A 2KUBA 4PJ0H 1BDDA 1GDTA 3CCUP 3VYIA 1M7LA 2FFDC 4GOFA 2RH0A 3H1HE 3KHUA 1EQ7A 2H7HA 3HE4B 3KZIH 2WSFJ 3N7NA 2JKVA 1QLED 2GUSA 3H1IJ 2RKLA 3ZDMA 3L73J 1JY2P 2JR8A 1URQA 5KAFH 1HJ0A 1QEXA 2R32A 3T97B 4EI2A 3TSIA 4U3FD 1LT9B 3SWKA 2R3CA 4Y28J 2FFDA 3RL0B 2Z5HA 4R4MA 1NH4A 1JTHA 4H0LB 3I5CA 4U3FE 1CI6B 2QJPC 4H44C 4WB4A 3AEDC 3PLNA 1P84D 1JEKA 2WVRA 3RGUA 3GHGC 1SQPG 3PTZA 2H89C 1HH0A 3PH0A 2A45I 5KKZB 1P84I 1QGKB 1AV1A 2YO3A 1P84E 3H1JD 4PV1D 1S9KD 1WMKA 1YJNP 5DJTB 1SQQK 2AEFA 3H1JE 2JP3A 3L71J 4M3LA 5M1BA 1JCCA 1CSBA 1H8AA 4RJTA 4D6TG 2B87B 3V2QA 1M1JB 1DEEG 5CMZA 2WSEH 4IL6E 1BCCD 3LW5H 2NPSB 1LJ2A 2WQYC 1ZLLA 1USDA 3VMYA 4I7ZB 3V2PA 2IZ0A 2Y0DA 2R44A 3JCUH 2KZIA 3VMXA 1FAVA 2A06D 5BU8B 2Y9ZA 1IFIA 2C9LY 1HGVA 3L75G 1KB9D 3H1LD 3PRJA 2Q9IA 4WVZA 2N1TA 3Q5PA 3RL0D 3CX5D 2N9BA 1QX8A 2YKOA 1M8OB 3WUTA 4H0LD 5KLIB 1SQQG 3AE6C 5KJ7D 3B4SA 1AA0A 3CX5I 3H1LE 1FZFA 3PP5A 3L74J 1E5WA 3CX5E 2FFDB 1NOHA 2NRGA 1BE3G 5DJUB 2AEMA 2OYOA 1JY3N 3BCCJ 4IOIH 1JTHB 5GTHE 1L0NG 4XE5B 4B86A 2WPQA 3G3ZA 1SQBG 2HPCA 3L72J 2UWJE 1VQ8P 3SFEC 5B66E 5KAIH 1NKZB 1FU1A 2OTJP 1LTJC 3BATA 1FS0E 1ZP0C 2E74C 3JSVC 1GL2C 1YJWP 1JY3P 2QJPB 4H44B 2NPSD 1M57D 3M0AA 3A0HH 3GHGB 2WMMA 2XV5A 4I6MC 1HJBA 4UB8H 3WUVA 1NU1J 2E75C 2CK3H 1Y47A 3WUUA 4EIJA 1N8RQ 1IZNB 3VP9A 3MZWB 1N2DC 5APUA 1YIJP 4QMAA 5CHXA 1LTAC 3D70A 1SFCA 1W5CE 1MZ9A 2QEXP 1YHQP 2QE7H 2C0XA 1SQXG 3G4SP 1KB9H 5GTIE 3H1ID 2KNCA 3L70J 1LNQA 2MKVA 3NXSA 3S1KA 2QRXA 2H8PD 1RF0C 1X9VA 2KIKA 1OIPA 4ZNCA 3BRTB 4N6JA 3CWBJ 3W67A 1KN7A 1NTZK 1BGYJ 2ZYAA 2XNXA 3VMZA 1S3JA 1S4XA 1PP9J 3NMDA 4H44D 1FZEA 3KDPB 4IFFA 4YTPC 4ASVA 2C0WA 3MUDC 3WMM0 2YXQB 2ZFCA 2I1KA 1N73A 3CCQP 1NTMK 3N4XA 2ITAA 1ZR2A 1OWAA 1L4AC 3G71P 2FXOA 1SVFA 3R2PA 4PV1C 1VQ9P 1L0LD 3L71D 1LTJB 5APTA 2KS1B 2E74B 4YXDC 2G8YA 1FDIA 1GL2B 4IL6X 2QM8A 1Y9BA 1L0LE 2LXBA 2PGDA 3CC2P 2FYUD 4KT0J 3TGUE 3AE9C 1VQLP 1RH5B 4Z1MH 2E75B 2KSJA 3AE4C 2FYUE 1NTMG 1LTTC 3CMAP 4TLFA 1LT1A 3II6A 2WSFH 4WBAA 3CMEP 4HH2A 5AW9B 1HF9A 1R5SA 3ABVC 4ZMDA 3M9BA 3C1LA 1ZRTD 3L74D 4PJ0E 2Y0CA 3HE4A 2E42A 2O3JA 2D2CC 2PFXA 3H1HG 4WY4C 3KZIE 3BCCD 2GA1A 1NAFA 3T97A 3AEFC 1AVYA 3L74E 1LT9A 2KYVA 1IFNA 5AW6B 5KAFE 3GW6A 1FZBA 2K3RA 1PGPA 3KPEA 3O8ZA 1KFNA 1RE3C 2I8DA 3OA7A 2B88A 2ZVNB 5KJ7A 1CI6A 5AVZB 1SQPJ 4NPEA 3WU2H 2E74D 1NVOA 1GL2D 1YQ4C 1NTZE 5C39A 4LC1A 1S72P 3IFMA 2Y0EA 2L5GB 3TK1A 2WTYA 2ZT9C 2VRSA 5KLVD 2E75D 3HUSC 1H88A 2O01H 1K9MQ 1NGMB 2A45G 4EOTA 3GMAA 2HFED 1IO4A 2R5DA 3BVHA 1KD1Q 1LTIC 4D6TJ 2E5YA 1L4AB 3D6ZA 1OVRA 5KLVE 1S5LH 4K35A 4N3YB 5AW5B 5AVQB 2W83C 1CZQA 2B87A 2FXPA 1M1JA 4DT0A 2XKMA 3HUSA 3EFGA 2NPSA 2POHA 1HWTC 3CXHH 2M3EA 2BASA 2IZ1A 5AVUB 3B5NB 4HKZH 5CBOA 1H0TA 3GF7A 1LWUC 3L70D 1VL2A 3A0BH 1OFCX 2JWAA 3JCUE 5AW7B 1Q90D 1G2CA 1SQVJ 3CWBD 3L70E 3CCVP 3CD6P 2P10A 1KQGB 1BGYD 1LWUA 1DX7A 3L36A 1BE3J 1PP9D 4GIFA 3TF5A 1X0TA 1OW8A 1L0NJ 1Q2NA 3L4FA 2D2CB 1BGYE 1SQBJ 5AW2B 3V5BA 1DD3A 4WY4B 1JO5A 1PP9E 4L73A 3AEEC 3H1KD 1HVVA 3HE5B 2OYIC 3FWNA 2K1AA 3C9IA 5AVXB 1MUUA 1L4AD 2K37A 1Q82Q 5KAIE 1OX3A 1EZVG 2IX7C 2I1JA 3H1KE 1NTKD 3AE7C 5AW8B 1YITP 2FKWB 3IN6A 1QL2A 1J1EC 2P2UA 3GHGA 3TYYA 2O01J 1L2PA 1NTKE 3B5ND 2Q5UA 1S9KE 3A0HE 3K5BA 5APSA 2ZT9B 1EXIA 4UB8E 3F5HA 5APYA 3HUSB 2V7QH 3E1IA 1H89A 5L8RJ 3IF4A 3KQGA 1J2JB 5E79H 1MFTA 2KK7A 3P8MC 1IFDA 1H0TB 1HUCA 3EQ2A 1BCCE 1SQXJ 1FE6A 3LIEA 1EDJA 2LKMA 1KQSO 1QL1A 1G2CB 1GZLA 2ZYDA 1KB9I 2IBZG 2A06E 2D2CD 4BRYB 3FX0A 4GODA 2OQQA 4RESB 4WWIA 1WRGA 4KHXA 2XNDH 1N86A 4WY4D 1KB9E 3NTNA 1LWUB 4W7YA 1ZMEC 4HB1A 4PD4D 2JDIH 1PV3A 3AE3C 4JYBA 2OGUA 1RY3A 2QG4A 4U7JA 1M56D 3LIDA 1SQPD 4XFJA 1IJDB 4JF7A 3G6EP 1T8ZA 1L0LK 1EXJA 3CLQA 5BU5A 1JMBA 1SQPE 4EDFA 1EDKA 2P7JA 1NO4A 2ZT9D 4L74A 1U7MA 4C46A 2K88A 4DOJA 4IFMA 2H43A 2FYUK 3VOPA 1YQ3C 2OYIB 3M9HA 4D6TD 5AW0B 3PJSK 1DH3A 3AECC 2WZ7A 1LTJA 1VQKP 3Q2YA 1J1DC 2KS1A 1IFMA 1GL2A 1PZQA 2BCCG 2P58A 2PP6A 1J1EB 1PGOA 5CCHC 5B5EH 1KQLA 5EFWB 5TISH 2V7QJ 1FDMA 1L0LG 2JO1A 2JJLA 3TGUG 1RHZB 3RK3C 1KFMA 1AQ5A 3U1CA 1QVGO 2QA4P 2H88C 5K5GB 4GKGA 2W27A 1SQVD 2FYUG 2QJYC 3TNUB 3NFQA 3SSUA 4CPGA 3L73D 5APXA 1SLQA 4LLHA 2IYPA 1VQMP 3H1HJ 1BE3D 1SQVE 3H1IE 1RF1C 2Q1KA 3PHLA 5CCGC 1L0ND 3L73E 2PAJA 4PD4H 3I56P 1FJKA 1SQBD 3L35A 2YXRB 3MTUE 4W7ZA 1A02J 2AXCA 1BDCA 1YTZT 1BE3E 3VMAA 1RF0A 1M90Q 1N7SC 4AQRD 2ZJSE 2AXTH 1NYHA 2M5AB 5KLVK 3MHVA 1DIPA 1E79H 1VF5C 1S2EA 2J5UA 3WU2E 3VN0A 3V2RA 5AW4B 2ZAEB 4JYCA 4IFDK 2E5TA 4HJGH 2O1JA 1NTZG 4TT3H 1AQTA 2OYHC 3MUDA 1GW3A 3U1AA 2K9JB 1FOSF 2KOGA 2QVAA 3AEGC 1ZOYC 1XTCC 1PPJG 4RKUJ 4AYCA 4N78D 3B5NC 3L71E 3FWLA 3B8EB 1L4AA 4GT1A 5KLVG 1S5LE 2OYHA 3V2NA 3CXHD 1J1DB 1SQXD 3KYQA 5AW3B 3HD7C 3M9QA 4ZKPA 3CXHI 2E43A 3B5NA 3AE2C 2FY8A 1AFOA 2FYZA 3CXHE 3CCSP 1SQXE 1YJ9P 2R5BA 3RK3B 2WSSH 1JMMA 2IFNA 2XU6A 2YMYA 1OXZA 3A0BE 2YIUC 2W6JH 3HD7A 1NWQA 3RK2C 3W68A 2Y9YA 1LP1B 3VTPC 1U57A 1BSNA 2QJYB 1ZRTE 3H32B 1K73Q 3CI9A 1G1JA 3L72D 1KILC 2HR3A 2QSIA 4XA4A 2Q7CA 4DZOA 2AEJA 2W90A 3BCCE 2W6AA 1RF1B 1PFIA 4NPFX 1NTKK 1GU4A 2FXMA 4WY4A 3L72E 2ZXXA 5AVYB 4U3FG 1KILA 3HE5A 2V4HA 3HTKB 1N7SB 2KZJA 2O01N 1RE3A 2IFMA 1NU1D 1KORA 2R3SA 3CPWO 2PRRA 1U7JA 1LTGC 3D6YA 3H1KG 3QWOC 3V4QA 1KYOH 1HGZA 1K05A 1VF5B 2Q3EA 4GOEA 3RBZA 3AE5C 2WPSA 1NU1E 2KLUA 5AVWB 5CCHD 1JY2O 3H1JG 1NTKG 1WT6A 3UIAA 2OYHB 4I2LC 3AE1C 3RK3D 1R5LA 2RMZA 3O6QA 1X8YA 2WITA 1AJYA 4RO0A 3MD0A 1PGQA 1TU3F 3L75J 3SWYA 1OW7A 1T2KC 3RK3E 5E79E 1OZHA 1JY2N 1BCCG 1JM0A 3CCRP 1SQQJ 1KZUB 1URQC 3H6PA 4BRYA 3HD7B 5CCGD 1KV4A 1SQPK 2A06G 2JWDA 1GW4A 3H1LG 2Q6QA 3MIWA 3CWBE 1NJIQ 1IK7A 1FC2C 3RL0g 2WT7B 3H25A 1N7SD 4BXLA 5AVVB 2E76C 1A02F 4A7PA 2YIUB 4YPCA 3TDKA 2YNYA 3RK2B 3Q1MA 3V6IA 3M0DC 1W2BO 1JB0J 2YKQA 1VQ5P 3A3YB 3C8VA 3OAKA 2GUVA 3MP7B 1VF5D 1KILB 4UB6H 3CCLP 3CL3D 4L75A 1YTZI 2C9NY 2XZRA 2KP8A 2OTLP 1VQPP 3FXDA 2QM7A 2KXPB 3M0DA 3OW2O 1IC2A 1UIXA 1VQ6P 1JCDA 2SPZA 4R4LA 1JOCA 1M1KQ 1CW5A 4BWNA 4Y99C 2OYIA 2QIWA 1JNMA 1PL5A 4KJMA 5H2FH 1HBWA 2JEEA 4AUWA 2BCCJ 5AVSB 2ZVOB 2FBWC 1S5LX 4OVNF 3O6QB 1SQVK 1AVOA 1L0LJ 3A7OA 1G1IA 3HD7D 2OARA 3TGUJ 3A2AA 2CPSA 1GTWA 1YI2P 3IAOA 2N1TC 5B5EE 5TISE 1D7MA 3MGNA 2N9YB 2FYUJ 1L0NK 2Z5IA 1EDIA 1SQBK 1USEA 3TNUA 1VQOP 3CC4P 1FZCC 4MN4C 4JQ0D 3RK2D 1EC5A 3CCMP 1VQ7P 2NZ2A 3CCJP 1KMIZ 3M91A 1YYCA 5APQA 1JY3O 1KILD 4JBZA 2RN0A 4LGDE 2WSCH 3G9RA 4OWFA 3U59A 1SQVG 3ITKA 1URQB 4PD4I 3H1IG 1GK4A 2ZYGA 2B89A 3S9OA 3Q3DA 3L73G 1FZCA 5KTBA 3M06A 4PD4E 3CC7P 1KILE 4YXWH 2WPRA 4H13C 1T3UA 4ZKUA 1EZVD 5TJHA 2M5AA 2OTKE 1PIXA 2E76B 1VQ4P 2FYNC 4DJGA 1EZVI 2AXTE 3RBXA 2A45H 2XDJA 1P84H 3JC22 1EZVE 5AW1B 1T3JA 4OGQC 1NTZJ 1ZN5A 1GU5A 3USSA 1MKMA 2W6BA 2HG5D 4C7RA 1SQXK 2K9JA 3FGAD 2Q3IA 1UIIA 2K9YA 3P32A 1QVFO 4D6TE 3CCEP 1GMJA 1SS1A 4IL6H 5KLVJ 4Y99B 1SFCC 3P8CD 4C7NA 3L71G 3L75D 2KB7P 1MV8A 2YKPA 3P7KA 1Q86Q 1GK6A 1NTMJ 3L37A 1T2KD 1ZR4A 1FJPA 1OVUA 2IYOA 2IBZD 2GM4A 3B71A 1KQFB 3P8CE 1SQQD 2WSEJ 3LW5J 3S4RA 3AEAC 3L75E 1URQD 2IBZI 5CCHA 1T6AA 2P1JA 4EYYQ 1FZGA 2WWWA 1S1CX 5BVZA 3GLMA 2IBZE 2N1TB 3HRNA 1SQQE 1VPCA 1ZW0A 1SP4A 3GF3A 5AVTB 3VP8A 4K3AA 3CX5H 1K04A 1LP1A 2E76D 2LR2A 2YMKA 3H32A 1FZCB 1EDLA 1GD2E 2WSCJ 3R4YA 5AVRB 5GTHH 1L0NE 3L74G 2M8RA 1SQBE 1K8AQ 3FXEA 1IFPA 1RF1A 1N73C 5CCGA 1RQVA 1NU1K 4U3FJ 5B66H 1ZV8A 2L91A 3BCCG 2HPCB 2HODA 1X79B 2ZXEB 1IFJA 2M3BA 3L72G 1X22A 1Q81Q 1W2EA 2P67A 3OJAB 3HTKA 1N7SA 4H13B 2CPBA 1MFZA 3H1KJ 1NHLA 1KYOD 1IK9A 2FYNB 3Q5SA 2BCCD 1Y8AA 1KYOI 2G3AA 1FOSE 2WPVB 3GG2A 3EFFK 3I55P 3SWFA 2KI7B 3H1JJ 4OGQB 1NTKJ 1KYOE 3BASA 5CBNA 3E1RA 3TGUD 2O1KA 2QJKC 1OMIA 4C7NB 2HLOA 2BCCE 1NU1G 1LGHB 1ZXGA 2KSEA 1FDOA 1JUNA 4N78E 1BSHA 2N1TD 2BEQD
chains in the Genus database with same CATH topology
5CHXA 3MD0A 3P8MC 1XTGB 1IFDA 1LTAC 2Z4EA 1HUCA 3EQ2A 3SWYA 1T2KC 1SFCB 1SFCA 5APWA 1MZ9A 1VDFA 1JY2N 3LIEA 2LKMA 1QL1A 2C0XA 4HYTB 3IR9A 2J59M 1G2CB 1GZLA 1KZUB 1URQC 3H6PA 3HD7B 4RESB 1WRGA 5CCGD 4KHXA 3NXSA 1LT9C 3A5TA 1N86A 1SQPK 4WY4D 2H8PD 1RF0C 1X9VA 3NTNA 1LWUB 1GW4A 1FBMA 3RL0C 4W7YA 3BRTB 3MIWA 4N6JA 5CJ0A 3V4WA 5APVA 4JYBA 2WT7A 2WT7B 1NTZK 5KJ7C 1N7SD 5AVVB 1A02F 1RY3A 2XNXA 2YNYA 3VMZA 3LIDA 3RK2B 1DEBA 3M0DC 2HODB 3NMDA 2YKQA 1FZEA 3KDPB 3A3YB 2YO2A 3OAKA 1IJDB 4JF7A 2GUVA 2HYNA 4IFFA 1KILB 2J58A 1T8ZA 3CL3D 1YTZI 2C9NY 1N7LA 2KP8A 2XZRA 1L0LK 2C0WA 3CLQA 5BU5A 1LTBC 3WMM0 2ZFCA 2I1KA 2P7JA 1NO4A 1N73B 1N73A 2QM7A 2IPPA 3M0DA 1IC2A 1NTMK 4O9BA 3N4XA 4C46A 1JCDA 4W80A 4DOJA 4IFMA 1ZR2A 1OWAA 2H43A 1L4AC 2FYUK 3VOPA 1SVFA 1JOCA 1CW5A 1LTSC 4Y99C 2OYIB 2OYIA 3M9HA 1JNMA 2MJZA 3BRVB 3R2PA 5AW0B 1DH3A 1M1JC 1HBWA 2WZ7A 1LTJB 1LTJA 2JEEA 5APTA 1Z56A 2NPSC 1J1DC 4AUWA 1SFCD 5AVSB 1HTLC 1IFMA 1GL2B 1GL2A 2QM8A 1SQVK 2PP6A 1J1EB 1RE4C 5CCHC 3A7OA 1G1IA 1KQLA 3HD7D 2OARA 3A2AA 2CPSA 1GTWA 2KLVA 1FDMA 4I1LA 2KSJA 2JJLA 3RK3C 1NKNA 1KFMA 2N1TC 1AQ5A 3MGNA 3U1CA 1L0NK 1LTTC 2Z5IA 4GKGA 2W27A 1SQBK 1FZAA 1RE4A 4OH8B 3TNUB 3TNUA 5CJ4A 3II6A 2WSFH 1FZCC 3NFQA 4WBAA 1GDTA 3RK2D 4HH2A 3VYIA 5APXA 5AW9B 1M7LA 1SLQA 4LLHA 2FFDC 3M9BA 1EQ7A 3M91A 2H7HA 1YYCA 3HE4B 3HE4A 5APQA 2E42A 3N7NA 1JY3O 1KILD 2GUSA 1RF1C 4LGDE 5CCGC 2WSCH 2PAJA 3U59A 4WY4C 1JY2P 1URQB 1FJKA 1URQA 1GK4A 2R32A 1NAFA 3T97A 3L35A 3MTUE 4W7ZA 1A02J 3TSIA 1FZCA 1LT9B 5KTBA 1LT9A 1YTZT 3M06A 2KYVA 1IFNA 5AW6B 1RF0A 2R3CA 2FFDA 3RL0B 2WPRA 1N7SC 1FZBA 2Z5HA 4AQRD 3KPEA 3O8ZA 1T3UA 1RE3C 1NH4A 1KFNA 1JTHA 4ZKUA 3OA7A 3I5CA 5KJ7A 5KLVK 1CI6B 1CI6A 5AVZB 4WB4A 3GHGC 1GL2D 1HH0A 2A45H 2XDJA 1J2JB 2A45I 5AW1B 3VN0A 1T3JA 4LC1A 1ZN5A 3V2RA 5AW4B 2YO3A 4JYCA 4IFDK 3IFMA 2L5GB 3TK1A 2WTYA 2O1JA 1GU5A 2VRSA 1S9KD 2W6BA 2HG5D 3HUSC 1H88A 2OYHC 3MUDA 2O01H 1GW3A 3U1AA 4C7RA 2A45G 1SQXK 4EOTA 1FOSF 2KOGA 2Q3IA 2HFED 1IO4A 1XTCC 2R5DA 3BVHA 3P32A 1SQQK 1LTIC 4AYCA 4N78D 3B5NC 1L4AB 3B8EB 1L4AA 4M3LA 1JCCA 1CSBA 1H8AA 4N3YB 5AW5B 5AVQB 4Y99B 1SFCC 1CZQA 3P8CD 4C7NA 3V2QA 1M1JB 1M1JA 2KB7P 4GT1A 2XKMA 1MV8A 2YKPA 5CMZA 3P7KA 1GK6A 2WSEH 3HUSA 3L37A 3LW5H 1T2KD 2NPSB 3EFGA 2NPSA 2OYHA 3V2NA 1J1DB 1ZR4A 3KYQA 2POHA 1HWTC 1FJPA 5AW3B 1ZLLA 3VMYA 2GM4A 3V2PA 3HD7C 3M9QA 2BASA 4ZKPA 5AVUB 3P8CE 2E43A 3B5NB 3VMXA 3B5NA 1URQD 1FAVA 5CCHA 5BU8B 1LWUC 1IFIA 2P1JA 2FYZA 1FZGA 2C9LY 2WWWA 1AFOA 1HGVA 5BVZA 2Q9IA 5AW7B 2R5BA 3RK3B 2N1TB 3HRNA 2N1TA 3RL0D 1VPCA 2YMYA 1JMMA 2IFNA 2XU6A 1G2CA 1OXZA 2N9BA 2YKOA 1SP4A 5AVTB 3VP8A 3HD7A 1NWQA 3RK2C 5KJ7D 3VTPC 1FZFA 3PP5A 3H32B 1LWUA 3H32A 1FZCB 3CI9A 1DX7A 1E5WA 3L36A 1G1JA 1GD2E 1KILC 5AVRB 4GIFA 4XA4A 2FFDB 2Q7CA 4DZOA 1NOHA 2M8RA 3L4FA 2W6AA 1JY3N 5AW2B 1JTHB 1RF1B 1PFIA 1RF1A 4XE5B 1N73C 4B86A 1NTKK 5CCGA 1NU1K 2WPQA 3V5BA 1GU4A 4WY4B 2FXMA 3G3ZA 4WY4A 1JO5A 1ZV8A 2HPCB 2HPCA 2HODA 1X79B 5AVYB 2ZXEB 1IFJA 2M3BA 1KILA 1W2EA 1HVVA 3HE5B 3HE5A 2P67A 2OYIC 3OJAB 5AVXB 3C9IA 3HTKB 3HTKA 1N7SB 1N7SA 1NKZB 1FU1A 1MUUA 1L4AD 1LTJC 2CPBA 3BATA 1RE3A 2IX7C 2I1JA 2IFMA 1MFZA 1NHLA 5AW8B 1GL2C 1JY3P 1IK9A 2FKWB 1LTGC 2NPSD 3V4QA 1HGZA 1QL2A 1J1EC 2P2UA 3M0AA 3GHGB 3GHGA 1FOSE 2XV5A 4I6MC 1HJBA 3TYYA 2WPSA 3SWFA 3BASA 3B5ND 2Q5UA 1S9KE 5AVWB 5CCHD 5APSA 2O1KA 4C7NB 2HLOA 1JY2O 1LGHB 1WT6A 5APYA 4EIJA 3UIAA 3HUSB 3VP9A 2OYHB 3E1IA 4I2LC 1JUNA 1H89A 4N78E 3RK3D 2N1TD 1N2DC 5APUA 1X8YA 3KQGA 2WITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G1I A;  1G1J A;  2O1K A;  2L5G B;  4HH2 A;  2O1J A;  4WB4 A;  4DOJ A;  3MIW A;  4LLH A;  2WIT A;  4C7R A;  3CI9 A;  4WBA A; 
#chains in the Genus database with same CATH topology
 1XTG B;  2Z4E A;  1BCC J;  4DCK A;  3EWK A;  1SFC B;  5APW A;  1VDF A;  5GTI H;  3AE8 C;  2DW3 A;  1VQN P;  4HYT B;  3IR9 A;  2J59 M;  2KNC B;  2BEZ F;  1LT9 C;  3A5T A;  3D71 A;  3H1L J;  3L70 G;  3F89 A;  1FBM A;  3RL0 C;  5CJ0 A;  4H0L C;  3V4W A;  1RQU A;  5APV A;  2WT7 A;  5KJ7 C;  1NAY A;  4H13 D;  3CWB G;  2IDB A;  1DEB A;  2HOD B;  1BGY G;  3KXD A;  1KC8 Q;  5KKZ C;  2YO2 A;  2W8Z A;  2HYN A;  1PP9 G;  2J58 A;  1DD4 A;  4JPZ B;  2B9B A;  1OW6 A;  1N7L A;  1NTZ D;  3AEB C;  4OGQ D;  1LTB C;  4UB6 E;  1N73 B;  2IPP A;  4L76 A;  4O9B A;  4ASW A;  1PPJ D;  4W80 A;  3SFD C;  1LTS C;  2MJZ A;  3BRV B;  1M1J C;  3QH9 A;  4GDO A;  1PPJ E;  1Z56 A;  2NPS C;  1SFC D;  4NPD A;  1HTL C;  1KTM A;  4I7Z C;  5H2F E;  1NTM D;  1OVV A;  1PGJ A;  2M0B A;  1RE4 C;  1Q7Y Q;  1YBK A;  2KLV A;  4I1L A;  4PV1 B;  3E7K A;  1NTM E;  1NKN A;  2QJK B;  2LXC B;  3H1H D;  5KLI C;  1R8E A;  3Q5R A;  1FZA A;  1RE4 A;  4OH8 B;  5CJ4 A;  2KUB A;  4PJ0 H;  1BDD A;  1GDT A;  3CCU P;  3VYI A;  1M7L A;  2FFD C;  4GOF A;  2RH0 A;  3H1H E;  3KHU A;  1EQ7 A;  2H7H A;  3HE4 B;  3KZI H;  2WSF J;  3N7N A;  2JKV A;  1QLE D;  2GUS A;  3H1I J;  2RKL A;  3ZDM A;  3L73 J;  1JY2 P;  2JR8 A;  1URQ A;  5KAF H;  1HJ0 A;  1QEX A;  2R32 A;  3T97 B;  4EI2 A;  3TSI A;  4U3F D;  1LT9 B;  3SWK A;  2R3C A;  4Y28 J;  2FFD A;  3RL0 B;  2Z5H A;  4R4M A;  1NH4 A;  1JTH A;  4H0L B;  3I5C A;  4U3F E;  1CI6 B;  2QJP C;  4H44 C;  4WB4 A;  3AED C;  3PLN A;  1P84 D;  1JEK A;  2WVR A;  3RGU A;  3GHG C;  1SQP G;  3PTZ A;  2H89 C;  1HH0 A;  3PH0 A;  2A45 I;  5KKZ B;  1P84 I;  1QGK B;  1AV1 A;  2YO3 A;  1P84 E;  3H1J D;  4PV1 D;  1S9K D;  1WMK A;  1YJN P;  5DJT B;  1SQQ K;  2AEF A;  3H1J E;  2JP3 A;  3L71 J;  4M3L A;  5M1B A;  1JCC A;  1CSB A;  1H8A A;  4RJT A;  4D6T G;  2B87 B;  3V2Q A;  1M1J B;  1DEE G;  5CMZ A;  2WSE H;  4IL6 E;  1BCC D;  3LW5 H;  2NPS B;  1LJ2 A;  2WQY C;  1ZLL A;  1USD A;  3VMY A;  4I7Z B;  3V2P A;  2IZ0 A;  2Y0D A;  2R44 A;  3JCU H;  2KZI A;  3VMX A;  1FAV A;  2A06 D;  5BU8 B;  2Y9Z A;  1IFI A;  2C9L Y;  1HGV A;  3L75 G;  1KB9 D;  3H1L D;  3PRJ A;  2Q9I A;  4WVZ A;  2N1T A;  3Q5P A;  3RL0 D;  3CX5 D;  2N9B A;  1QX8 A;  2YKO A;  1M8O B;  3WUT A;  4H0L D;  5KLI B;  1SQQ G;  3AE6 C;  5KJ7 D;  3B4S A;  1AA0 A;  3CX5 I;  3H1L E;  1FZF A;  3PP5 A;  3L74 J;  1E5W A;  3CX5 E;  2FFD B;  1NOH A;  2NRG A;  1BE3 G;  5DJU B;  2AEM A;  2OYO A;  1JY3 N;  3BCC J;  4IOI H;  1JTH B;  5GTH E;  1L0N G;  4XE5 B;  4B86 A;  2WPQ A;  3G3Z A;  1SQB G;  2HPC A;  3L72 J;  2UWJ E;  1VQ8 P;  3SFE C;  5B66 E;  5KAI H;  1NKZ B;  1FU1 A;  2OTJ P;  1LTJ C;  3BAT A;  1FS0 E;  1ZP0 C;  2E74 C;  3JSV C;  1GL2 C;  1YJW P;  1JY3 P;  2QJP B;  4H44 B;  2NPS D;  1M57 D;  3M0A A;  3A0H H;  3GHG B;  2WMM A;  2XV5 A;  4I6M C;  1HJB A;  4UB8 H;  3WUV A;  1NU1 J;  2E75 C;  2CK3 H;  1Y47 A;  3WUU A;  4EIJ A;  1N8R Q;  1IZN B;  3VP9 A;  3MZW B;  1N2D C;  5APU A;  1YIJ P;  4QMA A;  5CHX A;  1LTA C;  3D70 A;  1SFC A;  1W5C E;  1MZ9 A;  2QEX P;  1YHQ P;  2QE7 H;  2C0X A;  1SQX G;  3G4S P;  1KB9 H;  5GTI E;  3H1I D;  2KNC A;  3L70 J;  1LNQ A;  2MKV A;  3NXS A;  3S1K A;  2QRX A;  2H8P D;  1RF0 C;  1X9V A;  2KIK A;  1OIP A;  4ZNC A;  3BRT B;  4N6J A;  3CWB J;  3W67 A;  1KN7 A;  1NTZ K;  1BGY J;  2ZYA A;  2XNX A;  3VMZ A;  1S3J A;  1S4X A;  1PP9 J;  3NMD A;  4H44 D;  1FZE A;  3KDP B;  4IFF A;  4YTP C;  4ASV A;  2C0W A;  3MUD C;  3WMM 0;  2YXQ B;  2ZFC A;  2I1K A;  1N73 A;  3CCQ P;  1NTM K;  3N4X A;  2ITA A;  1ZR2 A;  1OWA A;  1L4A C;  3G71 P;  2FXO A;  1SVF A;  3R2P A;  4PV1 C;  1VQ9 P;  1L0L D;  3L71 D;  1LTJ B;  5APT A;  2KS1 B;  2E74 B;  4YXD C;  2G8Y A;  1FDI A;  1GL2 B;  4IL6 X;  2QM8 A;  1Y9B A;  1L0L E;  2LXB A;  2PGD A;  3CC2 P;  2FYU D;  4KT0 J;  3TGU E;  3AE9 C;  1VQL P;  1RH5 B;  4Z1M H;  2E75 B;  2KSJ A;  3AE4 C;  2FYU E;  1NTM G;  1LTT C;  3CMA P;  4TLF A;  1LT1 A;  3II6 A;  2WSF H;  4WBA A;  3CME P;  4HH2 A;  5AW9 B;  1HF9 A;  1R5S A;  3ABV C;  4ZMD A;  3M9B A;  3C1L A;  1ZRT D;  3L74 D;  4PJ0 E;  2Y0C A;  3HE4 A;  2E42 A;  2O3J A;  2D2C C;  2PFX A;  3H1H G;  4WY4 C;  3KZI E;  3BCC D;  2GA1 A;  1NAF A;  3T97 A;  3AEF C;  1AVY A;  3L74 E;  1LT9 A;  2KYV A;  1IFN A;  5AW6 B;  5KAF E;  3GW6 A;  1FZB A;  2K3R A;  1PGP A;  3KPE A;  3O8Z A;  1KFN A;  1RE3 C;  2I8D A;  3OA7 A;  2B88 A;  2ZVN B;  5KJ7 A;  1CI6 A;  5AVZ B;  1SQP J;  4NPE A;  3WU2 H;  2E74 D;  1NVO A;  1GL2 D;  1YQ4 C;  1NTZ E;  5C39 A;  4LC1 A;  1S72 P;  3IFM A;  2Y0E A;  2L5G B;  3TK1 A;  2WTY A;  2ZT9 C;  2VRS A;  5KLV D;  2E75 D;  3HUS C;  1H88 A;  2O01 H;  1K9M Q;  1NGM B;  2A45 G;  4EOT A;  3GMA A;  2HFE D;  1IO4 A;  2R5D A;  3BVH A;  1KD1 Q;  1LTI C;  4D6T J;  2E5Y A;  1L4A B;  3D6Z A;  1OVR A;  5KLV E;  1S5L H;  4K35 A;  4N3Y B;  5AW5 B;  5AVQ B;  2W83 C;  1CZQ A;  2B87 A;  2FXP A;  1M1J A;  4DT0 A;  2XKM A;  3HUS A;  3EFG A;  2NPS A;  2POH A;  1HWT C;  3CXH H;  2M3E A;  2BAS A;  2IZ1 A;  5AVU B;  3B5N B;  4HKZ H;  5CBO A;  1H0T A;  3GF7 A;  1LWU C;  3L70 D;  1VL2 A;  3A0B H;  1OFC X;  2JWA A;  3JCU E;  5AW7 B;  1Q90 D;  1G2C A;  1SQV J;  3CWB D;  3L70 E;  3CCV P;  3CD6 P;  2P10 A;  1KQG B;  1BGY D;  1LWU A;  1DX7 A;  3L36 A;  1BE3 J;  1PP9 D;  4GIF A;  3TF5 A;  1X0T A;  1OW8 A;  1L0N J;  1Q2N A;  3L4F A;  2D2C B;  1BGY E;  1SQB J;  5AW2 B;  3V5B A;  1DD3 A;  4WY4 B;  1JO5 A;  1PP9 E;  4L73 A;  3AEE C;  3H1K D;  1HVV A;  3HE5 B;  2OYI C;  3FWN A;  2K1A A;  3C9I A;  5AVX B;  1MUU A;  1L4A D;  2K37 A;  1Q82 Q;  5KAI E;  1OX3 A;  1EZV G;  2IX7 C;  2I1J A;  3H1K E;  1NTK D;  3AE7 C;  5AW8 B;  1YIT P;  2FKW B;  3IN6 A;  1QL2 A;  1J1E C;  2P2U A;  3GHG A;  3TYY A;  2O01 J;  1L2P A;  1NTK E;  3B5N D;  2Q5U A;  1S9K E;  3A0H E;  3K5B A;  5APS A;  2ZT9 B;  1EXI A;  4UB8 E;  3F5H A;  5APY A;  3HUS B;  2V7Q H;  3E1I A;  1H89 A;  5L8R J;  3IF4 A;  3KQG A;  1J2J B;  5E79 H;  1MFT A;  2KK7 A;  3P8M C;  1IFD A;  1H0T B;  1HUC A;  3EQ2 A;  1BCC E;  1SQX J;  1FE6 A;  3LIE A;  1EDJ A;  2LKM A;  1KQS O;  1QL1 A;  1G2C B;  1GZL A;  2ZYD A;  1KB9 I;  2IBZ G;  2A06 E;  2D2C D;  4BRY B;  3FX0 A;  4GOD A;  2OQQ A;  4RES B;  4WWI A;  1WRG A;  4KHX A;  2XND H;  1N86 A;  4WY4 D;  1KB9 E;  3NTN A;  1LWU B;  4W7Y A;  1ZME C;  4HB1 A;  4PD4 D;  2JDI H;  1PV3 A;  3AE3 C;  4JYB A;  2OGU A;  1RY3 A;  2QG4 A;  4U7J A;  1M56 D;  3LID A;  1SQP D;  4XFJ A;  1IJD B;  4JF7 A;  3G6E P;  1T8Z A;  1L0L K;  1EXJ A;  3CLQ A;  5BU5 A;  1JMB A;  1SQP E;  4EDF A;  1EDK A;  2P7J A;  1NO4 A;  2ZT9 D;  4L74 A;  1U7M A;  4C46 A;  2K88 A;  4DOJ A;  4IFM A;  2H43 A;  2FYU K;  3VOP A;  1YQ3 C;  2OYI B;  3M9H A;  4D6T D;  5AW0 B;  3PJS K;  1DH3 A;  3AEC C;  2WZ7 A;  1LTJ A;  1VQK P;  3Q2Y A;  1J1D C;  2KS1 A;  1IFM A;  1GL2 A;  1PZQ A;  2BCC G;  2P58 A;  2PP6 A;  1J1E B;  1PGO A;  5CCH C;  5B5E H;  1KQL A;  5EFW B;  5TIS H;  2V7Q J;  1FDM A;  1L0L G;  2JO1 A;  2JJL A;  3TGU G;  1RHZ B;  3RK3 C;  1KFM A;  1AQ5 A;  3U1C A;  1QVG O;  2QA4 P;  2H88 C;  5K5G B;  4GKG A;  2W27 A;  1SQV D;  2FYU G;  2QJY C;  3TNU B;  3NFQ A;  3SSU A;  4CPG A;  3L73 D;  5APX A;  1SLQ A;  4LLH A;  2IYP A;  1VQM P;  3H1H J;  1BE3 D;  1SQV E;  3H1I E;  1RF1 C;  2Q1K A;  3PHL A;  5CCG C;  1L0N D;  3L73 E;  2PAJ A;  4PD4 H;  3I56 P;  1FJK A;  1SQB D;  3L35 A;  2YXR B;  3MTU E;  4W7Z A;  1A02 J;  2AXC A;  1BDC A;  1YTZ T;  1BE3 E;  3VMA A;  1RF0 A;  1M90 Q;  1N7S C;  4AQR D;  2ZJS E;  2AXT H;  1NYH A;  2M5A B;  5KLV K;  3MHV A;  1DIP A;  1E79 H;  1VF5 C;  1S2E A;  2J5U A;  3WU2 E;  3VN0 A;  3V2R A;  5AW4 B;  2ZAE B;  4JYC A;  4IFD K;  2E5T A;  4HJG H;  2O1J A;  1NTZ G;  4TT3 H;  1AQT A;  2OYH C;  3MUD A;  1GW3 A;  3U1A A;  2K9J B;  1FOS F;  2KOG A;  2QVA A;  3AEG C;  1ZOY C;  1XTC C;  1PPJ G;  4RKU J;  4AYC A;  4N78 D;  3B5N C;  3L71 E;  3FWL A;  3B8E B;  1L4A A;  4GT1 A;  5KLV G;  1S5L E;  2OYH A;  3V2N A;  3CXH D;  1J1D B;  1SQX D;  3KYQ A;  5AW3 B;  3HD7 C;  3M9Q A;  4ZKP A;  3CXH I;  2E43 A;  3B5N A;  3AE2 C;  2FY8 A;  1AFO A;  2FYZ A;  3CXH E;  3CCS P;  1SQX E;  1YJ9 P;  2R5B A;  3RK3 B;  2WSS H;  1JMM A;  2IFN A;  2XU6 A;  2YMY A;  1OXZ A;  3A0B E;  2YIU C;  2W6J H;  3HD7 A;  1NWQ A;  3RK2 C;  3W68 A;  2Y9Y A;  1LP1 B;  3VTP C;  1U57 A;  1BSN A;  2QJY B;  1ZRT E;  3H32 B;  1K73 Q;  3CI9 A;  1G1J A;  3L72 D;  1KIL C;  2HR3 A;  2QSI A;  4XA4 A;  2Q7C A;  4DZO A;  2AEJ A;  2W90 A;  3BCC E;  2W6A A;  1RF1 B;  1PFI A;  4NPF X;  1NTK K;  1GU4 A;  2FXM A;  4WY4 A;  3L72 E;  2ZXX A;  5AVY B;  4U3F G;  1KIL A;  3HE5 A;  2V4H A;  3HTK B;  1N7S B;  2KZJ A;  2O01 N;  1RE3 A;  2IFM A;  1NU1 D;  1KOR A;  2R3S A;  3CPW O;  2PRR A;  1U7J A;  1LTG C;  3D6Y A;  3H1K G;  3QWO C;  3V4Q A;  1KYO H;  1HGZ A;  1K05 A;  1VF5 B;  2Q3E A;  4GOE A;  3RBZ A;  3AE5 C;  2WPS A;  1NU1 E;  2KLU A;  5AVW B;  5CCH D;  1JY2 O;  3H1J G;  1NTK G;  1WT6 A;  3UIA A;  2OYH B;  4I2L C;  3AE1 C;  3RK3 D;  1R5L A;  2RMZ A;  3O6Q A;  1X8Y A;  2WIT A;  1AJY A;  4RO0 A;  3MD0 A;  1PGQ A;  1TU3 F;  3L75 J;  3SWY A;  1OW7 A;  1T2K C;  3RK3 E;  5E79 E;  1OZH A;  1JY2 N;  1BCC G;  1JM0 A;  3CCR P;  1SQQ J;  1KZU B;  1URQ C;  3H6P A;  4BRY A;  3HD7 B;  5CCG D;  1KV4 A;  1SQP K;  2A06 G;  2JWD A;  1GW4 A;  3H1L G;  2Q6Q A;  3MIW A;  3CWB E;  1NJI Q;  1IK7 A;  1FC2 C;  3RL0 g;  2WT7 B;  3H25 A;  1N7S D;  4BXL A;  5AVV B;  2E76 C;  1A02 F;  4A7P A;  2YIU B;  4YPC A;  3TDK A;  2YNY A;  3RK2 B;  3Q1M A;  3V6I A;  3M0D C;  1W2B O;  1JB0 J;  2YKQ A;  1VQ5 P;  3A3Y B;  3C8V A;  3OAK A;  2GUV A;  3MP7 B;  1VF5 D;  1KIL B;  4UB6 H;  3CCL P;  3CL3 D;  4L75 A;  1YTZ I;  2C9N Y;  2XZR A;  2KP8 A;  2OTL P;  1VQP P;  3FXD A;  2QM7 A;  2KXP B;  3M0D A;  3OW2 O;  1IC2 A;  1UIX A;  1VQ6 P;  1JCD A;  2SPZ A;  4R4L A;  1JOC A;  1M1K Q;  1CW5 A;  4BWN A;  4Y99 C;  2OYI A;  2QIW A;  1JNM A;  1PL5 A;  4KJM A;  5H2F H;  1HBW A;  2JEE A;  4AUW A;  2BCC J;  5AVS B;  2ZVO B;  2FBW C;  1S5L X;  4OVN F;  3O6Q B;  1SQV K;  1AVO A;  1L0L J;  3A7O A;  1G1I A;  3HD7 D;  2OAR A;  3TGU J;  3A2A A;  2CPS A;  1GTW A;  1YI2 P;  3IAO A;  2N1T C;  5B5E E;  5TIS E;  1D7M A;  3MGN A;  2N9Y B;  2FYU J;  1L0N K;  2Z5I A;  1EDI A;  1SQB K;  1USE A;  3TNU A;  1VQO P;  3CC4 P;  1FZC C;  4MN4 C;  4JQ0 D;  3RK2 D;  1EC5 A;  3CCM P;  1VQ7 P;  2NZ2 A;  3CCJ P;  1KMI Z;  3M91 A;  1YYC A;  5APQ A;  1JY3 O;  1KIL D;  4JBZ A;  2RN0 A;  4LGD E;  2WSC H;  3G9R A;  4OWF A;  3U59 A;  1SQV G;  3ITK A;  1URQ B;  4PD4 I;  3H1I G;  1GK4 A;  2ZYG A;  2B89 A;  3S9O A;  3Q3D A;  3L73 G;  1FZC A;  5KTB A;  3M06 A;  4PD4 E;  3CC7 P;  1KIL E;  4YXW H;  2WPR A;  4H13 C;  1T3U A;  4ZKU A;  1EZV D;  5TJH A;  2M5A A;  2OTK E;  1PIX A;  2E76 B;  1VQ4 P;  2FYN C;  4DJG A;  1EZV I;  2AXT E;  3RBX A;  2A45 H;  2XDJ A;  1P84 H;  3JC2 2;  1EZV E;  5AW1 B;  1T3J A;  4OGQ C;  1NTZ J;  1ZN5 A;  1GU5 A;  3USS A;  1MKM A;  2W6B A;  2HG5 D;  4C7R A;  1SQX K;  2K9J A;  3FGA D;  2Q3I A;  1UII A;  2K9Y A;  3P32 A;  1QVF O;  4D6T E;  3CCE P;  1GMJ A;  1SS1 A;  4IL6 H;  5KLV J;  4Y99 B;  1SFC C;  3P8C D;  4C7N A;  3L71 G;  3L75 D;  2KB7 P;  1MV8 A;  2YKP A;  3P7K A;  1Q86 Q;  1GK6 A;  1NTM J;  3L37 A;  1T2K D;  1ZR4 A;  1FJP A;  1OVU A;  2IYO A;  2IBZ D;  2GM4 A;  3B71 A;  1KQF B;  3P8C E;  1SQQ D;  2WSE J;  3LW5 J;  3S4R A;  3AEA C;  3L75 E;  1URQ D;  2IBZ I;  5CCH A;  1T6A A;  2P1J A;  4EYY Q;  1FZG A;  2WWW A;  1S1C X;  5BVZ A;  3GLM A;  2IBZ E;  2N1T B;  3HRN A;  1SQQ E;  1VPC A;  1ZW0 A;  1SP4 A;  3GF3 A;  5AVT B;  3VP8 A;  4K3A A;  3CX5 H;  1K04 A;  1LP1 A;  2E76 D;  2LR2 A;  2YMK A;  3H32 A;  1FZC B;  1EDL A;  1GD2 E;  2WSC J;  3R4Y A;  5AVR B;  5GTH H;  1L0N E;  3L74 G;  2M8R A;  1SQB E;  1K8A Q;  3FXE A;  1IFP A;  1RF1 A;  1N73 C;  5CCG A;  1RQV A;  1NU1 K;  4U3F J;  5B66 H;  1ZV8 A;  2L91 A;  3BCC G;  2HPC B;  2HOD A;  1X79 B;  2ZXE B;  1IFJ A;  2M3B A;  3L72 G;  1X22 A;  1Q81 Q;  1W2E A;  2P67 A;  3OJA B;  3HTK A;  1N7S A;  4H13 B;  2CPB A;  1MFZ A;  3H1K J;  1NHL A;  1KYO D;  1IK9 A;  2FYN B;  3Q5S A;  2BCC D;  1Y8A A;  1KYO I;  2G3A A;  1FOS E;  2WPV B;  3GG2 A;  3EFF K;  3I55 P;  3SWF A;  2KI7 B;  3H1J J;  4OGQ B;  1NTK J;  1KYO E;  3BAS A;  5CBN A;  3E1R A;  3TGU D;  2O1K A;  2QJK C;  1OMI A;  4C7N B;  2HLO A;  2BCC E;  1NU1 G;  1LGH B;  1ZXG A;  2KSE A;  1FDO A;  1JUN A;  4N78 E;  1BSH A;  2N1T D;  2BEQ D; 
#chains in the Genus database with same CATH homology
 5CHX A;  3MD0 A;  3P8M C;  1XTG B;  1IFD A;  1LTA C;  2Z4E A;  1HUC A;  3EQ2 A;  3SWY A;  1T2K C;  1SFC B;  1SFC A;  5APW A;  1MZ9 A;  1VDF A;  1JY2 N;  3LIE A;  2LKM A;  1QL1 A;  2C0X A;  4HYT B;  3IR9 A;  2J59 M;  1G2C B;  1GZL A;  1KZU B;  1URQ C;  3H6P A;  3HD7 B;  4RES B;  1WRG A;  5CCG D;  4KHX A;  3NXS A;  1LT9 C;  3A5T A;  1N86 A;  1SQP K;  4WY4 D;  2H8P D;  1RF0 C;  1X9V A;  3NTN A;  1LWU B;  1GW4 A;  1FBM A;  3RL0 C;  4W7Y A;  3BRT B;  3MIW A;  4N6J A;  5CJ0 A;  3V4W A;  5APV A;  4JYB A;  2WT7 A;  2WT7 B;  1NTZ K;  5KJ7 C;  1N7S D;  5AVV B;  1A02 F;  1RY3 A;  2XNX A;  2YNY A;  3VMZ A;  3LID A;  3RK2 B;  1DEB A;  3M0D C;  2HOD B;  3NMD A;  2YKQ A;  1FZE A;  3KDP B;  3A3Y B;  2YO2 A;  3OAK A;  1IJD B;  4JF7 A;  2GUV A;  2HYN A;  4IFF A;  1KIL B;  2J58 A;  1T8Z A;  3CL3 D;  1YTZ I;  2C9N Y;  1N7L A;  2KP8 A;  2XZR A;  1L0L K;  2C0W A;  3CLQ A;  5BU5 A;  1LTB C;  3WMM 0;  2ZFC A;  2I1K A;  2P7J A;  1NO4 A;  1N73 B;  1N73 A;  2QM7 A;  2IPP A;  3M0D A;  1IC2 A;  1NTM K;  4O9B A;  3N4X A;  4C46 A;  1JCD A;  4W80 A;  4DOJ A;  4IFM A;  1ZR2 A;  1OWA A;  2H43 A;  1L4A C;  2FYU K;  3VOP A;  1SVF A;  1JOC A;  1CW5 A;  1LTS C;  4Y99 C;  2OYI B;  2OYI A;  3M9H A;  1JNM A;  2MJZ A;  3BRV B;  3R2P A;  5AW0 B;  1DH3 A;  1M1J C;  1HBW A;  2WZ7 A;  1LTJ B;  1LTJ A;  2JEE A;  5APT A;  1Z56 A;  2NPS C;  1J1D C;  4AUW A;  1SFC D;  5AVS B;  1HTL C;  1IFM A;  1GL2 B;  1GL2 A;  2QM8 A;  1SQV K;  2PP6 A;  1J1E B;  1RE4 C;  5CCH C;  3A7O A;  1G1I A;  1KQL A;  3HD7 D;  2OAR A;  3A2A A;  2CPS A;  1GTW A;  2KLV A;  1FDM A;  4I1L A;  2KSJ A;  2JJL A;  3RK3 C;  1NKN A;  1KFM A;  2N1T C;  1AQ5 A;  3MGN A;  3U1C A;  1L0N K;  1LTT C;  2Z5I A;  4GKG A;  2W27 A;  1SQB K;  1FZA A;  1RE4 A;  4OH8 B;  3TNU B;  3TNU A;  5CJ4 A;  3II6 A;  2WSF H;  1FZC C;  3NFQ A;  4WBA A;  1GDT A;  3RK2 D;  4HH2 A;  3VYI A;  5APX A;  5AW9 B;  1M7L A;  1SLQ A;  4LLH A;  2FFD C;  3M9B A;  1EQ7 A;  3M91 A;  2H7H A;  1YYC A;  3HE4 B;  3HE4 A;  5APQ A;  2E42 A;  3N7N A;  1JY3 O;  1KIL D;  2GUS A;  1RF1 C;  4LGD E;  5CCG C;  2WSC H;  2PAJ A;  3U59 A;  4WY4 C;  1JY2 P;  1URQ B;  1FJK A;  1URQ A;  1GK4 A;  2R32 A;  1NAF A;  3T97 A;  3L35 A;  3MTU E;  4W7Z A;  1A02 J;  3TSI A;  1FZC A;  1LT9 B;  5KTB A;  1LT9 A;  1YTZ T;  3M06 A;  2KYV A;  1IFN A;  5AW6 B;  1RF0 A;  2R3C A;  2FFD A;  3RL0 B;  2WPR A;  1N7S C;  1FZB A;  2Z5H A;  4AQR D;  3KPE A;  3O8Z A;  1T3U A;  1RE3 C;  1NH4 A;  1KFN A;  1JTH A;  4ZKU A;  3OA7 A;  3I5C A;  5KJ7 A;  5KLV K;  1CI6 B;  1CI6 A;  5AVZ B;  4WB4 A;  3GHG C;  1GL2 D;  1HH0 A;  2A45 H;  2XDJ A;  1J2J B;  2A45 I;  5AW1 B;  3VN0 A;  1T3J A;  4LC1 A;  1ZN5 A;  3V2R A;  5AW4 B;  2YO3 A;  4JYC A;  4IFD K;  3IFM A;  2L5G B;  3TK1 A;  2WTY A;  2O1J A;  1GU5 A;  2VRS A;  1S9K D;  2W6B A;  2HG5 D;  3HUS C;  1H88 A;  2OYH C;  3MUD A;  2O01 H;  1GW3 A;  3U1A A;  4C7R A;  2A45 G;  1SQX K;  4EOT A;  1FOS F;  2KOG A;  2Q3I A;  2HFE D;  1IO4 A;  1XTC C;  2R5D A;  3BVH A;  3P32 A;  1SQQ K;  1LTI C;  4AYC A;  4N78 D;  3B5N C;  1L4A B;  3B8E B;  1L4A A;  4M3L A;  1JCC A;  1CSB A;  1H8A A;  4N3Y B;  5AW5 B;  5AVQ B;  4Y99 B;  1SFC C;  1CZQ A;  3P8C D;  4C7N A;  3V2Q A;  1M1J B;  1M1J A;  2KB7 P;  4GT1 A;  2XKM A;  1MV8 A;  2YKP A;  5CMZ A;  3P7K A;  1GK6 A;  2WSE H;  3HUS A;  3L37 A;  3LW5 H;  1T2K D;  2NPS B;  3EFG A;  2NPS A;  2OYH A;  3V2N A;  1J1D B;  1ZR4 A;  3KYQ A;  2POH A;  1HWT C;  1FJP A;  5AW3 B;  1ZLL A;  3VMY A;  2GM4 A;  3V2P A;  3HD7 C;  3M9Q A;  2BAS A;  4ZKP A;  5AVU B;  3P8C E;  2E43 A;  3B5N B;  3VMX A;  3B5N A;  1URQ D;  1FAV A;  5CCH A;  5BU8 B;  1LWU C;  1IFI A;  2P1J A;  2FYZ A;  1FZG A;  2C9L Y;  2WWW A;  1AFO A;  1HGV A;  5BVZ A;  2Q9I A;  5AW7 B;  2R5B A;  3RK3 B;  2N1T B;  3HRN A;  2N1T A;  3RL0 D;  1VPC A;  2YMY A;  1JMM A;  2IFN A;  2XU6 A;  1G2C A;  1OXZ A;  2N9B A;  2YKO A;  1SP4 A;  5AVT B;  3VP8 A;  3HD7 A;  1NWQ A;  3RK2 C;  5KJ7 D;  3VTP C;  1FZF A;  3PP5 A;  3H32 B;  1LWU A;  3H32 A;  1FZC B;  3CI9 A;  1DX7 A;  1E5W A;  3L36 A;  1G1J A;  1GD2 E;  1KIL C;  5AVR B;  4GIF A;  4XA4 A;  2FFD B;  2Q7C A;  4DZO A;  1NOH A;  2M8R A;  3L4F A;  2W6A A;  1JY3 N;  5AW2 B;  1JTH B;  1RF1 B;  1PFI A;  1RF1 A;  4XE5 B;  1N73 C;  4B86 A;  1NTK K;  5CCG A;  1NU1 K;  2WPQ A;  3V5B A;  1GU4 A;  4WY4 B;  2FXM A;  3G3Z A;  4WY4 A;  1JO5 A;  1ZV8 A;  2HPC B;  2HPC A;  2HOD A;  1X79 B;  5AVY B;  2ZXE B;  1IFJ A;  2M3B A;  1KIL A;  1W2E A;  1HVV A;  3HE5 B;  3HE5 A;  2P67 A;  2OYI C;  3OJA B;  5AVX B;  3C9I A;  3HTK B;  3HTK A;  1N7S B;  1N7S A;  1NKZ B;  1FU1 A;  1MUU A;  1L4A D;  1LTJ C;  2CPB A;  3BAT A;  1RE3 A;  2IX7 C;  2I1J A;  2IFM A;  1MFZ A;  1NHL A;  5AW8 B;  1GL2 C;  1JY3 P;  1IK9 A;  2FKW B;  1LTG C;  2NPS D;  3V4Q A;  1HGZ A;  1QL2 A;  1J1E C;  2P2U A;  3M0A A;  3GHG B;  3GHG A;  1FOS E;  2XV5 A;  4I6M C;  1HJB A;  3TYY A;  2WPS A;  3SWF A;  3BAS A;  3B5N D;  2Q5U A;  1S9K E;  5AVW B;  5CCH D;  5APS A;  2O1K A;  4C7N B;  2HLO A;  1JY2 O;  1LGH B;  1WT6 A;  5APY A;  4EIJ A;  3UIA A;  3HUS B;  3VP9 A;  2OYH B;  3E1I A;  4I2L C;  1JUN A;  1H89 A;  4N78 E;  3RK3 D;  2N1T D;  1N2D C;  5APU A;  1X8Y A;  3KQG A;  2WIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...