5AVYB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 20 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avyB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avyB02
2C9NY 3VN0A 1OWAA 3M0AA 2WPQA 3UIAA 2WT7A 4AUWA 3O8ZA 1KQLA 2E43A 5AVSB 1T2KD 1GD2E 5APXA 5AW0B 4GKGA 2P7JA 3P32A 2R32A 2Q7CA 3VTPC 2Q5UA 3I5CA 1SLQA 2YO3A 1IO4A 3M91A 1T2KC 1FAVA 3P8MC 2R5BA 5AVTB 5APUA 3VYIA 5AW2B 5AW9B 1NWQA 2Z5HA 1A02F 2WPSA 2WTYA 1A02J 5AW6B 1GU4A 5AVXB 2WWWA 5AVVB 4AYCA 4B86A 4EOTA 1MV8A 3HE5A 5AVUB 5AW5B 3V4QA 2N9BA 2XU6A 3MGNA 3TNUB 1CZQA 1X8YA 4C46A 5APVA 1JNMA 3M06A 1HUCA 2YNYA 1MFZA 3WGUB 4I2LC 4HYTB 1GK6A 2JJLA 1GK4A 2XV5A 1FOSE 4M3LA 5AW4B 4DZOA 5APSA 1SP4A 2ZFCA 1NAFA 2XZRA 2ZXEB 5AW3B 3SWFA 1GU5A 5APYA 3TNUA 2VRSA 3KQGA 3LIDA 2W6AA 3M0DA 3KDPB 3NTNA 1CI6B 3LIEA 3HE4B 1CSBA 3TYYA 1HJBA 2YO2A 1H88A 2QM7A 1GTWA 2P2UA 3OAKA 3M9BA 4JYCA 5APTA 5AVQB 4RETB 3L36A 5AW1B 3MD0A 1HWTC 3V5BA 3B8EB 2W27A 3A3YB 3HTKA 1HBWA 4AQRD 2IPPA 2Z5IA 5AVYB 2KP8A 3NMDA 3VMXA 5AVWB 4C7NB 3VMZA 2H7HA 2C9LY 2QM8A 1S9KD 1G2CB 5AVRB 2R5DA 2E42A 1OXZA 3V4WA 3A5TA 2WPRA 3HE4A 1DH3A 3L35A 4JYBA 3A7OA 1H8AA 3L37A 4RESB 3NFQA 3NXSA 1YYCA 3P7KA 1FOSF 1J2JB 4I6MC 3TK1A 3WGVB 1GZLA 3T97A 3A2AA 2P67A 5CMZA 5APQA 5AW7B 2WT7B 4C7NA 5AVZB 2BASA 5APWA 4LC1A 1S9KE 2Q3IA 2R3CA 4KHXA 1H89A 1MUUA 3IR9A 1JUNA 4XE5B 1CI6A 5AW8B 3VMYA 4GT1A 3M9HA 3HE5B
chains in the Genus database with same CATH superfamily
2F54E 5JR1H 5FOBA 1NEZG 5TTRA 4HB1A 1SRDA 1QI4A 1BBDH 4DIXA 3WFEL 1MQKH 3VTPC 5MHSD 1E79H 2CO6A 4HIIB 2O3JA 3L71E 4EI6A 2VISB 1UWEL 4XCYA 1P7KA 1QSED 1Y47A 3IGUA 4N78E 3L7EA 3ARDC 3ZGIA 3KG5A 1HXMB 1XB3A 1B2WH 1DUYB 4B9PA 5JW4N 4KO9A 2DEYX 2VC2H 3VRIA 4G6ML 3VD7A 2D2CC 1X8YA 4ZOEA 2V5TA 2BO0A 3L2LA 1I3RA 3BH4A 1IBBA 2D31A 3L4CA 5I1EL 4KDTC 4I0PB 4O9BA 4ADGA 2HTLD 3P9WB 4G8EB 2CLZA 4FJYA 1KN2H 5K39B 2AV1A 1S7VA 1OVUA 1HSBB 2X4OA 5DDHB 1L0LE 4GMSH 1GZHA 1L0YA 3NPZB 3SGEI 5M94B 4WWPA 3TH3T 3BUTA 3C08L 5DF0A 4DT2A 4L4TE 1QPXA 4LOUC 5JIMA 1AXSA 2O5ZL 2NXZB 2AERT 2ZYAA 3NJJA 4P23A 3T0VA 4U7JA 1NCIA 3RNQB 2ZYHA 5ALBH 2P5EA 3IAOA 5GISH 4JFEB 1KZUB 5DRNB 3D69A 4ZX5A 3SPGA 3V6ZB 1KCVH 5E6IC 2NNFA 2FQGA 1MJUL 1UZ8B 2F7QA 3MRHB 1YN6A 1U3ZA 4AVHA 4D8OA 4Y4KD 1B6DA 1GIGL 2W91A 3P30H 4P59H 5FXCH 1JE6A 4YE4H 1HHHB 4POZD 1MFCL 2G3NA 2Y07H 4EIZC 2H0JA 3QWOA 3I6LE 4NQEE 4QRPB 3P4OA 2AJ3B 4ZODA 5KVFH 4YXDC 2ZWLT 1RHHA 3AB0C 4PS4L 2YAFA 1T2XA 1YMHB 3BZ4A 4LVHB 2V7HA 4NB7A 4XCNA 1UFUA 5ISZD 5T3ZH 4ZUVB 1RULL 4IRJB 3JTTB 4UNTA 2OMZB 2I85A 4NPKA 1QI5A 3UAFA 3CG8A 3TOPA 5MERB 1XH0A 2D03L 2JXMB 3MRQA 1CFQA 3MX0B 4XWOD 5IBLC 2EVGA 1J10A 3D0VB 4LL9A 2MNWA 3CIAA 2QJDA 2QV2A 3L5WB 2Y2YA 4Y2OB 3UJIL 4YPCA 1L9RA 3WFHB 1L9TA 1DD3A 1SQBK 4G6JL 4AVKA 1BCCE 2R0ZH 4AIOA 5C2BL 1FHNA 4MDIB 1M2VA 3QA3A 2AJUL 1J1XL 1XB6A 5HDBF 2J8HA 3TO4A 1C08A 1RZPA 1YN7B 3L3GA 5DMIL 4JHWH 4TUOA 2CMRH 5DZVA 5I73C 3LRSA 1AQKH 1MEXL 4N8UA 5CU9A 5KLIC 5FKAB 2DY2A 3KPQB 1NIEA 5BZZA 5D1XA 3H1LD 1OT1A 1QLFB 4J1UB 1CD8A 1DUZA 3TV3L 4XZ4A 5ID1A 5DR5L 4FABH 2AQRA 2IDFA 3T1FB 3U9PL 3ENEA 1EEYB 1SNRA 4EZJA 1R5SA 1ZIBA 4JFXA 4PGZA 4Z3TA 3K2MC 4PJ0H 4XPBL 1IUZA 2HYMA 2DYPB 3W37A 4ODHH 1KXHA 1RU9L 5IY5B 3QIBA 3VDBA 1T83C 2Q5BA 4LQ1A 3ITKA 3QDGB 2E7CA 3ASNB 3HE7B 2GSIA 3FN3A 4LHUB 4GRWH 4MJIE 2AGJL 5C0AE 3BDYL 4N3UA 2VXUL 2WZPD 2FO1A 2AK1H 1G0DA 2BHZA 5AD0B 4F9LC 1ZLVH 3ZZ1A 3M8OH 3PWJA 2AAAA 4GW1B 1I85C 1KT2A 1DQTA 4OUUA 2XQ0A 3CCHA 3RVXC 4JPZB 4DOHE 4DW2L 3GMOA 1OAUH 1FL6A 4U3FD 2KSEA 2QPUA 2DM3A 3LS5H 4Z7UF 3TA3C 2C3HA 1UXWA 1JHLL 4XN8A 1RQUA 2Z8SA 3T0EB 4FNLL 3QPXH 4D0DB 4OLVH 5EBMA 4AMXA 3AE1C 1TZGH 3DX7B 4HIJA 4NN6B 4JW3A 2K37A 1XR9B 3VJ6B 2FIKB 4NC1E 5DRWB 4M03A 1Q82Q 2FHFA 5F1IB 1KTLA 1LDPL 2W9DH 1V05A 5JW5A 1SJVA 1LT9B 1Z56A 4B3VA 1T2JA 2YQBA 1Y6MR 3BIBX 3IDJA 4G7YL 3APDA 5ABZA 1FIGL 1J8KA 3JV5A 2N01B 4PP2A 5GHWL 4ZDHA 1ID2A 4PB0H 5GGSY 3VM5A 4ZMPA 4M00A 5TJHA 1PZCA 2KDGA 1VAHA 2WAQA 4UV4L 1G43A 2NZ9C 3IMWA 4TNWK 4PJBE 6FABL 1GC1L 4KJWD 4F3FB 1BVOA 1AGEB 3HTKA 3D8MA 2OZNA 3EH1A 4XNXL 4ZS6D 3FT3B 3RGHA 2P8MA 4JFFD 1SEQH 3DUSA 4X6DB 4Y1AA 2HRGA 1TQBB 3P9MA 3Q5TA 5CWSA 4IJTA 4QCIA 5BRZB 5E08H 3IBEA 2VERN 1IEHA 2YKKA 3EJPA 2OXHA 3VP9A 3WIHH 1QFWM 1CF1A 1YY9C 5ANME 5HHPA 4UB6E 3S88L 3MFGB 3CFJA 5H4YA 5DK3A 2BIOA 3B2UC 1U3HD 4R7LA 2HT4D 4JFDA 3TT1L 2HH0H 1QNZH 5B38B 3ILPB 4LSTH 1CXHA 5D4IA 1VQLP 4HJGH 3GZQA 4KI5F 5KJ7D 3H1LG 1PD6A 2ZNWA 3DRQA 4QUOA 5CJOH 4L8DB 3DXAD 4UT9H 5LO7A 3WMPA 4BWNA 2C3WA 4PVLA 1NIAA 1XSIA 1K73Q 1MCKA 4OKVB 4GXUN 2VO5A 3C6LA 1UVQA 1BQLH 3ARBC 2Z34A 1I8IA 2VLJE 4YXKL 4G9FB 4L0YA 1KMIZ 3D4ZA 3PHQA 2J73A 4X7DC 4BFKA 3O3DB 4JO4L 3BP7B 4JFQA 4PTTB 5IOPA 1RJYA 1JZEA 2JLLA 1DX7A 3H32B 3BW9A 4UV7H 1VHPA 5EN2B 4XP1H 5I74B 1C12B 1I3VA 4BYHA 1B4LA 3ILQD 3NCXA 1PL5A 4AJVA 1SUHA 1IC4L 2RACA 2QKIA 3K6IA 5ERWB 1FBMA 3MOBH 3OJMB 3PJSA 3HE5A 4X4YB 3U0TA 4NO0B 3SOTA 4RRPA 1S5LE 4UZGA 3VFMA 5IQ7H 2YHGA 2AP2A 2WZ5A 1KMGA 4GRMB 1PY9A 2H1XA 4PV9B 3KEDA 4HS3A 4M8RA 4AOFA 5KS9F 1EDIA 4F91B 2KDYA 2R69A 1CC3A 4GAYB 3RILA 2VDRL 2CDFA 4QRUA 1CXLA 2XQBH 2FUTA 1VPOL 3WN5C 2JP3A 3IJEB 3QI9B 2BK8A 2EECA 1JGEB 4FNRA 3KPPB 1NTZK 4EMZA 3GW6A 1CE6A 2VDRB 1LO0L 5FB8A 1YY8B 2PWEA 2KBGA 4PJGB 3RL1A 5CCHA 4J8RA 1HEHC 4UDTA 5D2NC 2DQUL 1J11A 1HU8A 3MKKA 3M9BA 2LFGA 2OMNA 4CUCA 2M8RA 1B4JL 2B3RA 2ZYDA 4K0OA 1GTFA 3U30C 2NXYC 4N3TA 4DHLA 3MBEA 1R3KA 1YUKB 5TDOA 1IM3D 5I1JH 5E94B 1E2VA 2IADA 5FWRA 1FE8L 3RFZA 1D5BA 3EDDA 3ES6A 4XAWH 4ZKPA 5T1LB 4JFEE 1NSNL 1VQNP 1YLBB 3QFJD 5FO7A 2KZKA 2VQTA 4PJHB 3CZJA 1EO8L 1SOSA 3THML 2GEEA 3CFEB 3CTTA 3VSUA 5F7MC 3O2DA 5DC4B 2R51A 4PUBH 1XMWA 4UAOC 3RDTC 3RZCD 5JHLH 2PW2A 4QRPE 4WTZG 2D3VA 4TQHA 2QDWA 1KEML 1H5BC 2N1TA 2IALB 4J2QA 5AOLA 4UQIM 1DFBL 3KYOA 1KEGL 2NW2B 1AV1A 1OAZL 1FZCA 3H3PL 5KS9A 4I48B 3OW2O 3L75D 4L37B 3AE7C 3VE0B 2VL5A 2Z31B 4GRLC 4MMXA 3JWNE 4XTRC 5LBSL 4PIBA 1RPQA 5HDLA 5A3ID 2G60H 3SGDI 4PRBA 4A63A 3DV6B 3GO1H 4V11A 1FH5H 5CNHA 2DQGH 1YEGH 2BVOB 2IBGA 4JFZH 1PG7W 3RGUA 1E4KC 1MJ8L 4QXVA 2VMJA 3MLYH 1FGVL 2OMYA 2M5AA 1UKQA 2EDMA 3AACA 4WFHD 1OMIA 5IW6A 4JAMB 5DEGB 4L9LC 2XZAH 4LARL 4Z6AT 1M71A 3SQBB 2YQ3A 4A66A 1IBDA 1I3GL 5E8OA 1XD1A 1ZA6A 3JZYA 4X2UA 1B0WA 3Q2WA 4NWTL 4U4IA 1D6VL 3L1GA 5D7LE 4XI5D 3I84A 3SPCA 1CXKA 3TU6A 4P2OC 5JO5B 1RKRA 3IDGA 1A1OA 1G7JB 3KGRA 4NN7C 5A16B 4G80B 4BSWB 5C0DA 3OKLA 5AB2A 1IK9A 5E2UL 4EI0A 5BVJA 4XXDA 3C8HA 1GPOH 4ODSL 5C3LD 1ZLWH 3N40P 1INQB 5D9SB 2FFDC 4I2XA 5BU5A 1QQDB 2GITA 2WBJA 3TGUE 3MNDA 3UBHA 4DETA 2KERA 3F5HA 3VXRA 3OLEA 4DGYL 2YAHA 4Z7AA 2J56A 3WFBL 1CFSB 2VR3A 1XF3A 2BIPA 3BPCA 2IAAC 4K3EL 5EFIB 4HLEA 4M29A 1SBSL 4JPKH 2Q1EA 4GBXC 4NRXB 4HAFA 3WHXB 1N10A 1M3JA 5T1MA 2ZXDA 3KLLA 1BE3D 2IAMB 4D6TJ 1JUFA 2YA0A 4ZKUA 3MREB 2EDHA 2H0PA 2NYZA 3WLWC 3X11A 3LZLA 3BP6A 3QFDB 2Y22A 3BSZH 2KS1B 3EFFA 4S1QL 3CQFA 3KPSB 3SBWA 5JQ6L 4PJ8D 3I55P 1JVLA 2CUHA 1UADC 1NCNA 2OMXA 4FHJA 4PGBA 1IM9A 1KLFA 3T0EE 2A77H 4LL1A 2A6IB 5HYQA 4L5FL 1DN0A 4FJ6A 4LLHA 1NANH 2A0LD 4JNXA 2PR9A 4P5TD 3HZYA 3G3ZA 4GJTB 1E5WA 3H1KD 5JIPA 1YEFL 3OMNB 4H1LA 3PQYD 4LLVA 5IW3A 3L75G 2JKRM 2PXYB 4BQCA 4Z78A 3WAJA 1CBVH 1CTNA 2AEPL 3FU7A 1QUPA 4L8CA 4OJYA 3V2PA 3TA4D 2UWEF 3BIKB 1ES0B 5AL0A 5BO0D 3T4YA 3FUEA 4FYTA 3WTXA 1FVDB 4UNUA 2ENSA 3AT9A 4K3JL 4AYEC 2HG5D 4Y16A 5BRZE 1YJDL 4JO2H 2Z64C 1GGIL 2C3XA 4NENB 2ZWSA 4MD5B 5TH2A 3ZRCC 3ULVC 3LQAL 2OGUA 2CAKA 3F12B 3VMYA 4BIKA 1J8HB 2R9HD 4UILL 2YPVL 1UJTA 5E56A 1RQ5A 4FZEL 5FO2A 4M8QB 4WB4A 1RE4A 3KYNB 5IROC 5HVFB 3FZUC 3ZDZB 3D06A 2DQTH 3MNZA 1Q9WB 3GNML 4POYA 5BZWB 5JNYA 4UIKH 2G30A 3TZVB 2AEFA 1MF2L 2EIKB 5DO8A 5ESVB 3RUGB 4WDIB 3T6XA 2GEQA 5HJ3A 1A6PA 3LDBC 5F1SA 1KZYA 4JK0D 1OAYL 2PUQT 3A6CH 4F2FA 4PWFA 3T6QC 4G9FE 4XPGL 4ZS7L 1FZEA 5B39A 1TSRA 3AY4A 3U4BH 4U1SB 1ZLUH 1MHEA 3NDZE 1G0YR 4X9BA 4A6YL 2XYCA 4MNQA 1ZOXA 4HBCH 1NGWB 4QAWA 5EOTA 1OTSC 3I56P 1UFGA 1BE3G 1HK6A 5T33H 3EJSA 5FA3B 4PG2C 3TO2B 1ESOA 3APNA 4WGVB 4A6YB 4OY9A 2EC8A 1HXYA 1PLGL 3WIAA 2HJLB 5IW1A 5IOKA 3ZY7A 5IV2A 5I5IA 1FZAA 4Z18A 5CAYB 1EZVE 5KVMC 4CBZA 2UWEA 1OAXH 2BCCE 1E3FA 1B0GA 2W6AA 1MREL 5ALCL 5E8NB 5I26A 4AMKL 3ZHNA 3RX7A 3V0VB 2DQJL 2WBXA 5CO1A 2IMMA 5EN3A 1XTCC 5HPMA 2J5LB 4LCIL 2Q1KA 1RZJC 3P11H 1PNCA 4GOFA 3IDNB 5GPRA 1Q86Q 3LKRA 1MCOL 4QT5B 2GJZB 1EPFA 2YBRA 4DGVL 5IJDC 4AZ8A 15C8H 3K5RA 4KRPC 1FE6A 4LKXA 4M5SA 1G4RA 3AE6C 1W8EA 2GJJA 3QZWB 4MTMA 5DQJB 5I1GL 1A02N 1U8KA 3H1KG 3ESPA 4OCRL 3ZDYB 4TVPH 2J6EH 4WU7B 1DBJL 4JZJC 4PJFF 1BGXH 1IAOB 3LIZH 1P84H 1OQXA 4B0MB 4PJGE 4HISA 4O02L 2GC4C 5D93C 2QIWA 2L7JA 2ZCHL 1IGTA 3R8QA 4BWUA 2WXMA 2AJZA 1AYRA 3B83A 1W2EA 2APXA 1KYOD 1UD3A 1SM3H 1TDQA 2HP4A 2YWZA 3C9NA 2YPLB 3MODL 4K7FA 4M9OA 1JK9A 4RX4A 3DO3A 4N5ED 2QADD 2WP3O 5EU4A 1RVFL 4G8GD 4P2QD 1YNTB 4H8VA 1Y0LA 3H9SA 1QFUL 2C4FT 4X99B 2Z4EA 1XCTA 1FZOB 1HIML 1W15A 1F18A 3NAAH 2BNQB 1H89A 4YSPA 1KGJA 4WW2C 1LWUC 4P07A 3P0YL 1CD9B 4PJEB 5GIRB 1DIPA 2OR9H 3NZUA 2WLLB 5AWNH 4W9HC 5D7HA 4HP5A 1S72P 4ZD3L 1RF0A 1FH2A 4FTVA 2OSLA 2X9YA 1JZ6A 5B4MD 3ECQA 1HH0A 2OYIB 4FQ1L 1J0JA 4NUJB 5J1AB 3L4ZA 5EC1B 1SLQA 3RIFK 4LNRA 3M91A 1S7RA 1XSKA 2AQSA 4NI3A 2XZQL 3SDCC 3VXNB 4LOFA 3ZT7A 3CCQP 1SLWA 4LAJH 3HMXL 3FXIC 3RGVD 1S8DB 3G6AB 3HVNA 2AK4B 2NY6B 1P84K 2OSXA 4A04A 4E68A 5AENA 1SF5A 5FDYA 5H35A 5EIIG 3NA4A 1ZIAA 3RI5K 1KCUL 1XEUA 4HOZA 5KSVB 1LGHB 1JO5A 4PJFA 2ZWZA 3I9GH 1HNYA 3IPEA 3O3AA 3O8XD 1WHOA 1OZTG 3EGSB 3OAYK 2X4TB 3AREA 3CZSA 5IT2L 4ZI8A 1XV8A 1XH1A 3QUZD 3VI3B 2OL3H 1MFDH 4QNPF 2Q3AA 3O6FB 4YFDB 1ET5A 1X5IA 3QZPA 3N4XA 2IBZD 3VP8A 1W91A 3BAYA 4N9GA 1ZVSB 1YHQP 2ZXEB 1INEH 2HX7A 1FNSL 1JFQL 1F11A 1ZHNB 4PY7B 2C1OA 1TTUA 4IIQA 4JFPB 2D4FA 3WS3A 5IB3B 4XCCH 4RJTA 1JPST 2BSRB 2Q6QA 5TQ2L 5ITBH 3HB3D 1PJ9A 3QUHA 4QHLB 2MQ3A 1DLHA 3L4VA 3NT0A 3QQ4A 1GL4B 2H2PC 1EGJA 3RWDA 4ADIA 4YSAA 1U8QA 3P0VH 1U36A 4X6EB 4DKEL 5KVEL 3MLWL 3DTUB 3C09C 3HD7A 3A3YB 4DO6A 2FAUA 4HAKA 1EFXD 5HYSG 3MIWA 2D4DA 3O0RL 5ITFA 1GDTA 4NKQB 4DGIH 1U8JA 1F2XK 3FPYA 4B0MM 3FCTA 4ZOAA 2DQDH 4IRSC 4PJ5B 3RK2C 2X3CA 1VDGA 3FQTA 3MTXA 2P5EE 1PGRB 5D1QB 4EPSA 4BHUA 3ETBF 5IB5B 1WFIA 4TSCL 3HJEA 5KJRH 1NFIA 1UXSA 2DW5A 4GAJL 1XGRA 5IKCA 4L75A 1GJIA 4U3XA 3BC9A 4L1LA 4P5KA 5EU3A 1CL7I 3HA0A 1Q2NA 4C7NA 1IC1A 3DX6B 4XPTH 3OKNA 4K23L 5IB2A 4JY6A 3GSRA 3TH2T 3GSNH 4P3DB 3SCMD 2J71A 2W65A 2NW3A 4NP4L 4B9YA 3IU3A 3EDKA 4HS6A 2JJUA 2VXSL 4KHXA 3ZYOA 2F53A 2CSPA 3MRPA 3BH9B 2R4RH 1NTZD 1OM3L 4UDUA 1ZA3A 4JMNA 3UMNA 2JELH 1BG9A 4Q4IA 3RL0C 5JTWA 3BIAX 4WUUB 4D0CB 4XXWC 3DUHA 2IH9A 3AUWB 5JORA 3JV0A 2W5PA 1XT5A 4U1NA 2E75D 3DK0A 3S4SG 3HR5B 3TN0D 4F7MB 3LB6C 3OLDA 3QO0B 4LFHD 1TQCC 3ULVH 1G9NC 3O45B 3DGGA 1RMFH 2VLRA 2WTOA 3PLYA 2ZXQA 4GFTB 5EIQA 4NHCL 3T4AB 5FWQA 4BH8A 3NN8A 3KPEA 1P5UA 2VR6A 1X5KA 1P5VB 4QRTA 1GU4A 1TCRB 1ZAGA 1PX3A 4P2AA 2OARA 1J8HE 5DRZA 1LK3H 2I1JA 3D0AA 3MV9B 2VZ3A 4IMKC 4K3DL 3IDYB 4X98B 1QX1A 3CLEL 5AB0A 4RRPM 4QRQB 2UWJE 1R3JB 2IBZG 2EZ0C 4YHNA 3ZDZE 5I6KA 1HEJC 1K5WA 4G1MB 1PD0A 4NQDD 4IFMA 4LXFA 4X7CC 1BMZA 5IVZA 5JLZA 5B5EE 2O5XL 5FPIA 1NGZB 1ET8A 3RUGE 1S7SA 2BY3A 5L6YH 1EZVY 4ODWA 3T77A 5IHZB 2W0PA 1F4AA 1JCKA 3CZGA 1F8TH 3LRHA 5APYA 1UC6A 3PGCB 2YEZA 4EIJA 4Y5YC 5FUOL 1XB8A 3VI4F 1QEWA 2IV8A 4K71C 4C59B 1KNOB 5F3HA 1KJ3H 1FC2C 1UHVA 2P43B 3O2WL 1R19A 1H19A 5E4EC 4ZNEA 5INCB 4JO1H 3QIUB 2VDKH 1VIWA 1BD2A 1F1AA 1GMJA 4FFWC 5HYIA 2FT6A 3MD0A 1Q72L 1RZFH 3H7LA 2PPEA 4OGQB 1OGSA 4X83A 1HHJA 4DZBA 2MWCA 3WTTA 3ARFC 3L1OH 4XCFL 5FO8A 3WU2H 3VRLE 2CBTA 2PO6C 1IBFA 4Q0XL 4A39A 5FF6A 4ABUA 4QHMA 1RZJH 3AJ7A 3FOMB 4OFKA 2UXVA 1ITBB 4XN7A 3TYFB 4C56A 4YX2L 5LGKA 1MCFA 1BF2A 4F7TA 2FJFA 3W5NA 1UEYA 3RJOA 2YMTA 5C8JB 3QORD 4BUHA 5LGHL 4U6XB 2HCZX 1REIA 4O51B 4V1DD 2IH1B 4ZTPL 2Y25A 3E8UH 4H25B 4YDLB 2EXWC 1NTZG 3TBSA 2BVQA 4PRDB 3MJ7B 1KORA 2HVKA 1F3DJ 2IG2L 3ZDYE 3TVMA 1YCSA 2BFGA 5D1ZB 1UWGL 2XPZA 4WV1C 3ZIYA 1HHIA 3PGDB 3Q8AA 4PJ9A 4R7XA 3HAEB 3VUAA 3C5ZC 3FQWB 3SBQA 4BH7B 4WEMB 5DSCB 2FYUE 3DO4A 1GGUA 3BP5B 4UU9A 2FB4H 5I8EB 5CBEA 4I87A 2GFBA 3EAKA 1RXLA 4HWEH 4PR5B 2X2HA 2EEAA 3NTCH 1JVOA 3UTQA 3RK3C 2YEVB 3VI4A 2YPLE 5CD3A 2QZ5A 4H0LC 3S36H 3GKZA 5F21B 4P4KD 4JN1L 4NBYB 3NFNA 1ZV8A 2D7NA 2VM9A 4DZ8A 2D0HA 1SHWA 2A83A 2OTUB 2H2SD 5BVPL 2IXQB 5FYKE 1X9UA 3OKMB 5K5YA 5T8IA 3ULUE 2PPCA 4HT1L 1NGMB 1JRHH 1S7XB 4PJEE 6TAAA 4G6FB 1NUNB 3OM3B 1KZQA 1UXLA 3KCWA 4G6AC 1UZ6F 4RZCA 1E8XA 1N19A 3C6SB 3K6SB 2QT6A 2OMUB 2XN9A 2XQYK 4U49A 5BV7C 4WU5B 3PREA 3U0PB 1F56A 1ZJAA 4TNFA 1HGVA 2N56A 4OM0L 3PCYA 1QFPA 1KXQE 1WJ3A 4F24A 2OA9A 5L9DL 1N7SA 2WLYA 1RK7A 1GK4A 1A47A 5FYLD 1JOCA 1M6UA 3S37L 4WHYH 1BLIA 1U0QA 1MAKA 2BCKA 2DIBA 2AK4E 2R7EB 4EBQH 4XP6L 3RL0g 4XCEB 3L3JB 5HY9B 1EHAA 2KI6A 3VXPB 1YYLH 2E6PA 4AJYV 3V0EA 3AMKA 4Q6IC 3NTNA 4XXCC 4Z3GA 3HE6D 1SS1A 3WJLA 3MA9H 1F6LL 4JQXA 3QYNA 3VI3E 3ZZLA 5DWUH 5FUZH 3PTZA 4HIHA 5AYUH 2A73B 2WMPA 3L3DB 3WJMA 4UQ3B 1JB0J 4LRNL 1KFNA 2O5YL 4BDVA 3GSQA 2DQEL 4Q7DA 3W5MA 4P9MH 4JGJA 1TVHA 1XEDA 3HNVL 3HW7A 5K59F 35C8H 1DEEA 3N04A 3MFFB 3RKDD 3D09A 1SPDA 3ASWA 4KQ3H 3NIDB 1BDYA 3NXSA 3A67L 3QUYA 4I0PA 5DUBB 4DSYA 1WA0X 3DO7B 5IFAH 3DX4A 4N8VG 5F1OB 1EHKB 1NLBH 2Z93A 2D3JA 3NCFB 4WENB 3QDMD 4Z9KB 4N2LA 3BVUA 4XNZC 3H3BC 4I9XA 2NX5A 3O6MH 4JBZA 1YI2P 1N68A 4HH8A 4HPYL 1HZLA 4ZMQA 2OMBA 2C3GA 4N8PA 1Q1PA 5DK0A 4UM9A 2FYZA 2OM5A 4URTB 3UAJA 3FO0L 3MRJB 5TE7H 5IUSA 4LCCA 2BW5A 5DD6B 4XPFL 3VGEA 1DQJA 5I6OA 5IESL 1SOXA 1YY9D 4R4BB 4HKJB 1JUNA 5D1QE 3Q6FA 5SWZB 5D72L 3HC4H 4IOIH 4LLWB 4AG4L 1GZQA 5KTEL 1U42A 4Y7MA 2AXHA 3QUXB 1NAKH 3L5XH 1CD0A 3FAWA 5E8PB 2JNZA 3PY9A 3RY5A 2IWGA 4HD5A 5DEFA 3K4DA 4IBYA 3UDWC 1WA2X 3D0LB 1YMHA 3OZ9L 4Q9BA 3VFTB 3NJVA 2N1TE 1U58B 3G6JF 4JQIL 4PJ7F 1KIQA 3Q8CA 4FQCH 1ORQB 2WN2A 3DJZA 4GMTL 5B1BB 3L5JA 4JHUA 4DUXA 1MCJA 3FU5A 3ZHKA 1G9NH 3ALXA 5EZOL 3KYMB 3Q44A 4RFNB 3VGDA 4YPGA 4M6OL 1RAMA 3BVNB 5DMGC 3ZE0F 1RUPH 1W0VA 4AKOA 1ZPLA 4LSPH 3AG2B 2I9LA 5KSAD 3CLQA 1FBIH 1AR1D 1YEDB 3I75A 1NU1K 3H1JD 1T20A 2FYNB 2W60A 1MNUL 2CO7B 1EA9C 4GINA 2Q76A 5DMKB 4JFHE 4XNAA 3SEPA 1T2QH 3GSWA 3BDXA 3KXDA 4RO0A 2XWTA 4YEEA 4PRHB 5EBLA 4AK2A 2QGEA 5DHVA 4OZFB 2B20A 1A7NH 2DWDB 4NS0A 4YHOL 3KZ8A 2JJSA 5D7IA 3VWKB 1XAKA 1MCLA 4IFDK 1XGQA 4D8PB 4Y2DB 4X6DF 2KIKA 4PW9A 2IDTA 3EO9L 2OYKA 4Y2NA 4MZRA 2H3XC 4GS7C 4I2XE 2XA8H 4NQCA 2HXAA 2O72A 2WSDA 1LO2L 2PR4H 1AJYA 32C2A 3HE7A 5HSFA 1XL4A 3DPBB 4ELDA 3MJ9L 3NCEB 5IIEA 3Q6GH 1D7BA 5TGBB 1OP3K 3VH8A 5DD1H 4Q89A 3JTBA 3VYNA 3X3GH 3JV6B 5B3JE 3M46A 4BK5C 4JY5L 4OCXL 3G6JA 3B56A 4BZ2A 3L37A 1FDOA 4PJ7A 1P84D 1PX8A 3DI3B 4KKBD 3EZ8A 5CZVL 1IFMA 4GW1A 1NC4B 4ZO8A 3OJAB 4E41D 3UEQA 3GHGA 1DO5A 2XLLA 5EUOB 4RAHA 1MHHB 3US0A 4FQXD 1U8OB 1K8AQ 1O7DC 4PPTA 3LV3B 5C08B 3F64A 1QUNB 1PL3A 1IVTA 5E79H 2H89C 1YQVL 3FRUB 4P5MA 3AE4C 2FJHA 1FZKB 4WO4A 4M48H 6CGTA 3N91A 1OWRM 2GTZB 5MP6H 1T7ZA 4AT6B 4YFLF 1YVLA 1MW1A 3MYZA 3QXTA 1AE6L 4CVWA 1BFOA 5E5MB 3VVVA 1P9MC 5DQDH 2EO7A 1EXJA 3CFKA 4DEWA 5I24A 1HAUA 1DDHB 4PD4H 1HSAB 2IFNA 2VB5A 5DJAB 2ICWA 3IN0A 3WFZA 2HAZA 1EXIA 1GOFA 1VQ6P 1WV7T 3ATAA 2YD0A 3FB6B 4OAWB 2E76D 2Z3FA 3OKDA 4QRSB 5CUSL 2QG4A 2E43A 3EYOA 5DI8A 5INDA 4ELMB 4YDIH 4JG0H 2B15A 3JSVC 3T8XA 5FCSH 4Z7IA 4M7ZB 1IILE 2QJKC 2KZ1B 2V9QA 4GO8A 2WUBH 4B9CA 4MCZA 1WCBB 1JNJA 1KB9J 2Y36L 3EOTL 5DJYB 4BFNA 2AI0H 5JPMB 1T4WA 3OQ3B 4GKNA 3D87B 2EIEA 4RNRA 4ISVB 1TJHL 3MBXL 3BKYH 4QRRD 3QDJE 2X88A 1F4WH 3UYOD 3T6VA 1F1DA 2WBKA 2V8MA 4GP4B 3TGXA 1JGLL 4Z7VF 3S3DB 2R1XB 3D25A 2XYBA 4LASH 4M9PA 1SFCA 1A2YA 1FGNL 4RDQF 4RLDA 2HFFB 3BZ5A 4HK3J 5JMRA 3VFGH 4OT1H 2F7OA 1IBHA 4P3CH 1KDIA 4J4PA 2XPGB 3F65A 4E9VA 5E2WH 1DLFH 1A1NB 4MZ3A 5C09A 3KNBB 1DBKH 3FSVA 4QIRA 4ONFL 3SWFA 1WF5A 4O5LH 5BV7H 4U0RC 1NCBL 1JHKL 2ZXWB 4IL6E 3U36B 4RAUB 2HX9A 2CK0L 2CHWA 4X5XA 4PTTA 3B3IA 1GKEA 2IH8A 4XMZA 3LN5B 5TF1H 4AKQA 4YGAB 2Y5QA 1V3MA 2WUCH 2P7TB 1GS8A 2XPYA 3HC3L 5C6PB 3BPNC 3TCLA 2F8XC 1SMAA 3QUMA 1URQA 3EF4A 5DQ9B 4PVBA 3FN0L 2MFNA 3WO4B 4PJHF 4D9LH 1WAAF 1CN4A 2ZKHH 3QCVL 3LNIA 1YRKA 5AOKA 5EH1A 4WJ5B 5I66B 1NWOA 3I02B 2EIMB 4K8RC 4X0KA 3PRZA 5I1CH 2HFGL 5HJBA 4YUEL 1JGVH 1LLAA 1FFPB 2QVFB 3W3BA 2VDQH 3Q5PA 4P04A 3SDAA 3WKQA 5AAWC 3UJJL 5EO9A 5IVXB 1QRND 3ETBJ 1YYCA 1W2KT 2APWA 2E9WA 3QAQA 3S97C 1D2PA 3G5VB 4LPVA 2HG0A 3MCYA 4ZNCD 4V2CB 3RPKA 3EHBB 1E4WH 1X5JA 3QEGL 4YGVB 2QJYB 4R2GC 4AYGA 1UG9A 1CI5A 3SJVB 1AKJA 4LIQH 4RQQB 2YGVA 3H8NA 4H8WC 4HZAA 4Z7VA 2EDFA 5F44A 3ZGHA 3WNKA 2ZXCA 1JF1B 1KIUB 4AL8L 1G87A 2XWRA 3NG5A 4FQJL 2KPWA 4XNUH 1C5DB 4LHJB 4M3KB 3W82A 1JRHI 5AW8B 1BVLB 1J8RA 5CSZB 5IWLA 3QPKA 2JJTA 3H2WA 4NO5B 1BYNA 1I1FB 5K9JH 4XPHH 1NAMB 4BFIA 1BEXA 5LAXA 1TTCA 1WRFA 2NY1C 5CEYB 5TPWH 4Q2ZA 5ICUA 2R8SL 3MLXL 3S3SA 2NOYA 3CPLB 1T2KC 2HVBA 3KJ6H 3P8MC 1X5GA 4YWGL 4W1TA 3IF4A 1SY6A 2I60H 4I3SH 5CFHA 1WUNT 2QGCA 4OF5A 1M3IA 4P4RB 4P23D 2DJSA 2E8ZA 4MB5A 4WJKB 5SWZE 2DLFH 4W7YA 3KH4A 1H8SA 5D7JA 3FUJA 5F7FA 1CZQA 4HWBA 5DK2B 1NDTA 5IROD 5GRZA 1SJEB 3IYLW 4HFUH 4NC1C 1CFNA 3B8SA 4A7GF 3JSSA 4D9QD 3SDXF 1KIRA 2ATKA 3WNPA 1J9TA 4F7CB 2C7UB 4FTVE 2IFGA 1K8DB 1WGOA 2HWZL 2ZONA 1IT9H 1AG0A 4JB9H 2X1OA 1OW0C 4KK6D 5I76B 1CGYA 1YZZA 3VE0A 2YMKA 1Q8MA 2WWKT 3ATDA 5DD3L 3GUFA 3LY6A 7FABH 5DC0A 4HFWA 2UZIH 3DVIA 5T3XD 1LJMA 3B8YA 4TKWA 2NTFB 3KHUA 1X22A 2YUVA 2LR4A 4KUZL 2NNRA 4H8PA 2NY0B 1OTSD 1L4AC 2A1WH 2Q0ZX 3FO1A 4G8AC 1MCCA 4YDJB 4TQEH 5GGUB 2FBWC 3FFCD 2NPSD 1G1OA 1OPOA 4JAMA 5F7KC 4ZUTB 5ABAA 4MJ6A 1MPAH 2P5WA 3TPUB 5BQ7A 1OP9A 1WBZB 2J25A 4K9EL 5JYMA 2F18A 4XBPB 2YKLH 5F1KC 4AQRD 1Z1WA 5AVYB 1DO6A 2B4CC 2M26A 4JM2F 4PY8I 3OLGA 3WD5H 4U0QB 5IBTH 1LNUA 2YMXL 4DN3H 4PRHE 2QM8A 1D9KD 5HYJB 2Q8BH 3K80A 3TO4D 5H37H 3BPOC 3WSQL 1TZOA 1JYWA 4G80A 2WKLA 2K6WA 3Q05A 1C9SA 2BNRB 5GZNA 3T2PA 1R3LB 1INQA 2NY3D 1Q0YH 5D1XD 1SVZA 4DF9A 1QQDA 1YAZA 1M1JB 3EYFA 4OCMC 1S9YB 1HJCA 3DJ9A 1M7DB 2Q7NA 3PV6A 3HPLA 4EIUA 1EXUA 2A38A 3VQLA 1RUMH 2JI2A 1XWVA 2R1YB 4R97C 4FYQA 2V3EA 4EOWH 3RWHB 2FY8A 2IEPA 3WHXA 4A7GA 3SDXA 1QFOA 2CJSA 2OBGA 3QIBD 1I1AA 2JWAA 1ERNA 4S1DC 5C9KA 3ZDZF 3IT8D 4PBDA 3L1FA 5E8EA 4A7SA 4C4UA 4EKJA 3IR9A 1E28A 4MX7B 3BLKA 3GMQB 1YEKH 5AOIA 4HPHA 3IFMA 3HMWL 2W81C 1HDMA 3MRBA 3QFDA 3BZFA 3S35X 4MA8H 5EUOE 2KS1A 4Y4HB 5E4IA 5HHVH 1RQVA 2AFNA 1YEEH 3E2HB 3H2PA 4HJIA 5C08E 1MIML 4C55A 4IDJL 4KK5D 4F7PB 3OKKA 4Z5RA 1JCVA 4GKGA 5BW7A 4FJZA 3X12A 1N5AB 2BSCA 2A45G 1OAKH 3WIFA 3N06B 4KKPA 4YHLH 4CADB 3L3HB 1I1YB 3CXHE 2PP7A 4QHUA 4Q4EA 1N6QH 1AMXA 1EJ6A 2PP8A 2X6UA 4E5XB 3VM7A 3FRPA 1ED3A 3QC6X 4EKXA 1PKOA 2BVUA 5I19H 1JPTL 1VFAB 4JM2A 4OTXL 1Q1JH 3KLHD 1N64L 4PQXA 4J3OC 3REVB 1WHPA 4JGMA 1K5NB 4XGZB 4ELME 1S5HB 2XI9A 5GJSL 5BZDA 2DBLL 1O6SB 4BXVA 1MRFL 5DHYB 1OGAB 1Q0XH 1S7WB 1T5WA 1D5ZB 2V17L 3QIWB 4JDTH 3GJFB 1KD1Q 3HRZA 1IZNB 2ZSVA 2C9PA 2J44A 2IOMA 4H26A 1ZLLA 1KC8Q 1KOAA 4EI5B 5TQ0L 2W0FB 3WHE1 3F7YB 4EDWL 1B88A 1HH6B 2VDNH 2YQGA 4MD5A 4OQTL 2IZ1A 2F68X 2EDXA 5KVGE 3GSXB 4KXCA 4Y1AD 3BKCL 1T1ZB 3MDJA 3GI9L 1XF1A 3NZ8B 2BP5M 1RHZB 3KDPB 4JDEA 3V6FB 2CNYA 4OZIE 3AE9C 2OTPA 4C58B 5D5MA 1SN5A 1HAWA 3OGOE 3UZQB 3KL3A 1PGQA 1IGYB 1FNAA 5B7EA 1M57B 4XN9A 2HFEA 4ZPTB 5ESAA 1CR9H 4YSDA 1NPNA 5DZ9A 4NZTH 3FHAA 4XHJC 4CNIB 1G4MA 3MHZA 2RN0A 1ET7A 4CMHB 2W9EH 1CIUA 1KJMB 4U7KA 3L73D 5I82A 1NCWH 3Q1SH 1W6LA 1URIA 5E5LA 1AXTH 2WSEJ 1X9QA 4WWOA 4NAJA 4J6RH 2CG9X 3X13B 1JG9A 2N7SA 3C6LD 3IMBA 4ELKB 1Z2KA 4L3EA 2FX9H 4N2NA 4PD4I 2Y69B 4WSJA 1E9PA 4K8RH 3CC5B 4Y0GA 5DO2C 3C8VA 1ZLDA 5J57B 1GZPA 2WQWA 3EG9A 1NMBL 2KMWA 4L3FA 1CLCA 4NO3B 5A2AA 3VVWA 4A6YA 4HU2A 1RJZB 3PHAA 4FDWA 1R24A 1AA0A 1UWXH 3LKNA 4PS8A 3INUH 1NU1D 2OYHA 3BXNA 1TKWA 1G0XA 3O41B 3ZR6A 5KSUA 4I1LA 1ZHKB 2Q20A 4NNXA 2HTKC 2YKQA 5BS0B 3S96A 4ERSH 1DVYA 5IVXE 3ISWA 3EGDB 4QMAA 1Y18B 4KUCD 4KITB 3CZEA 3MMEB 1KB9K 3L4TA 3CCSP 2V2XA 4KNQA 1GGCL 4H8WH 5CD5D 1FZJA 2Z91B 3G5WA 1GAFL 3FQ4A 3HFMH 3IDNA 2JIXA 3SJVE 1F6FB 2GJZA 3VFSB 1ZVHA 2WZ7A 2H43A 3WE6B 3ZT6A 2BOBB 3CHXA 3LMJL 3WEAA 3CVDA 1NVOA 2PCFB 3IVKB 2LT9A 2IQAB 3RTLA 4HCRL 1IC2A 1YUHB 3E9TA 3LKOA 2VZOA 3D4GA 5K9KB 3O3EA 4WU7A 4YSUA 2HA1A 4OZHA 4KPHL 3VYIA 2APVA 3KPMB 1C16B 1J0IA 4LLQA 4IGBA 1F41A 3U2JA 1FUNA 1M1XB 3GZOA 4JHZA 3SPIA 2X4SB 1XTGB 1T22B 1AGDB 4KI5D 2ITDB 5KANG 5IMMB 2EKJA 1KN4H 2H6PB 1BJ1J 1NCDH 5F1NA 5CCHD 2W95A 1T1YB 2JWDA 2P47B 1EMTH 4O02A 5IF0B 2DWTA 3MSPA 5HGBB 3QNFA 3SKJH 2PTTB 3UTSD 5EDSA 1KJ2H 4FKEA 3ABVC 1MFAL 1XGPB 4HJ0C 4PJIF 2AXFA 1KCRH 3FU0A 4M5TA 1UA6L 1DQQB 3LKSB 3MBED 1UWXK 3MUZ1 4LLYA 4UB0L 2BNQA 2XWJB 1R5IA 2ICWJ 2K4AA 4AZUA 3T0EC 4N6RB 4BUQA 2MPAH 3CN4A 2J4WH 4R8WH 5MEPA 2EZ0D 4NN6C 4PRNA 3NACH 4KZDL 1PEZA 4MZ2A 5SWSB 4NI6A 3V95A 1LT9C 2ADGA 4WAFA 3KHOA 1X5HA 3L73G 3VU1A 1J1EB 5D70H 2FBJL 4HMCA 5EC1A 3RDJA 4MXWH 1HWTC 1JK8A 2VSCA 2L8AA 3BCCJ 2WXKA 4Z3HA 2I32A 4XH2A 2C9LY 3CFUA 3BN9D 4OQ1A 5F0LB 4ASVA 4JS7A 3BQUA 4JYBA 2W88A 4GKSB 3P3TA 3KW7A 2EH7H 3V8CA 3V4VB 2C1PB 4UB6H 4WEEA 2FR4A 1A7OL 1BIIA 1RK0A 3L1EA 1TU2A 1R1CA 2B4CH 4HETA 3KPRA 4JJHA 1NU1G 4NUGH 3EJTA 2AMGA 1JWUB 4KJYB 1YEJL 1T7XA 2JR8A 5BPPA 3H85A 1MFTA 2DQHL 4YSCA 2F58H 5IR1A 3S1KA 1ZVSA 2J21A 3MAWA 2EYRA 2WVVB 3KXFB 3QEHB 1KG0A 1ZHNA 3X2QB 2HKFL 3FO9B 3H7BA 1OVZA 1OQOA 3NIGB 4PJIA 4PWIA 4Z0XA 5IB3A 5EOQL 3BJLA 4PEEA 2FQDA 4J7RA 1MVUB 2XNAB 1KTDB 3VCLA 2WLZA 5TD4A 1EAOA 4GT7A 5IM7A 2HX8A 3MHVA 3VDAA 1A0QL 2VITA 5HBBA 1CDBA 3OB0K 2F2HA 4TSBL 3C5JA 5LAPA 1CICA 2IDQA 1SDDA 5APXA 1U2YA 5IK3B 4OJCA 2B87A 4NNPL 3NBNA 3N43F 5CEZE 1KBGL 3VXRD 4Z7WB 4APQD 3KPNB 4AM0B 3IETA 1CK0L 1SQPE 4MAYC 4TLKA 3ABGA 4GKOA 2WPSA 4PJ5A 2J8UA 4FA6A 2FX8H 2TSAA 1ACYH 1ASOA 3N1GC 1QBML 1S5LH 4GW4B 2XU6A 3GHEL 2ESVA 3R4RA 3J2PA 3ALWA 2B5IB 3CC7P 2HB0A 2UUDH 5HDQH 3ZU8A 4EJ1C 2VR4A 2VSKB 4WGKA 3DX6A 5GS1A 1BZ7A 3AS3A 4EUPH 1CLYL 5L4JA 3C60B 2OS7A 4NPEA 2OR7A 1X5FA 2NUPA 3P2BA 1TR7A 3NJGA 5DURD 4YSEA 3WFEH 3FT0A 4J3OH 1NCCH 1UH2A 1NAFA 2WXRA 3BH9A 3MV7B 3ROOB 5KYWA 1UT2A 3QI9C 4XNQB 2ZD0A 1EANA 1JMXA 4GQZA 1UWEH 3PFUA 3V9EA 5JR1L 4X7TB 1ZTXL 4D0CA 1W0WA 2V9TA 5F6HI 3TEYA 3ECBB 4ZXBB 2HR3A 4X5QA 1UIXA 1BX2A 3AXLB 1MCRA 2ZZUT 1U57A 5F0MB 2GPZA 4KTEL 3O9WD 3RWFB 2LW3A 3T5WA 4JYCA 2YIUB 4YAQB 2Q6WB 5F93C 5KSBA 4UQ9A 5I1EH 1UKSA 1ODUA 3CHRA 3RBXA 4HKXB 5F2FA 5FK9B 3SKOA 3T4AA 4BZ1A 5HHQA 3BZEA 4HUVA 1B2WL 1E3ZA 4G7QB 2K78A 3OGCB 4RMVA 4OCWH 2ODHA 4LRIA 4CPGA 4BGLA 4B7LA 4YSRA 3MV9A 1MW2A 1D7CA 2V5YA 1J88A 4AIXA 5HI3C 4X98A 3ABMB 4IKJA 2DBJA 5E95B 2XOTA 3BISA 1KILC 1KN2L 4F2MA 4QHPA 3E80A 2UUDK 4NPYA 2WVRA 5J11B 3P3UA 1BCIA 1YPZB 4KZCA 2FT8A 3PWLB 3X1BA 1A7QL 1QR1B 2AF2A 4HLZH 1J18A 3TJHD 3PU7A 1U6AH 3DRTB 3SB3A 5A2FA 4E0RB 2Z4QB 5GISL 1GR7A 1LTTC 3D39E 2EDTA 3VXUB 2ALWA 3JWNH 4L8SB 3PABB 2UY6B 2J72A 2Y7NA 3F7RA 4KOBA 3P30L 3X1NA 2C4FU 2P52A 3L3IB 5DGQA 4YE4L 1UB6B 1QFWH 2Z31C 3CD4A 1MRCH 1NDMA 2Y07L 5INCA 3ZDXE 2OAAA 1WT5A 2FTAA 4FFZL 5CP3H 5EZJA 2B9BA 2QPEB 1ZPUA 1D5RA 1UJ3B 1EXGA 4NJAH 4L3CA 1KYOI 3QULB 5BOPA 1YDPB 2ZWNA 4LVOB 4Y9EA 5JUEL 2D03H 1JZJA 1W0YT 3PAZA 2WXOA 5C7ZA 1RURH 2WQRA 3K8LA 4IIZA 2XHNA 3UJIH 5T3ZL 1T89C 3EJCA 3NSJA 4IKNA 1FFNB 4TTDD 5BS0E 4LCWE 5GS2D 5IB1A 1RE3A 4HUWB 4LAQH 2YIHA 3NRPA 1L9OA 2PFXA 3MV8A 4IBVA 5ILTH 5DZNA 2B2XH 3KZIE 1C5CL 3KWXA 2ZX9A 2JMRA 3M17B 3U79A 4NQUA 3BGMB 3VD3A 3N0AA 1AJ7L 4J12A 1U41A 4I18A 3LKPB 4TUJB 3RTQB 3CLFH 4CKQA 3ZOAA 5CP7B 1A4AA 3SIKA 2HMIC 3ARXA 4HOMA 4JHWL 2PW1A 2CMRL 4KK9D 3FTGB 1AQKL 1JPGA 4NRZB 5DJ8B 4Q74A 2JV6A 1GW4A 1F3JB 4ZAKA 5KZCD 3Q8BA 3ULSB 4AQ1A 3NYKA 3QEQB 4NO2B 4OIFA 4G43A 1QLRA 4YXWH 1DJGA 3QISA 4IQHA 3WY3A 4L4VD 5E9DA 1PCXA 3FUNA 4Y4FA 1XIWC 3A0OA 3MRDB 3UYPA 2OYMA 3P9LB 5ECJE 1QTPA 1W72A 1H8OA 4QXTB 3RIKA 2VXUH 3Q48A 3CVIH 3OD3A 4J27A 3N85H 1CFTA 2Q2EB 2X6CA 4P3WA 1DSWA 4WUKH 5KBPA 3RIAF 4H13D 3B8EB 3NIDF 4RX4D 3L4FA 3HG1A 3I50H 3B2MA 2F19H 1EDKA 1HF9A 2AK1L 3H9SD 1EJ8A 2GAZB 2O6EA 3F89A 3QZOA 4FNLH 1CVSC 1DANT 4WWNA 3T9WA 3K6SA 3S3BB 3OKEA 5SWSE 3H2QA 1TZIB 4RIRA 1JV5A 3GRBA 5BXFA 2AZAA 3ZZQA 4BRYA 1OAUL 3O81A 3NCWA 4NDMA 5DC2A 3LS5L 5L2KA 3GXMA 1FIGH 1MCQA 1H15B 5E6SB 3QPXL 1G7MA 1CDGA 5B3NA 4OLVL 1NAYA 4JUSA 2PXYC 1B4TA 3IDXH 5E1HB 5B39G 5EZLA 2RMZA 4UV4H 4BELD 2HT3D 4HIQA 4PRPA 4KKQA 4UAHA 4YLCA 5T1KB 1USDA 4ZYKB 3MLPA 1CLOL 4PB0L 2Y6SD 3HZMA 5IEHA 3DBXB 4K5OA 2K7PA 3VFUA 1YYMH 5HD8D 4UM8B 3MRFB 1RP9A 4N90D 3JT0A 1KPRB 3W0WB 2FWOB 2X05A 3HBPA 3QUGA 1SBBA 5LKNA 3ARGD 3GINA 5CJQH 2C3VA 1A9EB 4JG5A 5ETUB 1SF3A 2AKRB 1ZT4A 3ARED 4FMFA 4MNHA 2R32A 1K3ZA 3LQAC 3KXFE 1GY1A 2BNUA 4NRYA 3ZT5A 5E08L 2IQ9H 3RAJH 1JV2B 1QW9A 1S78C 4MA1B 3MRKA 3TZVC 4CN4A 1X3DA 5CGYD 4FP8L 4MD4B 4P2CG 4N78D 3FB5B 3ZYZA 4M61B 1J48A 1KLGA 5LWYH 5HHOB 5GGTH 1KBVA 1KIPB 2HH0L 1WS8A 2FEDD 4LSTL 3DO7A 3L95B 5FYJD 5APVA 4YXKH 4GPVA 1CDHA 2R29H 1NIBA 4F8QA 2P58A 2ZOOA 4AYDC 2FATH 3G71P 3KVDD 1MFZA 1KTCA 3U46A 2IOIA 4Z7WE 3ROLA 2GUSA 4I2LC 5TK2A 1QASA 4AENB 2GTWB 2MJWA 1GSMA 3U6RB 1NQBA 1FLRL 4GLRH 1BQLL 1ND0A 3HD7D 3BP4A 4NSKB 2FBOJ 2XZZA 4LKCA 5B7MA 1XF5A 2J1KA 4L8BB 4NAQA 3IMRA 1VFBB 3D3VD 3GM0A 2VR9A 4WW1B 3X1EA 3ZLQC 1OHQA 2XX0A 3FO2B 1IC4H 4FXGA 3ECVA 4UV7L 5HP5A 2WSFJ 2YMOA 4XP1L 1CI6B 3MJGX 3HE4B 5EWIH 5HHXL 3CXFA 2EDNA 1KB9D 3H1HE 5EMYA 5D6CA 3ZE2B 3HUJE 3NSYA 5KYXA 2DIEA 1EEZB 1OE2A 3PPEA 4NKIH 3SWKA 3W11C 3D0LA 4AVIA 3VFTA 1KV4A 1NTKE 5D7SH 5F3BB 1EWHA 3GMMB 5I6XB 3MOBL 4MLSA 1UT1A 1ORQA 3VA6A 1SXAA 4MCMA 3K71B 3KHQA 1VPOH 3U9UA 3K7UA 1TJGH 3B9KA 5LCVL 1LD9A 3N1QC 3P77A 5F89A 1FPTL 1JTHA 1K85A 2QMKA 3BLPX 4WY4D 1LO0H 1WBXA 2WJ5A 1JFHA 2XQBL 1EO7A 1ZTXE 2Q86A 3BUYB 4J28A 3MGTA 1J5DA 5C0GA 4EZLA 1S3KH 3LH2H 3QJUB 2DLIA 4OH2A 1AGFA 4MCYB 3WXWH 2DQUH 1NIDA 4KMTH 3VW3H 3I6SA 4LCUB 2A74A 4FX5A 3T3PF 1B4JH 2P5WE 1G2CA 2CDGB 3GHPA 5APWA 5JIDA 4LCYA 2VLRD 1CUOA 3WUWB 3RU8H 4FQQA 3DVGA 3VXME 1Y9BA 3WEMA 3VGGA 3BVXA 4GIFA 2QTEA 1KBBA 3E1ZA 4PG9A 3U7YL 3UZVB 5J6SA 1IGCH 4NLAA 4WI7A 4BCYA 3VB8A 5CJ4A 3ULUC 3OX8B 2ZG3A 2WT7A 5CCGA 3WAKA 2F7RA 1AD0B 5F6IB 3TNNB 5JOFA 4KVCH 2P8LB 4TLUA 4BXSV 3IXAA 2VDML 2VXQA 3QWRD 1OLLA 3DPBA 3L74E 3CFBB 4HC1L 5AVTB 1NGPH 3CDGB 5TGBA 1LP1B 1H3WM 2B1HH 4MJ5B 1ASPA 3MO1B 5E6IB 2DQ6A 4PUBL 4LGPB 1E3XA 5AW5B 2VDMB 2E86A 3FOLB 3MJ9A 5FDWB 4JJ5A 5EO0A 3HUSA 5DVKA 2CBPA 2D7QA 3OTTA 3LN4B 4GG6B 3OAZK 4UBDC 4GUPB 4QO1B 2G3AA 1NKZB 5L8LB 3W39B 4GAFB 5H2BB 2MKWA 4FNQA 4M6NH 3PUCA 3NJHA 3AG3B 1ECYA 4KFMA 2OP4H 4EEEA 2JSFA 2WO3B 4HUUB 1FGVH 2XV5A 1E5YA 2ATPA 3LRMA 1Q9KB 3WHE0 3AWFA 4KY2A 2EKSB 4JFZL 7PAZA 1I3GH 4UCFA 3ECWA 1Z5YD 4UT6A 1SQVE 3IFOB 3MLYL 1MY5A 3IBOA 1OAJA 2XZAL 3WTVA 3B5NA 4ICXA 5C0BB 2VERA 1LE9A 1T7WA 2CDEA 1FAKT 2NZ1A 2C9UA 5I73B 4E9RA 4X8JB 2VE6B 1FO0L 2XV2A 4J3XA 3RNKB 3GPEA 5KLIB 1IFRA 3D50A 4NM8L 3QEQE 5A2IH 5HHNA 4DKTA 3VMZA 5KLVE 4GSDH 5L2JB 4FYSA 3P4MA 5LDSA 1GPOL 1SBSH 1HKLH 2BRQA 2JK5B 2PPFA 3R0NA 4GI6A 4PJ9D 4U33A 1HOCA 4H44D 1J05B 1FO0B 3ZSTA 2EXSA 1MKFA 3FWNA 3C5SA 4RMRA 2EIDA 3JUYA 4K4KA 4PLJC 4DK3A 4PH8A 3V7AG 1RIHH 3IFNH 4UTAA 1KLUA 5D1QC 1VKXB 5D5ME 2O61A 4ZG1A 4JPKL 4M7JH 2XUWA 1MCWW 5KOMC 4GUQA 1JXDA 5HVHC 1A1NA 2HPCB 3AGVA 1VFOA 3LPOA 2AVGA 5HHMD 5EBWA 3WTSA 3T0BA 4ORGB 1AQ5A 1IGFH 3UEZA 5L88H 3AAZA 3FONB 2N1TC 4XN2A 4YL4A 5BV7L 3DHJA 3PWPA 1FFOB 2VLJD 5E1GA 2WGXA 1FZCC 3JCUE 2BRRL 3ZTJG 3CCEP 1QWNA 1XQ4A 4IM8A 1JZFA 1QSVA 3CUPB 4UB8E 3TA3B 1HOEA 3QQXA 4MMXC 2XN9D 2LU3A 1G94A 2HRPL 2OMWB 1X7SA 4JRLA 1CWVA 3ZN6A 4DKDC 1AMYA 1MG3C 5CEXB 1N7SD 4ODUA 4XN5A 5AW9B 5AYTA 1QL1A 3VWJC 1P1ZA 3WTYA 4S11A 4A2EA 3W0WE 2KLRA 2DMGA 1T0OA 5I5JA 2HRHA 2WCPA 4IK6A 2PETA 4MJHA 1CBVL 1N3NA 2V7QJ 3UIYA 3LQAH 2RAMA 3L7FB 1XX9C 5KN5B 3JWOC 2JCWA 4NEHB 4WEUD 4ANUA 2BX5A 4PRAA 3BEVB 3J27A 4K15A 3K5BA 3IDYC 3QNZA 5EC2B 4Z3JA 1T7VA 5B5EH 1U8HA 2RBLA 4G3YH 2IV9A 4DFIA 2YLHA 3T71A 2PYEE 1JF1A 3ZE1B 1HEZB 2NDFA 3PP4L 2HODB 4Z0BL 3HS0A 3GNMH 1C5DA 2WXQA 2O01H 4I5BB 4AQEA 2WBJC 1HYSC 2X6MA 5CSZA 1XCWA 2ADIB 4OZHE 1OB1A 2E7BA 5C0JB 5HHOE 3WL9B 5C39A 3RWGB 1T4KA 1S3JA 2QELA 4Y4KA 3RFRA 3F00A 4IU2B 3N9GH 4DPAX 3S9DB 2DQTL 3B7SA 2V5SA 4ZS7H 3U2SA 4PRIB 3LZRA 3QUYD 4FKHA 2GC7C 4I0PD 4I7ZC 3LHAA 1AKPA 4QEGA 1S9WB 1SOKA 1PGPA 2ZUYA 1UWFA 3JWDC 4OV5A 2OFQA 3SD5A 2AQ1A 4I9WE 4WKXA 3GSVB 1QNIA 3QIUC 1S9VB 2QQQA 1A7PH 5KBDA 3BD5A 3ARBB 2YAMA 2WYIA 5I1IH 5ISZA 3U4BL 4OZGB 2NXZD 3NCJH 4N4YB 1A9BB 3LRGA 1ONQB 2GSGA 1HZHH 4MQ7B 4IBQA 2B88A 4XVSH 4DVRL 4OD3H 4OIIH 3HPJB 4Q97A 1FV1A 4CSSA 1QOKA 2KB7P 3B9DA 4HBCL 4X6BB 3GZPA 3VACA 1CGVA 4M93C 3EGXA 1KPVA 3HCVB 4HK3N 4YLQT 5T33L 5E8DH 3L70E 5APQA 2GK0B 3U4EA 1H3PH 3ATFA 4KKZA 1OF2A 5IJCC 4YDLC 4AQZA 1MCOH 1OAXL 1N86A 4FA8A 1QLEH 4LVNB 4HZLB 1S9KE 1DR9A 1HQ4A 5KYYB 2MNJB 5F96L 1QSFA 4XHQA 3QVAA 5C0EA 3WDHA 1JPEA 1X5MA 5D1ZC 4IRJD 3F7VB 4OCRH 1XBRA 3PDGA 3QJVB 4FNUA 3P11L 4KNTA 1WWWX 1OSYA 2VLKE 1P4UA 3ILDA 2QQKL 1PIGA 4YDJA 4ZMDA 5JOPD 1HKFA 1NUDA 1OWAA 2GVYA 2GI7A 4G6KH 4MRBA 4LSQH 2XKSA 2F6AA 4N0CD 4Y16C 3RPIA 3WN5B 2QEXP 1A6UL 2ZCHH 4B50A 1NFDB 4FHKA 2XCMC 4ONHB 3RWJA 4TVPL 1K4CB 2B0SH 2BVTA 3PL6A 4UMSA 3U6RA 1BGXL 5I30H 2O6FA 3N6YA 2HTKD 3LIZL 3UZEC 5IHZA 3W38A 3AABA 5FYKH 4XAKD 1DVUA 1OEZW 3ULUH 1DD4A 1RE4C 5CGBA 1K2DB 1MDAA 1P1VA 2WZPA 5D2NB 4DJGA 4PIRF 4AYSA 1RD6A 3TT3L 1QFUH 3O4LB 4LOVA 4ZUWB 3R4DA 2ZT9D 1HIMH 2VABB 1JNHB 2BM3A 3D34A 1RZ8A 2VYRE 4PLKD 4PJ6A 4YZWA 4D0BB 3U30B 2AABH 4YXLH 1ACCA 3BGAA 2NXYB 3UGXA 1WWAX 1OXYA 2M3BA 2WTRB 3AE8C 4FXTA 2ZF9A 5C07B 3P3RA 1J9RA 4HCFA 4ZD3H 2DYPD 3EYQD 3HNTH 4NZ8A 4GUOA 1W16A 2XTJD 1QGKB 1DEEG 4EDFA 4KT0J 2Y7QB 1MAJA 4FNTA 4FQ1H 3QDGD 1G7IB 1B0RA 2YXQB 3HE7D 1OF0A 1IAIM 4DERA 5LNDA 2OR9L 1KJVA 3GLEA 5AWNL 2FYUK 2L7UA 2AXJA 2J8UE 5GTHH 1D5MB 3B9AA 3HMXH 3WNIA 4ZZKA 1R4XA 1S7TB 5AUMA 4J3VA 1UB5A 4RBPH 1BVNT 4GG6E 1H3GA 3AMLA 1OT4A 1AZZC 2RHEA 4F7PA 2G0KA 3G3LA 3VFVB 1KCUH 4CW1B 5H94A 2W8CA 2WWMC 1N5AA 2YD8A 3SPVA 1ZT1B 4KROD 1QZ1A 1ZGLB 1LILA 4GRLB 4CADA 2OJ1A 4PCYA 1KCLA 4WO4D 3SODB 1DBMH 3T0ED 1JCCA 3QQDB 3SYQA 1NBVL 5MEQB 5FIEA 1MFVA 2FRGP 2O6PA 4N85A 1XL6A 2WB1A 2IBZX 4HUKB 4DT0A 1NM9A 3VTMA 4B9KC 3ZL2A 1U3HA 1JFQH 4JL2A 4U3HA 2XFGB 2OL3L 4HEMA 3LAFA 4DN4H 4YSQA 3QQ9C 4L9LB 5C0BE 4CGTA 3A2AA 1D5IH 3W9EB 3SBRA 2ZOKB 3DXAA 2K8MA 1PKQE 5KSBE 3ATBA 3JWNG 2JTYA 1Q94A 3F7YA 2DV6A 2Y0CA 4DKEH 3VYOA 4YDZA 3OBAA 4XCCL 4O2EA 5K9QG 1E5UI 2HJFA 5IFJB 1AZNA 3O6QB 1S9XA 1L5GB 2DIAA 2BOLA 1BECA 2F74B 2LU4A 1KQGB 1DVXA 3WY1A 1DEDA 1RK1B 1E9QA 1XF4B 3M1BA 3DX9B 3P0VL 2UZYB 3VXQB 2A06E 1AHWA 1LO5B 2QR0B 5DZLA 2A9BA 1YITP 1NDGB 1OGTA 1PFCA 2F8OA 4KK8C 5J3HD 2ZNXA 4ZPTA 4JKLA 3TBVB 4K94C 4MAZA 1NJ9A 3QUXC 1XGUB 2IGTA 1KTMA 2OR8A 4DGIL 5I28A 2NYYD 4PREA 5JW4M 4MDRA 5DJZB 2K70A 3FL7A 4Z77B 3SE3A 2Q7YB 4KRMB 4MDJA 1UOWA 3GRWA 4K23H 1I75A 3X13A 3E9UA 4H88H 4IBZA 4P57B 5C09D 4XC3H 3AEBC 4U1IB 4QLRA 1LEKA 4BWTA 4Z7OE 5EEWA 2J5UA 4HDIA 4NP4H 5KJRL 4HJTA 2VR7A 1KXTA 1LTSC 1KN7A 3IJSB 4HJJH 4XOEA 4BKLA 2FUQA 3DPDA 3U83A 4XPTL 1OM3H 2V0AA 1YEIL 4LPCA 2W94A 4LESA 2OQJB 4O4YL 4NZUH 3GSNL 5EV7A 5DJCA 5T1DH 4OB5L 4RFNC 2ZX7A 2X1XR 3VH8G 1MWAL 2BSSB 5CBAB 2J2ZB 9PCYA 4NZFA 5E70A 4IBTA 3IAPA 5LXVA 1MCWM 2P24A 2R4RL 3MNWB 3OR6B 2ZOLA 1IEBB 2JELL 2JF1A 2FYNC 3GSNB 1PV3A 3JWOH 3AT8A 4HGMA 5AEAA 3MLVH 1JXFA 3PHSA 2ITCB 4RMUA 2H47C 3GS0A 1MWAB 3SDAD 4Q52A 2A45I 1M90Q 3WNNA 5JPNA 3E6HB 3D08A 3H9HA 4JE4B 5EOCH 5F0JB 5B1KA 3ULVL 2IBBA 1N8ZB 2BOBA 1RMFL 2VSMB 2ZX8A 3IDIB 3KD4A 5GSRB 4PV8B 3ZE1E 4FLSA 4UOQA 1ZGLM 4I89A 4X6FB 2E7MA 3OSVA 2HN7A 1YSOA 2FH6A 1LK3L 1NIFA 1WO2A 2A99A 3QCTH 1ZWIA 3L2NA 1PAZA 2BSED 2Y06L 4HCRA 3JWDH 1BQKA 3M7FB 5K1JA 1CO1A 2EEBA 1L7IH 2ITDA 3P54A 4YC2B 5FCUL 2ISDA 1C5BH 1UD2A 1HN1A 3B5GA 4MKMA 1F6AB 2DJMA 4KX8A 3BX7C 3RZCA 1PU0A 4PRIE 1KYUA 2NSXA 3BEWB 1J0HA 4ANVA 4ES8A 5CJXA 1YNLH 3IDMB 1AZCA 1XGPA 3NIGF 4XC1H 5BJTB 1QVOB 3TBYA 4UQ2B 2FJUB 1JZ5A 3E6FA 3LDBB 5FS5A 4JREC 1TPXB 4FA7B 1HCVA 4F27A 1A4BA 1Q72H 4YNYB 2JCCA 2XSKA 3OHXA 4N6RA 5I2IB 5AOMA 1KJ3L 1W2BO 5J9PB 2QE7H 5T1LD 4ZZFA 1WD9A 3T65B 5J6GA 5E23A 4DP8X 4R3SA 2ZCKH 3GKWL 5DTFA 3TEZA 3FT2B 1JGUH 4Q0XH 2VDKL 4XO4A 3SPJA 4XVUD 5JOEA 3TEWA 5D7JD 1L2PA 1QVGO 1RZFL 1RHFA 4YX2H 1A4KA 3JV4A 4H1LH 1OE1A 3ARRA 3QRGH 4UIMB 5AVSB 1WFOA 2C9VA 4EDXA 2WSCJ 2WAHA 1K04A 2ED6A 4M1CC 4QHNA 5L2KE 4AYFB 3GK8H 2E9IA 2VDKB 4KGLA 1I9EA 5CIPA 1UA7A 2MRYA 1XF2B 4Y9CA 3B2PA 1RZJL 4N87A 3EO1A 1LP9F 2DTMH 4KH2A 1OKEA 4M7ZC 1VF5D 4GKSA 4PRPE 4B86A 1I31A 3K4AA 2KYIA 4FFYA 2C1PA 1UWGH 4IKKA 4KH9A 3V4UH 5I8OH 5B1JA 2FSDA 1GYAA 1MSPA 2C9AA 5J7CC 1P5UC 1JWUA 4ODXB 5HI5D 1VB9A 1N6VA 1NFDE 1SJHB 4KRPB 4JFYB 4RMBA 1OVVA 5SWQA 2VGLM 3AEGC 1FNFA 1ZHBB 4JZJB 5DJDA 1M7IA 4WHTA 5IBUB 4FQ2L 3QEHA 1UCBL 4G1EA 5FHAH 4JN1H 2FB4L 3MTUE 5F88B 5D93B 3VX0A 4B7IA 2FEEI 4IL6H 3O4LE 4PFEA 2YUZA 4HWEL 1UOVA 3NTCL 3DGCR 3R7QA 5BVPH 3VSQA 3WDJA 2B77A 3GF8A 1I1RA 2BP0B 1T0NB 3S36L 4HV8A 2D3LA 5GZND 4MJJA 2BY0A 2HLFD 5FGCE 1MXGA 1E6JL 4IEFA 2KXPB 2VIRA 4FXLA 3H3KA 3NH7L 4RDQG 1PYWB 3QH3A 5LNEA 4CU8A 2GJ6E 1ZN5A 2PWHA 2XV6B 3CX5J 4JRYB 5DA0B 2MEJB 2PWDA 2YXFA 3WO4C 4EVNA 1JRHL 4WW2B 1LWUB 3D2UB 3RWIA 1ORSB 1YPZF 4X6CF 4E9LA 1T3FB 1L0NE 4IMLB 2VO8A 4QYOB 4M7LH 3S37H 4WWKA 3STZB 1FSKC 1I1AD 3QJOA 3UTPE 4ZMZA 2WY3B 2ZVNB 1T04B 4ECNA 1CDYA 2IAMD 1QO3A 2EO1A 4R7NA 1LP9A 4XP6H 3RY4A 3FB7A 3PQYA 4BEIA 2BINA 4MYPA 4X9HA 1TTBA 3MR9B 3GI8H 1WPCA 4KQ4H 4QRBA 2VT0A 4GXUM 4IW4C 4NQQA 3KPSD 1NZRA 3L72E 3RX9A 1I4FA 1N7LA 3P73A 4EBQL 3KGSA 5CLYA 3EHBC 3KBEA 2QJYC 2FIRT 4C4KO 2HG5A 3MLSL 1UUSA 3MV7A 5LDUA 1ACZA 5MEOA 1J7VR 4XNQA 1YYLL 3ARPA 4FGMA 2EILB 3CFDA 4KO6A 4X7TA 4G8FA 3FH5A 5IFHL 3KVQA 1PGOA 4LRNH 2IPKA 2O5YH 1V8HA 2DQEH 3CNKA 3MA9L 1IO4C 1E40A 5DWUL 5FUZL 3TVMC 4OI9A 1UGNA 4PTUB 5AYUL 4G7VH 2BCMA 1FDMA 3MCKB 4GY4A 5KYUA 4HX1B 4AL8C 2EDLA 3A67H 4YH6A 2DMCA 3HI1B 1E27A 4P9ML 4JDZA 5E00A 3VXTA 4L29A 35C8L 1WD8A 2Y7SA 4HGWA 3IJYA 2BHYA 3U4KA 4KQ3L 2RALA 3H4HA 3G04A 1F45A 4WHDA 5HVGB 1PLCA 3LW5J 1NCOA 2H1PH 1MV8A 3CVHL 3FO0H 2WYZA 3MBWB 5JZ7C 1Z7JA 3VFNA 2KZIA 1HNGA 1OAQL 3MUGB 1NLBL 4XPFH 5DMYA 4YR6A 3KE0A 4H5SB 4X6CA 1T66C 2K3HA 3O6ML 1TJIL 5D72H 2VTFA 4MXQD 5EIIA 1K4DA 4OI8A 3CVHB 2GJRA 2EUXA 5TE7L 3H1LJ 3T97B 2NY4B 2XY2A 4U31A 3P4NB 1T7YA 4MD0A 2HFED 4YHIB 3G9VA 4IRSB 2WIIB 4OLXL 3LSOB 1DQLH 1DQML 3QPQC 1MFBL 3OZ9H 3RIAK 3IE9A 1KV3A 1KULA 1XSJA 4JQIH 5DHDA 1DVZA 1NAKL 4KU1A 4HLJA 1AZVA 1WMKA 5D2LE 4E9TA 4N3YB 2H9GA 4L3ED 4BQ8A 4IOIB 1YDPA 4NYLB 2Z8WC 1JERA 4JM0A 1E8YA 4NKDA 4YLBA 1E8ZA 4NFDA 1FORH 4FKKA 1KXVC 5HGHA 2NY0C 5FM4A 1JM0A 3RA7H 1H3UA 1KQSO 1BV8A 2J43A 1FFNA 3D85B 1WK0A 3FWLA 1HINH 2XA3A 5IQNA 4UQAA 3H1IJ 4JFFB 1L3NA 4OZFH 3RL0B 2VJ8A 1FNGB 3L8QA 2LLNA 4NIKB 1G9NL 2EIBA 4KWUA 1JCDA 2VQ1B 1DH3A 4U3FJ 4HALA 3DHPA 5FW7A 2Q87A 5TJWK 1RUPL 3T3MB 4LSPL 4YXHH 1I7TA 3AITA 5I23A 2X6VA 2R23B 1V3LA 1TQCB 3BH8A 4YHOH 3QXAA 1DDTA 2CPUA 3OJDB 1ZANH 4UUJA 3K6NA 4R83A 5FKPA 2JIXD 1M1JC 1BQHB 3NQIA 2AXWA 4ZSOA 4QMEA 3HG0A 1T2QL 4R90L 4ZUSB 4Y5XA 4I77L 3F5WB 3S0PA 1A7NL 2X4PB 4OLZH 5C92A 4F7EB 1ETB1 3BAXA 2CLVB 3G5XB 3NJFA 4JUTA 2Z92B 3H54A 5CBNA 3FQUB 1OZUA 3KPLB 4IGBD 2EE2A 3LD8B 1MZZA 1X5LA 4JRXB 1UOKA 2G2RB 2WLJA 3CWBJ 1XZWA 1Z9SA 1NWPA 2WLIB 1SYVB 2Z35A 1VA9A 4JY5H 1J0YA 4N2KA 2PR4L 4PS7A 5CZVH 2YPLD 2CR3A 3G6DH 4GSQA 2X3AA 2WN3A 4YQXH 3STLB 5BOZG 3TX4A 5DD1L 3IM1A 1CT8A 3X3GL 4K71B 1GVIA 3S4SA 2MJZA 3CXHH 1ZHLB 2WO2B 4ZQKB 2FO4B 2Z7WA 3GBMH 3CC1A 1HHKB 1OIPA 2BNQD 2W0KA 4S2SB 5E4EB 3NFPB 4AC2A 1BFTA 2F1AA 1D5XA 1OD9A 2DWEB 1P4IH 3Q9QA 2Z7YA 1Z5HA 3NSCA 3Q43A 1H15A 2NY7H 4TVUA 2OW7A 3QUZA 2E56A 3MYJB 3CXDH 2MMXA 5MP6L 5DEZA 5JXAH 5MHSE 3FT4A 5AZEH 3C6EA 1T5XB 3GBDA 4BFRA 3RGBA 3KLAB 3NCYS 3LKQB 4YIQA 3GB7B 4PSRA 2APTA 3ELAT 4DZOA 5KVGH 2AVFA 3ZE2F 1QSEE 3V5KB 1XH3B 1Z3RA 2VN7A 3LHPL 3P2DA 3DBXA 4RA0C 5F9JA 1D7MA 4E9SA 2AK4D 2NY6D 2LVEA 1CU4L 2Y72A 1MFNA 3FTYA 2Y36H 5GTIE 2NYKA 4JFSA 5A2BA 1DJIA 1E8WA 4JG0L 3PS6A 1TJHH 2XKUA 2EVIA 5I1LA 4WK4B 1DVFB 5KBKA 3ESUF 1UD8A 3DKHA 3KPRD 2WUBL 2CLRA 4H8QA 1NTMJ 4WV1B 3OKOB 2X4NB 4NCDA 1U4FA 3O6FD 5C7XL 4ESKA 3C5ZB 4TULH 1F4WL 3EIFA 4JLRB 3CXHK 3QXUA 4HSCX 1OCCB 3JYCA 2NR6A 3S2AA 5IHUH 4X5WB 1M42A 2FDBP 5MENA 2FX7H 1E9OB 1S7UA 4HA1A 5GS3A 3D18B 3QFJB 2ZP8A 3B4NA 3RK3B 3SSGA 2WOYA 4ZFOL 5FLUA 4OD1H 3WIHA 2FXOA 4NQXB 1JHKH 3VFGL 4A37A 5G4NA 4OT1L 4P3CL 4XRCA 1WC7A 3GF3A 2LU7A 2WBWB 5BQDA 1GZLA 1IGJB 4OGYL 4YSTA 2GUOB 1GMIA 1BYOA 2GTWA 1H0TB 1IAKA 1ZK9A 3KR3H 4JRYE 1DBKL 5EPMB 3WDIA 4ZFOB 1CICD 1RY3A 3BWUF 2WQUA 2X3BA 4HJGA 4M7LT 3IAGC 4O5LL 3EUUA 1BGYJ 4PV1B 1L4IA 2I5YL 2QVKA 2WXPA 2XFXA 3FN0H 4UT9A 3ZW3A 4QY8B 2XJKA 4KRLB 4WZ9A 5TF1L 4A68A 3H0TA 4HAGA 5EU6A 3W11D 5AZUA 2WUCL 3AVEA 4ZW5A 4PJ5D 2B39A 2HFGH 4FCAA 1CI6A 4RGNB 4YUEH 2W07A 3IK2A 2OTWB 2FZ3A 4H20H 4F80A 5JHDA 4D9LL 1VLXA 2ZKHL 3QJHB 1EEZA 2ESVD 4ADJA 4AQAA 4M4RB 4U1KB 2JFCA 3D30A 4NZJA 3NZSA 1MVYA 5AW0B 1E5AA 4XMWA 5I9QC 2AV7A 1JXJA 5BO1L 3QEGH 1VACA 1EDJA 5E4AA 3WEXB 1D7FA 4KJQD 2WINA 4PGDB 4GG6F 3FBQA 3KDMB 4P48A 3LZQA 5EA0H 5KG9B 4EXKA 1SUJA 3APFA 3HZVB 1MZ9A 1I7UA 4AL8H 4LF3A 1FYTA 4ANKA 1P7BA 2X1QA 3H1LE 2FYVA 3LH8A 4FQJH 4BQ9A 3BWAB 1H6EA 4WUUD 3X17A 1NAMH 4QHKJ 1CZ8H 2FXMA 1EJOH 2KLTA 3L75J 2XWBA 2XXFA 3T0WA 2H26A 2E4TA 1PZUB 2HYNA 4F5CE 3MRLA 4MGXA 3ARDA 2CDGA 4XNUL 4Q6KA 4DCQB 4B9GA 1UD5A 2ENJA 1QWUA 4KKLC 3CHPA 4IHOB 3QZNA 4GXFA 3VRJA 5CR8A 2AEMA 1F90H 2FQFA 3CX5K 2IF7A 4JFHD 3ERXA 4KDTA 3IXTA 3POCA 1CG9B 3MV9D 5K9JL 4XPHL 4J4PC 4JDVB 1WFJA 4M8UA 5DMJB 4LDOB 1ILUA 5ES4B 3RG1C 1TETL 4QOKB 3GMPA 3TESA 2YO2A 4R7DA 5I8CB 2D7OA 2AQ2A 1QD0A 4PLOB 4Q8BA 2V2TA 4KKCD 2GHWB 2ITEA 1SQXK 2OMVA 2P8LA 2VDLH 3AE5C 3KJ6L 4N0FB 4R0LA 1MI5A 3VFWB 1LTJA 3WUTA 4N0UB 1EUUA 2EYTA 5ICXA 2HLEB 4OM1H 1VL2A 2ZUTA 3UABA 1CS6A 4KX7A 2HWZH 4HFUL 5FDWA 2HKAA 5DJ2A 3IF1B 5DD3H 4P5TB 4UOJA 4RESB 3LN4A 4N0YL 5LQBL 1IT9L 3MRIA 3NJKA 4JB9L 2P3YA 4KJPC 5H2BA 5JHLA 2WSSH 5EU5A 4TNGA 1CFVL 3VFWA 1RZGB 1NJIQ 5FUCE 1IB5A 1BE3J 2QSVA 4OGQD 3II3A 5F72S 2MQ0A 4JPIA 1YECH 1ZD6A 7FABL 2X40A 3KYAA 4JFFE 2NZ2A 3QO1B 4MMZC 4NXKA 3RPBA 1MWOA 1BVKB 3CDYA 2HKHL 4K9EH 2HPTA 2A6JB 3UG3A 4U1LA 2X7LB 2D3NA 3K6OA 1MUJB 2A1WL 3MV8D 4A7PA 2OULB 2EICA 1VZHA 2NUTA 1MPAL 5H2FH 2E3VA 3QQ3A 1KELH 2YKLL 3D2TA 1JZ2A 1XR8A 2I9TB 3FDWA 5CEZH 4DVBB 3WD5L 2XKNB 4DN3L 3QE5A 5KJ7E 5DD0L 1YTZI 2ZAEB 1FP5A 3OAUL 2UXFA 3DNKA 3MXWH 3QJQB 4IOSA 3CSTA 2DWSA 4W9FC 5F7HA 1INDH 2JJTC 4IK7A 5KUMA 1V7NL 5D4JA 1CD1B 1L0QA 2VM3A 4ZAKD 2Z5HA 1Q0YL 3L54A 1J05A 3PWUB 4RMSA 1BIHA 4X9GA 1UD4A 5E99H 2BS71 3NJIA 2ODIA 4F92B 1OSPL 1FL3B 1BBJB 2UVFA 1OZHA 1FN4B 4LP4A 4PGCA 1DL7H 1RUML 5EEXA 3MLUH 5E9DD 1YJ9P 3HMWH 2V2WB 4Z7NB 1T83A 1FNEA 3K3QA 3KS0H 1ZR4A 4EOWL 1NPJA 2WW8A 3X14A 4JCWA 4WI9A 4Z76A 3BT0A 2DIJA 2X4RA 2ZG1A 2HLOA 1ETZA 2XWXA 5F7LB 3VFRA 1F42A 3KBPA 3C60C 3MGOB 4PVMA 1YEKL 5J6HB 5F0PB 4ZPVB 3S36X 3HR6A 4F9LA 1G7QB 4N26A 3HG1D 1HI6B 2WXJA 1AO7B 3DX8A 4MA8L 5HHVL 1AZUA 2C5DC 3MCG1 4G6FD 1YEEL 3QHFH 3ZO0A 3EXJA 3HE6A 1JWSA 2ZJSL 3CUPA 2V3DA 3V0HA 4OZGF 1U91B 3RVTC 4Y19B 2Y0SA 3D6YA 3GJFH 5APTA 3BSZA 2YKPA 1UT9A 4IU3B 2J3SA 4YHLL 5ID0B 3I9IA 1XZ0B 3Q2VA 2YD2A 2DBLH 4F9PC 1N6QL 4F1SA 1SQPK 1H6UA 2V17H 3KW8A 4LU5L 2KP8A 1DQVA 5I19L 1XTMA 2CQVA 1AI1L 1Q1JL 4OGAD 2E27H 4JCMA 4PWKA 5TQ0H 5C2UB 3B6SB 3GT6A 4GUCA 5GRJH 1HHGB 1A6TB 4J3WA 3QNXB 3EYUH 5I1DB 5IQLA 5LLIC 1FNHA 1Q0XL 1WFMA 1SQBJ 1HS6A 2PKDA 3WLBA 3CFTA 1K72A 4JDTL 4FCHA 4BHUI 5C71A 2EDEA 2XT1B 1KTBA 3I3EA 1A6AB 1PY4A 2H3KA 4L18A 3Q3GB 2QJKB 3DJTA 1R8EA 4XVTH 1HEZA 1WISA 1XSOA 3PAUA 2VKXA 1L9SA 4ENEC 3DK2A 4I3RH 5LGJA 5C9JA 2P48B 2QADB 1HL9A 3DOHA 4UT7H 2I07B 2O30A 4G8GB 2ADIA 4P2QB 4L4TB 1TENA 2DZEA 5D71H 3RWCA 2A6DB 3QFJE 1NFDF 1OOAA 4CC1A 3RK3E 3N40F 3JQOB 1Z9OA 4HHGA 1OB0A 1T1WA 4L8SC 2KLSA 1KSRA 2VDPB 4BZ2H 3DROB 3CDZA 4OGZA 4LEOB 5DLLA 1VRSA 5DFVD 4NZTL 1A14H 3GJFK 2MH4A 2VLLB 3FXDA 2W9EL 4JPSA 4JN2B 3VMOA 3BN3B 3HAEG 5KVDE 1S9VA 2IC2A 3Q1SL 5FR3A 3ARBA 4MSWB 3EDJA 1AXTL 1HE7A 2V8LA 3I6GB 4LVOC 1GGYA 3C75A 4U0RB 3PXLA 4RISL 1QACA 1FAVA 2HT2D 2PCPB 1NMBH 3FF7A 2VXTL 4PJCB 2FX9L 2DN7A 2HUEA 4FNPA 1R33A 3N42B 5DZJA 4RGNE 1IU1A 3FXEA 2W6JH 3KZIH 1AACA 3RGVB 3BPNB 4K8RL 4EN3C 1FFQA 3N1FC 5BW7C 3P02A 4X6BA 3B34A 4YSSA 4W6WB 2WVTA 3DA0A 1NGYA 4G70B 3VGFA 3CIQA 5IB4A 2XG5A 3JVGA 3NPSB 3O8XB 1EDYA 1GGCH 3INUL 4WFHE 3SE8H 1HWGB 2IPTH 2CE6A 3LZNA 3EJJX 4M4PA 4LLAA 2FCBA 4XE0A 3RTQC 3C8KB 4ERSL 4LLDA 5KYYA 3LMJH 1E4XH 1NTMK 4AUJA 3ZL1A 5BZXA 3ZQ9A 4JGNA 1GU5A 3F7VA 2Y1VA 3BMVA 4H8WL 5TE6H 3TBTA 4NUQA 4N2FA 3BRDA 3ZDMA 3HFML 2WKOF 2XVLA 2DLTA </