5AVYB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 20 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avyB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avyB02
2W27A 2QM8A 5APSA 1J2JB 1T2KC 2YO3A 3M06A 3B8EB 3O8ZA 2IPPA 3UIAA 1GU4A 1GU5A 1DH3A 5CMZA 1CI6A 3TYYA 1MV8A 1G2CB 3L37A 5AVVB 5AVTB 2Q3IA 3VTPC 1FOSF 3KQGA 3KDPB 5AW3B 5APTA 4B86A 1HWTC 1GK6A 4LC1A 4AQRD 3NFQA 3WGVB 1CZQA 3HTKA 3L35A 5AVUB 2P67A 5AW2B 2WWWA 2YNYA 5APVA 5AW7B 4RETB 2W6AA 3M91A 2YO2A 5AVXB 2WPSA 1NWQA 3HE5A 5APYA 1GZLA 2XV5A 4I2LC 4JYBA 4AYCA 2WTYA 2P2UA 4C46A 3OAKA 3HE4A 1MFZA 5AW4B 1GTWA 1NAFA 1OWAA 3V4QA 2P7JA 1H89A 1SP4A 2Z5HA 5AVWB 3TNUA 5AVZB 2JJLA 1H88A 4HYTB 1FOSE 1A02J 1S9KE 1MUUA 3L36A 2WPRA 3HE5B 1FAVA 3M9BA 3WGUB 3I5CA 1KQLA 3P8MC 4KHXA 3VMZA 1GK4A 2C9NY 1SLQA 2C9LY 4I6MC 2R5BA 3P7KA 5AW1B 2R32A 3IR9A 5AVQB 1HUCA 3NTNA 3A7OA 2ZFCA 5AVYB 3T97A 1GD2E 2XZRA 2XU6A 3A5TA 3SWFA 2R5DA 5AW5B 3LIEA 5AW9B 1OXZA 3V4WA 5AW6B 2BASA 3A2AA 1JNMA 2E43A 4GT1A 1CSBA 3TNUB 3VN0A 4JYCA 2Q7CA 1S9KD 1IO4A 4C7NA 2Z5IA 2H7HA 4DZOA 1JUNA 2E42A 1YYCA 4M3LA 2WPQA 3VMYA 1HBWA 3NMDA 3P32A 2WT7A 1HJBA 2Q5UA 5APWA 3LIDA 4XE5B 2QM7A 2R3CA 3M9HA 4GKGA 1A02F 1X8YA 4EOTA 3A3YB 1CI6B 5AW0B 3M0DA 3MD0A 3V5BA 5AW8B 5AVRB 4AUWA 3TK1A 3HE4B 4RESB 2VRSA 5APUA 3MGNA 2ZXEB 1T2KD 5APXA 5AVSB 2KP8A 2WT7B 3M0AA 2N9BA 3NXSA 5APQA 3VMXA 1H8AA 4C7NB 3VYIA
chains in the Genus database with same CATH superfamily
1BOGA 1BDYA 3FRPG 1HZHL 1YN7A 1GOHA 1YYML 3DYMA 3EOTL 4XC3H 4EI5D 3NCJL 4MJIE 5EU6A 3V4VH 1JGUH 4XWOD 1THAA 1X6LA 2QJYC 3FF7A 3ISYA 1JWUB 3V0GA 4HWBA 3GSRB 1SQQD 4KK6D 4QRUB 5J56B 2H0EA 1LWUB 2PP6A 5APVA 4J2XA 1U8QB 4WY7L 4XPFL 2BPBA 4AJ0A 2FWLB 2OW7A 2E9JA 2B15A 1WWAX 2DQTH 3CFBA 4FZEL 4ADGA 4WWKC 4QT5A 4XCCH 4BWWA 3MIWA 5EN3A 5E51A 3TC9A 1M1SA 1HJBC 1CXHA 4KZDH 1JZ7A 5ESQA 3T09A 3AEDC 2W65A 3VXUA 3L1OL 5I1CH 5TDNB 3ROOA 4AM0Q 4D0CA 4LGPB 5I30L 3ZO0A 4K3GA 1R8EA 5DJCA 2YKOA 5B8CC 5E8OB 2C9LY 2BNRA 4W4OA 3UBFA 5DLMH 3GSNH 3HR5B 1QFHA 2W91A 5HJ3A 3W9EA 3CBJB 3CUPB 3EO1B 5HHXL 3KR3L 4UTBH 1EHXA 7TAAA 4JHAH 1F56A 1UWYA 2XWCA 2AEFA 2VM9A 1T7YA 4LCCC 2QHRL 3PWPA 4YSSA 1DSFL 4ZT1A 1DEEB 5ISZB 3A0OA 1CFNA 3OXRA 3TBWA 1F3JA 3ATDA 4WKXA 4ONHB 3U4AA 1DIPA 4R96A 4I18C 3EJJX 2IDBA 1T0PB 1ZHKB 2W80C 3D12B 2NT0A 4C7NA 1MW1A 3CL3D 4ZW7A 2QQKH 5DD6A 4YHZH 2BS9A 2GAZA 1F1AA 2DWXA 3ARRA 1RZFL 3L71E 3TEYA 3HNVH 4MXWL 1YHPA 5KSAD 4ZNEA 3H2QA 4G71B 3B1UA 4ZZKA 3NRPA 2YAMA 1AGCB 3FFOA 3TBSA 2DI9A 5FDWA 4PN6A 1M7LA 5EFIA 2PPCA 4F37F 3QJFB 1MY7A 3UTTD 4L3AA 2AHIA 5SWSD 1QSFA 1JDDA 3RWGA 43CAB 1UACL 5CZKA 3S3SA 2DMGA 1WVZA 1X5LA 3JTTB 1RJYA 3FGAD 1KY7A 5IQ7H 4YK4B 4U1LB 2V9QA 5C0GA 4WSJA 4L48A 1D5BA 4AUUA 4PVMA 3DNKA 2OTWA 1II4E 4NRYA 1QL2A 5B39A 2KP8A 3EH1A 5L4JA 1S5LH 4F58L 2OYIB 3Q1SH 1OVUA 3SKOB 1CFQB 4V2CB 5DWUL 5IROC 4QR7A 1ZCRA 4GKSA 3NCYP 3ELQA 4GQZA 1QR1A 4JZJB 3Q2NA 3ELAT 4XO3A 3FSWA 4WFGE 4A7GF 4KK6C 1IC7L 4L8CB 2AJYL 1SQBJ 3SGKC 4LLMB 4AYSA 2Z91A 4TNWF 3MUGB 1U8LB 3Q8CA 4FQJH 1FHGA 3DX7A 4CSSA 4Z7OF 1KN4L 1DH3A 4KH2A 1QRNB 4N3YB 4PJXA 4B97A 2H32H 5CILH 2NPSC 2NY0C 1IGTA 3T1FA 3UTOA 3WIFA 1PLCA 3QO0A 3Q13A 1FNEB 4F8TA 3C6LD 3HG5A 3DGDA 3IBEA 3LH9A 3V6FB 1FL6B 2Z35B 3WUWG 4NFCA 3HPJA 3KLDA 3SWYA 3U6XA 4MCNA 3D18A 3NA4A 2V4HA 4X9IA 2JP3A 3AJ7A 3GLAA 2E6JA 1BF8A 1LK3H 3FSAA 4HIQA 4D0DB 2B1HL 4OZ4B 3BCCJ 3IS0X 4IRSA 1XF2B 4HUUA 4ZS6D 5E2TH 4LFHG 1QR4A 2J44A 2PO6D 1NYHA 3A4AA 4OWFA 4JN2B 5I5IA 1AJ7H 4S1SL 2WGXA 4HH9B 1Z9SA 3MRJA 4KVNH 4GRWB 1DZBA 4QIRA 2CJ3A 2I60L 1L9TA 3JYBA 1NWPA 2E75D 2MKLC 2ROYA 5AVQB 3QNYB 1TZIB 4Y4KB 3A21A 3LEYH 4QXVA 2MWCA 5FYJL 2QADB 4GRWH 3L3JB 4OVVA 4B9FA 1TJGL 3QDMA 1AACA 3X12B 5E4IA 3BVNA 3ZY7A 4PV9A 4WHYG 5C09B 5B39G 5F70A 3LSOA 3D33A 4E41E 2Y0CA 4AIOA 4YSAA 4MCYA 1MFEL 3IJ7A 5AB9A 4L0YA 1Z9OA 5I1GL 3WIIL 4OLUL 1MLCA 2VR9A 1F6AB 2WIMA 4QXTA 1WT5A 1HOCA 1YNKH 1KCRH 2HT3C 3INOA 2APXA 2A7BA 5DD3L 2L0DA 5EO1B 3K72A 1AO7A 1HOCB 3LZFL 4UT6L 3T2QA 3S4RA 5HHNB 2CSPA 3N91A 4N2EA 4S1RH 5AAMC 3K0YA 4RSVA 4UT7H 5J13B 4PJ8D 1BCIA 3RWHA 3OXSB 1Q38A 4H8HA 1QOKA 1RL1A 2AJUH 3N04A 4FQLL 4HK3J 4JDTL 4AW4A 3P0VL 5TQ2L 4HCFA 3D6ZA 5GZNA 3WKPA 2HG5B 4MNGB 5DMYA 1G7IA 4BK5A 1TF4A 4QTFA 1LEGB 1S7QB 2HFFB 3INUL 2EYSA 3QIBB 4H20L 2WSDA 1KDJA 2EJ1A 1AJYA 1A7NL 2CIKA 5D1QA 3H1HJ 2NY7L 4U33A 1KYDA 3HG4A 3CCUP 4DKDC 5T3XL 5EUOF 3QIUA 4YR6B 3S5LG 2E7CA 2AV7B 3FAXA 1WYJA 4LQ1A 3S96A 4WAFA 1I1YB 1S7TB 5GISH 2AITA 4Y7MA 3CZKA 3LEYL 4JFQB 2FSEB 2W8ZA 1ZK9A 3DIFA 4MA8L 4Z7QF 1Q90D 2H43A 3Q43A 3O6FB 1NJ9B 1D5IL 3J27A 4JFEB 3PP3K 5DJXA 4CN1A 4PYGA 1SQQK 1GU5A 4N22A 1LO0H 1X3DA 5DMKB 2BP0B 5E94A 4MMXB 4PS8A 5C9JA 3WUWB 2C0WA 3ZDYF 3BZDA 4GG6E 3WO3B 5H8DA 4F1ZA 1E27A 2E47A 3FQ4A 3DX6A 1AKJA 5ILTH 1J11A 4DZ8B 2OMVA 3BQUD 4KXBA 4XWOC 4JVWA 4LF3A 2XDHA 1TCRB 2PETA 1EZVI 4P4RB 4Z7QE 4DK6A 4FTVB 5L88L 1CD8A 2WXHA 1MCSA 3AUWB 3QORC 4Z3TA 2EICA 1GIGL 2B39A 1OCZB 2VWEE 1H89A 1CO1A 4RGOH 3KZ8A 3GG2A 2RMZA 3M88A 2VXUH 5CEZE 4M03A 2BSRA 3CXHE 3IDMA 3HUJF 4V1DD 6FABH 2EIBA 1H3XA 4GIFA 3HE7C 2RCSL 3I5CA 1YJDL 2VM4A 1D7DA 4GQQA 1QSED 2BVYA 2ZX7A 3OMIB 5E1AB 4ZI8A 3SGEI 4PGDA 5C0DA 3BD4A 3L9YA 4GQRA 3VB9A 1RUPL 1UIIA 2NNAA 2BJMH 1TQCB 3LW5J 2GIXA 2J2ZA 5I8EA 4J3OF 1FJKA 4LSTH 4XT1C 1J9RA 1A7OL 4FF9A 4KPHH 3PHLA 4L9LA 5E1AA 4BUGA 5F3BB 4R97B 3O8XD 3D85D 3ARVA 4TSCL 1DN0A 3TA3B 2PCFA 1KFNA 4FMFA 3KWTA 4DP9X 5LHDA 1ADWA 3Q1SL 4MNQD 4AYID 2MCPL 4HOWA 3FPYA 1HDMA 2K6WA 4DGVH 5DZVA 1AGCA 4L18A 4JFZL 4ODBD 4TM9A 2F9BT 3RWDA 3S35H 5ALCH 4B9CA 2X9YA 4HAFA 4KNQA 1CE6B 1HBWA 1OB1B 2IMNA 3BUYA 5ADOH 2WT7A 4ZBJA 5T1JA 2AJSL 4AGLA 2X70B 2NW3B 4A7UA 5HHME 3P11H 3COOA 1S2EA 3X1FA 5FFLA 1KJ2L 3H1IJ 1IFGA 4FQQA 1MY5A 5KOVC 3CSFA 3NJLA 1JY3O 2AXFB 4GG8B 1RJLB 3H9ZA 1AKPA 4K9JA 1U58B 4LHUA 3L70J 1G9HA 1N8RQ 3OR6B 1P53A 3S36H 4PR5A 3L1EA 1SQVD 1ZIBA 4L2LA 2VQ4A 4TQEH 5DEFB 5FO7A 3S98A 4Q6IB 2JJUA 3CDZA 1WMKA 1ZW0A 1E9QA 4Q0XH 5I66B 4B9JA 5B4MC 2J6EL 4WB4A 5KSUB 2MPAL 3G71P 1EXUB 1EJ6A 1JYVA 1H8AA 2FEEI 1WAEA 5HYSA 3U0PA 2Z3FA 2VN4A 4DT0A 3O3AA 4KUZH 1IFHH 1ACXA 4XP6H 4PIRF 1KBBA 3DIVA 1OP3K 1OE2A 4NWTL 5DQJB 1A22B 3D4ZA 3AAZA 2Z9TA 5FYKE 1H6FA 4MB4A 3LSOB 3JWDC 1IZJA 3BP5B 5DFAA 5KKZC 3IFNH 3L1FA 1DQDL 2XKNA 5EU4B 3S35X 3ZU8A 3FOMA 3VFGH 3VMOA 3KDMA 4FP8L 5IM7B 2ALAA 4I13B 4G8AC 4J4PA 4K23L 2FWOB 1LM8V 1GK6A 3OB8A 4PLJD 5ES4B 4HJJH 4MN4C 4PJ7E 1RKRA 4JO5A 3LPPA 3RX7A 3MRQB 2UXVA 3FBQA 3GM8A 1I31A 3ETSA 2VR3A 2DTML 1RE4A 3V4LA 5JHDA 1VLXA 1F6AA 3BIAX 1EZVY 3QXVA 2G9HB 4IS6B 3BVWA 4GW1A 5CJOH 1P4IL 2Y5TB 4OB5H 4PJEB 1FZFA 1OOAA 2A77H 1WICA 5CGTA 2DY2A 1A3RH 4NQCE 2QIWA 2F7QA 4BFBD 1G7QA 5C6PB 1F11B 1NEZA 4GXUN 4J2QA 4NSKA 3KGSA 5J5EA 1QLRB 5PCYA 2M83A 2QPDB 5IJVA 5BV7H 3IU3A 5BS0A 3ARFB 3AE9C 1C1EL 3G5VB 4HETA 3QXDA 2EYTB 4IJ3B 5J4MA 1GW0A 4KOBA 1YHQP 4G9FA 5EZLA 2D3VA 1DANU 4X5XA 4Y7OC 4FERA 2WQRA 4GSDH 1DBJH 4IKIA 2EO7A 2R1WB 4P05A 4ETYA 2D2CC 2FO1A 3PL6C 3FO2B 4HH9A 2QKSA 2WINA 5I18H 5I1LA 3HS8A 4NJ9L 4J3OD 3RGVC 5A40E 3QRLA 4WV1A 3SDXF 1WT6A 4UINH 5DZAA 3F83A 1B2WL 1DN2A 5D4QA 3K2UL 3R2PA 5B7EA 1LEIB 4KZEL 4IGBC 2X1XR 5D7JB 3NFPA 4KVPA 1KIPA 3SPCA 4A38A 1LP1B 4L4VA 5HPMA 4W7YA 1PCXA 3BIKA 2ORBH 3QEQE 4P3DB 4PJFE 5CSZA 3S4SA 1MFAH 4J3OH 4M1DL 3FXIC 1DLHB 5DJ0B 1FH2A 4H7VA 5C8JB 4HLJA 4HPOL 4FZ8H 2RALA 4L5FL 4U31A 3US9A 2Y7NA 5JQ6H 1MZZA 4NWTH 4E0RB 4RMUA 3DX2A 3DGCR 3SY6A 5E5LA 4R0LA 1WBZB 1QEXA 2DYPA 3PJNA 3GJEA 4FYRA 3RDJA 1SHMA 4YPGA 2V2WB 3BKYL 4GRMB 3HG0A 3DX7B 5EOQH 3L3GB 5FCUL 3BWAB 4K9EH 5DVKA 1MQKH 5EFIB 5KBMA 2FT8A 1KCVL 4JRYB 1RMFH 4FJYA 2OQJB 3OTTA 4KTDL 3GO1L 2AEPL 2VSKB 3WTYA 1FJ1A 1L9RA 1T3FB 1D7FA 4L8DB 4YSDA 2K37A 3SKOA 3CDCA 4M6OH 1E7UA 3WN5B 5J7CC 3D3VB 3MV11 4C7NB 3ASWA 5D7IB 3NCFB 1U3HA 4OFVA 3VXTB 3ARDB 1BYOA 4E9SA 5J57B 4BCZA 4Q2ZB 2UX7A 2P5PA 1P1ZA 3X17A 3CFEA 1TFPA 3C5ZD 1A7QL 5CMZA 2Y0EA 4Q6KA 4I3RH 4L9LC 4OTXL 3DSFH 2GUOA 4D9RD 4NO0B 3H55A 3TWCL 1CFVH 5FWQA 2BCCD 2W6BA 1PZ5B 2DM2A 2Y07L 1KIUA 4EZJA 3BEVB 4JYBA 4AYCA 4RQQB 3ZGHA 2YAFA 4Z5RA 4N20A 1QMUA 4J39A 2NLJB 4M7JH 4QMAA 1NFDB 3I9IA 3Q2CA 4XWGH 5I1DA 1MUUA 1AR1B 3THMH 4JPKL 2X1OA 5CMAB 2HVJA 3U1SL 5D2NA 3VFWA 2DM3A 4WY4C 4HIXL 4H0LD 2BX5A 4G8GE 1B4TA 2G75A 5D7LB 2AERT 1GAFH 4Z7VA 1P2CB 1EUTA 4QRRA 1SQXJ 1HNYA 4ZDHA 1AE6L 2KSEA 3C60B 5I1EL 4GFXA 4FFZH 2ZUQB 4K4KA 4QHNA 1A8JH 3QJHB 4HOMA 3IXTA 3RK3D 1RF1C 1OAUL 4CVXB 4KKQA 5J9PA 4IMKC 2A38A 1N7SC 1ASPA 4A6YB 1XGQB 3MLRH 4HWEL 5CJXC 2EE3A 3CHRA 4I5BB 5F9WB 2CKNA 4LARL 3O8XC 3ZMRA 2WO3B 4W6YB 2ZOWA 4L29A 4G3YL 4X6BB 2XN9D 1A47A 5EA0L 3WTUA 4BWTA 2BY2A 1UXWB 1W0YT 5HDOA 4LDOB 3HI6L 5KZCD 5IB2B 3MOBL 3DKHA 3N3EA 1IBYA 4KXDA 5I5MA 4NRZA 5GRZA 1VEMA 4AQ1C 2CA4A 1IU1A 1VACB 3FHEA 1SQXD 3AECC 4TUOA 1RERA 3WKYA 3RYMA 1RD6A 4JPZB 1JWUA 1Q86Q 2JJWA 2QSQA 5D8JL 3MRLB 4KK5C 1NMCB 3FH7A 2EYRA 4FFWD 3AG1B 5AW0B 3T8XB 2K4AA 3L4YA 4YHLH 1DL7H 3VI4B 1BIIA 1MCKA 2IYPA 3AFLA 3QIBC 3F84A 2NZ9C 3F6LA 3L3IB 3X11A 1BD2D 3CCHB 2DQIL 3FUKA 2R2HB 5ID0B 5B38B 4JM2D 4ZMDA 1QQDB 3U6RA 3V6IA 4J8QA 3TBTA 4XHJD 4JL2A 3FONA 4YHYB 1MRDL 2J72A 3HG2A 1RZGB 3GRGA 4E36A 4AUJA 5K5YA 4JPSA 5D2NB 3VFWB 4UNUA 1OO2A 1YNLL 2HT4D 3S3BB 1IBGH 4BFJA 4QJ5B 2IBZG 2IBZE 4RIRB 5E2UH 3H32B 1Z0NA 1OGAD 3UG5A 32C2A 2RQ8A 5DEZA 3RUGA 1TUPA 3UFIA 3A67L 3C08H 1OT1A 1HNFA 5D1XD 3PP4L 1NDMB 4PH8A 5DS8B 5GGSA 3B5NC 3S1KA 2YMOA 3I6LE 3CH1B 4QI3A 3DMMB 4TVUA 2ISDA 3L9RA 3IJHA 1X5GA 1ZS8B 2B59A 2NXZC 3RY6A 3L75E 2HPTA 1N73B 1BZ7A 4RMRA 2ZYSA 2R3SA 2OZ4H 2HODB 3WIIH 1Z9MA 4JR9H 2HVBA 3N9GL 4PUBH 3B5ND 2HFED 2PNDA 3NFNA 4EZKA 1JWMB 1RY7B 3VSTA 1KTDA 2XV5A 1WT5C 1XSJA 1SMAA 3IETA 1TJGH 4HXAL 1TETL 4XN2A 2YC1B 1OSPH 3H3PH 3ARDA 1H5BB 3O8XB 4NZTL 3UXFA 2Z92A 4R26H 1J0IA 4I0PC 3V8OA 3WFDL 4TSBL 4W93A 1SLVA 4DIXA 3EYFA 2J1KA 5TGBA 2BHZA 3E2HB 1K8AQ 4PWGA 3FQXA 3VXUE 2VLKE 3VD5A 2BXYA 2BOBB 1K8DB 4OF0A 1SOQA 4P23A 1SJHB 3BRTB 4WCYH 1NGYB 3AQYA 4G7VH 5J3HD 3LHPL 2FGWH 2J4WH 3RVUC 5KYXB 2X4NA 3X13B 1QRND 4UIKL 3HA0A 5KLVE 3CAFA 1SQQE 1SF5A 2ADIB 3QI9A 4F9PA 1M42A 1KQSO 1G6RH 2RFXA 4XP1L 3ZDYE 2F53B 2YD4A 3WU2H 3USSA 3E1RA 4NPDA 1NCWL 1O9ZA 2WJ7A 4PJEE 4QOKD 1PLGL 4YXDC 2TSAA 1TVDA 4AEHL 4QRAA 4UT9H 5DO2D 1YPZF 3DI2B 5FO8A 4HJGA 4CADB 4MX7B 3SDCB 1T0OA 4OD2A 4YZFE 3I02A 2WQWA 1NDTA 3EYQD 5A3IC 5CBOA 1LO4L 2OMBA 1JPSL 1ZS8A 3IJSB 4H0HB 4XPHL 1MJJB 1IAOA 5C0CD 1OAKH 1TZ8A 2CPUA 2IYOA 3V0DA 5DQDL 1PW3A 4DESA 1ZXGA 3VP9A 3HW7A 4I9XA 5MERA 3F01A 1BREA 2FHFA 1UEMA 1I53A 5AW8B 1L6XA 4JJ5A 4JRFA 1JZFA 4RNRA 2F68X 1QKZH 1QWUA 1JPGB 2B77A 3B2UC 5IIEA 3LH2H 3BZFB 3QDJB 2MJZA 2PPFA 4PJ9A 2ZXEB 1VJSA 3HS0B 1A7RH 5AUMA 2BCCG 2QLVB 1RE3C 1DJXA 4KKNA 2CKBB 2EDMA 5AZEH 3NP3A 3RAJL 1T89C 2NPSD 2VXSH 4G8FB 1HYSC 1XDTT 4MJ4A 4ISVA 5EN2B 3BFWA 4NPJA 2ZTBA 3FPXA 5CBEB 2VUKA 4LVHB 1BAFH 2Q8BL 4PSPA 2OKMA 1PY4A 2Z0BA 3UIAA 4PQXA 2YBGA 1BQUA 3ZTCC 1T83A 5DD5H 3UCRA 2YRBA 2Y9RT 3T0EA 3HBGA 5CCGA 4LRNL 4YDIL 5EC2A 3QIUC 1WZKA 1NLDL 3FU5A 3BGAA 1U8IB 2G75B 4PB0L 3WTXA 1Q0YL 5GGSY 3IAQA 1FAIH 1SEBA 1KB9D 5TQ0L 1Q81Q 2XI9A 1XB8A 5E4EB 5I1DB 4KOCA 3FRUA 4KKZA 4X6CE 3FJTA 5IBTL 1CLOL 3NT0A 1ETZA 4N6QA 5AB1A 5D1ZA 1A6ZA 1AC6A 1ORQB 4PJIA 4U0QB 2Y6SD 2CLVB 2Y5EA 2Q3EA 1NTMG 1GZHA 2E7MA 4OVUA 4PV8A 4PJGA 5C08B 3FT9A 2GVYA 3O3AB 4Y4KD 3EW3B 1E79H 1R9FA 3D69B 1A4KA 2E75B 2QGDA 3QT2A 4UUJA 4QHMB 4X5QA 2WYHA 2C4FU 4S0SD 3GYRA 1KTRL 4K73A 3FC8A 3KPNA 2J57A 3RIAK 1PP9D 1NIAA 4PS3A 3IR9A 1FUNA 1ZT4A 1HUCA 1FPTH 4OZIE 2WTOA 3H1JE 3A5TA 1KC5H 3P0YH 4X7SL 5CU9A 1U8PA 3ARFC 3EGSB 4D9QE 2Q10A 1EA9C 3BP6B 3BKML 1B4JL 3WJMB 1ZOXA 4MQ7B 5K39A 1AOZA 3EDKA 4XPFH 1CC3A 3P30H 1DL7L 4UM8A 2CDFB 4PD4I 4HUXB 3PPEA 4X6EB 3CFDA 1UVQB 1FPTL 1QX1A 5CZVH 4BUQA 3WO4B 3D39D 4YXKH 1P84E 3PV6B 1T3FA 2ERJC 3O9WC 4L8DA 3TLRA 4KJMA 3I50H 3U59A 1OB1A 3X13A 3CCJP 1NMBH 4UB6H 2WSSH 1NQBA 4CNIA 2N1TA 1NGYA 3HAEH 3Q5SA 4OJYA 2YKPA 5HHOA 4S10A 1PG7X 2ADJB 5AWNH 1KLFA 2NZIA 4FLSA 3SPGA 2ZSWA 2CLRB 3MI6A 2FX7H 2YN3A 2ZPKH 2YRZA 2P8MB 5CJXA 1OCWL 2PCFB 2YARA 3GSNA 4PLOB 4X4KA 3F12B 4HIHB 4JG1L 3WTWA 5TF0A 1KILD 4FLQA 4XZUA 3UC0H 4WUUD 1MEXL 2EDBA 2VXTH 5E03A 1XEUA 2E8ZA 2R39A 1GHFL 3SSGA 3A5VA 1N8ZA 4AV4A 1RIVL 3B3IB 1ZA3A 3P3UA 1DJWA 3HG1B 4OCXL 5F3FA 3ARYA 3QR2A 2VERA 1H8LA 1Z7JA 1R3HB 3HN5A 2WVTA 3AC0A 3MV9E 3QVAA 2B59B 1BFVL 1NFAA 1LTTC 2H2SC 5D7JA 1EXGA 3F7PC 2WZ7A 3CH1A 4R8WL 1BVLA 3T4AC 2M3EA 3PQYB 1J2JB 4EIUA 2B9BA 2YMYA 4KI5E 2R1XA 3L74J 2OP4H 4MNHA 1TITA 3O2DL 4R0LB 4ODXA 3TWYA 4NNXA 4BRYA 2FQEA 1IGMH 3WLBA 2H0PA 2J1WA 3I3DA 1WIPA 3WGVB 5D1XC 1CZQA 1A7RL 2B3RA 4R5TA 1MWAH 3T5WA 1Z9LA 4GQPH 4OLWL 1OAXH 2VDKB 1JK9B 3KNBA 2NRDA 2EZ0D 3PFQA 1P4LB 4PJDB 4K3JH 5DJXB 1DJGA 1OTUC 5IB5B 1YJDC 3AMLA 3KL5A 3GHPA 3B4NA 4IS6A 5J11C 4YBHA 5FB8B 3DIFB 3VXMA 2WVRA 2KSJA 1G1KA 2R29A 3GK8H 3BXNA 4FG4A 5K59F 1JPST 3VJ6A 2QR0A 3GMLB 5FGCE 4NGHL 1EJOH 2ID5A 3KHQA 3MCKA 3N40F 2BZ7A 3TCLB 1NTKD 1ZVYA 1R5LA 3HZYB 1EH9A 4B41A 3CCMP 5DC9B 1TQCC 2R32A 2NPLX 4FFWC 4JREC 4LLDB 1FL5B 1HZKA 3G4SP 2F54D 2CHNA 3V5HB 3GO1H 4JM4H 3L95B 1YEGL 4NKIL 3O9WD 1CFTB 1WDAA 5IV2B 1KEMH 2D7PA 1OW0A 1X5ZA 1NMAL 1OM3H 4D94A 1JRHI 5DQJA 5DRXA 1U9KA 2AK4B 25C8L 1RURL 2VDKL 3TIEB 3U7WL 5GJTH 3EF7A 3QNFA 1AQKH 4ONGH 2UWEA 4GOSA 5FFGA 1KNOB 3UJJL 4WCYL 1URQD 3OR7A 1WK0A 4P46C 1Q72L 3ZXAC 2OMYA 4R4NC 4U1SA 1HEHC 2BSDA 2JQMA 2YBRB 3B2XA 3EADA 5E8NA 3ZYIA 1AQ5A 1EZSA 2GJJA 3R1GL 2HLFC 3D4GA 4UT6A 1V54B 4KZEH 1R3IL 1BQHA 4JGMA 4QXUH 1YTZT 1A6PA 2V5TA 4U1NB 1Y7VA 4I0CC 4L8SB 5J8OA 1IGML 4NQED 2HKHL 4NZDA 4HUMB 2AJXL 1LWRA 1MFBL 2AEOA 2V2XB 2ZXBA 3L4XA 4TSAH 2X3CA 5I18L 1TENA 9CGTA 3KBFA 3MRIB 3LQMA 3ZZLA 1E40A 4M7KH 5ICXB 1CL7I 4YE0A 4YHIB 2GHWB 4LL9A 1CU4H 1MVUA 4GB9A 3NN8B 5LQBL 1S46A 3OR6A 2R69L 2ED8A 1BBDH 3NDYE 1TTFA 4PW9A 1PD0A 1VGEL 4YO0B 1HH0A 1RP8A 2WXJA 2XFXA 4GJTB 1OV8A 3NAAL 3V8CA 3VNYA 3UTZB 3MACL 5IG7B 5M1BA 3UX9B 4B9GA 1KBVA 1TLKA 5FW8A 4FQPA 4ERSH 5AVTB 1JZIA 3UYOD 4IBYA 3KDPB 1WUZA 3U1QA 3TEWA 3GSOB 4R4FL 1GS6X 2NY4D 4G6KL 5GIRB 3TEXA 3F89A 2EECA 3ARGB 3B7TA 2OAAA 2O5XL 2VGLM 5CN1A 1JHKH 2YPLA 5KAFE 3QZOA 1K73Q 3D09A 4OD3H 3IDMB 4U7SA 2OL3B 2A9MH 5DJAA 1X6NA 5EUKB 2VL4A 1HHGA 5EEVA 5AZUA 5DJ6A 2MOGA 1U8NA 5DD1H 2DYPB 2OYPA 2VC2H 3KPSA 1MJUL 5KLIB 3CZEA 2WWOA 3O4LE 1Q4NX 1M1KQ 2XIIA 4JZJA 4ZO8A 5DEJA 3KBPA 4NX0A 2IAMD 2G2PA 2WYZA 2WPGA 4PWHA 4K3DH 5E2WH 3MUJA 5EBMA 2LQRA 4Y4KC 3UTTA 5AW1B 2Q1EA 1CCZA 2DOCA 5C86A 4N9GA 4GAYA 5AKSA 3TT3H 1OK8A 1SUJA 2JTYA 3GHBH 4PJHE 2G0KA 3VFRA 4B9KC 3NCEB 4P46D 5FGCB 4JVUA 4KKRA 2AMUA 3BHBB 2R56L 2X2JA 1B0WA 3ETBJ 3HZKB 4NBYB 3AVEA 4PWJA 5CP7B 4EAEA 4N2AA 3TF7C 2CBTA 4I87A 1PMYA 5LLIC 1PX3A 5JPNA 2ZYAA 4KQ4L 5AQ0A 5E6UB 2P9RA 2E42A 5IBUG 2VDOB 5KW9H 4H1LG 5D1QB 1OHZA 2X4QB 5ADOL 4FNSA 3W68A 4JANB 5GRJL 4HPYL 4Z7UF 3GXPA 4YDKL 3JXAA 1TT6A 2NQDA 3P4NB 3EBGA 3L1GA 2KZWA 4I3SH 4JFZH 5FYKD 1N64L 3OXRB 4G7RB 5J12B 1TYEB 5E08H 1N0XH 4Q58C 2QEJA 2Q9IA 4PP1D 4R7DA 4ZXBC 2CM5A 2R1YB 4W1TA 4OIBA 2XCMC 4ZW3A 1W72L 3RWFB 3KWUA 3DRTA 4IOIH 4W9LC 2XLLA 3NRFA 3HN8A 4KI5C 3PNRB 1SDYA 3I74A 2R23A 1UA7A 2HLAA 4XPAH 1UWEL 3QQDA 3DHMA 4ZFOL 1R0AL 3MC0A 4NBZB 4NC0B 5CCGC 2A6JB 3DVFA 3ESPA 4OJFH 2WZ5A 3AXIA 5TDNA 4OLVL 2BIQA 3E80A 3QUZB 4KHTL 2K1MA 4Y9BA 4XP9L 2E3VA 3H4FA 2AK4A 2BRQA 1XGTA 2JCWA 1X7SA 3P9MB 2XWDA 3UJTH 4GBXB 3F2LA 1WA2X 3K6OA 4NFDA 1EHNA 4BRVA 1G1JA 1MZYA 3ATEA 5T3XE 1ZLDA 3B37A 2LXBA 4M5YH 3HNSH 4F8NA 1L0LJ 2FYUD 3QUMA 3GLMA 1MQ8A 2DKSA 4LCIH 3FQRA 5IMLB 3RWHB 3U0PB 4M02A 3G6JE 5GS1A 5HYSB 3G6AA 4YC2C 1L7IL 2FHBA 4PRPA 3HTKA 4X5PA 4N6JA 3MCKB 4P9MH 2JCCA 5JXAL 1X22A 3VFMB 3VJ6B 2H1XA 4NKDB 2APFA 4E5XA 1LO5B 4LCWE 1KF9B 4EYYQ 2IANA 4CKVX 1YN7B 3ECQA 3ABMB 1S9XB 2DLIA 3RBSA 4LHUB 1CXKA 3P3SA 4K07A 4R7DB 1I8KA 3L3DA 4RGMB 3L36A 3E6HB 1DYZA 1XBRA 1HE7A 3TPKA 2VLRB 2Q2EB 3L95A 1KQLA 4XAKE 5D7LD 4WEMB 1F58H 3NPZB 4HKZH 1Q8MA 3K5SA 3K7UA 2A83B 3HI5H 4KMQA 3U0WL 2HKHH 4HIJB 3BUYB 4KFZC 4LKCB 2PO6C 2H1LM 3OLDA 3FTGB 1JHKL 1NTZD 1I7TB 4PY8I 1CDHA 1E42A 3BSZL 2WKLA 2HRGA 1RLWA 1QPPA 1YECH 4J5VA 3QH3A 5KSVA 4HUUB 4X2UA 5EUOB 4W6WB 2ZVNB 4UOZA 4GKZB 1IEHA 4JMNA 1WGVA 4QTIH 2QE7H 2YD8A 4NWUL 2OCCB 3O6KH 1KGIA 4WTZA 5CIPA 5KJ4A 1QLEH 3JC22 1CDUA 3PHOA 5I1AB 2R0KL 2XWXA 4WWKB 1OM9A 1RP9A 5C0EA 4LSRL 4UCFA 5IJDC 1W91A 2EIDA 1VEOA 3KLQA 1YO4A 3QJQB 3GD1C 4UTAH 1Q90A 1PCSA 2HT3D 1N7LA 3T1FB 4H8PA 2XT1B 4B9ZA 1CI6B 2ZJSL 4APQB 2IPUG 3FU0A 4WU7B 1J05B 4FQ1H 2JCCF 1K5NA 1MFEH 2AI0H 3BN9D 4IK7A 5FW7A 1W8EA 2D0HA 1RFDL 1X9UA 5C0BD 2FQDA 4NXKA 1G4RA 1CK0L 1R17A 3LN5A 2EINB 4EN3D 5TK2A 2NX5E 4HWBH 1TVHA 5JO5A 1AD9B 2A9NH 1AHWC 4I18A 1KXQE 4WFED 4IW4C 4JFPA 1CBVL 2JJTC 3WJLA 1EJOL 2GAZB 3VACA 4WEBH 3AG4B 4IFFA 1CTNA 4L1BA 4XP4L 3O2WL 3HC2A 1UVQA 1MHHB 4UM8B 2FIKB 2HSIA 3BH9A 1CDIA 2HKFL 2PUQT 4MMXA 2DEXX 1K4DB 3L17A 3OAWA 4JFEA 1EGJH 2EDRA 3CDYA 2VAAB 2C5DC 2O01J 1EVTC 1QSFB 4LEBA 4PJ9C 2VDKH 2GT9B 4N68A 1QUNB 4AC2A 2DQIH 3GMQB 1AS6A 2Q3ZA 3SJVA 5D7LE 4JN1L 4XMKL 2CCVA 3W0WA 3GGWA 5KSBE 1A1MA 2ZF9A 2NTFB 3LNDA 3MRKB 1AIFA 4HT1H 4NOBA 3SDCC 5CKGA 4P5TC 5KZCB 2W65B 3VCLB 1OQOA 5IGXH 1LHZA 2MIZA 4F5CA 4F27A 4GFTB 5GXBB 5J6GB 2Z34A 3FSOA 1J1DC 1W8OA 4UF7C 2QPSA 1UB5B 5CWSA 4OFYD 1CR9H 1PZUB 2YSTA 4I1NB 4NT6B 4P8QA 4I77L 1WWCA 2MHAB 3OXSA 2VLJE 2QHLA 4Y4HC 1XAKA 3VRJB 3H1HD 3SE9L 5I75B 1Y0LB 2ZUYA 5CIPH 4HWEH 1ACZA 1BEYH 1YY9D 5L4IA 4AYFA 3H9YA 2P48B 3BVHA 1IGJA 3WFCH 1MKMA 2YGNA 5C3LD 2VT0A 2FDBP 3PAVA 2IAMC 4UOQA 1ZV9A 4K7PL 3LKRA 4HJ1A 2BEZF 4PJFB 4QXTB 2Z6FA 1QVFO 4ALAL 4PRBA 1YTZI 5I16B 3CMOH 1QLFB 4QXGL 5FA4B 1EEYA 4JYCA 2YN5A 1IJNA 3FCTA 4ANUA 1CFTA 1SQPG 2Y2WA 5IV2A 1DBML 5F7KC 1PAMA 4GBXC 3L72D 1FBMA 3QNYA 5H2BA 5IMOA 4RGNE 1R5VA 1NTMJ 3A24A 4ZAKB 1H6TA 3S48A 4N8PA 3EH4B 1C5CL 3GTVA 4E9XA 3QUZC 1ZGLA 4OZFH 2D4FA 3MJGX 3T0EB 3VVWA 2J3SA 1A02F 2QQKL 1RIVH 1B4JH 2VLRE 3OKNB 3BPLC 3NH7L 3UPAA 1OT4A 3QJSB 3O4OB 4PYHA 4XXDB 5EZJB 3W1ZA 3PIQB 1WAAF 3NSYA 4NJAL 4A2LA 2F19L 2XBTA 3IJSA 1VGKA 3IDJA 3T4YB 5FHBL 5ABDE 3SDCA 3KR3H 4UTBL 1MRCL 3C5JB 4GXFA 2E76D 3LS4L 2JB6B 1CD1B 1JRHH 3SOTA 3AE7C 3QO0B 5DSCB 1FH5H 2DDQH 4PJ7B 1HWGB 1X9RA 3SCMC 3I50L 1XV8A 1WAAE 3BZEB 1JVOA 5KS9B 1FV1B 4IBVA 3GSQA 4IFDK 4P59L 3MR9B 3U48A 1D2PA 1XSOA 3Q1EA 4R6UA 1A6UL 2ZT9B 2B4CH 4P04A 4DO6A 5CCJA 4X80L 2HPCA 3ROLA 1KCVH 4NZFA 4PJAB 4B95C 5CD3B 2D31B 5SWSE 1A1OB 3L4ZA 4PRNB 4F15B 3CX2A 4XNQB 4KJYA 2DIEA 3LN4B 1F1GA 1TU2B 4WNQA 2BIPA 3QPQD 1RK0B 4GSRA 4KUCD 3T0DA 3S6CA 1ACCA 1H3PH 3OJMB 4U0RC 4X4XB 4R2GC 2VC2L 1A0QL 3VGGA 2P2UA 1KPRA 4Y4FC 3GMRB 5LWYL 5F9OH 3PWPD 3NTCH 3R06A 3B2VL 5GGRB 4PGZA 5GSRA 4ENEC 3VSUA 1QBLL 3TO4B 4JFYB 2TRYA 3FQWA 3ZMEA 3NFNB 2O5NA 1AQMA 5LCVH 3T71A 4C4KO 4IM8A 3FOLA 4EN2A 1Y6MR 3CMEP 1XGPA 4LASL 3I6KB 3LKPB 1H3GA 1KLUB 2K0RA 3H1KG 3CK0L 3HFFA 1A6AA 5E99L 5KSAA 3D5OF 1L4AC 2XPGA 3FUJA 4P5MB 4ZSOE 1HCYA 5B1CA 2Q3AA 3OAZK 5DS8A 4XN9A 2AV1A 3WHXA 3FQXB 4V33A 4WY4B 5BVZA 5TGBB 1LD9B 2WIIA 3RUGB 3CFDB 1IGFH 2MTPA 4PTUA 2A3TA 5L7XL 2P52A 5CF3A 1RZ8A 5HY9B 2LKMA 4LMQE 2D0GA 1H5BA 1FDIA 4AWJC 2VDPB 3U9UA 3GMRA 3PWPB 1Z5LB 2P80D 4JQ0D 3IXAA 4HWZB 4PSRA 2XRAL 5L2JA 1FN4B 1ZT4B 3MFFB 4MRBA 2NOYA 4WNQB 3IXAB 4HWZA 1QPXA 2OTPA 4CN4A 4MD4A 1KYUA 4M00A 1U21A 2OTLP 1OSZA 2NYZA 4JCWA 4CU8A 3BUBA 3ZKMC 2BHYA 3KLHC 1FFOB 4JN1H 2X05A 5IOPA 2HRLA 1BP3B 1OQXA 4J3SA 4MZRA 1D9KB 2WSPA 2OMWA 2YA1A 1RIUL 4JX0A 2J59M 4HUVA 1MZ9A 5T5NG 2J4WL 4MRCA 4LL1A 3VXNB 4XX1E 1DQJB 5CR8A 1X5HA 3RL0C 4PJ8B 3IRZA 1OAKL 2BHUA 1BXXA 2I07B 1DBBL 2WLKA 5GRWA 4H13B 3NIGF 3WXWH 1T03H 3FKUS 2MNUA 2G3NA 2QGCA 3GMNA 1JTPA 3KPTA 3N50A 5E7FA 3OB0H 1QW8A 3NJMA 3ULSA 1AZNA 3BSGA 4L29B 4EUPH 3E7JA 3EOAA 1T8ZA 1AZBA 4QRPD 4FKKA 2J6EH 4PJCA 2XKUA 3PWNA 4ORGA 1PTZA 2MTAA 3ZHKA 1JNHA 1UOWA 4AYDC 3G3LA 1OPOA 4G7YH 1ZE3H 2QEXP 1J5CA 1VDGA 3WXVL 4ZQKB 4ISVB 3PQYE 2PO6A 4B3EA 4JPIB 3PTZA 1MFMA 2W07B 4QY8A 3D0LB 4MFHA 4XVTL 1COBA 1NC4A 4HCRL 4O02A 2IH1A 1VZIA 3OAUL 4WJG3 5DRNB 1GGIL 3VXSA 1XCTA 2EH7H 4WHCA 1TO5A 1ZLVK 1QL1A 3BT0A 5HHVH 4U05A 3S5LA 1U2HA 4R4MA 3QDMD 4AQ1A 4RNRB 4YSOA 2QVTA 5EHFA 3H0TB 1CGWA 4P5KB 1I9JH 3SYPA 1MNUH 4W9FC 5IP4A 1SM3H 2X87A 2VISB 3RBGA 3W38A 4KXAA 1WD9A 2L7EA 3O6KL 4OJEH 4Y19B 4M61B 4PRBB 4GAFB 5E9NA 4DGVL 1OLZA 1E4JA 2VABA 2ZKHL 2JB6A 4Y16C 2B16A 1E9PB 2AEMA 1NU1K 2NY2D 3I02B 4EBQH 4POYA 2JFCA 2GUOB 4JHVA 4Z0XA 4Z7VB 2QJPC 2FUTA 4R7XA 5EF0A 5FO8B 2WMPB 3JWNE 3HN3A 3Q2VA 2YA0A 4P2QD 4JE4B 4PLJC 2FFDA 2VZ1A 2IADB 2VB5A 4LSTL 4TQHA 4N0CC 3WJJA 1TG8A 5C9KA 2PWFA 4NAMA 1NFDA 3ZOAA 5JHLL 2PRRA 5GZND 3K6SA 1VZHA 1S5IH 1IGCH 3O41B 3FMGH 1VB9A 3V0IA 2ZYRA 1XSIA 1DUYA 4XMPL 3RGHA 3H1HE 2HWZH 4R3SA 3VSQA 4BHUI 4XZ4A 1ESOA 2J8UE 4N2FA 4JFXB 2VRKA 3RWJA 3NEEA 1GIGH 1QFOA 1SJEA 1CGSL 3ES6B 3HAEA 3UC0L 3CNKA 2DWDB 3MRBB 3OHMB 1IBFA 1TZHA 1HIML 1SLXA 1K8IA 1HNGA 1IFNA 5FA3A 1CD9B 3ZT6A 3TO4A 4FC3E 4FQIL 2LTQB 2PN5A 2W60A 5GGRA 1FC1A 4LHJB 3MBXH 3QQ9D 3FT0A 3M8OH 3H1IG 5ETUA 3UPRB 1AE6H 4IDJL 1M57D 3QO1B 4XNZB 3NJHA 1OEZW 1A6VH 1SDDB 3EDFA 2ZXGA 2LU5A 3L74D 4NKQB 1JY2N 5IK3A 4NB7A 4P2YA 1NSNH 1QG3A 5CSGA 1DBMH 5E1QA 4PD4H 3CC5A 4XC3L 2PR4H 1M90Q 2HPCB 1TO4A 1SNRA 4Z23A 4YQXL 5JQHC 4LBEB 1LT1A 3O11A 4YLCA 5MEOB 2ERJB 3O9WB 5BZZA 3Q6GL 3C6LC 2H8PB 1W72H 4FNPA 4G8IB 1RUAH 4MHHI 3FT4B 4H20H 1SXSA 2LAAA 1JZDC 5E08L 2H6PB 3ZT7A 3BN3B 4X5XB 1TQWA 5C2BH 4I3SL 3W0WB 1DLHA 5DJ0A 4XNDA 4EDWL 3L7EA 4FLOA 5TDOA 3G5VA 3LRLA 2VMFA 1X9VA 2DBLL 1NAMH 3CBRA 1W0VB 4N0YL 4JGUA 3PHOB 4R4LA 4GQ9H 5I1AA 2VAAA 3MCLH 1AZCA 1AP2A 2ICCA 4DN3H 3MNZA 1AY1L 1NAFA 1YG9A 4H2CA 4KQ0A 3E9UA 3IU4H 1HXYA 3SGDI 2IZ0A 4HS6B 1BIIB 4J23A 4E9WA 3FL7A 1ADQA 1JGLH 3I9PA 5C08D 4MQXD 2E75C 1PZBA 5IBTH 5CEYA 4JPVH 1I3RA 3VG0L 1KG0A 2JJSC 2B7DT 5DT1L 4XRCA 5GS2D 1GK4A 2WTRA 2VDLH 3X1GA 2YJLA 3VD4A 4WKZB 5C3TA 2A83A 4XODA 5H2BB 5F7HA 4OCSH 2Y07H 5GRUL 2C9AA 4V11A 2GITA 3MBEB 4FDWA 2XU6A 2E56A 5IWLA 4X6BA 1KBPA 3HE7B 3MRPA 4PB9L 4BFIB 1HGZA 1FNSH 1IE4A 3AITA 3NIGB 3H1KE 4EI5B 3G6DH 1U8MA 4L5FH 4LHUD 5L2KA 2ZCHH 3ZTJH 2A73A 3KPEA 2ADGA 1KJVA 2NCEA 3CFUA 3CFJA 3MAWA 4P4KA 3QEQB 4GMSH 3LW5H 5EU7E 4Q6IA 3S36X 1FORL 4X7TB 3T3PF 2PPEA 4WJ5B 3QC5X 5DR5H 4N86A 4MS6A 4ZFGL 3FB8A 5AAWA 1P7KA 3T65B 3EFOB 4EI6A 3VRJA 4HWBL 4H1LA 5I8CA 3FQRB 2WZPD 3QNXA 4K35A 5C0RL 1ZLSL 2AEPH 4KHXH 3RVVC 5CJ0A 3ZHDA 3CU7A 4GG8A 3HS0C 3MD0A 4QHUA 1IBDA 1E2ZA 4JKWA 2BW5A 1FVDA 4IQHA 3SYOA 4XCYA 4JQVA 3I6LD 4MQSB 3TVMB 1EGJA 4KXCA 3MRCB 4L74A 4OH2A 1DUZB 3KLLA 3GF3A 1PKQE 3MGNA 5LBVA 4Q9CA 5DYOB 2R69H 3N41B 2YD2A 1T7WA 3ZZ1A 1NIDA 3E6FA 5KBDA 5I66A 2IBZY 4HPHA 1VDFA 3N1PC 1GZPB 5DEFA 3CXDH 1FIGL 3QEQD 2FLBT 3DX3A 3L45A 1I8KB 2ZCLH 1ICTA 1RPUA 3MJWA 2QQNL 5LUMA 3WD5H 1CVRA 3PJSK 2X6UA 1LEKA 2RACA 5DRZA 1UD2A 2WMMA 4NN5C 4IL6H 4RFEA 3G5ZA 3CX5E 3AT0A 3QR1A 5JW4R 1SRDA 4G8EB 4YLQT 3VGAB 3U1AA 2RBLA 3FO0L 3HFML 1DQML 4LIQH 4UILL 3WSQH 3EQ2A 4NDMB 3CCVP 2XG4B 4PLKD 5I19L 5DJ8B 4RX4A 2ZSVB 4G5ZH 3B9DA 3CIQA 4JFPB 2VR4A 4HV8B 3KPRD 3QUMB 5I1IL 3RWDB 2IEPA 1L4AB 1DCEA 4D3CL 4E42A 2GW5A 1HH9B 3QARA 1NTKK 2CLZA 5FUZL 5KBLA 4I9WE 3FT2B 2EEXA 2C9VA 1EMTH 3OLEA 5IW6B 3GXTA 4YPGB 4ZUTB 2RKLA 5C0AA 4GUOA 4WU7A 4UAHA 5GJTL 2YUZA 4BRJA 2DMKA 1QZNA 1FO0H 2F7RA 1HQRA 3OWRA 4GYBA 1QLED 2OMUA 1P6WA 1VQ4P 2WANA 1JPFA 1KLGA 4NHUA 2FZ3B 1H5BC 4OB5L 4LVNC 4Q0XL 3RL1A 3CLFL 4JB9L 2VXQA 2XIDA 1P4BL 4HCGA 3S2CA 2XV6B 2AQTA 3EYVA 3IJEB 4JQIA 5HYQA 2B20A 4L4VB 3NIDB 2RH0A 3QEHA 2BNQD 4IKNA 4TNFA 2ZYHA 3A67H 3C08L 2FHCA 4YHMH 4BSVA 4M5YL 1KILA 2AEQL 2EC8A 3LNEA 3A2AA 4KJQC 2W95A 4DGIL 4OF3A 4F20A 1AGBA 4Y9FA 3WV0A 5CZXC 3GF8A 1NCBH 1ES0B 4DGYH 4PJCE 3KXFA 1AVAA 3S96B 5IVXE 2AV7A 1OGAB 2D4DA 3S88L 3FO2A 2P8PA 4J6RL 2F7IA 2HKAA 4IFMA 4C47A 3II6A 3S35L 4XPAL 1M2VB 4MAZA 1M6UA 4XR8C 5JXED 5INDB 3G9AB 3OKEB 4OV6F 2MPAH 2QM7A 3V7AE 5JPNB 2BOCA 1ZTXL 5CLTA 1SY6H 4UB8H 1HL4A 5CP7A 5C9JB 1QEWB 3VUAA 1DE4B 2GKIA 1BW8A 1TPXB 3O45A 2DD8H 4PJHB 5D1ZC 3H1LG 2BSTB 3VM7A 5DT1H 3C5ZA 4HSCX 4YE4H 2MNWA 2BJML 1T5XA 2ARWA 2PYEE 2VXVH 2OTUA 1AO7B 1AIZA 1CR9L 3QJOA 1S7TA 3UTTB 4Z7WF 1RK1A 5DZLA 5EBMB 3QCVL 2HVKA 1A5FL 1XZ0B 3CC4P 5APQA 1KB9E 3P11L 3VMXA 3TL5A 4PRPB 1FP5A 4KKLD 3SDAA 5K1VA 2V2XA 4Y5YC 1PQZA 1NAML 2NW2A 2N59A 4H4NA 4ORZC 2HFFA 4HKBA 4KMLB 3UAJC 1G7IB 3EYQC 2Y3AA 2DQHL 1FIEA 1Q9LA 3AXLA 5GSVA 1H15B 2WCGA 1JP5A 3UIZA 1LP9B 1RHHB 2CIIA 1VEPA 1M3IA 1FGVL 3S5ZA 2YBRA 5E8NB 3QUZA 1HJCA 3TCXA 3FQTB 2C1PA 4Z7NB 3ILEA 1NTDA 3SE3C 1VADB 1OANA 4OM0L 2OYHB 2QVAA 4KPHL 1GKEA 5JR1L 2Y2YA 2EXTA 3VFNB 5APYA 1O9WA 3PGFH 4EUPG 3BLBA 2V9UA 4XWGL 2WBWB 4UZSA 4C46A 5FWRA 4KKCC 4PR5B 3RILA 4YDLB 3F7VB 2WQXA 1G1YA 4P48A 1HT6A 2FBOJ 3L4WA 5MI0C 1UM6H 3FS9A 5JHBA 1KB9I 1JTOA 3CGTA 2W90A 3HUJA 3GS0A 2DWYA 4XNMA 3RB5A 2AJVL 2BFVH 4S11A 1ZLWK 4DFHA 3H4HA 3V5HA 4JO4H 5FCSH 4WTWA 1UQSB 1LJ2A 1TJIL 3E7KA 1WZMA 2OSLB 4FQCH 5CZXD 2DQ6A 3CBKB 3TEZA 3EWKA 3D25B 3RL2A 2XSKA 4LBAA 4Y1TA 3RTQC 1IM9A 2UZIL 4BQBA 2GM4A 4LOEA 2C3XA 1B2YA 3BCCG 2I5YH 1U8LA 3MUGA 2EEBA 5AW6B 4KXZI 2OYIC 1UM4L 4XC1H 3TZVA 4H1LB 3EO0A 3FB8B 5PAZA 1RQUA 1P4LA 2VRQA 2Y6SC 4PJDA 3LJ3A 2D7QA 4GKSB 4KBPA 2R69A 4YK4C 4HJUA 4RFOH 5I1JH 5JHLH 3H1ZA 5F3BA 4FG2A 4X6CB 2CO7B 3FUEA 3TJEL 4AUYA 1ZSHA 3V6FA 4YGVA 7PAZA 3OAYH 1NEZG 2SODB 4BA8A 3WELA 5LGYA 1LWUC 4G42A 2C7FA 1YY8A 3BSZH 2ATPB 2AJXH 3V0VA 4HFWB 3CXFA 4TLTA 1X7QB 3N5AA 4QLWA 4TYUA 4QGTA 4BJLA 1KIQB 4GAGL 5L6YL 1KC8Q 4NM8H 1OP9A 4H13C 1XR9B 2MFNA 3CXDL 5GJSL 5LG1A 5BUAA 2P26A 3V0EA 2Q7NA 5C0CB 3NABH 3VRIA 3RRQA 2VMJA 5ESVB 5I6MA 2YXWA 4FYQA 1D9KC 3QULB 4FFYA 4JFFB 3EXJA 4QHKI 2BCMA 2EACA 2XG4A 3P2BA 5GIRA 1N7MH 2P44B 2R9HC 5AYTA 4DTGL 5I73B 4GT0A 5TFSH 1K2DA 2EADA 2ZYGA 1F4HA 2R2EB 3JUZA 5E5RB 4EKJA 3VNZA 4BH7A 4X9YA 3B7UX 1DEEA 5ISZA 2EDHA 4HIHA 1LJMA 1YNKL 4RWYH 3UO8B 3BP7B 1B3JA 1QVOB 2PAJA 4X4YA 3IKCA 3WHE0 4JFQA 2YAPA 4FTDA 3HD7D 2NSXA 4AK1A 3QJFA 4ZFGH 4QGYA 2BNRB 1SFCD 5APTA 4Z76B 1MJ8L 4YXLL 1IC4L 2I7OA 4HAKA 3BYYA 2K6YA 3MUY1 3QQXA 4LHUG 1AZRA 4G8IA 4Z7UB 1CICB 4FI6A 5KVGE 4OLVH 4D6TD 2NYYD 1VF5C 3GPSA 3V7MA 4OZIF 1PDKB 1T3UA 1UCBH 3QIBA 1ZHKA 2TAAA 5LN4A 2IO5A 2X7LA 1NCJA 3TBWB 1FOSE 2X89A 3UBXI 4E42B 2COQA 2QJYB 4ZTPL 1ZSDA 3A4DA 2B1HH 1AV1A 1YQVH 5E0QA 5DHYB 3CUPA 5EU6D 1SFCB 4CSTA 1XXFC 1AQ8A 3HD7B 2QSVA 5KANI 2N1KA 1PSKL 3IAPA 1FG2B 4JNXA 4JFSA 1X5IA 2DS4A 5MEPB 2R15A 4OZFG 5F7UA 3S8GB 2P8MA 5HI3C 3LIEA 3TFKD 4YC2B 4I7ZC 2CGRL 3DSNA 2H2PD 1SOKA 1VPOL 2I27N 4M93C 5CILL 2V3FA 3IMBA 2F1AA 4AENB 4UV4L 1AFVL 4AMXA 1BFVH 1YDPB 3KBHE 1WTLA 1I8MA 3QFJD 3HHSA 4GW5B 4M62L 3FB5A 3FCBA 3GMPA 4WO4B 3C2SA 2HN7A 5MEQB 2NNXA 2ZNWA 3TCLA 3QJVB 3NEXA 3H1JJ 2NPSA 5I17A 4JN2A 2X40A 1HHHA 2F74A 4PRHE 4LEOA 3U9WA 2CR0A 2FATH 4OZ4A 1XF2A 2FX7L 5E8PA 2KHAA 4OZIB 5HHXH 2G4EA 1EZVG 2LU7A 4OUUA 1C7SA 5T3ZH 1DQIA 4Z7OE 2VW6A 1MCLA 3GSNL 3ZIMA 3DROA 4B9YA 3S3JA 1T6WA 4JRXA 3UG3A 2ZXXA 4Y8AA 3CC2P 1MIML 3HE6B 1S9VA 4ABVA 1UATA 4ZMQA 2H41A 5DRWB 5J12C 5KS9F 2OA9A 3HI1B 3BPLB 4U1JB 3ILQC 4NQCD 1W2EA 5F7AA 2A9ML 4WO4D 1ZVSA 1BQKA 2A4EA 1DTUA 2VISA 1RZFH 1H3UA 2BXZA 4FQIH 4M5SA 4FI7A 4L4VE 4XMTA 1WFOA 3VOPA 2K78A 1VQMP 1VF5D 3N44B 4W9EC 5D72L 5INCB 4MWFA 2PYED 1CIUA 3ULVH 4XP5H 2XA8H 4BWUA 4PBXA 1FFPA 1ET7A 5E79E 1WFTA 3TNNB 4JFUA 1TYJA 2FEDD 3MJ7B 1FZCA 5D93B 3RY5A 5JNYA 3ILPA 4PREB 4NHCH 1FZAA 2BRRL 1WCBA 4M5ZL 1QGKB 3BISA 3RBXA 1PG7H 1CI3M 2VDLB 4MMZB 1VPOH 1KJ2B 4U2YA 2K3RA 4CMHC 2G5BB 5FOBA 2L7QA 5L88H 2Z8WC 5KLIC 4JZOA 2DEWX 1P6AB 3QCTH 1SUHA 1XCQA 3CPLB 4JKPH 1USZA 1TZHB 2J21A 4G9FE 3X1EA 1N10A 1SBBA 2CKBA 4JO1H 1FZJB 4OD1H 4HJSA 3KD4A 3ES6A 4RFNB 1CG9B 1OAUH 4I6MC 4H8QA 2WNGA 3R1GH 5C7XH 4UIMA 4BCXA 3BW9A 1QTYT 4DP0X 2G60H 3BZFA 1ASOA 3X1NA 4XN8A 4Y2DA 3BKJL 4Z77B 2EXWD 1MH5A 5CM1A 3WNIA 3BMWA 3SPHA 4D9LH 5GGVY 4POZC 4LSVH 4X8CA 3BZ4A 1NAYA 4H1LH 2NR6D 4K8RC 4WI3A 2WK2A 3DXAD 3LKSB 4J28A 3U0TA 3QUKA 3U30C 4P5RA 4UB0L 1BVOA 3AU1B 2Z8RA 2X12A 3N7NA 3PHQA 1INEL 1J1PL 3K2IA 2OZ4A 4DPCX 3L70G 1S4IA 4IRSD 4ZOEA 3G04A 3RWCA 2J58A 2CUMA 2H2SD 2R0ZH 2YUVA 3HRZA 4MCZA 1NKGA 1UYWH 3BAEL 4OFQA 1XTGB 1QRKA 4DO5A 4M6AA 2VNCA 3BSZA 3F5WB 2CGZA 2PFXA 2NNFA 1KN2L 4HH2A 3RFZC 4H26A 1SGKA 2G4GA 2AABL 1A4KB 3TWCH 3L5XL 4ELKA 4OLYL 5EU7C 4Y1AD 4YTPC 4ICWA 5E00A 2NMSA 5I73C 1IILE 3EOYG 3WIHH 5HPOA 4RWYL 1UURA 5DQDH 1KFAH 1HZLA 3EYOA 1QBAA 3RFZA 2IVFC 1AH1A 4RESB 4P5MA 1EZVD 4Q52A 4S1RL 3QH9A 2M26A 4PGEB 4C58B 1JPSH 3QCUL 5E6RB 1F3DJ 1IFDA 1GGUA 3CZFB 1ETJA 1XGPB 5EWIL 1NANI 3LB6C 2CMRH 4DEUA 1ZHBA 3M7OA 3MGAA 5L8JB 3QW9A 1S7WA 1CJYA 2BOLA 3L5XH 3VWKC 1UENA 3MGOA 3W39A 3QUXC 4P46B 3VRLF 4KTDH 3ZSTA 3ZDZB 2BO0A 3V4VB 1KPRB 2Z31D 5AB2A 5HDQL 3JV6B 3TV8A 1G6RL 4JKMA 4MXVE 4PJDF 4X9FA 3TJHD 4PMEA 4HJGH 1XF3A 4UU9B 4A2HA 2B9AA 2GPZA 3RZCD 1NFKA 4YAQB 1E3ZA 1FFPB 1MCQA 1VFAB 1PLBA 2VQTA 5B3JF 3P4LA 4UYPA 3SGEH 5E6ZA 4XX5A 4YDJB 1PY9A 5D1QD 4NZRH 1S78D 3AREB 2Y9YA 2BVTA 1VQ8P 2ZUXA 1VQ5P 1WBXB 5DJ2B 2BS71 2OMWB 3DWTA 3GXFA 3WNOA 2J12B 3DV6B 1OIPA 1XCTB 4F7PA 2IBZD 4R90H 4J27A 1WS7A 3Q5PA 3DO3A 3GMOA 4M9PA 2NUTA 3KVDD 3M1BA 2JWAA 2D73A 4AT6B 3KM2A 4JPIA 2Q6WB 3VFSB 3WFHA 2OZ4L 2IDTA 4ODUB 3IMVA 3MFFA 3DROB 4D6TG 3GLEA 1AG0A 2O6EA 4HS3A 5FC9A 3T6WA 4YQXH 4P2RB 3D50A 4IHOB 2X0VA 4CVWA 4XO8A 2A9AA 1GZQA 1GYCA 1KN4H 4BZ2H 1NA8A 2XVKA 1BQSA 1B4LA 1NFIB 2H6UA 1KV7A 5LWYH 2ITFA 1OFCX 1YMMB 3MV9B 4WENB 2Y1VA 1YJNP 2NPSB 1S7WB 3MV8A 4YXKL 5I17B 4K5MA 4NAJA 4PJ7F 1BQHG 3QNZB 4G72B 4WY4A 2XA8L 2YMKA 1XGUB 1IBGL 1JV5B 4IDJH 5IMOB 3VD2A 4LRIC 4OM0H 1JE6A 2I85A 4OGYH 5A7EA 5EU6E 4Y99C 4BM7A 4F58H 3MBXL 3PABB 1LLAA 1RH8A 1S7VA 3MRMA 4XE5B 3DTDA 5BJTA 4GW4A 1BZ9A 2B4CL 3FCSB 1S4XA 1OT2A 3L48A 4G80B 4AOFA 2CBMA 5F6IB 1QLFA 2W9EH 4HGKC 2ICWI 3LVEA 5IB4A 1SQVK 3CN0A 4QO1B 5L8KB 4POUB 3K4AA 2ED6A 2ITCA 4MAYB 3D85A 3WTTA 4AYBA 3PU7A 3QJHA 1ZKAA 2IZ1A 3O3BA 5IVZA 3QJRB 5JHDE 2E7LC 4G1EA 2FO4B 4E2OA 3ZQWA 4XMPH 4M5ZH 1SYVB 1ZHLB 3LS4H 1KPUB 5J6HA 3L75J 3P8CD 1Y0LA 4EF3A 15C8L 3AE1C 4RH4A 3NCCB 1ASQA 3VXOB 4HEPA 2X4RB 2GFBB 1S7RA 1IAKB 3RWIB 4DUWA 3IPFA 1KGWA 1T5KA 3ZW3A 1ZMEC 2X7LB 2E74D 4P5SA 3EYOB 3MHZA 3O81A 1MCCA 1HTLC 2OXHA 3LZLA 4OFKA 2F1BA 5DMGC 5D1QC 1FV1A 4ACTA 3S36L 1WBYA 1IZKA 2IH3B 4RCAA 4CC0A 4V1DE 2GBVA 1PNCA 2ZKWA 3Q8FA 2RTTA 3VTPC 1C5CH 1JGDB 5J06A 3QXWA 1YEIH 2YPLE 3NJXA 4PM1A 2FR4B 1X5XA 1NH4A 1G5AA 5A1AA 3QEUB 1NCOA 1IGIL 4JLRB 3TFKC 2Y2TA 3F6JA 1I9JL 1HVXA 2JR8A 3G04B 4XP9H 3KGTA 3GI8L 3DTUB 2RHEA 2VXSL 1NU1D 1MPAH 3AQDA 1A9EA 1QNZH 1SJXA 1FZCC 5JIKA 4QXGH 3K2KA 3HRPA 1KB5L 1YEIL 4P2RD 2X6AA 5JA9A 2M0BA 5DD0H 1J8HB 3WMPA 4ZUVB 1WCBB 4TVSa 4IMKA 1YMME 2XC8A 2IGTA 3D3VA 1EHLL 5T33L 1J18A 5IQMA 1ZJAA 5EF2A 3IAGC 2VE6A 3H42L 8CGTA 4X99A 2R1WA 3GXMA 2SEBA 3DYPA 2D31A 1QBML 2VQ1B 3EBHA 1HSAB 3T3MB 3AS3A 1BSNA 3SFDC 4MNGE 1O7DC 1FZKA 2V2WA 4GRMA 5IHZA 1MFUA 1YYMH 2WSFH 1J05A 1SN0A 2DLFL 2IWGA 1PEWA 3H7BA 4D8PA 4FADA 2DJ4A 2Z7ZA 3BVDB 3B9KD 4JZNB 4X5WB 5BQ7B 4PJEA 4DEWA 4DKTA 3GUTB 3RUGF 1SQVE 1FFRA 3KWWA 2VERN 2VLLA 2WLMA 1SQBD 2YGQA 3KXFE 3EKCA 3DX9A 5IVXA 4X6CA 3NMDA 3H56A 3TDKA 4GODA 1ADQH 2XXGA 4LCUB 3CMAP 5IESL 2IGFL 5B1JA 1IAII 1AVYA 4CW1B 5HI5D 2UY7A 5D55A 1T0MB 1DQLL 4AQZA 5DURD 3VFVB 1JF1B 3B9VA 1BECA 2WBJB 3S5LB 2ITDA 1OX3A 5ANMB 3H9HB 1DQVA 1YN6B 4XBGA 4JO2H 1HGVA 3FQUA 2CO2A 4I2XE 2V7QH 3GDBA 4ZFOB 1UCBL 3MBWA 2D7TL 3BEVA 4TVPE 3MNVA 3MTXA 1YEEH 2F5AL 4ZUUA 3P77A 4PRPD 1UXSB 3JT0A 2XN9B 5D7KE 1A1MB 2AK4E 3GGWB 4ZMXA 4AKPA 2WXGA 2ZG2A 5ESAA 3GMQA 4FCHA 2GT9A 3TV3L 4FQ1L 2IAND 4NQXB 1EQWA 4GXVL 4PJFA 1GC1L 3KPOA 1OAQH 2PTTB 8FABB 5IFJB 3GSVB 5FECB 2C9XA 1WZ1L 4Q89A 1LE9B 3Q3GA 5KYWA 1BE3E 3IFOA 1FVCB 4PJ5E 4DP7X 1NL0L 2AJZA 1EDJA 2X2HA 2QADD 3WFZA 2HRHA 3L3HB 4OI9A 4BQCA 3WKMH 6PAZA 1FJ1B 1OKEA 4DH2A 3N2JA 4FEIA 3V0AC 1AGEB 3UZQA 3LZFH 4UT6H 1YDPA 1YNLH 2WWNA 3NABL 1WCQA 3NPSC 1N3NA 2ZP8A 4LVOB 1KFMA 3LQZA 1MCWW 3TP4A 3K8KA 3DECA 2IDUA 3N42B 3SQOH 1GC1H 4O4YL 1N70A 2DQDL 5DZNA 5EIIG 4GAGH 4ZFFA 5H37A 1GC1C 1JHTB 2YKKA 4K71C 5I0VA 4YMPA 1HL9A 2FH8A 1KQFB 4OV5A 4OCSL 3FFCD 1JWSB 2YZ8A 3S97C 3CFTA 4QNPF 1J8KA 5JIDA 3V4PH 1OE1A 1SLWA 4YHPB 2MCG1 4C8XA 5B1KA 3RTQA 1TU3F 2I60H 5EEYA 4N2OA 4W9KC 1ZT7A 2BHFA 4MA1B 4PGCB 3PREA 3IDNA 1E6JL 4JY5L 2R2BA 3BIBX 5JIPA 3EHBC 3IU4L 3JSSA 1MHPH 5AEAA 3ISWA 3AWFA 3GSUB 5E2TL 2A9BA 4QTHB 3MLSL 4JKLA 4K5LA 1P9MC 4NN7C 4X98B 2XZQL 25C8H 3QYNA 1H19A 3D08A 2ODIA 3HZVA 3D2UA 2FYYA 4NJAH 1TVHB 5GZOC 4QDGA 1TJIH 4FQCL 2ZT9D 5EZLB 1CLVA 2BM3A 4QRBA 2VDPH 3FT3B 3RWEB 4LU5L 4Z76A 3BRFA 1AGBB 3CPUA 1CMOA 4QRRD 4HF5L 3IMUA 2LR2A 1PX8A 1DVYA 1ID5I 4I85A 3VM5A 1WWWX 2R4RL 3IKCB 4NP4H 4LSQH 2WVUA 4YFEA 4OCRH 4BSVB 1T20A 4G8GA 3PL6D 3T77A 5C6TL 2R59A 4LPWA 2Y5TA 4JFED 4NGHH 3FN0L 1OE3A 1KIRA 2IANB 1AZUA 4GO9A 1A3ZA 3T3MF 4YGVB 5FKPB 4P0DA 2WHVA 1GTFA 1MCOL 2CDGA 4QOKB 4LQFL 2BIOA 5B8CA 4YZWA 4P9HL 2WYIA 4A6YH 2FWOA 3H42H 2ZNXA 4JHZA 4NUMA 5CEXB 1S3KH 2NY0D 2OMTB 4I7ZB 2EYSB 4ZJ9A 3UBXG 4X7EC 3WE6A 2AXHA 4FNUA 2QKIB 3VFTB 3MKGA 4JVPA 5B3NA 5DGRA 3C8KB 5GRJH 4CRPA 4QRQB 4P9HH 2V8MA 1WHPA 2OTJP 3BPOC 2YPLB 3TH3T 4A66A 2OYLA 2HG0A 4LC1A 2LXCB 2WSEJ 1HN1A 1NFDF 2FECL 1BD2A 2B87B 3GSWA 3L6FB 4K94C 1N7SB 4JM2A 4L8BB 4ODVH 1XWVA 4WHTA 2HWZL 4OGXH 5EU3A 1PV3A 2V3EA 4W68A 3WUWA 2FXOA 1IFRA 4HHAB 4RZCB 4URTB 1LQSR 4PV1B 1I3VA 3NSDA 3TIDA 5ENWA 5CCHC 1NUNB 2YOAA 4YE4L 1JY3P 1LYQA 1MHCB 1MHCA 2QJPB 3AXHA 1TYRA 3ABZA 5BZWB 4Z7UE 1CICC 1T4KA 3BEWA 3KM1A 2EVJA 1PIGA 4HIEA 5AZ2L 3P4NA 3WLWD 5A2CA 1FDLH 5H2FH 5BMFL 5HI3D 4XCFL 4KJWC 5FCUH 2AQNA 2P7TB 1JMZA 4X42A 1V5JA 2HX7A 4ZS6C 3CQPA 1IKFH 3NA9L 3F85A 4HC1A 2A5UA 2X6VA 1H15A 3C87A 2W0PA 3DVIA 1VPCA 4XNMB 1UWGH 3HUJB 2HG5A 4MNGA 5FUZH 1BE3J 1NOFA 1EPFA 3BUIA 4MASA 4IOFC 4G6ML 4MB5A 3NZHH 3O2WH 5MHSD 1B0GB 2FT7A 1JF6A 3GFUA 3SE6A 4DNLA 4XOBA 1S9KD 3ZR5A 2A6JA 4DUVA 5ELIA 3ZYJA 1XZ0A 4NQDD 3ZVVA 3P30L 3T04D 4HCRH 3E1F1 3ARDC 4YXHL 3QEQA 2GQHA 4M48H 1M56B 1RFDH 1LNUB 4JM2B 3JVFC 3HAEG 4CSZA 3DRTB 3GRWH 2ZJSH 1MAML 5HSFA 1J1EB 3T6QC 3SQOL 4Q9QH 4XBMA 4ZW6A 1IFIA 2YLKA 1QRNA 5GSVB 1KENH 3RX9A 3CIAA 1UT1A 4JM2F 1A6TA 1KFGA 2ZX8A 3X12A 4BELD 5AG9A 3DBXB 3QI9D 3CVHL 2VN6A 4N28A 1UZ8A 4AVKA 1IQWL 4XNAA 4XVUC 3ARTA 3US0A 1FL5A 4RX4D 2FYYB 4KK9D 4N0RA 4WDIB 3W57A 3FU3A 5IZ7A 2WTRB 2OYOA 1A66A 4QOKA 1RQVA 5EBLB 2EKSA 3ZX1A 1DQQB 2E76B 2X2UA 1KG0B 3QA3B 4Y5YA 1V55B 3CD4A 4HH8A 3C5ZC 4KHXL 3UBGA 2XX1A 2D7MA 4IRSB 3IN2A 2L3BA 4OLUH 3TESA 3L7FB 1OOWA 1INQB 1KJMA 2CG9X 2DIJA 1XH2A 1Z3GH 2PGDA 2XQYA 3R19A 4MJJA 3RTQB 3A4EA 2WBXA 2D9CA 3NIFE 5B22A 3NN8A 1FL6A 2BINA 3M86A 2X0UA 3CLWA 1HS6A 4M7LT 5KYYB 1FO0A 1OW8A 1A7BA 3KPPA 2ICWJ 4L8CA 4S2SA 3UJJH 5TJHA 2CCWA 2FBJL 5IOKA 1TOXA 3ARUA 3ZHNA 3ZRCC 5IFHH 3MXVH 4TVPD 2DWEA 1GGCL 2IC2A 2ZIDA 4PB9H 5JPNC 2H5UA 4KJWD 2LLNA 5DJDB 5HHOE 2A4ZA 1L0YA 4IJ3C 4YEFA 2Z91B 1BQHB 1IC4H 4YL4A 1EDYA 4PY7A 3EO9H 4CUCA 1U42A 2BVPA 1R3HA 2OYHC 1Z3RA 3KVPA 7PCYA 1IO4C 2ZWNA 3E2HC 3IJEA 1TJMA 4CDHA 5C70A 5HYQB 1C7TA 2XVLA 4KGJA 4EKXA 3EHBB 4JPVL 5E1HB 4IIQA 3W82A 1OP5K 2JKNA 4AIEA 1K04A 2FO4A 4ZMTA 3B4SA 3QZNA 2AVGA 2ITCB 4MAYA 4DTGH 4DW2L 2QKIC 5IHBA 1BZDA 2XFGB 1MI5E 4MLIA 4KAQL 3NSCA 4XPTH 3UPCA 1ZLUH 5CCGE 1UJ3C 2RAMA 5T5FL 2ENQA 4UT9L 2FEJA 4DVRL 2NXZB 2RMNA 3A6CL 3HAEB 4GLRI 1HH9A 3MOAL 1RU9H 4M3LA 2C1OA 2OLDA 5ACMA 1KN2H 3SO5A 3ECUA 4C55A 4ANXA 1TZIA 4Y4KA 3RGVD 2PYEB 2EH8H 4JRYD 1OW6A 5DFTA 2PWGA 1CYWA 3IGFA 1J0HA 2DQMA 3GQFA 1I9RL 4U1MA 3DV4B 4PJ0E 4YBLC 4EMZA 4XCYB 1FZBA 4ZW8A 2NZ9D 3NACH 1KB5H 1RZQA 4RAVA 3RNQB 4NUJA 3S34L 2A9CA 1M05A 1T4KB 1YEFL 1XF5A 3BEWB 3L72J 3M0DA 3KPOB 4Q6IC 1E5WA 4L4TE 2VR7A 3VXMB 3BCDA 1HKFA 4JAMA 2UXTA 2UY7B 2K88A 4D6TJ 1RF1A 3PRZA 3U46A 1AY1H 5K9KB 1QTSA 4L3EE 4RZCA 1M7IB 1UXMA 3OMNB 4LNVA 3MRRA 4GRLB 5DUJA 5F21B 3PJSA 2GJ6E 5D5MA 4NS0A 4UOW0 2KI6A 1J48A 4I1RA 3BRDA 1EO5A 3IFLL 1MRCH 2IBZX 1VZGA 3T1WA 4H13D 2R56H 2UY6B 3WIFB 4F7PB 4JO1L 4YHZL 1NMCC 1JNJA 1JY3N 3CZLA 3Q44A 2CO3A 5C6WH 1R5WB 4HLEA 1T2KC 5C09D 4ETQB 5I0XA 2IDFA 2W0KA 1BMGA 2J71A 4AQ1B 3PP3H 3D06A 1JGEB 4PI2A 1MCNA 2ITDB 1BVLB 3VXSB 4J3VA 5DJTB 2DQJL 1WISA 4M4RA 3SWKA 5AYUL 3TVMC 4JFDD 2Q9OA 2VQ1A 1ETB1 4LLDA 1FYTA 3V6BR 5JOFA 4GMTH 3FMGL 1AXSB 3VXRD 1UM6L 3CZGA 2Q6QA 4KTEL 1F5WA 5GS0L 2A2QT 3GS7A 2A06E 5K9OB 3WFBH 3QXAB 4R97C 5EG6C 1XF4A 1N8ZB 1I3RB 3N44F 5B39B 3EHBD 3JV6A 2Q1KA 4DVBA 5C0GB 4UB6E 2YPVA 3GUTA 1YEDB 4PGBA 2V17H 1M6OB 1RJYB 4YSCA 3L75G 2O01H 5IQ9B 1A4JB 3U1CA 2VO5A 2YMXL 1OW0C 2WOYA 3Q0HA 2Q86A 3Q7JA 4EBQL 4TRPH 5J3HC 5BVJB 2X41A 2YMXH 1CVSC 3M45A 2HJFA 3L3OB 2DW5A 3BDYH 1JNLL 1SEQH 2CK3H 3IPBA 4LPVA 4OKVA 4Y8DC 1BWWA 2Q3XA 1JGDA 4FQLH 2Y25A 4XMXA 4DP4X 2JDIH 1L9NA 3HZVB 4OFDA 4WWOA 3A47A 3J2PA 3DC0A 4ODHL 2WUBH 4JFEE 5D8JH 3H25A 1A7PH 4K94L 4FX5A 2ZXQA 1BM3H 4NFBA 5FS5A 3GM0A 5HHVL 1KXVC 3VH8G 3H9SB 4U7KA 3D51A 3O11B 4QRSB 3OA7A 2YR3A 4HKXB 4N1EA 5EV7A 1IAOB 1L9SA 2E43A 3BDBA 3VG9B 2H3KA 5EEXA 1MN4A 4S0HA 3I3EA 1WLHA 3QORD 2VXVL 4JFOA 3APFA 5KVEH 1UA6L 3BQUB 3U4EB 1V7ML 3O4LD 1WC7B 2FY8A 2E9BA 4GUCA 3VXOA 2J8UA 3O6FC 4A04A 1K4CA 4JO3L 3NJKA 2ZQKA 5DK0B 4OLXL 1L0NG 4H2AA 1H9VA 3STBA 2BNUB 1HCFX 3VWJC 2H7WA 3PHQB 4G1EB 3SO3B 3BP4A 3AU1A 2JIXB 2PTVA 3K81A 1JZ5A 4FQ2L 3BKCL 3QUKB 3TSIA 1U8KA 4XPGH 2J5LC 2IH3A 1WBYB 2HJKA 3L3KA 4YSEA 2E4FA 5CGBA 3IE9A 4U6TA 2A1WH 4MLSA 1N6UA 1CPUA 3O9WA 3EUUA 4Z6AT 2FYZA 3GIZL 1CE1L 3HE4B 1FFNA 1HEZA 1PVHA 2DEYX 5FKAB 2XPGB 4F92B 1BYNA 4TF4A 1A3LH 2QBWA 2YPKA 4GRLC 1GCYA 1S7RB 4I4WB 2CO6A 1XD1A 4ODWB 1SMOA 4XP4H 4R7NB 2K6ZA 1KEGH 1WRGA 3PV6A 4AXWB 3GNMH 2H3NA 2CDEB 3I9GH 2YA2A 5J13C 2FCBA 5CEZD 3PWVB 2N0KA 2V7NB 1IM3D 3VGFA 1CI5A 3PV7A 3VQMA 3DX0A 1T2QL 2G5BA 5FOBB 1ZEAH 2IWKA 3E9TA 3UDWC 1IARB 1SF3A 3BZ5A 3IETB 3CLFH 1DBKL 3FQNB 3KYQA 4KY1L 4F9PC 4Q8BA 1EQ7A 2X53A 3DSFL 3Q9PA 1SQPD 3ESOA 5IEKA 3G9RA 2VLJD 5ALBH 5DZJA 4KAQH 4XPTL 1CDBA 4LPUA 5IMMA 3OX8B 2QPUA 1SJEB 4N5UA 2M1KA 4GIPD 4M7ZC 1U30A 3IJHB 2RQEA 1UTDA 1FE6A 4EZLA 5EF3A 4ZUUB 4UUJB 3NCYS 4BGLA 3FDWA 2WPSA 5AALA 1MSPA 4BV1A 1N4XH 5DQ9A 2DWSA 2JQZA 3V2NA 3MV7D 4Z0BL 2M5AA 2ZX9A 3TTSA 2J5UA 4PJIE 3G5YA 1EXIA 5ANMA 1KYOD 1ZVNA 4YL9A 2XQYG 4PD4J 1U57A 2EDWA 2FYUE 4LLYB 3VFVA 5KYNA 2E5TA 1NGPH 1T0MA 4FJ6A 5B3JE 4XGZB 4KHXA 1T21A 3VMZA 3N1FC 1MCBA 3L72E 4G43A 3C5JA 4P4KD 1MG3C 1CF8L 1EV2E 2VLRD 1L0LD 4D8OA 3WNJA 2QV2A 3MXVL 4TUKH 2R2HA 2XTLA 5FYLH 5TF1H 3RIFF 1FLRH 1A9BB 5D7SL 5C3IA 1FNFA 1PD1A 2IG2L 4XVUD 2AANA 3SODB 1X9LA 5AW5B 2F61A 4WW1B 4EXKA 2O5YL 5GRYA 3EBIA 4LEOB 4DZBB 2J43A 5K1JA 4N85A 4OCXH 1TZAA 5HI5C 1ZPUA 2WCSA 3P3RA 4M1CD 1NKOA 4Z78B 1NU1E 4PJAF 1Z3GL 5JIHA 1KELL 3GTNA 1CIDA 3GMNB 4LLQB 3H1LE 4L3FA 2Q2LA 5KJ7D 3ZKQD 2LFEA 3FB5B 3KH4A 4N8CL 4WO4A 4OD1L 2YKLH 1A6UH 5GZNC 3I56P 2IDSA 1E0OB 2PWEA 1RQ5A 4J6IA 2J88H 4QRTB 5CEZL 3OF6A 5E8EA 1IT9L 1YSOA 2EIZA 4JHAL 5I1JL 1TNNA 2E27L 1KB5A 7CGTA 3MA9H 1KULA 3ML8A 4PWKA 1CN4A 2OSWA 3EFFK 3HNTL 4IRSC 2BFGA 3SSUA 2LU3A 2VC2B 5F6IC 1UT2A 4HKJA 4KVCL 4OCMC 5CS7A 3S9OA 3KYNB 1JRHL 2DLHA 4HS8L 1MJJA 3V52H 4CVXA 2XG5B 5J9PB 1IZNB 1BLIA 2APTA 5KN5B 4PI0A 3U4BL 2XTJD 1IGJB 3FUIA 1NGXA 3NQKA 4M8QB 4Y99B 3VO0A 3B56A 3OSVA 5I8KH 1VQOP 2WXLA 3ULVL 1ZDSA 3H2PA 4PS4L 3FYIB 4GKNB 1NH6A 2E5EA 1IVTA 4KKAC 3BE1L 2NNRA 2F53D 1PD6A 4P3WA 3NK3A 4EI2A 5IMKB 4R4ND 5ABAA 1H8OA 1KN7A 4YHLL 3TX4A 2VUYA 4NO3B 1D9KA 5HHQB 4NN6C 4HK3N 4RQQA 2DL2A 2Q8AL 4WO0A 2O1AA 3CX5J 5L0QC 1ACYH 4APQD 1KIUB 3CXHH 5FGBA 4H44C 1YEJH 3VG0H 1I7UB 4WUUE 1PZ5A 4W7ZA 5B66H 1BGYD 3Q2LA 1KT2B 1R3KB 3EOTH 3A0BE 2GFBA 4Y2DD 4YDVA 4NKMA 4WFEE 2CO4A 1D2OA 2GIYA 2GJ6D 4MJ5B 4YSRA 4LCYB 3HNTH 1CZ8L 2Z31C 3L3OA 5SX5H 2EUXA 1D3CA 2YO2A 2NR6A 1NVOA 3QEGH 3BGFB 2YC1A 3ZHFA 4BH7B 5C2BL 4MTMA 2DZEA 2UXGA 5AZ2H 1QA9A 2AVFA 3BZ4B 1UZGA 2G3XA 4X4XA 3VXME 1PZSA 3H9SA 1KELH 5EEWA 4Y4FD 3VW3H 1RK0A 2EO9A 4N25A 4TT3H 1QYGL 1J9TA 4G11A 4OCWH 4Y2DB 1OAJA 3TNNA 3SKJH 1LNQA 3VSVA 1SHSA 2GI0A 4AL8L 4N2NA 3K2MC 3KS0H 4HIXH 3ROLB 3QCVH 3IN0A 1BGXH 1FI8C 3BVUA 2Z7WA 3UERA 1TKWA 2YEVB 1WA1X 1OWRM 4OBRA 5KS9A 1J5OL 2GB2A 3KLAA 2C9SA 4R7VA 4E0RA 4C59B 3ARGC 2WKOF 2B88A 4ZPTA 4ZODA 2B89A 1AZVA 1QAWA 1N59B 2LV4A 4Q7DA 5FYKU 4MKMA 3IDUA 1L0QA 1PPIA 4P2CG 3WIHA 2ZKMX 3BT2L 1CS6A 3G5XA 3MLVL 1EHKB 5TJWK 2LLGA 4AQ8A 2H47C 1PAZA 1YQVL 2I8DA 5CLWA 3MRRB 2P42B 1M7IA 2VJ0A 1AHWA 3RX8A 3VD7A 3LXCA 3BQVA 3CHOA 3S5YA 3LYRA 3P9LA 2CA3A 4XNQA 4Z0BH 4J6RH 2DW3A 1QNIA 5IR1A 1J1OL 4JRLA 3CHSA 3AE8C 1BE3D 2F0CA 1MW2A 4FQHA 3VI4A 4M1GL 3OKNA 2Q20A 2Z65C 4MJIB 4ODTH 1EFXA 1ZMYA 5I1LB 2EIKB 3QHZL 5MENA 1CU4L 4DKFH