5AVYB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 20 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avyB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avyB02
1KQLA 1GD2E 2WPQA 2P2UA 1MV8A 3MGNA 2Q3IA 2ZFCA 1GU5A 3HE5A 2WT7A 4I6MC 2Q7CA 3A2AA 3M0DA 3KQGA 2R5BA 3M91A 1X8YA 4RESB 5APQA 3B8EB 3M9HA 2R5DA 3TK1A 3NTNA 3WGVB 1GU4A 2N9BA 1FOSF 2WTYA 3UIAA 1JUNA 3NMDA 1A02F 2W27A 1T2KD 1GTWA 1A02J 2P67A 2WWWA 3L36A 5AW6B 3WGUB 1GK4A 3VMXA 2KP8A 3P7KA 4KHXA 5AVVB 4C7NB 5AVUB 1H89A 1CI6A 1HJBA 1CI6B 3V5BA 2Z5IA 5AW5B 2ZXEB 2BASA 1HBWA 3SWFA 1FAVA 5APXA 4C7NA 1GK6A 3A7OA 1OWAA 5APUA 5AVYB 4DZOA 3NFQA 1NWQA 1IO4A 2P7JA 4LC1A 2XV5A 5AVTB 3LIEA 4JYCA 4AYCA 3V4WA 1CZQA 5APYA 2C9NY 2H7HA 1JNMA 3TYYA 3VN0A 3L37A 1HUCA 1OXZA 5AVZB 5AW4B 2W6AA 3A3YB 4M3LA 2JJLA 2C9LY 1S9KD 4B86A 4AUWA 5AVWB 2QM8A 1G2CB 5AVQB 4JYBA 5APSA 3VMYA 2YO2A 5AVSB 3TNUA 2Z5HA 2VRSA 1S9KE 5AW2B 1DH3A 4GKGA 5AW8B 1CSBA 3A5TA 1FOSE 5APVA 5AVXB 2XU6A 1HWTC 1YYCA 5AW0B 1SLQA 4C46A 3V4QA 2WT7B 1J2JB 3M0AA 2Q5UA 4RETB 3IR9A 2YNYA 3HE4A 2YO3A 3LIDA 3VMZA 1GZLA 1H8AA 5AVRB 3HE5B 2R32A 3VYIA 3L35A 2IPPA 5APTA 3NXSA 3P8MC 3VTPC 1SP4A 3M9BA 2XZRA 1MUUA 3OAKA 3P32A 3T97A 5AW1B 2E43A 3M06A 2R3CA 2WPRA 4GT1A 3HE4B 4I2LC 3I5CA 3HTKA 5APWA 1NAFA 2QM7A 5AW7B 4AQRD 4EOTA 5CMZA 5AW3B 2WPSA 3O8ZA 1H88A 5AW9B 1MFZA 3MD0A 3TNUB 4HYTB 3KDPB 1T2KC 4XE5B 2E42A
chains in the Genus database with same CATH superfamily
2ATKB 4PGZA 5CF3A 4Q6IA 1G7IA 1NDTA 3PABB 1TDQA 3QZWB 4I6MC 4KC3B 1BG9A 1DHKA 1U93B 1UJ3A 5FA4A 3HI5L 4LF3B 2VAAA 4Z5RA 1WZLA 1L4AC 1TQSA 5BCAA 1VLXA 2YKLL 4IU2A 3MUGB 2ALWA 3K71B 1M71B 1RD6A 2Y3NA 3SDXF 4AYFB 5HJ3A 3VFSB 3WJJA 2V7QJ 4PJHA 3QHTC 1FH2A 3FQUB 4FXGC 3V4PL 4WY4B 3WNNA 4HWZA 4ZSOB 1O5DT 4KBPA 4XP6H 1ITBB 3DGGB 3SGKA 4HDIA 2XN9B 2MPVA 2W5PA 1VFAB 2WMMA 3FN9A 3SWFA 4JREC 5CR8A 1UG9A 2Y0SA 3VGBA 4D0DA 4YSCA 1L0NE 4CSSA 3DK2A 2P28B 5EU4B 3T0EA 5AVYB 4DZOA 2QDVA 5K39B 4YL4A 4Y9BA 4XMWA 1X5KA 4JE0A 1ZPUA 1IO4A 4HIPA 3QUKB 1S1CX 4NFCA 4PRIE 2EVJA 1E9PB 3WNOA 1AAJA 1E28A 2Y7QA 3MUJA 1SGKA 4PV8A 3ESNA 4H8WH 3CCLP 3SYPA 4Y2NA 2YD1A 1DQTA 1FAIH 2NCMA 1ONQB 1T2QH 5C08D 3L9RA 3MRJA 3PJSA 3VXME 4Y2DA 1I8MB 4QLRA 1YJWP 4OGYL 1JGEA 2FBJL 1J5OL 3OR6A 3OAWA 5F3BA 4K23L 3TO2B 1HOCB 1WTGT 4RGOH 4U1LB 1LT1A 1PV3A 1PVHA 2JJVA 1X3DA 2W07B 4HUWB 5MP6H 4HS8H 3NMEA 4BM7A 4HOXA 3L75J 3T0BA 3TEWA 2GSIA 4ZMPA 2BSSB 4BZYA 3REVA 2D7TL 3AG1B 2YQ3A 1OLZA 1S9WA 4S2SA 1I8LC 4ZJ9A 5BNXD 2RFXB 4XP4H 4M02A 1CICD 1AZNA 5FYKU 3DIDA 3TH3T 1GOGA 3OMZA 3RL0D 2Z8RA 1PZ3A 3DBXA 1RQVA 3ZYIA 1IGMH 1N73B 4MVBC 4C56D 2YXRB 1M53A 4P3CL 4U4BA 1BSIA 4A2HA 5JPMC 2QTVA 5FB8A 2XYBA 4NNXA 5I1EH 3DJSA 4I1PA 2CRZA 1NTME 1KJ2B 3AUVA 3KJ6L 5I6OA 3Q2LA 4Y16A 5DMJB 3L3OC 5CBEB 3Q43A 3W3BA 3MNZA 5KOVC 2VIRB 4XN4A 3H6PA 4TSBL 3ZTJG 2BIOA 1AR1C 3QNYA 2IC2A 1ET7A 4GUOA 4IKIA 1LTBC 1HGVA 2Z93B 4GG6E 8CGTA 5BQ7B 1NBQA 4XNBA 2F1BA 5KW9H 1JI1A 1CLCA 4NQSB 5DUBA 2CPBA 1FZFA 4MJHA 2QTEA 2J8UE 4PD4E 1HF9A 1ZA3A 4XX5A 5APQA 1L9QA 3MGOA 5E6IB 1KGCD 5HDLA 3EDEA 4K7PL 4Z3TA 1N0LB 1OSPL 1BZ7A 1DJIA 1G6RL 2Z7YA 4FULA 1D5ZB 4QRTB 5CIPB 3SPCA 4E36A 4LL9A 5F7DA 1CDGA 1T04A 3IJYB 1XGPA 4HAFA 5AVVB 1OY3B 3S3BB 1SNRA 2VR4A 3W39B 4DPBX 1LO5B 2K8MA 5BVJB 2RBLA 4KAQH 3HD7B 1NZRA 5JIKA 2OYKA 2G75B 4FQXD 1D5XA 1HBWA 4X7SL 5EOTA 4Y7MA 3W68A 4G83A 1KBVA 5E1IA 2NUTA 3M86A 4M6MH 1RK0A 2B5IC 2BVTA 3D0VA 5CZXD 3LXUX 2O5XH 3HI5H 4QRPD 4X0KA 1IVLA 1YMMB 2ITCB 3FYIB 3ILPB 2ALAA 5EUOF 3TC9A 3F5WA 1NTZK 2AEOA 1S8DB 2K3RA 3HZVB 3O45B 4PJAE 5B1JA 1UA7A 3TO4C 4WFED 2NQ3A 4JB9L 1BECA 4YHMH 4B9FA 2QA4P 1AS6A 2B1AH 3CXHK 3D69A 4LCWE 4N9GB 1AQTA 4AEEA 5KJRH 5DSCB 4M7KL 1NBCA 3KDMB 4AYDC 4AQEB 4AYBA 5HJ3B 4ETQB 1J8HB 2X4QB 1XGRB 3HMXA 4PJFF 1KB5B 2EE0A 3ZDYF 1I3UA 1HWWA 4M8UA 1D7CA 2NNFA 2VRQA 4F33A 1U30A 1R3JA 2A0LD 3RDTB 1C7SA 2ZUUA 2VLRE 5ENWA 1HINL 3P73A 3LMJL 1GZPA 4MQSB 3RGVD 1IE5A 5CEZE 3DV6B 4GQRA 3QR2A 3O0LA 4XN5A 5GGSB 3T71A 3SGKC 1AZCA 5DZ9A 1FA4A 2BC4A 5DQDL 3P40A 1YMMD 5DHVH 2L7QA 1X5ZA 3QYMA 3JV5A 4K3AA 4JDZA 3DXAA 3CN4A 3VXRE 1IFNA 2HPTA 2AMUA 4PV8B 2ZAEB 4ZUSB 4I8DA 3SO3C 4JHBA 5DLMH 5EOQL 1B6UA 2XTJE 1UB5B 3WTTA 1A02N 4I2LC 3OXSB 5ETUA 5CINH 3US1A 5JMRA 3LNHA 4QHMA 3WKQA 4A2MA 1PDKA 2X10A 1NFDB 1E79H 3QJOA 5K69A 2GUSA 3Q5RA 4U3SA 3US0A 3VXTB 3X11B 1KILD 2HN7A 2B87A 3QYCA 1P0SE 3ROOA 1T2KC 2H9GB 3MRQB 5F3FA 2VDQL 2NY0C 4KRPB 4NBXB 3V0IA 2P2UA 3OZKA 1T7VA 2WO3B 5H2BA 5CNHA 3WTVA 4NAMA 4UIKL 2F08A 2WKOF 1LLAA 5CJBA 4IDJL 1CXLA 2Z7WA 2VAJA 1YZZA 2CKBH 3FFOA 3RI5F 3TK1A 4NQDD 3M1OA 1OK8A 2P80D 3WKPA 4AWJC 4LEOB 3DDGA 2XRAH 1BE3E 3HG1B 3RRQA 1MZ9A 1DSFH 1KTLB 2VAAB 1T22A 3V4PA 4L4TA 4C7NB 2DQHL 4MJIE 4RKUJ 2F5BH 1DIPA 2P58A 5TF1H 3SGEI 1CI6A 4BFBD 4JFUA 1WCBA 3SD2A 1NGZA 5ACLA 1ILUA 1E5ZA 4XFJA 4GEIA 1K2DA 2XN0A 5EO1B 4F2MA 2BJML 1XH3A 4HUWA 2L5GB 2VSCA 4YDLC 1L0LG 3LV3B 5LBSL 3REVB 5HPMA 4NGHH 1H0DA 5JO5A 5ANHA 1KTRL 1RMFL 3OAYH 3AGWA 3G3LA 2A1WL 3OPZH 4XPAH 4IFDK 5F0MB 2X1QA 4KRLB 4UQEA 3PWPE 1JNMA 1JK8B 1FGVL 1X4YA 4NN6B 4UDTB 1ETZB 1F45A 4LP5A 3CFBB 1KACB 3S98A 3F85A 1FU1A 1BQSA 3L95B 4G6AC 3WO4B 1QFWH 2VB5A 3P54A 1VQOP 4KZCA 1THCA 5IB1A 3NCYS 5AB2A 1X7TA 1N8OE 1SQQG 1A3LL 1M6UA 3AU1A 4PLJC 1WT5C 3MJWA 4RGND 1UQSB 4ZUTA 1S46A 43CAA 5K39A 5AFAA 1EDIA 4B0MM 5CMAB 3ZDXE 3KYAA 5DVNA 1WHOA 5SWSB 3QUXB 3ROLB 3F12A 4BRYB 1J2JB 3H1KJ 1QVFO 1MCEA 4KXBA 3ETSA 4KKCC 4TF4A 5IBTH 2IANE 4R5TA 5I18H 3PTZA 3CHXA 3PWLA 3RE0A 2C0XA 3RNKA 1OWWA 3G5VB 1BOGA 2HLAA 3OZ9L 3TPKA 2NUPB 4X4MA 3KXFB 5ICXB 3HB3D 3KWUA 3HE5B 4HCRA 5JQ6H 1IGFL 4AC4A 1U0QA 2X0UA 3TV3L 3I56P 5KYYA 4R8WH 4Z7UB 5DLLA 2KT6A 3AS0A 3PL6B 2PR9A 4QHKI 3ARQA 2JCCE 4OF7A 1MAMH 3RTQB 4HGWB 3JV6A 3VXMA 4M5TA 3TO4A 1PJ9A 5J4MA 3HAEA 4QXUH 1OP3H 3IFOA 2CJSA 1WAAF 2A9NL 1E5AA 3QULA 4PJGE 3BSHA 1OL0A 3FMGL 4GB9A 4Y99B 4XNXH 4WB4A 2F8XC 3ZJAA 1GW3A 4AG4H 5I6XC 5EN2A 3MRHA 1RF0C 4NQXA 2PMZA 4FHJA 1DSFL 3WJMB 4MJ2A 4OZHE 1HH6B 2R83A 4N0CD 4NKOA 4AW4A 2CPSA 2WN3A 3DWTA 4KK6C 2CDFA 3HI6L 4TULH 4WUKH 1RULH 3VJ6A 4M29A 2GBVA 4B9GA 4IRSD 4JRXA 1K9TA 4FQHA 3CIQA 4BH8B 3NFPB 3MRCA 5HTSA 2P24B 5C3TA 1M1KQ 4QRRE 2GA1A 3WIIL 2I8DA 5I1HH 2XJLA 3FT4B 5I0YA 3SYQA 4L1DA 4PB9H 4G6FB 4DW2H 4E41D 1LT9C 3KLAB 1MCRA 2EDWA 2C3VB 3GKWH 4FTVE 5DJCA 4BFKA 4XPGL 1NTZJ 3HZ3A 3S37H 2FAUA 3QZBA 1XHHA 4G8GA 1R9FA 1CURA 4ABQA 2DQTL 1SM3H 2D3NA 3B9KB 2Q86A 4X83A 4HMEA 4UT9A 1EAPA 2VMCA 1RZ7H 4ZBJA 5I24A 3RIKA 4P23B 3PP4L 3FO1A 3ERXA 3K74B 4F37F 3QO0A 2ITDB 2V3EA 2WNKA 5CU9A 2XYCA 3JV0A 4M3JA 1ZW0A 4UQ3B 2GJJA 4JDEA 1O7DE 3K4AA 1YEWA 3BKYH 1P4UA 4Z6AT 5KS9B 4J3OH 3DSNB 1H8SA 5EUOB 1FP5A 5I74C 5F1OB 5EHFA 4LVNB 1ORQB 4N2NA 4WIQA 2ADGA 3S48A 2XACC 3ARSA 5TH2B 3Q01A 3HNSH 1EJ8A 4B9IA 3L5WA 3WXVL 3QEQD 1X44A 2GAZB 1J1OH 2JV6A 4KO9A 1TZIA 2DLIA 3FUKA 4HLZG 4KKCD 3A0OA 5E2VL 3TT3H 1UIXA 3H32A 4HUMB 4APQA 2YEZB 5E95B 4UINH 2WWMD 1JPSL 5BXFB 1TU2B 1VFOA 3GIZH 1ZA6A 4OKVB 2Y9RT 3IAPA 3L72D 3LTVA 3T1FB 1BF8A 3OG6B 3H2QA 2E0PA 4FFYL 1PDKB 2ZE0A 4HIHA 1KF9B 1VADB 4JY4A 3D7PA 3EOTH 1K85A 2ZXQA 2D9CA 3WUWG 5DYOA 4MASA 3S4SA 3FU7B 5BRZD 2C3WA 2F8OA 4G3YH 1NFIB 4LLUB 4KY1H 4MKTA 3NDYE 1KJVA 4V11A 5EIIA 2N7BA 5L2KA 4PBWD 4WNQB 3U46B 1N7ML 4FG2A 2HR3A 4H5SA 2EQDA 5CEXB 5CM1A 3AE5C 4OUUB 1T7YA 1E4KA 2WXIA 5DK2A 3L1FA 2WXRA 1KLGA 4U1KB 3LZOA 3Q1SL 5AOJA 1OE3A 2YJLA 2Z31A 4HW6A 3D25A 4KROD 3HZKB 3E7KA 5G5DB 5AAMA 1NU1D 1T1XA 5KWYC 2YAPA 1FZCC 1E5UI 1NU1J 4N6JA 4K15A 5IBUG 4E9LA 2O5YH 2XTJC 2PWDA 4JFEA 3S5LG 4NERA 4PJBF 4FQXB 4XE5B 1ILSA 1KORA 2AW2A 1W5CE 1I3RA 1GC1C 3T0XA 4X6CA 5KVMC 3IXAA 4P5TA 4OKDA 4WDIB 1WT5A 4F7EA 3HG1A 4E9TA 4I89A 5AYUH 3TBYA 2ZX7A 3MLUH 4L5FE 3I6KB 4B27A 4LHUG 3RL1A 3FS9A 4OIIL 4FTVD 1EZUA 1K72A 1VHPA 4JQIA 4NFBA 5H94A 5I5RA 3QIWB 1LE9B 4TLTA 5TF0A 4FQQA 3T09A 1EEYA 2VLLA 2VITB 5JIMA 5GRWA 4F3FB 2H6UA 4F8PA 1LTAC 5D2NA 3DROA 4XMXA 4DCKA 1NL0H 1OGPA 4N24A 2J5WA 3MV9D 3B9KA 2IDBA 4YDVA 4MB5A 3FO1B 5CBOA 4ODTL 4KQ4L 1EK3A 3UDWC 1MHCA 4PJIB 4F8OA 1KJ3L 4N2IA 5MP6L 4RVBA 1F90H 3GFUA 3MN8A 4X6FB 1A7NH 4WUKL 4E9QA 3KD4A 5T5FH 1CI3M 3K5RA 3KBPA 4WU5A 2V2TB 2DRUA 1FV1B 2BSEA 4B7IA 2X53A 4GKZA 1ZY9A 2WQSA 2QQQA 3WE1A 4JDZB 1T2QL 3H1LE 2A73B 3PGDB 5KANI 1N64H 4XB8A 4NO0D 1LTSC 2F1AA 4QRQB 3OF6A 5DC4B 2E74B 2XVKA 4HC1A 3SJVB 3MBEC 2XKNB 4DVRH 1A9EB 1S9VA 4HCGA 3VI4B 1QI4A 2ODHA 2A9BA 4XCFL 3UACA 5IGXL 2VDNL 2HLOA 2BNRD 3O3BA 4OVUA 5E79H 1YDPB 1F2XK 2E7CA 4S0TD 1XD1A 4FNLH 5DTFB 1R5SA 5KLIC 1CGWA 3ARPA 2PR4H 1G7PA 2AZUA 1RH8A 2F74B 1RSFA 1I85A 4KI5E 4LOFA 1MCJA 4RMQA 3UTTA 2JWYA 5LN4A 1ACXA 4G6AD 1YY8B 2JB5L 3CCMP 3IJEB 4JE4B 3EYQC 2UZPA 4P3CH 1Z66A 4NT6B 5DVKA 5FO7A 4G8EB 3FT1A 5IMMB 5K1JA 4DF9A 2H41A 4L29A 3SGDH 4AT6A 2FIKB 2J21A 3QEQB 4JANB 1C7TA 1E4WL 2HA1A 3HE6C 4M5ZH 5DJYA 5KVEL 5E2VH 3TT3L 1XF3A 4LO9A 1SVCP 3BX7C 1UWXH 2CZNA 2HXAA 1UGNA 2XBTA 4UV7H 3HG5A 4HJGB 4G5ZH 4Z95L 1MHEA 4H13C 1IEAB 2PXYA 4OJEH 5TDPB 3S37X 2OSXA 1CD0A 2YGQA 1JPSH 2R0LL 2IPTL 3I2CL 1MCPL 1XIWB 4YX2H 5KBPA 2DQFB 1KGUA 3UO1H 4YK4C 2MQCA 3SFEC 1JZHA 2ROXA 1PCXA 1KIUA 1X7SA 3STZA 3T0WA 5DC0A 2RIKA 5I1KH 1CL7I 4PWJA 4EN3A 5FYLE 2DICA 4M6OL 2PYFA 3BQUB 3FRPA 4ONGH 1E6OH 2FHCA 4ZD3L 3E1ZA 1ES0A 1JHKL 1JXJA 3P9LB 4R2GC 5KSVA 3DUSB 1R34A 2FZ3A 3NTNA 1GGIL 3ESPA 4UDTA 4YX2L 5A16B 2FT8A 3G9AB 4FD0A 2V9QA 1YJDC 5HYJA 4MMZC 2OTWB 3RILA 2X4PA 3DJZA 4OGAD 5C07B 3JWOH 4IS6B 3K5BA 1G5GA 3CBKB 3K2IA 3ZL1A 4KHXA 4V33A 5F96L 4BELD 2FQDA 1F56A 1QBLL 2NY2D 2XN1A 1EDYA 2LVCA 2F7RA 3NJKA 2XIBA 5DJTB 5E5MB 4JFPA 2DOCA 1D3CA 2EE3A 2UUDH 1NGZB 3C08H 2OGUA 4KFZC 5JHDE 3RGVB 2OZNA 3EFOB 3TN0A 1AP2A 3MBED 4D9LL 2Y06H 1T0NA 2FL5A 1RUPH 4IRJB 5L9DL 1UM4L 1WZAA 4HAGA 3UBFA 3ETBJ 3GK8L 3TBSB 1IBHA 2NPLX 1FZCA 1RF1C 3GMRB 4J8QA 4N2OA 3GUFA 3MRGB 1NDGB 4NO2A 1UWFA 4XH2B 3UTZB 4RMWA 3GXFA 4CPGA 3VFRB 4PFEA 1AQ5A 2HLFD 3SDAA 1QUNB 1VACA 1DZ0A 1RHHA 4LKCB 4BGDA 4GW1A 3WMPA 2I25N 5CGYC 2VN3A 1T5WA 3H55A 5BRPA 2MJZA 3JUYA 4GG8A 5C8JA 4OJCA 4UTBA 3H1IJ 5E2TH 1YDPA 4P4KD 4W6WB 3TJHC 3WUTA 3EG9A 5G55A 1CDYA 1EZLA 2GCYA 1FYTA 3G04B 4XP1H 5SV3A 3FOMB 2PTTA 3STLB 4YDZA 1ZOYC 3RL0g 4KX7A 3ULUL 4M5YL 3MOBL 3O8XB 2D4DA 2MCMA 3KM2A 2ITFA 3VSTA 2IFFL 3WHE1 4BCYA 4X4ME 3L75G 3T0ED 4BINA 1JCKA 3GLAA 3O4LE 2QJKB 1AR2A 4PV1B 1MREL 3SSUA 1XB8A 3PNWB 4LRNL 1BQHB 4LPVA 2WWKO 3VFTA 2JKNA 5C09B 5D1QE 1VFBB 2EIKB 4OLUH 4X5WB 2NY0D 3QPKA 4EXPX 1H5BB 5FCUL 4K3HA 2ICCA 5I73C 2FT6A 3S0PA 2R3CA 3NSYA 1MVUA 4N4YB 2YKPA 1KXTB 1YN6B 3AT9A 1QEWA 4AUYA 3G9VA 3NFSH 2QJKC 3ABGA 4TUUA 1ACYL 4N2DA 2DTML 3PHQB 2W0KA 4J6RL 3KLLA 3HZMB 1ZRTD 2F54E 1CN4A 1FZOA 1JP5A 3QZOA 1J1PH 1YC8A 1TYRA 1ZSDB 1M57D 1NO4A 3I85A 2ZSVA 4WHYG 3A23A 3SE9H 1B3JA 3U4AA 4EPSA 1MWAB 5DUPL 1IK9A 2D4FA 2XOTA 4MJ4A 3BC9A 4PJHB 3RA7L 1RE3A 3RVXD 2G2PA 2WLIA 2K7QA 1BAFL 2MRYA 2XPYA 4NT6A 1C12B 3KPSD 4JLRA 3DBXB 4KKLC 2HJKB 4I1LA 1BDYA 2FX9L 3Q3GA 4K5PA 3KL3A 4MDIB 4NDMB 5E7BA 5GZOA 5GZND 1OKEA 2COVD 2GSGA 1H3WM 2O01H 3CMEP 2WN2A 1EXGA 1NGQH 4X9GA 2V7QH 3ULAB 5E5MA 2Q8AL 4L3AA 2DM2A 1UADC 3MV11 3IAQA 3MLYH 2HLFC 2XVGA 4BCZA 3GBNH 2FSDA 1R47A 1ZEAH 3ZT5A 4JJHA 3UAAA 5JW5B 5GQBA 1KV3A 2V0AA 2RKLA 1LO4L 1QO3A 1MRFL 2K6WA 2N1TE 5I17B 4JQ0D 1VESA 1OTSD 3LRSA 5ECGA 4PLJD 2GIYA 5FA3B 4K8RL 3C8DA 5EU5B 1KSRA 3EGDB 3CH1A 4GQQA 4HXBH 1ZA3B 1UA3A 2EXWC 3T8XA 5LCVH 1QW9A 3UBXB 4Z76B 4ATWA 3RPKA 4FLOA 2E5EA 1ZHNA 1E9PA 4FP8L 2H3XC 2IAMD 1BD2D 3RWCA 3QUZD 2DIJA 2NY3C 4L8DB 4W4OA 3Q1EA 1BXVA 4LCUA 1IEAA 1JMBA 1SYVA 1II4E 3ETBF 1YTZT 4KVPA 2WUCL 1TU2A 2VJ0A 5CD3A 3F01A 1FYTB 4KT0J 2Z35A 2VRSA 4KUZH 5F6HI 2UZXA 3G6AB 4KKRA 1DEDA 1AGBB 2YA2A 4AQAA 1A7RH 5DU7A 3L5JA 4YOKA 1I7ZA 1MI5B 1Q9WB 4I4WB 1B4TA 1GJUA 2VLRD 3FO0L 4WW2C 1QP1A 4NAJA 5IOPB 1EV2E 2GJRA 3D6YA 1NKGA 4HWEH 1XL6A 1KIQB 3EYOA 4BZ1A 5IIEA 5CSZB 1JZEA 4PJ0E 2NY1B 2IPKA 1RUQL 3A6CH 2XLLA 3ZKMD 1HIMH 1IQDB 2WPRA 3JYBA 4IRSB 5IW1A 2XWRA 3RVXC 5HHNA 3M9QA 5FDWA 5AW7B 1FL6A 5GZOD 2PR4L 3DK0A 3RWJB 2LAAA 2HJLA 4AG4L 2QQLL 4AJ0A 4ZOAA 1KBWA 1FC2C 2Z4QA 3B2XA 4KMTL 5GRYA 2A45G 2LXCB 1XSOA 4D3CL 3MBXH 4UZGA 4F7TB 3DI2B 2CG9X 1IFMA 1XL4A 3OKNA 1VZHA 4M5ZL 3IEAA 3CCVP 4JFXA 3KQGA 5I0VA 4UB6H 4C57C 1HZLA 5JQIB 3B56A 1U8NA 4IHOA 3ABVC 1HKFA 3MMEA 2X3CA 3QJHA 3GBNL 3FRPB 4RFNC 2A77H 1QBML 5FECA 4RIRA 3I6LE 1LP9E 1JNNH 3GHEH 4NQDE 4FI7A 2P5ED 3UZVA 3QH3B 4RMBA 4FQIL 4QT5A 3L71J 1WH0A 4P3WA 5TK4A 2ZXXA 3VFMA 4V1DB 4BQ6A 2IAMA 5B5EE 3R8BB 4K55A 1M9SA 3IFMA 2CQVA 3IPEA 3NCJL 1P84E 1G1IA 4N2GA 1A7OH 2WXFA 2ZT9B 3F7PC 4N1HB 3FQTA 2VN7A 2WSEH 1LO3L 4LEBA 5BZZA 3CXFA 2EYTA 1AMYA 1FL3B 1GHFH 1HK6A 2UVEA 1CFQB 1E5YA 1RUKL 3CX5H 1URQC 3C5SA 1ZJAA 3SCMD 1CG9A 5ICYA 4IRJA 4PLKC 3O3DB 5IB2A 5CEYB 2XNDH 1AE6H 3JZYA 4LIQH 3AT0A 4M1GL 4Y4HD 4PN6A 1A7RL 3GNML 2WKOA 4NSKA 4NWTH 1KCSH 1B4JL 4NN7C 4PJIF 4ADGA 4DP8X 1SOXA 1CICB 4L73A 4ZUVA 3AM8C 4NOFA 3BD4A 5E6UB 3W0WD 2IX7C 1N8RQ 4K23H 4XA4A 2W07A 3O3AA 1L5GB 1KELH 4AMXA 1NKRA 1U3JA 4BHUI 4AEFA 1PKOA 4UBDD 2M5AB 2WBJB 3FFDB 3V4UH 1F3JA 4U2ZA 4WEBH 4FLRA 1UGKA 1MY5A 4WUUA 5DR5H 2G5UA 3U0WL 4L8SB 2A9AA 1QVGO 2ICWB 1DEEG 3U6RB 2UXTA 4P4KC 3D6GA 1TXKA 4GKSB 1OGTB 1BEXA 1KLUA 1VFMA 5AYTA 1P6AB 2P8LB 5DFWH 1ZLWK 4DKEH 4Y5VA 1L7TH 4KXZH 3NA9L 4GW5A 4N0UB 2B0SL 3ARUA 1BREA 1P5UC 1LJMA 3HTKB 4P99A 3N04A 3RVTC 2VL5B 4LHUD 3LHPL 4DVBB 1OQXA 2YBGA 3O9WD 3U36A 3EFGA 5A7EA 5F7WC 3L7EB 3NTCL 1M05B 4HX1B 2DIBA 2LLNA 3FUDA 4QF1A 2JELH 3WS3A 5EEXA 4XNUL 4X7FC 3LNGA 3O81A 1YTZI 1YRKA 3AWEA 3C5XA 5HDBB 3L3KB 2AQSA 4E9XA 3AQZA 3O4OB 1PY4A 2KQMA 4KO6A 5JHMA 4LGSB 1OTUD 4Z7NB 1S7VA 1GOFA 3JTTA 5CZVH 5I8OL 3DVNB 4PR5A 3NMDA 4YPGB 2O3JA 4AW7A 1Q94B 2FSEA 4UQBA 1QR1A 2BCCJ 1QNIA 4F7MA 3IU4L 4L3FA 1E40A 3T2LA 2EXYC 4G8GB 3TO4D 1KCWA 2YQGA 2L4OA 2O30A 3SCMC 5E6RB 3TYGL 3TBTB 5FYKH 5PAZA 3W67A 4WI9A 3WCYA 3GB7B 1UT1A 4L1BA 1ID2A 3N43B 4L4JA 2R3SA 4XCYB 4LSDA 5ITFB 2PCFB 4HB1A 2D7NA 4QMEA 1GMEA 3I9PA 4UT6L 5HHME 3DPDA 1Z9SB 4NWTL 1NCJA 3KPMB 2FXMA 1XH1A 1IM9B 4WGVB 1HILB 3MCLH 2CDFB 2WV3A 4JHAL 3K4DA 5IQLA 4WUUD 1E67A 2HT4D 4RLDA 4UBDC 3ZMEA 3UERA 3LV3A 1XGTB 2WP3O 5L8JB 4NSKB 1H15A 2X6AA 3OLIA 4U6VH 1U3HC 4YLCA 5I0XA 1LEIB 1LO2H 2IPKB 2NLJB 3L73G 3NJMA 1FFPB 3JWOC 5ELIA 3HN3A 3QUXD 1UOKA 3EBIA 4N26A 5A3ID 3L71D 5AVSB 1JTTA 3UTPD 4X5XB 3WIHH 2O61A 1A9VA 1JNJA 1C5BH 1G7JB 5KVFH 3ARFA 3TGXA 1EJOL 5J11C 2VLME 3MREA 4P59H 3NK4A 4GS7C 4FEMA 4UILH 4ZS7L 4KXAA 3R0NA 4AK1A 2DQHH 3ATBA 1F18A 1W0VB 4WSJA 2IAMC 2J3SA 1W0YT 4PJFB 1QKZH 4KJQC 3ASWA 5J11B 4L2YA 1CFQA 4U6HB 2N59A 3FH8A 4ZDHA 4XO9A 4LU5H 5ILTL 4BZ1L 1NOLA 4OFQA 5I2IA 5DQ9A 1OZUA 5CJOL 3BN9C 4G43A 3LZPA 2B3IA 3T9WA 1BCCG 3L3IB 3ARZA 3HTKA 1SQBK 5I74B 4G82A 2LR4A 1OPGL 1URQA 1U3HB 1N2DC 1X5YA 2JELL 3J07A 4GRLB 2CR0A 3IDMA 3SDDB 3AE1C 4PD4D 2GEEA 2JH2A 1H0TB 5B39B 2OMVA 1L9NA 5HVGB 3B2PA 4NZRH 3BUTA 3ZO9A 2BNRB 1A8ZA 4YHLH 4D0BA 2NY5C 1JS4A 3QG6A 3ZKMC 1PPJE 3LVTA 2NY2C 1AI1L 3AM8A 3ESOA 3QJHB 4LSVH 4JMNA 4NQUA 4NQED 4JHVA 1NINA 4DGVL 1ZHKB 1RPKA 2DZEA 3F8UB 3NABL 4BSJA 4TQ8A 3IJ7A 5DRNB 5LGHH 1OF0A 4X6CE 1EMTL 4RGMC 3AG3B 2NPSC 3Q5TA 4JFFD 4YC2B 1FC2D 4ISVB 1SJEB 3QXWA 4Z7VE 3RWIA 4ZZKA 2CUIA 2EC9T 1DVUA 4D8PB 4ZNEE 4EI5A 1OCCB 2NRGA 4HZLA 2SPZA 3V4PB 1FG2B 3EZ8A 4OD1L 3ZR6A 4ZNEA 3WTUA 1H3GA 1JPFA 2DQEH 3GQFA 1XXFC 1CI6B 2H3NB 3CFKA 4PJ6A 5E99L 1CL7H 3A6BH 2JJTA 1FORL 3D39B 3EF7A 2ATPB 3NP4A 5IESL 3K7UA 1J8HD 2J1YA 3HMWL 3OKEB 1G9NL 2BVUA 4KKNA 3RKPA 3KYMA 3U4EB 4CAGA 3C5SB 3QDGE 5CGYD 1P5UA 4FZ8L 3Q6FB 4K2UL 4N5UA 5EU7C 4PGEA 4OF8A 3TT1L 5L2KE 2DI8A 4YZWA 1UWGH 3NCWA 5DJAA 3CAFA 4L8BB 4W70A 3BCDA 5F72S 1EBAA 5KAIE 2H43A 3REWB 5JOPE 2CDGA 2P48B 2WLHA 5F6IC 2K70A 4C83A 1DBJL 3PL6C 1MFEH 1WK0A 1CO1A 2P45B 4HD9A 4S11A 1USQA 2IBZI 1ZGLB 2QMJA 5FECB 4C8XA 1JMZA 2UXFA 2ZCKH 3UTQA 4EN3C 3Q13A 4U1SB 4P23A 5BMFH 4GW5B 2YWZA 1T0OA 1XH0A 1SYVB 2M8XA 2LU4A 3PAUA 4DJMA 5GSVB 4J3BA 5E94A 5EU6B 4XAWH 1SVZA 3FO9A 2L04A 5A6IA 1YJNP 3DARA 1BMZA 1OAZL 3II2A 3QARA 4K94H 4KH2A 5AZ2H 4UAOC 5KSBB 3H1JG 2UWEB 3SPIA 3WNLA 2K9YA 3VFWA 3L16A 4GP4B 4F58H 1AMXA 4YR6A 3QIBC 1CQKA 2HLEB 4J3XA 3L8QA 1HHIB 2DM3A 1ZT4B 1E2VA 4C4BA 3NCEB 1RLBA 1WWAX 4QRSB 1CK0H 4KK6D 4Y16B 2R29L 3NJIA 4MSWB 3V0AC 1U8QA 1WS8A 5CLTA 1U7MA 3ESMA 5H37A 3UPAA 1OHZA 1BIIB 2APWA 3QULB 3BKMH 3K8MA 4YHIA 2VDQB 3HNSL 2WPVB 1FNSH 1QHPA 1WC7A 5AOIA 4LGRB 4Z7UF 1CE6A 1G1OA 1XF1A 2RCSH 4S1DC 5FCSH 5FO2A 2O01J 3EYUH 1PSKH 2R4SH 4BK5A 1CFVH 5JXEC 2ZXCA 2CMRL 5F93C 1JGUL 3UBHA 3TBBA 1QPXA 3A0HE 3MGAA 5J1SC 3HUJF 1Y0LA 2DB8A 5INCB 5T1KD 1TJXA 2GJ6E 3BAEH 4XMKL 3VYNA 3W81A 4KUCF 3IGUA 4Y1AA 3EO0B 4PVMA 5GISL 4XPBL 1XGUB 5F9AC 2RD0A 2ZYHA 3CIAA 1T3UA 2PP7A 4WW2B 1IGCH 4CMHB 3UYPB 4QRRD 4R0LB 1KYOI 3RVUC 1R3LA 4TVSa 1DTUA 1URZA 3DUHA 1PNDA 1D5XB 4YSSA 2JTDA 4NWUL 4PJXA 2OJ1A 1NMCB 5D7KD 3ZTNL 4FADA 4Q9RH 4JFTA 1P7KA 3ZXAC 3CXHE 4U1JA 1M6OA 3A7OA 1LMIA 1XGQB 1OTUC 3HRZC 4GRWH 2YS4A 3BT0A 4HGKC 1IC7L 4EN3D 1XZWA 2OSWA 4WENB 2LHAA 2E27H 4YHML 5C7ZA 1DQLH 3CCUP 2BVPA 1BBDH 2DQJH 2H32B 3S96B 2V7NA 3E8VA 4TUOA 1WBXB 2IANA 4UQCA 3VNZA 2AK4A 1GZQB 3QDMD 4LDEB 3II3A 4J3SA 3IJ8A 3BHBB 5AB0A 1NCCH 3K4ZA 5INDA 2WOYA 2GI0A 4M00A 5EC2B 3SYOA 4HZAA 2J5LC 2IGTA 1JY3P 4I0PC 3N40F 4M9PA 3BP5B 4FFYA 4DT2A 4ZX4A 4XVSL 5LAXB 5CFHA 3MV7D 1SJVA 3Q06A 3BRTB 3DOIA 3LX9A 1R3JB 4DP0X 3SOBL 1S9KE 3TBVA 4JRXE 4GW4B 2ZOTA 5F9JA 2WKLA 5IHLB 2Y69B 2YRZA 4J3OC 4ZFOA 5BPPA 2VSDA 4R83A 5IHZA 3HPLB 4TUKH 5DO2D 2RMZA 3RU8H 2KYVA 3T08A 5TE6L 1TNMA 2FY8A 2BNQA 5FB8B 2JJTC 1K6QH 2IMNA 3E1F1 5DVLA 3IN6A 3DX7A 1DEEB 3FAXA 1WITA 1NEUA 1M1SA 4PJ9D 4MRCA 4XNZB 3GMRA 4BGLA 4W68A 3D34A 1CDIA 5DD3H 3S2AA 1RZKC 1BYPA 1YEJH 4YBLB 3I3DA 4S1DD 5JUEL 2J55A 5DJZB 3TFBA 1F4WH 4ZT1A 1Z3GH 4WI0A 3HE4B 1UKQA 2Q2EB 4AXWA 4JHAH 1KXTA 1YN6A 2VO5A 3RA7H 4U6YA 4H26A 1SJEA 3LNEA 5F7LB 1JZ3A 2ED8A 4HJSA 3RUGA 4PLOB 3USSA 5AB1A 5IUSA 1J1OL 4IBLT 2MTPA 1SQVJ 3LKSA 3ZU8A 1UIIA 2CJUH 1XEUA 3QGVA 5IJBC 2OK0H 3H9SA 2JWAA 1PD0A 4YHOL 1W8NA 3BD5A 3TH4T 2QKIA 3GXPA 4BSWA 1Z5HA 2G3XA 2X88A 1NC4B 1Z0NA 3K8KA 1E6JH 2GABA 1UD8A 2ZXAA 4PRHE 1HE7A 3BWUF 1HNYA 3MRIA 3RPIB 2E86A 5I1LA 2F5AL 1A3ZA 4PS7A 4WWKB 4DETA 2PYFB 5EPMB 1UXWA 4PJBB 5AAWA 5DA0B 3DJTA 3OAUL 3WE6B 1HKLL 5DJDA 5D96B 1AQKL 1IC0A 5AYQA 2XN2A 4JX0A 2JF1A 5TE4H 3VX1A 2WNXA 4L3EA 1CF1A 1MCIA 2Z93A 4RRPA 3V0VB 5SX5K 4MD0A 3PWPA 3QIBA 3L70J 1UWYA 4QD2E 3HMXL 4HF5H 1EFXD 3WEMA 4FI6A 2XWJA 1A8JH 1KB5A 4JPKL 5D93C 2BMKB 5HDBF 4ZO7A 3UTZA 3FBQA 1RUAL 4PRID 1UKTA 3VW3H 3OHXC 4PJDE 5L4IA 3GTNA 3MLXL 3MCKA 3MTUE 1P69B 3FXIC 1RZ8B 5DSCA 5BZDB 1JYWA 2XBDA 1NTKG 3RBSA 2YMYA 4ESKA 4YWGH 2P44B 4ODXB 2GB2A 3KWTA 2OL3B 1J0ZA 4GO9A 4JPVL 4Q2ZB 5C97A 2YPLD 5ECJE 3Q5PA 4AZUA 1XF2B 4MCNA 5I66A 5JXEA 4LLQA 4MJ5A 5F7AA 2YC1B 3GBEA 1LXMA 3C60A 4O4YL 3U9PL 1RJYA 2K1AA 3ARYA 1A64A 4PW9A 2WP3T 2XFGB 3F64A 1S9KD 3HD7A 1SYSB 3N43F 4ZOCA 4ZOEA 4OI7A 2YAMA 2XQ0A 2IPUK 1PJWA 3CZJA 3CFCH 4C7RA 4JFDB 1U6AH 1OAUL 3IDJA 4FJYA 3SDYH 2NXYD 2FE0A 3S4SG 2JKVA 1B6DA 3ES6A 4ANUA 5JLZB 2WSFJ 1EFXB 4EEEA 4FG4A 4N6RB 2WZ0A 3LNIA 5AW0B 4LCWA 1A21A 3MZGB 4A7SA 5MI0B 4H88H 1REIA 4UOJA 3C9NA 3KCPA 2DYRB 5BO1H 7FABL 3IXTB 4QUOA 1FZBA 4F7PA 4QJ5B 5DWPA 3IU3B 4N87A 5KAQG 5AVRB 1TFHA 4XBGA 4UWQB 2IALB 3U2IA 2IH8A 3QZMA 4UM8A 1WD8A 3GTTA 3V6ZA 3G08A 2WXNA 2QFPA 3WDHA 1LK3H 4V2BA 3BVHA 5DQ9B 3POCA 2CRIA 1U8IB 1B9KA 1IIIA 3EGXB 5LBSA 3TOPA 5F9WC 4KMTH 5KSUB 4IBUA 4PRHA 2DEXX 1NEZA 1GAFL 4GPVA 4LE8A 4N3YB 3H9HA 3LIZL 3KMDA 5L6YH 4M4RA 2Z65C 4JEGB 4QXVA 3AECC 2FJUB 2IQ9L 3LRMA 1URLA 3IU4H 3ZRFC 4GAJH 4IBSA 5F2FA 5K9QI 2AABL 1H3VA 4JVPA 1YECH 3CG8A 3VXOB 1TLKA 3P0GB 3QXDA 4AGQA 1H9DA 4WY4C 4I0PA 5FYKL 1TTCA 3Q2CA 3RJOA 3KS0H 3V52H 2ZP0T 1NHLA 3HZYA 1U4EA 1I53A 1A6VL 4MJJA 5I1CL 3FRPG 5C1MB 2JKWA 4FLHA 4OM1H 3GMQB 1DO5A 5DURB 3DHUA 3LQAL 1MUJA 3CQPA 5F7FA 4BFRA 5F1SA 3KLAA 1R5IB 1I9JL 1W72A 1QFUL 2DM4A 4WY7H 1SQPE 4E42A 5IHBA 2PWGA 3IJSB 4E0RA 4IGBA 4UCFA 5LNGA 1CD1B 5DZLA 2WW8A 3TIDB 2VLJD 4HPOH 2HPOA 1JV5A 4I3RH 4G9FB 3FSAA 4DFHA 3QEGH 4GT0A 3MLZH 3D85D 5CD5C 4NZDA 2BH0A 3VGAB 3WIFA 2P1YA 4LCUB 5TTRA 3MBEB 1U9KA 4ELKA 4MB4A 2M8RA 5B66E 1F0LA 2EE6A 4PJDF 2XZQH 3W1ZA 3AREB 4HIIA 5IJKC 4FXKB 2D0HA 3HS0B 3RHWK 3I9GH 3I74A 4RZCB 4TNVK 1OCZB 4MJID 3BSZH 1IKFH 4LCWD 4UM9B 1VCBC 4Q56A 4IJ3B 1JNLH 2KLUA 2L7EA 3V6FB 3DMMD 1FZMA 3OX8B 1T0PB 3MRMA 4Y4KB 5C9JA 4DIXA 4JVUA 3RZCA 2YD5A 2PP6A 3LRSB 4JDVA 5AVZB 1QZ1A 4D2NA 4PAZA 3TONA 1FIGL 4NQCB 4XR8C 1YI2P 3MXVL 1G2CB 5LWYH 4OKVA 1ETB1 4PP2B 5J12C 1OM3L 3OLDA 1XD0A 1IEBB 2QQNH 4MLSA 4PJ7F 1PP9D 1GZHA 1G9NH 4U6YB 2TSAA 4RAUB 5EFWB 1FOSE 1E50A 3EJCA 2WIIB 4YUEH 4U7JA 1HINH 3WUZA 4M6NL 4F92B 1I7UA 2L3BA 4A38A 2XZAH 1KENH 1OV8A 5LB1A 4CW1B 1QATA 3FQTB 3GKWL 5AL0A 4QRUA 3TYFA 5BOJA 4I0KA 4RRPM 4GNKB 2VDRL 2CDEA 2YO3A 4B5ZA 2I60H 3G3ZA 2C3GA 5C2UB 1G43A 2CO4A 2PW2B 4YPJA 2O6CA 4HIQA 4UZSA 3L5XH 1TCRA 2VM4A 1SN0A 1JGVH 4Y4FD 3FQWB 1KWGA 4NHCL 4GEJA 1MXGA 2WXMA 4HT1H 5LCVL 4F93B 2IWKA 1UEMA 3H2WA 3QRLA 4OZFH 5C0CE 7PCYA 2WTOA 1SQMA 1IAKA 1OAXH 3D25B 3NACL 1R3HA 5E2WH 3M7FB 5C0RL 1MRCL 1YNKH 3LS4L 1SHXA 4JZJC 2ARJQ 4CL7A 4X98A 3H1ID 4MHHI 3AITA 2WZAA 4KKLD 1P7HL 4L0YA 2KLTA 5GS0L 1N9PA 1VSCA 3C60C 5F88A 4PREB 3B9AA 3U9UB 2E42A 1ZXKA 4MAYB 1JF1B 2VR5A 1E8YA 3DHPA 3FQ4A 5I15H 1A0QH 1HC1A 3I6GB 1PPIA 1DLFH 5DD3L 3UXFA 2R1WB 4A2FA 2V7NB 5SX5H 3O0RH 2XT1B 4CVZA 5E5LA 4MZ3A 1HQRB 4GAYA 3T65A 1UOLA 5KBNC 2OMZA 5GGVY 1MUJB 1NOFA 4TVPL 5E56A 1HSBA 1YBKA 1FZJA 1NBVH 1VQNP 4UQ2A 2V37A 2VERN 1WP6A 5ICYB 2R23B 2DWDB 5D2NB 3ARWA 4J1UA 4MLIA 4WHDA 1F4HA 1NCTA 3WFZA 4WRLA 3U82B 1ID5I 1L6XA 4TNVF 4ZW3A 4OCYL 3VXQB 4TNWF 1M56B 3HUJB 4H20H 4JCWA 4YHPA 3HC0B 4WTQA 4XC3L 2HUEA 4K0OA 3QUZC 2WXGA 4PYGA 4QF1B 4X99A 3RWHA 2E5TA 2KZIA 1KNOB 2C3XA 3IN0A 4OLZH 3TCXA 1N2RA 1MJUL 4HIEA 4NM4H 3BP7B 4XGZA 1N6VA 2CXKA 4KOBA 3FB7B 2ZG2A 4JM2A 2N1TD 4NC0B 3UBXI 5IB5B 1R5WB 3HC2A 4DPAX 3K72A 3HC3H 4GO6B 1WZKA 3NCYP 3UBXA 3IFPA 5C9KA 4H2AA 1XTLA 3L95A 4PGJA 4RGNE 5J9PA 3PLYA 2FYUD 2C3HA 1LL1A 1S4IA 2B14A 3MACH 3KJ6H 3G5YB 3B5NA 5DD0H 2Q20A 3FGAD 3K0WA 5J6HB 3P9MB 3CCSP 5TQ0H 3W2DH 3TA3A 3IVKA 2ESVB 4Y4FC 2DQDL 3FXEA 3OPZL 1UB6A 2XU6A 3D2UB 3CFDA 2WLNA 4MA3A 3VD1A 3OQ3B 1ZANH 1YC7A 5I76A 2BY1A 3LN5A 1QQDB 3K2MC 4EI5C 1ZR2A 1TQUA 2DYPB 1RPUA 4NM8H 5I5MA 2Y0DA 3C60B 5T5FA 1D7MA 1SHMA 4AVKA 2VXSL 3BH8A 3AREC 3L70D 2XQYK 3HC4L 3MLXH 1LO4H 4JZJB 1SP4A 2WXKA 5CJXC 12E8L 1CICA 1CPUA 5AW1B 2E43A 3LKRB 3IETB 1QLEL 4XC1H 1U6AL 1RHFA 2NY4D 4YDIL 5EBLB 4Q97A 1NANH 1FYHB 2W9DH 2WBJC 1V10A 4HWUA 3BKML 1RU9H 3JV6B 5MEND 5I6XB 2YSSB 4LSPL 3O4OC 1A6TA 3IFOB 3QJSB 1H9VA 4Q6IC 3U9PH 1PX3A 3KPOA 4Q58C 5A2LH 4ZMTA 1YYMH 1SLXA 4FQJH 2CRYA 2YMKA 1G1CA 1GSKA 1QSEE 5F7YC 4BWUA 3O6ML 2CJ3A 2HJFB 3JWNH 5EU6D 2FWOA 3HFML 3O2DH 2EVHA 1T2JA 4M48H 2GC4C 1SDDB 3BEVA 3E2HB 2IJ0C 5GIRB 1D2OA 4F8NA 4P23C 2FYZA 2PLTA 2ADYA 3IFLH 4S0SD 3MRFB 4YGVA 4WWKA 1ZLEA 2BIQA 4TL4A 4PJ8A 1MCFA 1WS7A 2XV0A 3T6VA 2DI9A 3L4ZA 1XGPB 1FZMB 4QHNA 3EO9H 4U05A 3B37A 3O6MH 5KVGL 1SXAA 4AK2A 3T2NH 1L7TL 4JDVB 5KAFH 5KAQF 1J9CT 4LNRB 1GW6A 3D30A 4KGLA 4POUB 2DBLL 1CBVL 2DQTH 1RZKL 4AQ8C 1RURL 2P26A 2W95A 2CR6A 1OEZW 2JCCB 4XMVA 3O11A 1ZV5A 2E7LA 1IGTB 3US9A 1ZLSL 3RK3E 1QVOB 2VXTH 3QISA 4FABL 3UJJL 4JBSA 3SD5A 2HG5A 1I1YA 3GB7A 4NQSA 5DUBB 4NQEA 3OQRA 4Y2DC 2X44D 3LXBA 2F58H 5LBVA 2ZCLL 3D07A 4PJCA 4AQZA 4HK3J 1GY1A 1OZHA 2IOOA 2P7TB 3FQNA 4O9HH 5HGGS 3SYCA 2V2TA 1ROWA 2B1HL 4UB8E 1Y9BA 5ERWA 2JJLA 1SQXJ 2QE7H 2VH5H 2I69A 4EI5D 5CCHE 1LTIC 2J6EH 4YDLB 5ABZA 1YEGL 3B5HA 5FYJD 2P5WB 5DXWA 1MDTA 2YGNA 3H1LD 5DD5L 4MCYB 4DCQB 4G6JL 3QXDB 1YEHL 1PGJA 4A7TA 3MJ8A 3H6AA 3P11L 3FU8A 3B6SA 1CFSB 4UMSA 1F1GA 1LTJC 5E70A 2H0PA 1KFNA 5IVXA 1S8DA 5C08A 1QI5A 1CYXA 1YNLH 2HFEB 3BZ4B 3EKCA 4NQCA 3U1QA 4FQ1H 4YLQT 1G9MC 3L3OA 3RUGE 3SKMA 4PWGA 3QEHB 4Z7WE 4G8IA 1DN0A 1DP0A 2NX5B 4N0UA 4XP5H 3BPLC 1FNSL 3QPQD 3B7YA 5BS0D 3D1MC 3C08L 1QASA 2XSKA 1UUNA 3NN8B 3NQIA 2WPSA 1KBKA 2E7MA 4FG6D 5HGAB 5DFVD 3M6DA 4BCXA 3WN6A 4P23D 5H4ZA 4N8CL 3CX5E 4XX1G 4ELME 5A40E 1CIDA 4N9OB 3RBXA 1KGCE 3S3JA 3DA0A 4EIGB 3TBCA 2UYLA 3DC0A 3GIVB 1NDMB 4PW4A 4U4IA 4W81A 4CVXA 5IROD 4G6MH 4UQDA 3BRDA 1KZQA 4JHZA 3RY4A 3CLQA 2EABA 4PJ9B 1KGWA 1MAJA 5AAPA 1UT2A 3CVBA 3JSSA 3L4TA 2IF7A 4H0LB 3QUKA 5DD6B 2DQFA 1L4IA 4C56A 1N68A 3BWZA 4ZW7A 1HS6A 1KIUB 2Z7UA 3GSRB 3DUUB 2V8MA 4ABVA 3P77B 1F13A 1OIOA 3DYMA 3TZVC 3GTVA 1A7PH 1WWBX 1F6AB 3NFNB 4KZEH 3DMMB 5LHDA 3CDCA 3N85H 2ENPA 3CXHJ 5KTBA 1P84J 3P0VH 4JPIB 4AJYV 3D39D 2BZCA 2GJ6D 4ABUA 3O6QA 2FH6A 3X17A 5TISH 3BFOA 5KTEL 3Q2NA 1WCBB 1HGZA 3ARBD 2EZ0D 3H1HE 4GSXA 2LFGA 1T3JA 2ZP8A 1HI6A 5DS1A 4P9HC 5F7BA 4XGZB 2BASA 2IWEA 4M62L 1RZGB 2AHIA 1RSYA 1J05B 3ZE2F 5C0RH 3E3QE 1BGYE 1UZ8B 2CR3A 2XETA 2UZYA 2JIXB 1L0PA 5DS8B 5IREA 4N9GA 4K3DL 4XVUD 5LKNA 5J1TC 4I7ZC 1CLOH 1J0HA 1J8SA 4EDWH 3WAJA 1SY6A 1L0NG 2FGWH 3FQYA 3NDZE 4IS6A 5AG9A 1WAPA 2YR3A 4IKJA 4XNUH 1FO0A 4UOW1 5HDQH 3C6EA 4NUPA 1D7DA 2W60B 3QDME 2QKIC 4L4VB 4KV5F 5IOKA 5TH2A 1K8IB 2EJ1A 4W9ZA 5DMKA 3MYJA 1FGNL 2J2ZB 3KXDA 2ZCHH 3NQKA 3JBG7 3PNWA 5C0IA 4BQCA 3KEHA 4MNQB 3S8GB 4P2OA 5E8DH 5FW8A 3KR3H 4HHWA 1SQPJ 2A9MH 2P3YA 5KVDL 4CGUB 1XGZA 3F7KA 1H5BC 1NGQL 2BVYA 5DFVC 1WFUA 4Y28J 2GKIA 2VLMD 4AQ8A 2VRAA 5DC9B 4FFTA 1NJ9B 1H8AA 3X1FA 4IQHA 4G42B 2O5ZL 4WEMB 2IAND 4CJ0A 1SQBD 3LEXA 1ASQA 4AYGA 1Q1JL 3W11C 2WVVB 3QXUA 1NMCC 4OZGF 3KJ4B 1N70A 1UT9A 2XWCA 3H4FA 3LVEA 4F20A 1UD2A 3Q3GB 4MDIA 1OP5K 4D9QE 1IT9H 1FBMA 2BCCG 3MU3A 4YBLC 2Q8BL 3TVMB 2F0CA 3TZVD 2YHGA 2J72A 4D8OA 1BZDA 3HNTH 2HODA 1U3ZA 3FOLB 3FUNA 1VERA 3CVIL 1DBJH 1HH9A 4GAAA 3ARDC 2OX5A 3ARED 2HRHA 3PP4H 1C12A 5EIQA 1BW8A 4KZEL 4RBPK 5JPMB 1FHGA 5HDRA 3F5WB 1K05A 3IDNB 4M6OH 4P9ML 4LIQL 5L4FA 1BIIA 3QC5X 1FZOB 1X4XA 1R8EA 2Y1VA 4A7GF 5L8KB 2J5LB 4OZ4B 3ZIMA 3KXFA 4QRSA 4N1EA 3WGVB 1BGYJ 4UILL 1Q0XH 1F3DH 3C8HA 3O6FD 2DLGA 1TJGH 4JCLA 5DJDB 1A66A 2AK4B 1UXMA 3ENEA 3MBWA 3VD9A 3P7KA 1U8LB 1ZIBA 5EO9A 1KILA 4R5VA 2YUVA 5SWZB 1MWOA 1R1CA 1X5HA 5AD0B 5I73B 3LZFL 4W6YB 3BP4A 4L37B 3LS5H 5E6IC 4HH2A 3NZUA 1MW0A 1OAJA 3LRGA 4UNTA 4X8CA 3HUSB 4YHKL 4AYEC 1BMGA 4KZ0A 3HS8A 3CFBA 5A6MA 4Q0XL 1L9OA 4LRIA 3L9EA 1A4KB 5E2JA 3AQYA 5JQHC 2EILB 1L0LD 5CCGD 2H26A 1SQQE 2BCKA 3CLEH 2YA0A 4IIQA 3VD5A 4I7ZB 2ROYA 3KWWA 1CXIA 5MERA 1OX3A 3ZE0E 3WY4A 2XWEA 2JKSA 3WNJA 1DJWA 1J0JA 4OWFA 4QTHB 3UX9B 4R4BA 3SDXB 3FPYA 3GK8H 2OAAA 4JZOB 4EIJA 1K2DB 5EO1A 2JP3A 3PHSA 5IMOA 2F68X 3BXNA 3HKZA 2J1XA 2ZCKL 3MHZA 4HXAL 3QIBD 3MLSL 3SDYL 3GMAA 1PG7W 3UZQB 4A68A 4F37K 5GRJL 3O2WL 3OA7A 5IG7A 3IGKA 2BRRH 3L13A 4Q52A 4N90E 1N3NA 5IMKB 5IIEB 4G1EA 4PWIA 5KOMC 2VISB 4H1LH 5D1QD 2CPUA 4YSEA 4OI8A 1J7VR 1FZAA 1HHHA 3EGSA 3MCKB 4MAYD 5CLWA 1L4AB 4JFDD 5IT2L 1G7QB 2Y3AA 2E4TA 3GSVA 4O58L 4FAAB 4NWUH 1H3UA 3KGSA 1U33A 3HN8A 3AQXA 3UJJH 4UOZA 4X6EB 1DQQA 1WA0X 4K7PY 5CEXA 5KLIB 2J12B 5JXED 1HHIA 2GIMA 3EGXA 4JRYA 3VSQA 1IC7H 2P24A 3FBKA 2MNWA 4PJDA 2UZXB 3RWDB 4EOTA 4J27A 3H4HA 3TBWB 1OTTC 3A4FA 5C7XH 1FDOA 1NTMK 1EGJA 1LGHB 3WNIA 4DP7X 3MLRL 4ZAKD 1WUNT 3WL9A 3PDGA 3AAZA 5J1AB 1XGQA 3VJ6B 2XTLA 3WFBH 4KH9A 3U59A 2V6HA 4R2GB 5FOJA 5HHOA 1INEL 2VJXA 3S4RA 4OM0L 1ZLVH 4UNUA 5EWIH 2QVAA 3RVUD 5I23A 1R0AH 1CUOA 1ZVNA 3N9GL 3LKQA 4O9BA 3TEXA 3RK2C 3OKOB 3OTTA 3QEHA 2NY6D 1LT9A 2ZKHH 1XIWC 2GEQA 1JV2B 5BW7A 4W7YA 1MCPH 2ERJB 2AXHA 1BYOA 4XCCH 1LTGC 3LDBC 3MBWB 1G6RB 1WFJA 1NLBH 4H13B 1SDYA 3BW9A 3MV8E 3O3DA 2VR6A 4WFGD 2LU5A 3DGGA 4FTVA 3F6LA 4GRLC 3FTGA 3OGOE 3QNZB 4H1LA 3CN2A 4I87A 4K3JH 4WJKB 5DJ6A 5EBGA 3WMSA 1RIVL 4H0IA 4KVNH 4UOQA 3B43A 3P1VA 1EDHA 5SWSA 2EUZA 2BY2A 2QSTA 3VCLA 4Y9EA 2BOBB 2YPVA 3QCTL 3NP3A 3Q8FA 1FAIL 4TUJA 4BZ1H 3H1HG 1JWUB 3IKKA 1ZMEC 3PABA 3QZWA 3BATA 2CLVA 5TPWH 5KYWA 1JZ5A 1KCVH 4P06A 3DIFB 4GG6A 1MIMH 2W83C 3D85B 3OJMB 5D8JL 1JGIA 3LIEA 25C8L 3LEVH 3D3VE 1T4KA 2B0SH 4HXAH 4J12A 2C9NY 4NNYB 4EKJA 5K9OA 1MRFH 5DI8B 5IR1B 2DAVA 4QTFA 1FDMA 3FZUD 5I6NA 4MN4C 2Q3ZA 1ETZA 4OSUH 2W6AA 3EH2A 3P3TA 2NDGA 4J3OG 1JXKA 2XQBL 1HDMB 3IDIA 2WXHA 1BZ9A 3VFPA 4F57L 5GJSL 1IFJA 2UY7B 2OMWA 1NFAA 2APFA 4L5FH 3QXVA 4XC1L 2P47B 4DN4L 4GO8A 5HVFB 3KHQA 1JUFB 2CK2A 1NC2D 1IM3B 4LLUA 3GHPA 1KFMA 1HWTC 4M1DH 1FE8H 4Q6KA 1O7DC 4EDWL 2PABA 4N1CA 3W5MA 4ZAKA 5KJRL 3VOPA 3IMSA 2IH1B 1FJPA 4HJ1A 4NKIH 2PCFA 2OSLB 1GYVA 2YKOA 1OTTD 4R96A 1KIRA 4BUGA 7CGTA 5C07D 1G7QA 5HHOD 2HMID 2C4FT 2YD7A 1XQ4A 2E6QA 3CVDA 4X9BA 3VQ2C 3QRGH 2Y7NA 3W0WE 4QXGH 3VYIA 4YSQA 3UTTD 4LLVB 5F6IB 1NBYB 2VMDA 3CXDL 1WD9A 3AACA 4DO5A 4KQ3L 3VMAA 1CLOL 2O1KA 4L4VA 5DMYA 1HZKA 3MLUL 1ZA6B 4GQ9L 2WXJA 2AEIT 2F6AA 2NOYA 4KX8A 2WNWA 4PS3A 1NC4D 1GYUA 1IAII 1PEZA 3MRRB 4UTCA 3TYGH 2NY6C 4JCMA 4OZGB 2Q76A 3AJ7A 4HJUA 1JD7A 1Q72L 2Q1EA 4NQTA 2CNYA 4OF3A 2R1YA 3D2TA 5EN3A 3V7AG 3DVGB 2KL6A 3TBYB 4F8TA 1NL0L 2BZDA 1DQVA 3IJ9A 1L2PA 4UQ3A 1OSPH 4HLZH 3T4AB 4RMTA 4KQ3H 4TVPH 1RZKH 4FMVA 4WO4A 3U36B 4UTBL 4QOKB 3KBEA 3Q9PA 1IGML 3QQXA 4HFWB 4PRAB 3V6ZB 2GPZA 3HG2A 5CKGA 3V7MA 1AZZC 3I6LD 2G4GA 3L4VA 3U1SL 4MQ7A 3MMEB 1PX4A 4ISVA 1MF2L 2N9BA 2P42B 4B0MB 1F6AA 1JYXA 3ARDD 3B9KC 3ZQXA 5EEVA 1A02J 1KB9J 4EI5B 2I1KA 1TOXA 4O00A 4X4YA 2HPCB 1SLVA 2Q3XA 3MRMB 4BFIB 2X2HA 4W9JC 35C8L 3N40P 3QQDA 4TLUA 4Y2DD 2MCPL 3WFDH 4Y7OC 4K5OA 5AKTA 2FH8A 1F8TL 1I1AB 3FT9A 1F42A 1DUZB 1FV1A 1GL4B 2J8HA 4U6XB 1G0DA 4PCSA 3T3PF 1F3JB 3QAZC 3ZE1B 5GGTA 3QI9C 1ZTXL 4QHUA 5E8OB 4DPCX 2HYNA 3KYKH 1ASOA 3U9WA 4Y1TA 3D3VD 5AUMB 4HZ1A 2ZF9A 1FO0L 1RZJC 5KN5A 2FWSA 2Y1ZA 3VWJC 3M1BB 2WWOA 4LC1A 2F19H 3T5WA 2I07B 5D1ZA 4NI6A 3EH4B 3V4WA 3WN5B 4EF3A 1FJKA 2IMMA 1PW3A 3IFPB 4KI5D 5L4JA 5B4MC 4EVNA 4ETQA 5FYLH 1K8DA 1ZT7B 2JKTM 4JUSA 4HSQA 2Z34A 1TZGH 2OCJA 2YEZA 3BUDA 3QDJE 4TVUA 2QSIA 4XMPL 4Y4KD 3WNPA 3CZSA 1Z9LA 1TEFA 2Z5HA 3TYFB 2JO1A 3CVHL 3O2DA 4IFFA 2WWKT 4FL4C 1TVHA 2A1WH 5E5UB 4F2FA 5HDWA 1HKLH 1F4YL 1CXHA 2QELA 1AE6L 4XXCC 1SLQA 3HUJA 5FDYA 3ABKB 5I1JH 5KJ7A 2LU3A 1VZGA 3AEEC 4PP1D 4QWWD 5CJQH 4B6ZA 3UTSA 4F8LA 5FGBC 1Q82Q 3NSFA 1ZDSA 1AO7B 4MYPA 4DN3H 1GGCH 3MUGA 2FGWL 2GK0B 3LN4B 4QMAA 4LLYB 4FP8H 3MNDA 4OGYH 2CO7B 2ZT9C 1QSFB 5IVOA 3MI6A 3IS1X 4DZ8B 3CVHH 3FTVA 3P2TA 1EC5A 1YITP 1S9XB 2TRYA 3AXHA 4OD1H 1LT9B 4YAQB 5EIVA 1RAMA 2P5WD 3WFCH 1N7SB 3L3JA 5DJ8A 5J6GB 3HI6H 3OM3B 3ULUD 5IEKA 4P4KB 1BVLA 1RIUH 1ZV9A 3DHMA 5F89B 3OKKB 2NR6A 2AI0H 3BZEA 4NKMA 4FXKC 5MHSD 3UG3A 1FGNH 3JCUH 1EAJA 1F11B 1E4KC 1FCCA 3B1UA 3TA3D 3DNKA 4AX3A 2CKBL 3CL3D 4RFNB 4B3EA 5DZVA 3QFGA 1AGEA 3CDGA 3RWDA 3BT2H 1MNUH 1MF2H 3EO9L 2GYSA 3DTDA 1ADQL 2X4OB 4PJGB 1ZRTE 2F54D 4CSZA 4KDTC 5D7IA 4Y99C 1EO8H 4X6EA 3S35L 3WI9A 4UQIM 35C8H 3U83A 5KUKA 2MHAA 4JRYB 4D0BB 3JSVC 2FX7L 5EC1B 3K5SA 1JCDA 4RAVB 3VFVB 3EAKA 4C4UA 4P2AA 5CBEA 1SBBA 4LSTH 5F1IB 3QJRB 4N68A 5LDSA 4NN7B 1H0TA 3KPSE 4U1HA 5IMLA 2ARWA 1Q94A 4E9WA 4Z78A 3FUJA 5DHYA 4KQ0A 1Q72H 1MI5D 4M62H 2Q2LA 1I9JH 4PS4L 5MENA 2H6OA 2BWIA 1KFAH 3BDYL 3ILPA 3IS0X 3BE1H 4ALAL 5KW9L 3LDBB 4RX4D 3HHRB 5EZPA 4WLCA 3ULVD 2NNAB 3QUYA 5EZOH 5B4MD 4O02L 5F44A 1H6FA 3SGDI 4AY0A 3AEBC 5C0JB 1QSFD 3SB3A 4AYSA 4QOKD 3GZOA 3QNZA 2YFOA 1SBSL 4TSBH 4Y4KC 2W9EH 4NUGH 2B4CC 1XSIA 1M56D 3VXQA 1GKEA 4AL8H 4Z7NF 3H3PH 5KJ7D 3H9SE 3VWKB 2Z8SA 3WN5A 2AEJA 2G3NA 3IJYA 5MEQB 1GCFA 2KMWA 3WEBA 3FNKA 1TENA 3TYYA 4WGWB 5E00B 2DTMH 4J6RH 4K7FA 5DMIH 5IB1B 1CW5A 4N86A 2FYUJ 2YGOA 3QQ9C 1NBYA 1EHAA 3NJFA 1SBSH 2X6UA 5LXGL 4PD4H 2X0VA 3B7TA 5FK9B 5JOPD 4M03A 3O41B 3FH5A 3QAQA 5EZJB 1E9QB 5IM7B 1LO2L 3GYRA 1AV1A 3FSZA 2QPDB 1S7UB 3GLMA 2Z8VC 1BZOA 4G8GE 5DMIL 4ZNCD 5EBMB 3B9EA 4MX7A 5HPMB 2HG5D 1NQBA 2OV0A 1O9ZA 3BWSA 4F7CB 1MCNA 5GTHH 2DMBA 4NP4L 2F54A 4ONGL 3QP3A 1QI3A 1D5MB 1BZ9B 3MRPA 3VFPB 3W9EB 3KG5A 1Z9MA 2FRGP 2VQUA 1XGRA 2ZPKL 5B66H 3SYAA 3WFEL 3INUL 5MHSE 2HCZX 3V2RA 1WE5A 3MUY1 4G43B 2VXVH 5FDWB 2ZYRA 1OCWL 1JSYA 2PO6B 1CE6B 3D06A 4OD2B 1KQGB 4NENA 4TTDD 4F57H 3OHXB 3QORB 3V10A 4X5PA 3GMOB 4QJ3B 5I1EL 1EJ6A 3C5ZB 3FN0L 4KKAD 1OQOA 2K9UA 3D12B 4M9OA 5AG8A 1U8CA 2F53E 4P5KA 3ABZA 4BHUA 3U2JA 5ESVB 5EDSA 4EI6A 2PYEA 4QO1B 1FRGL 3GSOB 2BXZA 4AQAB 4F80A 5IHZB 1DQJA 4ELMA 2CAKA 3QEUA 1T03H 3L54A 1GRWA 4OLXH 3FTZA 3GGWB 5I71C 1A0QL 3TIEB 3ZYOA 2CA3A 4KXZI 5GXBB 2DWEB 3X11A 2BP5M 1RUMH 3MGTB 3NA9H 1SQQK 1VRSA 2PN5A 5LXVA 1IBGL 2YLKA 3OKOA 5IK3B 1CQYA 3LW5H 3KPRD 5JHBA 3VI3E 2FZ3B 5SWSE 3SKOB 4ENED 2VUKA 1RJZA 1NAMA 2QIWA 1PYWA 3Q3DA 4OZIE 3KPNB 5EUKB 3BWAB 3V5KA 1HCVA 4PJFE 1UACL 4I2XE 4N20A 5DZJA 5MI0C 2JB6B 4DWHA 2PYEE 3E8UH 1JGVL 1WZ1L 3MV8A 5GSVA 3WUWB 1CL7L 2R59A 3A6BL 4EUPG 1L0LK 4MFHA 4ODVL 2BS9A 1P6FA 1YMHA 1KTDA 1TEGA 1DQDH 5IROA 2P5EA 3PAVA 3QQ9D 4KWUA 3SPVB 2IBBA 1JFQL 2AV1B 3IF1A 2WVSA 4ZQTA 4P2QE 3KW7A 3FRUA 4AMKH 1PF3A 1RE4C 1OF2A 3UGUA 1FZGA 1HQ4B 1SEBA 2R9HD 2BHYA 2YGPA 1U2YA 3FT2A 2CDGB 1KPRA 1RK1B 1BJ8A 3AXIA 3ECQA 4LBEA 4XPFL 5DHMC 5B3JE 3K6FA 3UYPA 1WQVT 1X5MA 4KJYB 1TQVA 3EJZD 5IB3A 4FHKA 3HE7A 1QL2A 1KIQA 3SPGA 4AQEA 4O58H 2CO6B 3GLZA 1T5WB 2EIEA 2QGDA 1G7HB 5C0GA 1A6TB 4WJG3 4HLJA 4XNZC 1K8AQ 1ORSB 3G6JB 1HCYA 1HOEA 1NIAA 3LHPH 2BNQB 4GIOA 3BCCG 2IAAC 5BRZE 1N5AA 3NH7L 3S6CA 2FQGA 1UURA 1H3PH 1IVTA 3R2PA 4GSDH 3K91A 3EUUA 1BM7A 4OB5L 5IBLD 2BMKA 5CO1A 1WAEA 2A6KB 2B5IB 4IOFC 1J12A 1S3RA 4DAGH 5CD3B 2HB0A 3GJFA 4ZFQA 4F7CA 1AACA 2GUOA 4ENZA 4XCFH 4XTRC 5IGXH 2IZ1A 1KN4H 2Y9YA 2A06E 5B5EH 2KZJA 4G59C 5D7LB 1ZHNB 2OZ4H 3SKUD 1Q4NX 4BKSC 1AG0A 5EC2A 1NTMJ 1GSMA 1FH5L 2CO2A 3FQ1A 4DUWA 3RX8A 4GT1A 3Q1MA 4HJ0D 4DKAA 1D5BA 3TDKA 1UZ6E 1MVUB 3MA9L 1A3RL 2WANA 3IE4A 5CBAB 3RK2D 3CBJB 2QKIB 2IADB 3APDA 4BSWB 6PCYA 2QJPC 4OCLC 4PV1C 1MQ8A 2NYZA 1DL7H 1USZA 2C5DC 3D9AL 4FCAA 1CDJA 4KTDH 5MENE 2AEPH 5LG6A 1M2OA 2EH8H 4NQDA 1SFCD 1TQCC 4OV5A 1ZLLA 5F3HA 3BAIA 3RFZA 1BM3L 3MGTA 2O1JA 5EU6E 3EDFA 1E27B 1U58A 32C2B 3PGCA 2R56L 3WY1A 1K73Q 1P84D 1F6FB 5JORB 1MJ7H 1FVDB 4JFEE 2VXQA 2KQNA 2FR4A 1TZ8A 4D6TE 3KYOB 1J05A 1NCIA 2EE9A 3RWFA 5CJ4A 1XTCC 2D7QA 2WXPA 3VXSB 5CLXA 2ZXEB 4G6FD 2EEXA 2VDOH 4E41B 4J6IA 2A4ZA 1QPKA 3C5ZA 1NFKA 1G7LA 5IMLB 2I60L 1OARL 3PXHA 3VUAA 3EO1B 2ZOLB 5D7LD 2BCCD 4JAMB 1JTPA 3OGCB 4BFJA 2QVKA 1S7QA 3ISYA 2BSTB 4ZMZA 1AJYA 4W9DC 4Z3JA 3JTSB 5IEHB 3VMNA 3KPPA 3G4SP 3BFWA 2AXFB 4M43L 3VFOB 4ZO6A 1T1WA 1FFRA 4PPTA 4PTTA 3P3YA 3GMNB 4P8QA 5JHDD 1V7ML 1NTKK 2JCCF 4X7DC 5L7XL 5JZ7D 3VD0A 4MB1A 2I27N 1Z9NA 1YEKH 1EGJH 5GGRA 5IQ7L 1Z3RA 1GC1H 1S9YA 3ARTA 3EFFB 1HOCA 4PJEE 5HVWA 4HEPA 3AGVA 2CUAA 2Z0BA 3CX5K 4HU8A 2BIHA 1CI5A 5KJ4A 4FYTA 3VWKC 2K45A 5APVA 3ZSTA 2OZ4L 1M9WA 1KB9D 2XBZA 2DF3A 3BH9A 1TYEB 2CHWA 1Y47A 3CWBE 2G2RA 3BQUC 1WFNA 1QRNB 4LASL 4I9XA 1FNLA 2CDEB 4PY7B 3ARFD 1SPDA 1SFCA 2JI1A 4PCYA 4P5TD 4D7PA 1BWMA 1AGDB 3BYTA 3CFJA 3GHGA 3GPEA 1N86A 1SN5A 4U1MB 2A6JB 3WJLC 4LCVA 4BKLA 2GVYA 2M0BA 2OKMA 1G0YR 4AV0A 2XZZA 4NC1E 4ZX6A 1RE4A 3W0WA 1KG0B 4AYFA 2NW2A 2QT6A 4HS3B 3RFRA 1CLYL 1KXQA 2XKSA 5BU5A 5JPMA 2C7UB 1I82A 2B4CL 3FQUA 3QEUB 5CHXA 4WW1A 3G6JA 4LCCA 4XHQA 1T1YA 4Y16C 1TTGA 2UZYB 3TL5A 3QUMH 1G7PB 4MD5B 3FL7A 3L7FA 2Q3IA 1A6WL 1AHKA 1FN4B 3GMOA 2EDLA 1F4XL 2LW3A 4H2CA 3HC3L 5EWIL 3UTTB 4Z77B 4NJ9L 4HS6A 4JQXC 4JG9A 3G5XB 4LPWA 5D71L 3TU6A 5D7IB 4KTYA 1E27A 1B0GB 3TGUD 4K5MA 3LZNA 1IAIM 2H2SC 4AGOA 2ZKHL 2YD4A 3EXJA 4RZCA 3C6LB 3T04D 2MHAB 2IFNA 3SODB 4R97C 1M1XA 3DURB 1F58L 4BFNA 2E74C 3LZQA 4PIRF 1E6JL 3L73E 2UWEF 1IIKA 2OJEB 1OP3K 3EFDH 1BBJB 3CC5A 4N3UA 1TFPA 2BP8A 4LK4A 3L2NA 1KTDB 3WTYA 2QR0A 3BWUC 2XIDA 2NY2B 1EZVI 1Z5LB 1SQXG 2IBZD 1KEML 2NQDA 4B95C 3IF1B 4V2CB 4JFFA 1FNEB 1J5CA 2H1PL 2Z6FA 1WA1X 3RJQB 4AM0B 3I02A 4U3CA 1M90Q 4NPYB 2NTFB 2WPGA 2B2XH 2MQGA 4ONFH 1YEEL 2YLHA 3G6DL 4LU5L 3NFQA 5G4NA 3HLAA 1KXVA 3U0PB 4DEWA 1T03L 4GINA 3GHBH 3QDGD 3BUBA 3T3MF 3PV6A 3S5LA 3P4MB 3HE6B 3SDDC 3H1HJ 3GBMH 1UA6H 5HVHB 2V17H 1CGTA 3K72B 4GIPD 3DETD 3DX2A 4CBPA 5B38G 1EXJA 3DX3A 1S7WB 2P8MA 2OR8A 4FL4B 2WTRA 4Z7OE 4Y89A 3H32B 3ARFC 4ZXBA 2R27A 3B7RL 3UAEA 3VXMB 3VSVA 4Z18A 1LEKA 3DVFA 2LVEA 3HJ0A 1W0VA 1CU4L 2MFNA 5HD8D 3G6JF 2AI0L 5HI4C 1OAKL 3GJEA 4J3OF 3KYMB 3U4EA 5ICUA 4XOCA 2OA9A 4BRJA 4YC2C 1FCGA 1IK7A 2Q5UA 4RETB 1MH5A 2ICEC 4CRPA 4AVHA 3BVTA 1EERB 1NOAA 3QAZB 3FHQA 2Z31D 1N12A 3SDCB 3LZFH 1PX8A 2XKNA 1ED3B 1IARB 5FHBL 2E59A 3S97C 4J4PD 1ZR4A 3U1PA 1ZMYA 2FJSA 4N8VB 4IRZL 3QI9A 2X4TB 1I9IL 4HUNB 4EE2A 4XBPA 4Y5YA 5J6SA 1F4XH 3DX8B 2AQTA 3IDUA 3QG6B 4LCIL 4ODSL 4R90H 3UYRL 2GK2A 1CZ8H 1TUPA 1LVEA 2CJTA 5JNYA 1NC2A 3D87B 4PVLA 3ZT7A 5IV2A 2SEBA 1TETH 5BOPA 1R3HB 2DIEA 4H44D 1S7SA 3ZKND 1GZPB 1B4LA 5T1LB 5J06A 3DOHA 5FO8B 1SQXD 2IBZG 2K9JB 4OCMC 4IRZH 1E28B 4IDJH 2WZPA 4RA0C 3CXHI 1Z3GL 3KBFA 4GIAA 2LQRA 4KK5D 1UJTA 1ZXGA 2FKWB 3WYRA 4ZMVA 1XVSA 3IGFA 3LQAC 1W80A 2QDWA 1OHQA 3AUWB 3D5OF 4JG0L 2YAHA 4XPHH 4KKPA 4GAFB 3U1AA 2BOBA 4YHOH 1W0WA 1JDCA 4GS7B 4CVWA 1N7SD 2BVOB 3BGFB 3GHGC 2F8IA 1IBZA 3ILEA 4ZXBD 3ZHFA 4FXTA 1FZCB 4QKTA 4OT1L 3E6FA 3ASOB 5C0DB 2CPCA 5JHLH 1SOSA 3TM6A 1UCBH 3CCEP 3RKDC 3I84A 5BO0D 2OTJP 1ZVSB 4ZFFA 4F2ME 1OD7A 2O1AA 2UVFA 3GJFH 3UPCA 1NGWA 1P5VB 2GBAA 4F58L 2I07A 5CXPA 1EDKA 3ARGC 1SQVD 2ETWA 1LO0L 2KDYA 5KKZB 2RQEA 4YDIH 3K2KA 1IJDB 1SOKA 1BVOA 2IG2L 1HXKA 4LSPH 3L71G 4S1QH 4MAYC 1WGVA 3PP3K 1YEDB 5CP7A 1E4XH 4N2LA 1Z5LA 3WL9B 4EDXA 1T83A 5D7EA 1WCQA 1F6LL 4UMGA 2BSCA 4MXQC 2EIJB 2CBQA 3DYOA 1RIHH 2B9BA 3VFNA 3VGAC 1DUZA 3SWYA 1CTMA 2UY7A 3OZLA 5GTIH 1DFBL 3H3BC 5T5FL 1OP5H 3ZO0A 3HPJA 3GMNA 2VLRB 1R5WA 3SKNB 1Q0YL 2NNCA 2UZIH 4PG2A 3L7FB 3ZVVA 3D2UD 5H35A 1U8JB 4JJOA 2ZVOB 1KDIA 4K9EC 4MA7H 3ZDZE 1ED3A 2VRKA 4XPBH 4Z77A 3GSVB 5C0CD 1ZGLA 4DZ8A 2WLLB 4BWNA 4PRAA 1MIEH 3DV4A 4ZX5A 3TF7C 3IMBA 3P32A 1IQDA 1NCGA 1QFOA 3VWKD 3A6OA 4HGWA 1MHEB 1HCZA 3WS6A 1XCXA 3MRFA 4YGVB 2LLLA 3BQUD 2R15A 4TSAH 1CD8A 3F58L 2WTRB 4PJ7B 5GZNA 2HTLC 2QZ5A 3PJNA 2M3EA 1G94A 3JWNG 1E7UA 4JDTH 1JZFA 3D71A 3B2VL 5JW4Q 2RR3A 1L6PA 3IMUA 1YYLL 5C2BL 1DJZA 1P6WA 4P5TC 2FX8L 2OFQA 2B1AL 5HYIA 1P5UB 1BAGA 1F1AA 4RDBA 5C0BE 2MOVA 4DEPC 1C08B 3GS4A 5JIQA 2YSSA 2ZIDA 1MIEL 1CGSH 4HC1L 4GSUA 2DJMA 3ROLA 4JJ5A 4AZ8A 3CFJB 4XCEB 4FA7B 4PS4H 2O93L 2IGFL 1QLRB 1Z32X 2WQWA 1A7PL 4U1IB 1GYWA 3E1IA 4QNPE 4L8SC 1RF0A 1NGXA 3OXSA 1S7XB 2E27L 4XP4L 4M7ZB 3ASNB 2D0FA 3L5HA 3BE1L 4W9CC 1JTHB 2QSCL 5F7EH 1IL1B 5DJ0B 3WOVA 2R2HB 2IQAA 3CN3A 3ZL4H 1A3RH 4AMWA 3BKCL 2Y07H 3CFEA 3EHBC 3R0MA 4B3VA 2EKSA 1I1CA 3D18B 3KVDD 2K4WA 2A9ML 4G8FB 4OFYD 4N78D 5DVMA 4I3SL 2IIJA 3V9FA 3UMTA 1VENA 5FA3A 2XA8L 4O5LH 5GJTH 4NPDA 2Q5BA 4EYYQ 3PWJA 2MMXA 2B15A 4XE0A 4WKXA 3SFDC 5EN2B 4E9VA 5BZWA 2QVMA 2AQQA 5AZ2L 3DRQB 4L3CA 2YSTA 1X7QA 2GTQA 4MQ7B 2FBWC 5CUSL 5D9SB 3VE0A 4FQ1L 4OW6A 1B4RA 3ZZLA 3GMLA 3P4NA 1OM9A 4QGYA 3UFIA 3UCQA 3V4VH 1A7BA 4XH2A 3VH8A 3DIFA 4LPUA 3WKML 3HNVL 4GG6B 5HHMB 4GI6A 4LLQB 5IB5A 4LT7A 3T3MB 3GIZL 3MODL 4NNYA 4ZTEA 3FF8A 4OLWL 1R0AL 2K3HA 4QRRA 1YN7B 3RK3D 1WIPA 4MDJB 2GITB 3JWNE 1KC5L 2NW2B 5B38A 1M1JC 2V2WA 3FKUS 3S7GA 3MXWL 1KB9K 2E7DA 3GJEB 3PL6A 3P9WB 3SY0B 4DP2X 4ELMF 3CZFA 4RZKA 1MI5A 2F7OA 1PZQA 2FD6L 1JY3O 3CHOA 1T1YB 3H7BB 3ZKSD 1EA9C 4ODHL 3WEAA 3WJJC 1OARH 5LNDA 4R7LA 4KMLB 3RK2B 2NY0B 4KRPC 4M6AA 4CVUA 3QUYD 1Y1DA 2R2BB 1JL8A 1MW3A 1U21A 4O51B 1TSHA 3MODH 2QZQA 5CN1A 3W82A 4YXLL 3BZFA 4P2RB 3HE6A 4AJWA 4XNYH 1V8HA 3TPUB 4S1SL 3CCRP 4IM8A 3JUZA 1HEJC 3MXWH 4PY7A 5CLYA 2LAGB 3JWDH 3N85L 3P0VL 3CMOH 5GHWH 1R3IL 1AGDA 3B4SA 2DL9A 4LXFA 1TF4A 2D9QB 3TJEH 2HRGA 1E7VA 2LGNA 3BZ5A 4Z7WA 2EO9A 5E51A 2Y1AA 2Z92A 4PEEA 1YMME 2WUCH 4RMVA 5T8IA 3N1GC 5JNYB 5KLVE 3S1KA 1ZK9A 1BZ8A 4JFFB 3BO8A 1BGXH 4HAKA 4XHJC 3FSVA 4WAFA 5KLVK 3FQ2A 5FYLL 1QSED 2KIKA 3SIKA 3V5DA 2G3MA 2Q87A 4FQ2L 1ZE3H 5T1DL 3CMAP 4L1LA 1FFTB 4OFYA 2FYUG 3KDPB 3ETTA 5BVPH 2ZWLT 4FE9A 4XBPB 4Y5YB 5CGTA 5DEGB 5FOBB 4MXWL 4FN0A 3A4AA 5DEJA 3CC1A 1NEPA 1C5DB 1AQ8A 3FULA 5FHBH 5I75C 4EBQH 2NY5L 1HVVA 2Q9OA 5B7EA 4W9GC 3VW3L 4BK5C 5JOEA 1BBDL 1O6SB 1M71A 1WEJL 3QWOC 1I1AD 3FUMA 4HHAA 4N2MA 5M94B 3DVNA 5HHQA 1F02I 3PJLA 5JQ6L 4LEOA 5DJXA 1FSKC 3U1SH 5DZAA 1GYCA 5DHVB 1UVQB 4XP6L 1P7QB 1KTLA 4PG2C 2DYPD 3CC2P 1DVQA 3OR7B 3UROR 1EWHA 1UZ8A 2AAVA 2AEMA 2ZAGA 3AFLA 3PXLA 4NQEE 3RB5A 3RI5K 3HHSA 3WHE0 2QPSA 4YQXH 4Q6YA 4Q8BA 3OHXA 4QKXB 3WDIA 2V3DA 2IDCA 3JT0A 3FCGA 5DHXB 5KS9A 1B2YA 5E9DE 5GGRY 3R4RA 1RF1A 5E4IA 2PYED 4DGWC 4WU7A 2N1KA 3GS7A 3M07A 5APUA 4H8PA 2ZUYA 1KZUB 3NJVA 3BIBX 4AEIH 1XH2A 4FOMA 2YQBA 2E76C 3NFNA 5DK0B 2DIAA 4J3TA 3PV6B 2C4XA 3S5LB 4KRPD 1XR9A 4F7PB 4NEHB 2C3VA 5DJCB 1IGYB 1I8MA 4XPAL 2YXQB 3QH3A 4DP9X 4AM0Q 4ETYA 3MSPA 5C0IB 1GS8A 5EMYA 2WSFH