5AVYB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 20 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avyB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avyB02
4DZOA 1CSBA 5APVA 1NAFA 2BASA 4C7NB 2R32A 5APWA 5CMZA 2Q3IA 2XV5A 2VRSA 1GU5A 4AQRD 3TYYA 3MD0A 1SLQA 3HE4A 1MFZA 1GD2E 2KP8A 3P8MC 5APXA 3V4WA 2E42A 4B86A 3M9HA 1HUCA 1S9KE 3HE4B 5AW0B 1DH3A 2YNYA 3M06A 1HWTC 3NMDA 4HYTB 3OAKA 2ZFCA 4I2LC 4C46A 1H88A 1OXZA 5AVTB 1H89A 2Q7CA 5APYA 3V4QA 2P7JA 3M9BA 3P7KA 1GK6A 1YYCA 3HE5A 4LC1A 1SP4A 3M0AA 5AW1B 2ZXEB 4GKGA 3IR9A 2E43A 5AW6B 5AW8B 3SWFA 2WT7A 3HE5B 5APQA 5AW5B 2P67A 4AYCA 2QM8A 2XZRA 4KHXA 1G2CB 1KQLA 2WT7B 2YO3A 4JYBA 3V5BA 2IPPA 2WPRA 2R5BA 1NWQA 2C9LY 2WPSA 2WWWA 5AVYB 1A02F 3VMZA 1FAVA 4I6MC 3VMYA 2C9NY 4AUWA 1JUNA 3WGUB 2R5DA 2R3CA 3TNUA 2QM7A 1JNMA 5AVSB 1J2JB 5AW2B 1FOSF 3L37A 2W27A 2Z5IA 3I5CA 3A3YB 5AW4B 5AVWB 3VTPC 5AVQB 3NXSA 5APUA 5APTA 5AVVB 3LIEA 3M0DA 3A5TA 1T2KD 1X8YA 4M3LA 1GTWA 3P32A 3WGVB 3KDPB 1T2KC 1IO4A 2W6AA 4XE5B 3LIDA 5AVRB 5AVZB 3M91A 1HBWA 5APSA 1CI6A 3L35A 5AVUB 4GT1A 3NTNA 3VN0A 2Z5HA 3T97A 2N9BA 1CI6B 4RETB 1GZLA 1MV8A 1FOSE 1HJBA 2WTYA 3O8ZA 4EOTA 1H8AA 1A02J 2WPQA 3TNUB 3MGNA 3VYIA 3VMXA 1GU4A 5AW3B 3HTKA 2H7HA 3TK1A 2YO2A 1MUUA 4RESB 5AW9B 2JJLA 5AVXB 1CZQA 1S9KD 1GK4A 3L36A 3NFQA 2Q5UA 4JYCA 4C7NA 3B8EB 3KQGA 3UIAA 2P2UA 3A7OA 5AW7B 1OWAA 2XU6A 3A2AA
chains in the Genus database with same CATH superfamily
1CSBA 5APVA 2CWRA 3G71P 2YD0A 1FRGH 2QKIC 4JAMA 1T1YB 2BVYA 4YXLL 1JCKA 3BCCD 1ZLSL 3TBBA 2EAEA 4MWFB 4J2QA 4ODVH 4TQ8A 5B3SB 4L48A 2VQ4A 1JTHA 1IQWH 3TIDB 3V0WH 3FO9A 3N0AA 1KCUL 3QIUC 1UB6B 3C09C 2JO1A 3JXAA 2K37A 3QJRB 4QRPB 3PWLB 2DQUH 4P4RA 2CBTA 2BK8A 5JO5B 4WTZG 4XI5D 1JPGA 5CILL 3EGXB 2HXAA 2MKLC 2DIJA 4Q9CA 1KYFA 2NNCA 2OARA 2CIKB 2QDVA 4JN2A 3QIBB 2M8XA 2VN5A 4WTWA 4YXHH 5I1EH 1W80A 4WVRA 2W0FB 4WU7A 1X9UA 1YECH 5JHDB 4H8PA 5D7JD 1GAFH 2Y5TB 1AA0A 4QOKD 5DJDB 5INDB 1KLGB 1BFVL 4PRAA 5C3IA 3ULSA 3KL3A 4LDEB 4APQC 1G94A 4L1SA 5AB0A 3RHWF 4HFWB 4IU2B 2X6CA 3HNVL 3SZ6A 4F9LC 4WV1C 4PLKC 4WGVB 4NO5B 3P4OA 4N22A 3V4PL 1KQGB 4R97C 5D5MA 2XTSA 5F93C 2FLRT 2J5LC 3S5LG 3TV3H 1DVYA 4KROB 3KLAB 3GK8L 3MP7B 3DRQB 1AXIB 3K5BA 3LKNA 4IDLA 1EHLL 3CFEA 3IDNB 4NSKA 3FUEA 1UT2A 3FRPA 4GXUN 5MI0C 1W15A 1OQOA 5I1HL 2D7TL 3WL9A 2YRPA 1EJOL 3UXFA 2J8UF 2P4AB 4KTYA 1E30A 3BVNA 4X7TB 1F3DH 5LBGA 4IRSC 4RZCB 2OX5B 4JN1H 2X4SB 4P2RB 1E5YA 1F4YL 1XGPB 3WKPA 5I0ZA 1NTME 3D05A 2UZIH 2XLLA 3EBIA 4HPHA 5HI5C 3MNZA 5DD3L 4YWGL 3ZT6A 1KXHA 3HOGA 1EZLA 4OF6A 1KPUA 3FNKA 4FCAA 4AYID 2F8IA 5CZVH 3IMVA 3TT1L 5AKVA 4L4TE 3CSTA 3LN4A 1PQZB 1NPNA 5T3ZL 2BWDA 2MPVA 4QJ3B 1TXKA 1A8ZA 4BHUI 5C0CE 2WNXA 3NCFB 3VFPB 5C0BD 2DL2A 2YBRB 3B56A 4RESB 4J4PA 2D0GA 3QYMA 1IB5A 3PJNA 1KB5A 4R7DB 3FO0L 5BQDA 3QULA 3HIZA 2BCCE 4RQQA 3F5WA 2VISB 1QOKA 1X5XA 2PETA 3RL1A 4D0DB 1JFHA 2P2UA 3V2PA 3BP4A 4JM2B 5CZXC 3WNOA 4I3RH 3E1ZA 5DFTA 1SXNA 5FK9B 4EI6B 2A6KB 2UWEA 1DQIA 1TEYA 4X9HA 4NO2A 3GHBH 5I8OH 2JTYA 3VD7A 2OYIA 4AGLA 1MUJB 1KZYA 1FCCA 2BIIA 4C8XA 3VDCA 2CK0L 1XTGB 1IKOP 3QJSB 4GSDH 2WQ8A 1VEOA 3CLEL 3C5XA 2ICCA 5BU8B 4TOYH 4H20H 2IMMA 2R27A 3G4SP 3QQ9C 3T2LA 3EDEA 3U0TA 1S1CX 3HR5A 3SWKA 1FFNB 5JHAA 2KZWA 2O5NA 3IRCA 3PWPB 5E1QA 5BRQA 3HAEA 3IS1X 4AH2A 4Z77A 4XGZA 5CCHD 2Q3AA 1HYSC 3HE6A 2B1AH 1A3RH 4KVCL 1MY7A 3EG9B 3EOAA 3PL6B 4PCTA 3KXFB 4PJCB 3ZL1A 5AW6B 3I9IA 4KBPA 1TF4A 4LSRL 5KVFL 4NFBA 2EEAA 3BVHA 1WFMA 4RMSA 3UJTH 2WT7A 1ANUA 5F1OB 4G8FB 1KXVC 2AK1H 5DI8B 3TA4D 2RMZA 2UVFA 3IU4L 5EUKB 7TAAA 3MLXH 1RUMH 2YMTA 1F18A 4OM0L 3UTZB 2YO3A 1MRDH 5HHVH 5AVYB 3B9KC 4FTVA 4NZJA 3LNFA 1QR1B 3O6QB 4HVBA 1X5ZA 4MXQC 4EIZC 4PMFA 2IQAB 3TWYA 1FSKC 2QM7A 1CUOA 3ASWA 4NHCH 2ATPB 4DP4X 3P77B 5SV4A 3H3PL 3X11A 4EPSA 4QHMA 1FJKA 3SDAA 2V2XB 4G8GA 4MJ2A 5E9AA 3AREB 3QZWA 3HVDA 4AWJC 4DO4A 5E4OA 1IEBB 1OZTG 4Y2DD 1ZV9A 1P2CB 4G8EB 1NGXA 3KPPA 1QPPA 35C8L 4CSTA 1OZHA 1MIEL 2R7EA 1XGTA 5AVRB 3X1GA 1R3KB 2OMZA 3RG1C 5F44A 5IB3A 4IYKA 1I75A 3HB3B 4PJAB 5C3TA 2AMUA 1JNHA 3PS6A 3TJEL 2DQGL 4OF3A 4EI5B 1QHPA 4AKQA 5FEBA 5IHUL 1YQ3C 3KPQA 1QD0A 3WMQA 4DT2A 4JO4L 1SM3L 2OMVA 2DH3A 3D09A 3T3MB 5KUKA 1JZFA 3WNPA 1KC5H 3M46A 4ELKA 1BSNA 4HC1H 5FM5M 3EJYD 4X7FC 2HMID 4OGYH 1U95B 1LQBC 2DQ6A 5F6HI 3S4RA 3D2UB 4WWKD 1L6XA 3R1GH 1YPZB 2VNCA 3ET9F 2VKXA 3RKDD 3N4XA 2JJLA 2CO6A 3EFFB 2ZKHL 3KYQA 4HFUL 1CYWA 4N5EC 4P9ML 5IK3B 1Q9OA 3HTKB 4WFEE 4GG6F 3HUJA 1F45A 1F5WA 4LLVB 2OZ4H 5DZNA 2WCSA 4RMQA 2PP6A 3PHLA 3LNEA 1DJXA 4YXKH 3X2QB 3SE9L 5JW4Q 2F19H 5HYQA 2JKWA 4NT6A 3QEQA 1BYNA 1AO7E 5HPMB 1PDKA 4YAQA 3QJUB 4MMXC 4RZKA 3NCXA 4YHLH 2ZX9A 2V37A 1MCKA 3CGTA 4XMPH 5IBLD 3ISRA 4NPYA 4I9XA 4WDIB 5HHQA 3SE4C 1KG0A 2XSKA 5L2JB 4M5ZH 4I5BA 4BCZA 3NMDA 1T1WA 1FGVL 8PAZA 3CXFA 4O4YH 3L7EB 3OXRA 4HUVA 4U6HA 3MLYL 2RKLA 1UWEL 1RZKL 1EJ8A 5KLIC 4L8SB 5E8OA 3V6OE 4BHUA 1Z3RA 2AQ2A 3HG4A 1P1ZB 3IFMA 2WKOF 3MBED 4OCNC 5TJWK 1NU1E 1VZIA 5C9JB 4HG4K 3SY6A 5F1SA 2FX9H 3T77B 3DOSA 5DZAA 4TQIA 4Z23A 4G6FD 5CBEA 2PO6D 4NM8L 1H8SA 1K3ZA 4ODUB 4IS6A 4JYBA 1BE3J 1UH4A 1X5KA 4M4RA 2VERN 4IRZL 2NQDA 1IV8A 1XF5A 1JPSH 3N85L 4ZYKB 2XCMC 2WITA 2E7CA 4XCEB 3Q05A 3PUUA 3MCYA 4XPGH 4U1JB 4F7CA 4QKTA 5DMKB 1SS1A 1KYDA 4PR5A 4RWHA 1VCBC 3DGCR 5BV7H 1HQRB 4XB8A 4ZX4A 1TJMA 2GJZB 4A2EA 1YYMH 5INCA 3KWTA 1A4JB 5CCKL 5CEZE 2RH0A 3TN0C 5LBSL 5DMJB 1CPUA 1IGIH 4GO6B 3QDMB 5E8EB 1EFXA 1Z2KA 2XOTA 1I9IL 1FC1A 2FBRA 3MV9E 1M8OB 4CC4A 5FGCE 1E5ZA 2CSPA 5EUOB 2XPGB 3BVUA 2KXPB 2F54E 3FRPG 3RDTB 4KKBD 4H0IA 1IQDA 5EF1A 1JDDA 5LAXA 4OFYA 5E6SB 4OT1L 1DBKH 4JRYA 3DXAD 3CXHJ 4PVBA 4LHJB 3QJFA 2NXYD 3ARXA 1QZNA 4GRWE 5AOMA 2DL9A 4PSRA 3LXBA 1JNNH 3FN0H 4QMAA 2A74C 3KYMA 1AOZA 3RVVC 1P4IL 2R8SL 4QYOA 4ZFZA 4HGMA 3HW7A 1NGYA 3A6CH 1MV8A 1R6VA 4NJAL 5FW7A 1T3FB 5JIDA 4RAVB 3KHQA 5E00A 4GKNB 1BXAA 3QEUB 4LARH 2YD5A 4OLZL 4OZ4B 2ZNXA 1L3WA 2YIHA 1X4XA 4U1LA 4MJIB 2WINA 2R9HC 4GMSH 1RULL 2DKUA 3ZUCA 5T3XE 3KVDD 2J8OA 3L3OA 4R5TA 4UIMB 1S78C 1I8IB 2M83A 5D1XE 1KFAL 4PRHD 1QFWL 2IGLA 4OCSL 4L8CB 5CMAB 5I6NA 1NAFA 3AG3B 2ZD0A 3BHBB 3NP4A 3L7FA 4M00A 4ZUTB 3U4KA 1QL2A 1N3NA 3KJ6H 2N4IA 2YD1A 3EWKA 3L3JB 4MD5A 1T2QL 4YXLH 1ZLSH 3L75E 3J8F7 3TBVB 5BUAA 2O3JA 1YNTA 1ZLVK 1SEBB 3U79A 3WS3B 2VLRD 3FB8B 1RZGA 3Q43A 3QZMA 3T3PE 4PJ9D 1KCUH 3QP3A 4FLRA 5DHVH 3MRBB 4GP5B 1U6AL 4CVZB 3SYCA 1S5HB 2XXGA 3VX0A 1AXSB 1LO2L 2OQJB 2QVKA 4JFEA 5CILH 2X1XR 4M1DL 1TCRB 2Q8AL 2APBA 4C4KO 4HD9A 5AAWC 1HSAA 1E90A 1UVQB 1QNIA 3II6A 5CCGE 2IFFL 3F5HA 1ZVHA 4OCRL 4TQPA 5KYWA 5C71A 1IFMA 4KPHL 4U1MA 4OGQC 3F6LA 4UMGA 5I6XC 2PWEA 1BFVH 5FM4A 1JPST 2PYEB 5EULV 3TA3A 2EYTA 1J0KA 1E9PA 1S9WB 1YN7A 3HAEG 2QA4P 4HT1L 5E8NB 1OTTC 1XF4B 1HXMA 5EZPA 3HNVH 4WUKL 3VG9C 1BG1A 3H1IJ 3HBZA 3UZQA 4YHIA 3V4PH 2H6PB 5I0WA 3NZ8B 5FDWB 4NWTL 1GGIL 2ARJQ 2OMWB 3OLIA 4UQDA 4PGDA 1PV3A 5ID1A 1YHQP 4X0KA 3RWFB 4JRWA 4LKXB 3UZVB 5BS0A 4ZZKA 1SQPD 2DQIL 4JLRB 4GBXC 4RIRA 2LLNA 3ES6B 1EHLH 1OVVA 3IDUA 3H1IE 2WXIA 3FPXA 3HG1B 5BW7A 5EOTB 3D39D 2KS1B 2VB5A 4C54A 1IKNC 3Q2WA 2DW5A 3K6FA 2D7TH 4FA6A 1E4HA 1FVEB 2DWEB 4AENB 1EJOH 3K81A 5DEJA 1ZRTE 1CE6A 5CF3A 5ISZE 4KKCD 3ULAB 1LLAA 2IZ1A 4MCYB 4Q52A 3CX5K 3FQYA 1YI2P 1E42A 4Q4EA 2R39A 3S3DB 2HN7A 2HJKB 5EU6B 3VFGL 3NSJA 4YFDB 3UZEC 5IG7A 3FO1A 5D2LA 1SNRA 1XBRA 3X13B 5D6CA 4DQOH 1ZANL 1G0XA 1WCQA 3FCSA 3QZWG 4QHUA 4XO4A 1BQLL 1HSBA 1U7JA 2X09A 1AIFB 1LP1B 1F4YH 4HC1A 4ZSOA 5F7DB 3MUDA 6CGTA 1SZNA 3NTNA 3PUCA 5F7MC 2D31B 5FFGA 5DD3H 4YWGH 4D6TJ 2Y5EA 1FO0B 4XMWA 4QY8B 4ZW7A 2KPNA 3UG3A 2AEWA 1OSPL 1N6VA 2NW2B 5AALA 5ADPL 5CR8A 3GIVB 1BCCG 2FFDC 2G5BB 3IMUA 5TK2A 5IMKB 5KSAD 2P48B 4O51A 3TT1H 4GLRH 4Y19A 1G7MB 3L73G 2WB1A 2BP8A 5KZCB 5T3ZH 1AG6A 2F53E 4FFZH 1QLEL 1R5VA 2KZKA 3EOBB 4ORGA 5FYLL 1LL1A 2OTUB 3IXAB 3EZ8A 2DTMH 4PJIB 5TD4A 4LSTL 1A6PA 5IMLB 3VI3B 2QLVB 4I18A 3FO0H 3QA3B 4N0CC 3WIFB 2IWGA 2D7PA 2KZIA 4EKXA 1X6NA 1GL2A 3SYQA 4N3TA 2NZ1A 1L6PA 1A3LH 4GAYB 2V4HA 4PV1D 3V6OC 1N2RB 2V2TB 2A4EA 2DS4A 4JFFD 4DJGA 1ZHLB 3BMWA 2VOTA 3OXSA 1P7QD 2CK0H 4R2GC 3U30C 2WVVB 4K5PA 4WK0B 1PW3A 4ATWA 2O4EA 4PVLA 4ZUUA 3CLEH 1UGNA 4Y1TA 4C57C 4P3DB 1AGEA 3OKEB 3KPOA 3AE7C 1VGKB 2BMKB 2WB7A 5K59E 4D7PA 1N8ZA 4MGXA 1S3JA 4CMMB 3L8QA 1QA9B 3NESA 4HGKC 2QZ5A 4JY6A 3O4OB 5EOCJ 2WVUA 3D4CA 1X9VA 3CH1B 1FZKB 1WTLA 2MWCA 4MNGE 4XTRC 4B60A 4H13D 5KVFH 2KBGA 3GS7A 3S5LB 5EC1A 3F7VA 1TZAA 2LHAA 3QS2A 3EDJA 3IU4H 2O72A 1JV5A 3DPBA 4OM0H 4P5TB 5DFWH 4HWNA 4AUJA 4F91B 2KLVA 4BJLA 3SDDB 1PD6A 3BWAA 2PR9A 4PJBB 4L1BA 3BAIA 2BIPA 2A7BA 2NXZD 4L8BB 2K4WA 3S37L 3PH0A 1S3RA 4K55A 2D8KA 2M8RA 3OF6D 3FSOA 3BW9B 3C6LB 5GRYA 1PKQB 4WI6A 4OI7A 1DANT 1C16B 4NN7C 1JRHL 4U0QB 3W5NA 3S35L 4LT7A 4FA8A 2D3VA 5JMOC 1TIUA 2DMCA 4GXVL 1QP1A 3G6AA 2IBZD 35C8H 1S5LE 3L3GB 4JQIL 1LGHB 2VDKL 1MIEH 3DURB 3BWZA 3ZE2B 5D1ZC 2BIOA 4WSGA 5DHXB 4OZGB 3RL0B 2D2CC 1W91A 5IHUH 4WWIA 2DQGH 3TJEH 1USQA 1JHLL 1ZLUH 2B16A 5D1XC 1JS4A 1RCYA 4XP5L 4PRBA 2NNFA 2Z4QB 3LRHA 4ZPTA 2NY3C 1SM3H 4JO4H 1IGJA 1SMOA 3LJ3A 3EUUA 3T2PA 2ZUWA 5F1IB 2XKSA 5KYXA 3FCUB 4OZIE 4A7SA 2PXYC 5J9PA 2WXFA 1GYWA 1DQJA 1P9MC 1CGVA 3GJEB 3OMNB 4MD0A 5HDBF 2RAMA 5IVOA 1AOHA 4PCSA 3PWNA 1MCNA 3GINA 3QCTL 4V1DE 1EXIA 2ZKHH 4HFUH 2IG2L 4P9MH 2J1WA 4PQXA 4KXAA 4X6BB 1OWAA 2X3BA 4DZOA 3CTTA 4U1IB 1A1MB 2DYRB 2EDTA 4OSUL 3CSYA 5DHVA 5F1NA 2D4FA 2WQSA 4PJEF 1SQ2N 3NBNA 1NFDF 3GSXB 3SE9H 1BFOA 3FH5A 3PRJA 1MF2L 5CCGC 1RZ8B 3QIWC 2E42A 2WY3B 3EF7A 5I1CL 1ND0A 5KAFH 3W9EB 1OP5H 3VWKA 3D0LA 3ESNA 3LV3B 4IKIA 1MCLA 2B9AA 2DM4A 2OJEB 1JZ8A 1ADWA 1N7SC 2AGJH 1NINA 3NJLA 2WBJC 3T08A 2BVOB 3S2AA 4LVOC 4LC1A 3Q8BA 3UEQA 1SP4A 1FGVH 2AEPL 4WW1A 2DAVA 2ESVE 4I1PA 2ZAHA 1EEYA 4GW1B 5DC9B 4PH8A 3MLYH 5KTEL 4G42B 1UWEH 1AZCA 1RZKH 3V4PA 1XHHA 3GBEA 2EE6A 2IANB 1KNOA 4IBSA 2HFFA 3FT2A 4WNJA 1FYTD 1WC7A 5DSCB 5IFAL 5EF2A 4G82A 5PCYA 4YS4A 3W39A 6TAAA 1X4YA 2PCPA 3EAKA 3TONA 4NM8H 1OVRA 2P45B 3PHAA 1ZS8A 5CXPA 5I26A 1ZA6B 5G4MA 2EVJA 5E8PB 3SCMC 2QSQA 2FXOA 4ZUSB 5EF3A 5AZ2L 4IRZH 5FYKE 3VWJB 4AIXA 5ENWB 4KI1A 1K4CA 3ETBJ 4BFRA 5CJ0A 3V6IA 2FHCA 4MAYA 4N2DA 1S2EA 1RUQL 1LILA 1I4FB 3EYVA 1RF1B 3HHSA 3EGSA 2ZQKA 3V0AC 2CIIA 1XH1A 4J1UB 4MB1A 3SO3C 5CCKH 3MO1B 5DUML 4O2FB 2LU7A 3VXRA 2EIBA 4LHQB 3O4LA 5LBSH 4I0PA 1P84K 4QIRA 3GXMA 1I9IH 1TTCA 4HU2A 5GSVA 2HJLA 3WGVB 4AOFA 4LBEA 4UANA 1MG3C 1T7ZA 2DMKA 4C56D 3V0GA 5ABAA 4Q56A 4QAWA 2TRYA 4U6VH 1HQ4A 4XCFL 2Z1KA 4NWUL 3H53A 4OT1H 1HCFX 3X12B 2JJVA 1A9VA 2GCYA 2DD8L 4QEGA 5ERWA 1SLUA 2IBBA 4PJHE 5B1JA 1U8CA 5T5FH 4I2XA 3WUWA 1XGZA 1P4IH 5IY5B 2M3EA 4LHUD 2R8SH 1F3JB 4PJXA 4TXVB 2OMNA 1ZT7A 4NJAH 4Y4HB 2IWKA 5EZLA 4H4NA 5C70A 4Y4FA 3H9HA 5C09D 4FHBD 4NZTL 4UB0L 4OLZH 1N5YL 2CR3A 2EIJB 4I48A 3CFKA 1DN0B 1KLFB 1RIVL 2H6OA 3LZFH 5ALCL 3LMJL 4XXDA 4AYGA 3VQ1C 4KZEL 2AZUA 1TQBB 3FRUB 1HHIB 1AKJA 1G9HA 3F85A 1RULH 4HEMA 4EYYQ 1T2XA 4TVUA 1KFAH 1U8JB 2I24N 4QRQB 1QFWH 4OCSH 4KZDL 2O1JA 3PWJA 3T71A 5DJCB 2WN3A 4BSVB 5KS9F 4KGLA 4UIKL 5FX3A 4JAMB 3OAYH 1SPDA 3AJ7A 1T2QH 4P46A 5DJ0B 4OF7A 1JTHB 3RX9A 3QRLA 1Q72L 3V4UL 1RE4C 4NZDA 4OH8B 2C1OB 2JV6A 1ZAGA 4CW1A 4HV8B 3BFQG 5F9WB 4P4RB 5J11B 5A43C 1U6AH 1A1OA 2F74A 2P1YA 1LO2H 1T21A 1KQFB 4JN2B 4PJGF 4LLDA 1KB9D 3WY1A 5F7FA 4F5CE 4M1DH 2Q8AH 2AI0L 4WU7B 4DK3A 4PM1A 3MLVL 5J0BA 5AW8B 3DNKA 3HZVA 1NTKE 2GIYA 1Z0MA 1N0LA 2IFFH 4OCRH 3DSFL 4PRAB 4JGUA 4TPRL 1GKEA 4HAFA 2OJ1A 4KPHH 5AG8A 3GNML 4FS0A 5EBGA 5FYJL 4HT1H 4IIQC 3OM3B 4WUKH 3P4OB 5D5MB 3NCYS 4N90E 2YC1A 3ERXA 5HTSA 4GJTB 3WGUB 1DP0A 1YEIL 1Y0LB 3EJUA 1GGIH 4NWTH 3KZ8A 2NZ2A 1JZ5A 4JCLA 3P11L 4J3BA 1QFWI 1OFCX 3BN9C 1LTJB 2DQIH 2J59M 1JGVL 3LKNB 4PTTA 5J6HA 3CFEB 3GMRB 1D7DA 4HIJA 4X7EC 4TLTA 4J27A 4PJFA 1TQTA 3FRPB 3KD4A 5C0DA 4DEWA 1WG3A 3WL9B 4ZMVA 5DD5L 1BFSA 1R5WA 3EJSA 3M1CA 3P32A 1T04A 2CKNA 3BVNB 3VXNB 3VFGH 1OK8A 3CZLA 3QJHB 3B4SA 1A7BA 2NYZA 3D07A 1O6VA 1WBZA 2ARWA 2NQCA 1ZANH 4PSPA 2HFEA 1XXDC 3MNZB 4B9CA 4BCXA 3BH9A 1A2YA 1FDLH 3NJJA 2IEPA 2G0LA 4YSRA 4A38A 1CF8H 3EBAA 3MV7E 4MCNA 1OSPH 4P2YA 1E27B 1F8TL 1I1CA 1ZHKB 1JFQL 1UXLA 1Q9WA 4XPFL 3TZVA 2WSEH 3WFCL 3PQYA 3LN4B 5CUSL 3STLA 4TUJA 25C8L 3V55A 4G6AC 3ZKSD 1RV6X 5DJ6B 4M8UA 1JF1B 2ICWI 5L8LB 2C9AA 1LQSR 2FUTA 1QLEH 4BRVA 5FYLH 2UX7A 4LSTH 3PTZA 1KB5B 4X42A 3QULB 4RQQB 3RL1B 3F5WB 1KZQA 5EOQL 5GSRA 4K9JA 1O6SA 3BP4B 3LPOA 4NDMA 3MPCA 2EQDA 1KB9K 3UTTD 3KCPA 2KP8A 1YIJP 4NO2B 4G1MA 2OYIB 5K1JA 4QLRA 3QFJA 3GBDA 1HH9A 4B3VA 4R6UA 3U6XS 4G80A 2JIXD 5HYSA 1J1DB 1UD3A 3L5HA 4YNYB 1NMAL 5IUCA 3QNFA 3RK2C 4AQ1C 5E5LA 3U0TB 3LZQA 3VFVA 5C07A 3HR5B 5LDSA 4BKLA 4LGDE 1TFPA 2WXQA 4DJMA 1KEGL 3SFEC 3HAEB 1YN6A 4AH2B 4Z77B 4XGZB 4TQEL 3TJHD 4HZ1A 3HE6B 4O2CA 1LEKA 1FU1A 3EOAB 3OHXA 4IRZA 2O5YL 1JY2P 1V27A 2H9GA 2WT7B 2C9LY 2O26U 1A3ZA 3OGCA 3JSSA 3VMYA 2AXCA 3CCEP 3GZOA 1VDFA 1U2CA 1HCVA 5H2FE 4FTVB 5LBSA 2NZ9D 2DMHA 2F5BL 3GW6A 4URTB 3VD3A 2VMCA 3AGWA 4DVRL 2ZSVA 3S37H 2QRXA 4UZGA 1EZVE 3MCLL 3SHSA 2R2HB 4FNQA 3QPXL 2Z7ZA 2VL4A 2K3TA 3X11B 5FOJA 4QHMB 1HESA 3SDAB 3MV8A 4G8GB 3QZWB 3INUH 3QI9C 3TO4A 3NRQA 5T5FA 3OVUB 1QBBA 1WAPA 4HUWA 4JZJC 4ZW6A 1JRHH 1KTLA 3F7PC 1NGXB 1IE4A 3S35H 3KPPB 2C3VA 5T1LD 3VTTA 1X5FA 2ZE0A 3M6DA 4GXVH 1AHKA 2OULB 1JD9A 1VQ9P 4DETA 5T5FL 3Q2LA 4JQIH 1OE3A 2OMZB 1BQUA 5MHSE 2VDKH 1MVUA 2ZXDA 3LEVH 2XQYK 1JNHB 3QWOB 1WQVT 3L73J 1JHLH 4NLAA 1NC4D 2DBLL 4XP5H 1AC0A 5MEPA 4R4LA 3CFBA 2KQNA 1WA2X 1O7VA 4GEIA 4JY4A 4KDTC 4ELKB 3OTTA 4KDVA 4ZMQA 3WUWG 2CDEB 4OJDH 4X8XA 1ML0A 4ABWA 3RNQA 2C4FU 4JPIB 3ULVE 2CO6B 3O6ML 5DEFA 4I2LC 3H1KG 1Q9OB 5D7SL 1CDYA 2IG2H 5CP7A 4HMEA 1JHTA 1M1XB 3HUJB 1E8YA 3GLDA 1M57D 4ZOAA 4F9PA 3VACA 4JRFA 4OSUH 1TR7A 3KPRD 5B1AB 4BK8A 5HXMA 4XPTL 4ENED 3CVBA 1YA5A 3Q48A 5GJTL 4Z7NB 5CR1A 5HYQB 4NT6B 3QEQB 4J3VA 4AX3A 2VWEE 1PDKB 1MF2H 2C9RA 3BD3A 1KYOE 1UD5A 5I1CH 4HHWA 1JRHI 2IPUG 2P8LA 4PGCA 2NX5A 5KBDA 3B6SB 4YSPA 4NPYB 4NKDA 1KILE 3QZBA 1KG0B 2K6ZA 5E24E 3U7AA 3V0IA 1PZBA 2APVA 4X6CA 2CPBA 2DKSA 4I5BB 1FIGL 1T1WB 3EW3B 4UV7L 5GS0C 3P0YL 3ZZSA 3OXRB 3NDYE 4BQ8A 4U6HB 2AEPH 1ZLWH 4FFTA 3NJMA 2QSVA 3O6FD 5FA4A 4JKPL 5E8OB 5KTEH 2ICWA 1UKQA 4AXWA 2V9RA 3RVXC 2WV3A 3QO0A 3IDIA 1NGMB 1XL4A 2DQEL 1EERB 3BGMB 3DOSB 4W1TA 5IFAH 4IRJD 2W94A 4OLVL 5CBEB 1A02F 2FDBP 4K3DL 3BQUA 4JPKL 4YZFF 5I8KL 1OTSC 5E0QA 3WIIL 4IS6B 2E7HA 4OBSA 1VDGA 4M4RB 5I73C 3D85D 1EEZB 4LLQA 1XF5B 4HXBL 4RFEA 4D94A 5AZ2H 1VQ7P 5HJ3A 1EQ7A 3ARBA 1M90Q 3L9YA 4L1LA 5E2TL 4EIBA 4ERSL 5H2BA 4F7CB 1UB5A 4XN2A 4POZC 1CR9L 5I15L 1K4DB 1D6VL 3ECUA 2IC2A 1F3DJ 1RUQH 3EH4B 4YDMA 1NDTA 5INCB 4I7ZC 3TPUA 2BY1A 5GJSL 3QRBA 4XO3A 3KZIH 1IJDB 2EE9A 1KMGA 5DUMH 5F0JB 2WQXA 3FUJA 1U42A 4GP4B 1QR4A 2Y6SD 4XVUC 3WLWD 3P9MA 5HPOA 3MRDA 4U33A 3N5AA 2GTZA 1BGYE 3EDFA 2ZTBA 3VRJB 2EH8L 2GI0A 5LAXB 4AUYA 4HPOL 2RBLA 2V8LA 4LZKA 1EDJA 2F8OA 3DJ9A 3QJFB 4NWUH 3WTVA 3EGDA 3ECWA 3VYNA 3CN4A 3KYMB 4NPDA 2DD8H 3US9A 3SQBB 4XHJD 4M6OL 3L1GA 4QYOB 4ZFZB 1REIA 1QTYT 4UQ3A 1NGYB 3DETC 2XIIA 2QHRL 4QRUA 3BE1L 5E00B 2UY6A 3RK3D 3BWSA 5CM1A 3JQOB 3OD3A 4YDIL 5AZEL 4F8NA 4L9LA 4JRYE 4WWOA 5C08D 4N0UE 3SSUA 3DC0A 4XN7A 3CZSA 3UPCA 4J4PC 4NZTH 4UB0H 1OP3K 1N5YH 4D9RD 5JYMA 4X6FA 4PVNA 1HYRC 4H7VA 2VRQA 4N2MA 1JOIA 1RIVH 4HMCA 4U1LB 5ALCH 3LMJH 3JWOL 4KZEH 4EDFA 2WVTA 2VKWA 3L3OB 4AYFA 1YYLL 2AQSA 3A47A 1X5YA 1MAJA 3QQXA 4MN4C 2E9WA 4WB4A 4D8OA 3LRMA 3KAAA 1D7CA 2RJMA 2Y1VA 3AG4B 5D7LE 3L7FB 4X4ME 1PU0A 1FV1A 4JFDA 4JRXA 4MD5B 4UIKH 1SQBG 4FAAB 1XFPA 2O5ZL 3CV5A 1TZOA 2F7IA 5I9QC 1YNTB 2VTFA 1DJIA 3ZE0F 1KGYE 4EO5A 2DH2A 3V4UH 1CICD 4BH8A 4WI9A 3V5DA 4S10A 4XMTA 3KS0H 3KPSA 5K5GB 1WUZA 3J7HA 3KEHA 2YGNA 4JFEB 1YUKB 1GY2A 1YEJL 5E4IA 5HYSG 1X7QB 5H35B 2SODB 3T0ED 3SWFA 3DARA 4KK9C 4CILA 4L0YA 1WZMA 4GSRA 5FV1L 4K7PL 5DZ9A 2AI0H 5IW3A 3MLVH 5F6HJ 3C5ZC 5KYWB 2QM8A 2LFGA 2A9NL 3BI9X 3NYKA 4P3CL 4U1MB 4TPRH 1BJMA 3TFKD 3DSFH 2EYSA 4WTQA 4Z7WF 2EYTB 1E9PB 1MJUL 3GNMH 4TUUA 1LTTC 5FYJH 1NCJA 1HXMB 2CPSA 3K46A 5HHXL 4I4WA 1N67A 2E7LA 4ZAKD 1KMIZ 1R46A 4KJWC 3UZQB 3N43B 1NANH 1UWXK 3FU3A 3FQUA 3EH5B 3AQZA 1JXKA 1Q0XL 3A5VA 4E5XA 1IARB 1NKRA 4PGDB 5GZOD 1YEIH 5ID1B 2JP3A 3QZOA 3LB6D 3P11H 5BS0B 3S1KA 3U25A 1BLNA 3Q2YA 5FUOL 2CHWA 3BUDA 1E5BA 3B8YA 4GG8A 4RIRB 1JGVH 3BGFB 5CBAB 1XTMA 1J1EC 2DI9A 1DVQA 3WXWL 5JXAL 4JQIA 5GGUB 4FG4A 2YD9A 5IWLC 5DD5H 3V5KB 3F05A 2XVBA 3MVSA 2ZAEB 3QDGB 2Y23A 3T2OA 4MD4B 2HN7B 4UDTA 4R96A 5F7YC 5IG7B 3NEOA 1S9VA 5D2LB 4U31A 5D6CB 3FCSB 1IC2A 1B90A 2QTEA 1HSBB 4QTHA 1CT8B 3ULVC 4ZSOB 4UWQB 1PTZA 1H15B 2LAAA 3AY4A 4K35A 3O8ZA 3U6RA 4J3OD 4UOW0 2K70A 4F1SA 1NGPH 4G2AA 4P9HC 1F8TH 2HRGA 4J3SA 1JFQH 3ZGIA 5IJBC 4XPFH 4O51B 3WFCH 4Y19B 3QFDA 3A0BH 2BP8B 4C7NA 1Q0YL 1GS7A 1NANI 25C8H 4GEJA 1QWHA 4ORGB 2OTKE 4Q97A 3U2SB 2VLLA 4ZQKA 1R34A 4TNVF 1OCWL 3DROA 3SBWC 4XT1C 4YBLC 5KUMA 4IOSA 3P4MA 4Y5YC 3IS0X 5TTRA 1EXUA 3CFIC 4HLZG 5TQ2L 1KILC 3QORD 4NAJA 4YPGA 5EOQH 2JKRM 3CU1A 2YD7A 4FFWD 5AENA 1GL2B 1EHXA 2YSTA 5GGVY 1HUCA 4ZXBD 1QMUA 3ZU8A 2I07A 1WE5A 1VB9A 1INDL 3SJVA 2FH6A 4F58L 2EXYD 2GTWB 1FL6B 3W68A 1TQCB 2ZX8A 4XMZA 3SPCA 4BA0A 1XWVA 3OXSB 1U8MA 2LABA 3ABKB 4IJ3C 3Q5OA 2AQRA 3IPBA 4MTMA 5IOPA 4PP2A 3LZPA 4ZUUB 3G3ZA 2QVFB 1NMAH 1AGEB 2YQ3A 2QLYA 3HA0A 1I7RA 2IFNA 3I3DA 1I1AA 3KPOB 3MJ8A 3RFZC 3U46B 3K4DA 1N8ZB 4NUMA 1KEGH 4MNQD 2IDTA 4TQEH 3ZQ9A 1BF2A 4UOZA 3HRNA 4TULH 1QFOA 2YN5A 1CG9A 1Z9LA 3ZTNL 4CSPA 3BPOB 3QUXD 1NFKA 2O5YH 1NOAA 2RCSL 3NEXA 5DRNA 5EC1B 2EADA 3NGBC 2E0PA 1CXEA 5JOFA 1ZLLA 1R3HA 3K2MC 5BV7B 2BX5A 2J20A 2X1PA 4Z3EA 5IFHL 3IFOA 4I13B 5LBVA 1JV5B 1KEMH 1KV3A 4P57A 3DPBB 4PD4K 4DKAA 3VXUE 1FNGA 3VGAC 4XVOA 5AW4B 4YHYC 4MS8C 1QRND 4ESKA 2P10A 3BWAB 4WNQA 3FHEA 1DVSA 2F5BH 2KSJA 4L4VA 4XMKL 2BXYA 3H6AA 5HVGB 4BH7A 1NL0H 3A6OA 5A2IH 4DVRH 4PWKA 3SE3C 1J8HA 3F3HA 3MCLH 2YLHA 3WMPA 1CDCA 4KITB 2K9YA 3QPXH 1A6ZA 2AAAA 4KZ0A 2WOBA 4LCWE 4A2DA 2VDPL 3BAYA 1GPOL 2BRQA 5F7EL 2QQQA 3I9PA 1PZ2A 4F2EA 3O9WC 3Q9PA 5EWIH 2Y0CA 4A7TA 3G6AB 4UQCA 1OPOA 1O7DE 3QUGA 4AV0A 2YRBA 2NY0B 5FGBA 1UM6L 2QVMA 1BPLB 1JPTH 3ZUNC 5SWZA 3ULUF 5DRXA 4AV5A 4OV5A 1ZV5A 3IKKA 3FF8A 3WUTA 1IZNB 4KUZL 4PRBB 4ZPTB 4CAGA 4AI7A 2XPYA 1IGJB 4Y1SA 3VVVA 2VR5A 2X4QB 3LCYA 4B9ZA 1GGBL 2POHA 4QRRD 5GRZA 4AIEA 3ZIMA 5J9PB 3QXDA 3GD1C 2WWKT 4RGNB 1DQJB 5DMIL 2QV2A 3WE6A 3R4YA 3PWNB 2YXWA 3HBQA 4F15B 1XMEB 3I84A 3O6MH 2UZXA 1NTZD 2FLMA 1NPJA 5D7SH 1E5WA 2VRSA 2NY2D 1DUYA 2E9GA 3IAOA 3GHEL 2VO5A 4RBPH 5AQ0A 4HIQA 5IJVA 1CQKA 3D6GA 1F97A 1SGKA 4UZUA 1XCTA 5DHVB 1C5BH 2GJ6B 4V33A 5F1NB 1OMIA 3GM0A 3QUZA 3ARVA 4XPTH 3Q3GA 1BFOB 5GJTH 1HE7A 3R4DA 4RSVA 1L5GB 5F6IC 1GTFA 5D9SA 4RDQF 4GSUA 1ND0B 4L3FA 3SB3A 3MGAA 4OFKA 4Z7OB 1WIPA 1XEUA 3VWKB 1TMQA 1L4AA 1A3QA 4XCNA 2F58L 2QTVA 4GG6A 1RD6A 1RMFL 5GS3A 1AFVL 5KAQF 2EUXA 2ZKXA 3OZLA 4DOJA 3RZCA 3RZWA 2ADFL 1FIGH 4UV7H 3VOPA 4WW1B 3P0YH 4NN6C 5K1NA 1UJ3C 4BE6A 3V4PB 3G5XA 3TA3C 2BCKB 5D7IE 4HALA 1AV1A 2EDHA 1KNOB 2HFFB 3FT2B 1WC7B 2X6BA 2DQEH 4OLUL 5HJGA 1B0WA 3EUDA 3AM8A 3W39B 4LE8A 1UACL 4OLVH 3O8XD 4BSWA 2C4XA 4K3DH 4JPKH 1SXCA 1ZS8B 5EO9A 3IPEA 3MACL 5I8KH 2EDMA 4LQ1A 3P02A 2GBVA 1YMMD 4GW4B 5DJ2A 1U33A 4HXBH 4OVUA 2X89A 4QXUL 4DP8X 3DJTA 1K4CB 1N64H 4ZO6A 4DEPC 5E2TH 5J12C 4ERSH 4MAYB 4B9YA 5F1KC 4JREB 1CLOL 2WKOA 3RYMA 1PVHA 5BW7C 5I15H 3EYVB 4E5XG 5KSBF 1OVZA 2HSIA 4KQ0A 3PABA 2JWAA 3GC3A 3SGKA 3W5MA 5GJSH 3FU8A 3VXRB 1C8PA 5IMMA 3O4LB 4QT5A 2BLFA 4I0PB 1EGJL 4MVBC 4Y2OB 2J6EL 2XN9D 2QSIA 1R24A 2VL5A 4M93B 5J6GA 5GSVB 3FBKA 5HYJD 3TC9A 3ZHLA 3B43A 4MB3A 4L1TA 2CJUL 4A37A 2ZOUA 1NGQL 1HTYA 2Z31B 3NIFE 5GHWL 4H44D 1KV4A 4HPOH 1QABA 2ATAA 1JI2A 2GCYB 3SQOH 1U8CB 3WUWB 2XV0A 1SQXE 1N73B 4M6OH 2G5UA 2RB8A 1SYSA 1WZKA 4PJXB 5I0XA 1EA9C 1ZT7B 4UCFA 3ILEA 4PJ5A 2QHRH 2D0FA 2ITDA 3H9HB 4Y4FB 4YHNA 4TLKA 3H1KJ 2E76B 1U3HC 3L5XL 3QNZA 1IC1A 2WMMA 4YDIH 5AZEH 4AZUA 4GH7B 5C0FA 1CMOA 2GQHA 4FOMA 3FUNA 3WSQL 1ZTXE 4I48B 3HNTL 1MNUL 3CFKB 5T3ZE 2HH0L 3A21A 4XXDB 2EC9U 3V0VA 4KKAD 4I18C 3WJMA 1AKJB 1QLRA 5ID0A 3JWOH 4AQRD 3DMMD 4HIXL 4AK2A 3RUGA 1YYLH 5DHDA 1HJCA 5F3HA 3PWJB 4CKVX 5EU4A 1JIBA 3C6SA 4X6EA 1B4TA 2V3DA 2ZKWA 3PPSA 1U8QA 3WUZA 1NC2D 3FB5A 1UOKA 3H1LJ 1HWTC 2IO5A 4P46B 4HYTB 15C8L 2O5ZH 4ISVA 1XCQA 2QJYC 4R7NB 2WP3T 2HA1A 3RILA 4ZMYA 6PAZA 4E0RA 5CD5C 4KKZA 4G9DA 2ZP8A 4CW1B 5BJTA 1A4BA 3DSNA 1ZDQA 1MDAA 1ZHBA 4TVPL 1A1OB 2F74B 4OJCA 4KK8D 4JM2F 3GSRA 3HZMA 3H1LE 1PX4A 1T21B 4LLDB 1YEJH 1WAAF 3K6SA 2OSXA 3VFRB 2VDNL 2XVLA 3T4AA 3CC5B 3HZVB 1R33A 2WVRA 4K7PH 1GR7A 3ILQC 1PX3A 1ZSDA 5EFIB 3RWDB 1G7JA 1N0LB 1U8HA 3UABA 3NJFA 2A9NH 4Y2DC 4FNTA 5HHOA 3EO0A 4ICXA 4P3CH 4ZKPA 1KPVA 1WWCA 5ICXB 3WU1A 3HD7D 1M6OA 2Z35A 1MJUH 2VDML 1SQPE 1R3LA 4MA3A 3T0DA 3GWJA 4P2QD 3LVEA 2A2QT 4W4OA 2XV2A 43CAA 5HHXH 1GW4A 4MQXD 5AVSB 1FOSF 3H9ZA 1QL1A 1BVKA 2YC1B 3EJTA 2FYUK 1Q0XH 1GOHA 1DQVA 2PP7A 3CN3A 3EFDH 3FAWA 4Z76A 3IYLW 4JFPA 1MXDA 1O7DC 1BD2E 3GRGA 5FUOH 4NFDA 4PJCF 2AJYH 4FC3E 5EU5B 4HIJB 1MVYA 1HDMA 4EZKA 2F1AA 5C0DB 3BLKA 2VLKD 5L0QB 3I75A 1IO4A 5C6PB 3FN9A 3LIDA 3A4FA 3AQYA 2EXWD 3WXWH 5MEOA 5JXAH 1R5WB 1M7UA 2HPCA 2P5WD 4CBPA 4DP5X 2Q9IA 1T04B 2DMGA 3EJCA 5FDYA 3DPDA 3RY4A 2JQMA 3UG5A 4F57L 5E51A 5JPMC 1IAIH 2B77A 1WBZB 3EF4A 3FTZA 4PJFE 4G43A 3BP7A 5C0RH 2HFEB 5JOPE 5JIPA 4LASL 3MGNA 3DX8A 1MHHA 4K9EH 2C9SA 4W9GC 4DWHA 3BH9B 1A2YB 1N10A 5DRZB 3D6YA 3K2UL 4EVNB 1NKGA 4F37K 4NUPA 3FSVA 5A2JH 5GS2D 4ODWB 1NEZA 2W0LA 1AVOA 1A1NA 1Q9WB 4TTDC 4JJOA 3TZVB 4U4BA 3MTUE 2CUHA 2YD6A 3PQYB 2E5EA 3STLB 4TUJB 3CCMP 4ZDHB 4L4JA 2FATL 1Q0YH 1XH3A 3UEZA 3M8OH 3BISA 3RPIA 1TJIL 2CM6A 2H2SC 3U2JA 3S9OA 1OCWH 2Q7NA 4H26B 4PJAF 1JYXA 4M7JL 3TPKA 1PZQA 3E80A 3O3DA 4YSOA 4BUHA 1O6SB 4NDMB 1SQBJ 3JV0A 4U49A 1JF6A 3L4ZA 5T1KD 3KCPB 3WFZA 4BWTA 5IB5A 4PJ0E 2ZYDA 3U7WL 1JMBA 1TU3F 2CU9A 4G1MB 3ZSSA 2ZFCA 1NCWL 4ZBJA 3QFJB 4IBVA 1INDH 2MPAH 1HH9B 4N0YL 4F58H 4L1DA 2H4EA 1FVCA 3L72G 3H4FA 4G80B 1HHHA 2A38A 1N59B 5HYSB 1UKTA 5KAFE 1IU1A 1B88A 3B1TA 3F6IA 3VFVB 1G2CA 4N8PA 5G2NA 1UH3A 1HEJC 2DLFL 3WUUA 4KGJA 5E1IA 4BKLB 4N25A 4U3FJ 4ZMPA 4ZZFA 3AY2A 3O0RL 1YN6B 5DO2D 2XICA 1FORL 4O2CB 1LEKB 1XCWA 1T66C 4Z5RA 3Q1SL 3MTRA 3ZTNH 3CHSA 4FNUA 4MJ6A 2J12B 2H9GB 1U93A 4AGQA 5FKPA 1L7TL 2RCSH 5C07E 3ZT7A 4LOFA 4XNUL 3OGCB 3APCA 4U3FE 1KFMA 2NXYC 2K3HA 5D7JA 3U7YL 1CD0A 2ZNWA 2FJFA 3GF8A 4QOKA 4L8DA 4J23A 1HWHB 3L71D 1T6BX 2QPFA 4FZ8L 4IGBD 3S98A 3T2QA 1O9ZA 3EO1A 2VH5L 3OAUH 4P3WA 1HXKA 3AWGA 4M61A 4C59B 4XMKH 2Z0UA 1NCUA 2ZSVB 3LRSA 1RZIA 3O3EA 1RIUL 4TUKL 2WQVA 4JZNA 1AKPA 2YIUB 2E75B 2W6AA 2ZONA 1SOXA 1S7TA 3MV8B 1BEYL 1E28A 2VDPH 5B7EA 4GT7A 1GPOH 3UYOD 3TO4B 1JPEA 4HUWB 3B7SA 5F7EH 5DJTB 4Z95L 3VFWA 3V95A 1T0NA 4TVSa 3LZNA 5F8QC 1SBBA 2C3VB 1G4RA 5M1BA 1KF9B 3LYRA 5FUZL 1JERA 3E0GA 5HGGS 1UM6H 1MVUB 3LZRA 4XVSL 1GDTA 3AAZA 3QAZB 4FQXA 5BZDA 3E1RA 3PRZA 2AHIA 3JSVC 1RU9L 1R47A 3SDYL 4X6DA 1CFTA 2Z64C 3DIVA 2J5WA 4KUZH 1J8KA 5MEPB 2FBWC 1OTUD 4PJ9C 2OTLP 4JY4B 2KSEA 5EUOF 1GGBH 2ADJB 1DEDA 1AVYA 4LCYA 1HKLL 4C83A 3IMBA 2AEJA 3PG2A 5DMIH 3RNQB 5HGBB 3VXSB 1TYEB 2O5XL 3CDFA 4XNYL 5DEFB 3HE7C 2FWSA 5IR1A 1SFCD 2J1YA 2HPTA 2VRAA 4EXKA 5A2BA 3QISA 5CP7B 1JHTB 1KCVL 1VQPP 3BIBX 3GHEH 3K6OA 5IQNA 4K3GA 1FA4A 3QDJE 5C0BA 4LU5L 4PV9A 3EQ2A 4KDWA 3USSA 4X80L 1PGJA 3MRPA 3STBA 4U1SA 1LEIA 4UT7L 4DVBA 1NMCB 1AGFA 3CX5H 2JELL 2QMJA 3TLRA 1L7IL 5E7BA 3E8UL 4HK0A 4MMYA 5KSUA 3GBML 2P8LB 1V7NL 5IQLA 3F62A 2XNAA 2IIJA 2EINB 5IEHA 4NKDB 1JPFA 1MCDA 3FF7A 4OI8A 2BDNL 1J11A 2F58H 4X98A 5E6ZA 1FYTE 2YPLB 1GMIA 1RMFH 1AFVH 1X22A 3RBSA 1U2HA 1ZHNA 2YKOA 2ADFH 1FZEA 1L0LD 3N1MC 2GUOA 1IC4H 2WK2A 5MENE 4BUGA 4NO0A 4PJEA 2R1YA 3GPEA 1NFDA 1YJ9P 2ICWB 2NX5E 1I1FB 3DIFA 1YTZI 1HC1A 3FQNA 3QO0B 4MB4A 2HTKD 2HR3A 1C08A 3HN8A 1H3XA 4OLUH 4BA8A 4QTFA 5CCHA 4TNWK 1UACH 1AGDA 1SMAA 3BIKA 4OV6F 2O30A 2ALAA 3MACH 1PX8A 4RFEB 1UQSA 5B3NA 4ZFGL 2VW7A 2C7UA 5I1KL 1N8OE 1QFHA 5APTA 1RJYA 1XH0A 2YPKB 3FN3A 3CHXA 2AQQA 4QXUH 4WJ5A 1WICA 3VCLA 5H2BB 1KGWA 4JL2A 5JUEL 1UB5B 5TQ0L 2NQ3A 4B5ZA 3LHAA 4XZUA 1CLOH 2WXMA 3GHPA 1KTKE 3WHE0 1A7QL 3TPUB 2YGVA 1Y1UA 1AQKL 5KKZB 1L0XA 3CX5I 4N26A 5E6ID 4FG0A 3NCWA 3V0HA 5B8CC 3CWBG 2YMXL 4KXCA 2J6EH 3P69A 3KHOA 5HVFB 4G9FA 1JY2N 3P4NA 4YR6A 1WVZA 5C0EA 3MRDB 2GTZB 4OW6A 2CJUH 3LS4L 4HQQL 4C4UA 1NGQH 2X53A 3ECBA 1SVBA 3L5JA 2ZICA 2CR0A 2GW5A 5GHWH 3EGDB 1YTZT 4QR7A 4AGOA 4ZMTA 1FBIL 1K6QL 1IM3D 2DI7A 2AQ1A 2YXRB 2XQBL 1SY6L 1TMCB 4UQ3B 2E7MA 3EH2A 1PGOA 3QT2A 6FABL 2UY6B 4IBUA 5KJ7D 4JDZA 1HN1A 1ONQA 1AYRA 4L9LB 2HT2D 2ARJA 2X5PA 4A2GA 4Y4KD 3L5XH 1IFRA 5KJRL 1KTDA 4X6FB 1YC7A 3WSQH 1NEZG 4XPAL 2HG5A 2NYYD 3HNTH 1MNUH 2HH0H 2ZXCA 3AT8A 5DMGD 3HE4A 4XZ4A 1MFZA 3WTTA 1A0QL 3AE6C 2XA3A 3H9SE 2EXSA 4HIXH 4KKNA 3A23A 4BEIA 4TT3H 4ZNEE 1L0LK 4E2OA 3UDWC 2P80D 2IAMA 2P5ED 4FL4B 4HIIA 3VXME 3EYOA 1GJIA 1MCCA 1EO5A 1FV1B 2PW2B 3B5ND 2Q76A 2ZWKA 3BZ4A 3KVQA 4JRXB 4P2OA 4P59L 3VSVA 4YLCA 3ULUL 5JDSA 4Z78B 2V9TA 4IBTA 3AEBC 1FL5A 1RZKC 4PJIF 1TVBB 2A9BA 4WHDA 2E43A 2NDFA 3SGJA 3ZX1A 4BH8B 5C3LD 5JMRA 3V5DB 3T8MA 1PP9G 2NXZC 2R69L 3KPSB 3ARQA 4U6TA 3T09A 4TVPH 4YVUA 4YXWH 3ABMB 3CMGA 4P23D 5ACLA 4BGDA 1KULA 1Z6JT 3WY3A 2WCGA 2XZRA 1J9SA 3BUQA 2JF1A 5KS9A 1KCKA 2WPRA 2G30A 2WWKO 3OHXC 2VDNH 3R19A 1RZQA 3BCCG 4KQ3L 5J3HC 1KORA 1KBPA 2E47A 1GYUA 2OZNA 2EYSB 5HGDA 1DBML 1PJ9A 2YGOA 3D3VD 1WFOA 1QUNA 2VDMH 5I2IA 2JFCA 2PAJA 3BAEL 4I4WB 3GUTB 3NMEA 3H1JD 4GQRA 4KJYA 3MBEA 3FQUB 1I8LC 2VR3A 4K2UL 4EIGB 1F6AA 4E5XB 4PJGA 4EKJA 2C9PA 4CVXA 2VLMD 5AB9A 3L1EA 2PO6A 1S7RA 3BD5A 1BLNB 3P8CD 1L4IA 3AEAC 3MRLA 3O3BA 5AG9A 2GA1A 5D96B 5DD1H 5DFAA 5KBPA 4GI9A 4ALAL 3WAKA 2IDQA 4PYGA 1KYUA 2FX8L 2G8YA 1QSED 3MROA 4DPBX 4B50A 2EEFA 3H8NA 2AEIT 2YARA 3PIQB 4X9BA 3SKJL 5I8EA 4YC2B 1EMTL 1XZWA 4R96B 4UDTB 3DVGB 3LXCA 1S9VB 3BKYL 1PYWA 4GO9A 1H8AA 4F57H 3KWXA 4JGNA 4AEFA 5I6KA 3MZWB 1URQD 4QTHB 3VNZA 4P4KD 3H2PA 3QB7C 2RQ8A 3UAJA 4LASH 1OB1A 3RWGA 2JNZA 5IB4A 3U6RB 4Y8DC 5CU9A 2WKGA 4BFIA 3FUKA 2RHEA 1H8NA 2A9AA 1NH4A 3DXAA 2Q6WA 3AROA 1ACXA 3QFDB 4C7NB 5CFHA 4UDUA 3UTTE 3V0DA 3QIUD 4F37F 4G3YL 2FATH 2PPDA 3X3GL 1D7BA 3GM8A 1GOFA 3DROB 4JF7A 1TJIH 1CCZA 1DLFL 4ZX3A 5E94A 1XR8B 3CHOA 2ZX5A 1UD2A 4X5QA 5IB1B 1EXUB 3JTBA 2LXCB 4M7JH 1SOSA 2J8UE 2DLEA 4F2ME 4YPGB 4JFOB 1LTGC 5L4IA 2OTJP 5EEVA 2B1HL 2NY4B 5DJ8A 2A99A 4P2CG 3BP6A 4M5SA 1P84H 3OZ9L 1HHGB 2A83B 3RIAF 2AJUL 4DKTA 5EDXA 3U7WH 2F9BT 2I07B 4APQD 1RXLA 4PRHA 1NCWH 1WFJA 3PP3K 5EU3A 4PLKD 4R0LA 1U8MB 3O6LH 3FWLA 5KLVD 2CGRL 4X9IA 1AC6A 4E9QA 2DJ4A 4DP6X 1B4LA 3K2IA 5IOPB 4IBQA 2MQCA 4YSAA 4M6AA 3HUSB 1I7RB 3MJ8B 1I1AB 2W8CA 3KJ4C 2DLFH 1GS8A 2VLRA 3PJLA 3ARRA 3SJVE 3VJ6A 2V3EA 3DX9A 2GFBA 4CC1A 3O0RH 2N1TA 1PLGL 1FORH 2AEOA 2LR2A 1CG9B 2EZ0C 1X0TA 4YGVA 5KAIE 1U30A 2OSYA 3Q1SH 4PLJC 2W92A 3BQUC 5DRNB 1Y07A 1IILE 5JOFB 3E2HC 1L7TH 3VGFA 4LVEA 4XNUH 3FXIC 1KT2A 4TL5A 1LT9A 2IBZI 1KSRA 2GYSA 4IRSD 4P57B 2DQJL 3WN5A 3ARBC 3U7YH 4DF9A 2OR8A 2VLJD 4FZ8H 1T0MA 3UGXA 2ZP9A 2ZUQB 1EGJA 2VH5H 4DPCX 5D93B 3DWTA 2J6EA 4WNQB 3RWCA 2A9ML 4CSSA 4ZNCD 4L4VB 4BH7B 3HMWL 2E74D 3KDPB 2WP3O 4XP1L 4HF5L 1P84I 3S34L 4X8CA 2EDOA 2DMBA 1J8HB 1RIUH 3MUGA 4TUKH 3MRGB 1EQWA 1A6ZB 3C2SA 2YZ1A 3CH8A 1M7LA 3L1OL 3P40A 1BEYH 1AHWA 4PS4L 4HK3J 1CDUA 1DVFC 1D5IL 1BDCA 3ZN6A 4JFYA 2DN7A 3D39A 4XCYA 5DVNA 5C0GA 2B0SL 2OMYB 4UAOC 3Q6FB 3WFDL 4EDWL 2GJJA 3TOPA 3OWRA 5FUZH 3ARDA 1S46A 3E9TA 1YUHA 5SWZB 5CZXD 4YLBA 4XVSH 5DRXB 2YKKA 5BUGA 2J44A 4OFQA 4OV5B 4AEIL 3WDJA 5IQMA 4FXGC 4EN3A 1A7PL 4JYCA 2AABL 1RU9H 4HEPA 1P53A 3SDYH 3ZZLA 4ZMZA 3KQGA 4ZMAT 1ZT4A 3CFTA 1KTMA 4OIFA 3CFMA 4OB5L 3K74B 2GEQA 3QXDB 1MI5E 3NACL 3UMTA 4U2ZA 4WJKB 3ZDXB 2VSDA 4FYQA 3WE6B 1HKLH 2D73A 1LEGA 2X05A 3JTSA 3K0WA 2O5XH 3QQ9D 4XNYH 1FF5A 2H0JA 2LTQB 3EO9L 5KSAA 4UINL 2BSTA 4AYSA 1G4MA 3VGEA 4EJ1C 5IJVB 1KCVH 3WTXA 1HYSD 1XIWA 1XCTB 4LU5H 3RY5A 4X80H 3ZSTA 3QUZB 1F1GA 4F7EA 3KS0J 3Q3GB 4RX4D 4YSTA 3P7KA 4UT7H 1RZ7L 4QRTA 5D9SB 1I1YA 1XV8A 2JELH 1L7IH 3E8UH 3GBMH 4ES8A 1V7NH 4XCNB 2CQVA 3MGTA 1MCOH 3ROLA 4ANWA 4HOMA 4TNEA 1IIKA 3B9KD 1UKSA 4MA7H 1MHCB 3RZCB 4JFFA 3GHGA 1RE3A 3PU7A 4RMRA 4MXQD 4LEBA 1P7QA 4LCIL 3MCKB 3X3FL 3LKOA 1UUNA 1HL5A 3G5XB 1OAYL 5IHZA 2ZUTA 1KGJA 1JI1A 3MFGB 4FI7A 1NJ9A 4GG6E 1WWBX 3B7RL 1IFNA 2WXGA 4BSWB 2EIDA 1QKZL 5EO9B 3ZKXC 5FYJE 3F7KA 2Z3FA 4JO1L 1UATA 2QHLA 4Z1MH 2WSDA 1EZVY 1WBYA 2FJGA 1F6LL 4GKSA 3MFFA 4S1RL 4IL6E 4YDJA 5DJ2B 1MFCL 3R8BB 4ZFGH 5I1KH 4YPJA 2CRZA 3BRTB 4HULB 3QR1A 2KI7B 2K9UA 5CJ5A 4EZJA 2FJUB 3ZMRA 3A24A 2Z8VC 1A7QH 1T7WA 3FK3A 3SPHA 1AQKH 3FT9A 2P58A 1QYGL 2B20A 4LCCA 4QT5B 2A06D 3QJXA 4ZT1A 5IMMB 1JV2A 4NQQA 2YMXH 3C9NA 2XWJA 5J6GB 5D5MF 3ATDA 1JWMA 2BERA 3K3QA 5CJ4A 3IWVA 3MREA 3HJ0A 1NWOA 3LS4H 4HQQH 3TBCA 3AY4C 4MYWB 5DJZA 1SN5A 3IBEA 1I7UB 2V9UA 3V4LA 1S7SA 2CO2A 2X2IA 4BQCA 1FBIH 3BASA 2R4SL 4U1KB 1SYSB 1Q1PA 4R84A 2XQBH 1SY6H 3BUIA 2JCCA 2NUPB 3WG7B 2BP3A 3P3SA 3TO2A 3L70J 4YHNB 2ITDB 5DURD 4RSYA 6FABH 2D3LA 2L04A 1JZ4A 5C0FB 4X5WA 3ITKA 1LWRA 4PRID 4G5ZL 5KJRH 3P3UA 2YAFA 1R5IA 5B1CA 2FIKA 4K23L 3EFGA 4TSCH 3V0VB 1DVUA 1QLRB 2YXVA 5ID0B 1A0QH 3G6JE 2IOIA 3L70E 3RUGB 3HRZB 1UASA 1MLBA 4PJ5E 2M5AA 1H6FA 4AMKL 2FSDA 3C6SB 5BNXD 4GW5A 5F7AA 4ZRGA 5LGKA 1U8QB 5IV2A 3NVQA 4LIQL 5EZOH 2HKHL 3FB5B 4Y1AB 4WRLA 2IF7A 3S37X 43C9A 1QSFA 4M7LL 3ZT5A 3ULUH 1OAUL 4M9OA 4ISVB 1YBKA 1TPXC 1XCQB 1FAIL 3F6JA 5FV2A 3RE0A 3T0EE 5A2KH 1BZQK 4P5KB 2NZ9C 4G9DB 1QZ1A 3RL2A 5BJTB 5DJXB 3DSNB 1NIFA 3VI4B 1ZHBB 1U8OA 3LZLA 2B4CC 3QQ3A 3ZDYF 2E5YA 2R69H 3TVMC 2J43A 3BC9A 1P7HL 1DZBA 1EJ6A 3S35X 3SPIA 3DUHA 3HZMB 2BEQD 3WUVA 3WEOA 1ZTMA 4JFSA 4HJEA 2E6JA 1IBHA 3QUYA 3K6SB 4I6MC 3KWWA 5TDNA 1FNFA 4FQPA 4LEOA 3AS0A 1NUNB 4NZUL 2AF2A 3VNYA 3PLYA 1OV8A 1ZSDB 2J3SA 1G7JB 1U8HB 4FQHA 4U3SA 3W3BA 3LRGA 5AEAA 3W0WB 2Y06L 4AQZA 5HHOB 4NS0A 2R0ZL 2E59A 1DBMH 1M6OB 4HUMB 4P5SA 1R3LB 4MA3B 3A0HE 1B2WL 1W8EA 5B22A 5TPWL 1MHEA 5T5NF 2AXGA 2X4UA 5L2KA 3A4DA 3BAEH 4L4TD 4ZMWA 5TDPA 4Q9RL 4XRCA 1BVKB 4K2UH 1HJBC 5F9AC 4Z76B 5C0CD 3FFCA 3D5OF 3VSUA 2YXMA 1MCWM 2P3YA 1A9EA 1EBPA 4FG2A 1HI6A 1IGFL 1U8IA 2H8PD 4LVHB 1NCBL 2IX7C 3RVVD 3OKOB 3G9RA 2X2JA 1HDMB 4PWHA 4ALAH 2XYCA 3M7FB 2VN3A 3I75B 2FX8H 5KOVC 2ZYAA 3GQFA 5CSGA 5MEOB 2YD2A 1KIQB 1FFTB 5DUPL 3J07A 4AGNA 1BVLB 1ASOA 4O2EA 3SKJH 2EO9A 1FFOA 1GA2A 1OY3B 2JEEA 2X4PA 3GMLA 2B5IC 3PDGA 1XSOA 2CA4A 2KH2B 4QRSA 1PY9A 1FVDA 2R9HD 3BKYH 4WO4C 4G43B 1BAGA 1S78D 1ET7A 2QG4A 2F68X 3H56A 4NX0A 1MHHB 1NBQA 3INOA 4LNVA 4C56A 1I82A 2MFNA 4PLOB 1DHKA 1XVSA 4CGUB 1UZ6F 4I87A 2VITA 2DYPB 1A1NB 5D1QA 4XO9A 3ABLB 1D5RA 4P06A 2R1WA 1WITA 1MCQA 4HEPG 1E5CA 3TGUG 1XH3B 1PBYA 1BZEA 4LHUA 4P5MA 4G3YH 4UU9A 4KRPC 3RPIB 3X3GH 4PY8I 4WW2C 5LNDA 1B0RA 1PD1A 1MZ9A 2XQ0A 5DZPA 1DLFH 5C09A 2YGQA 4BXVA 3RFRA 1R19A 4GQ9H 3D4ZA 4GIPD 3LH2L 1ZK5A 2WLHA 1ULVA 5IB5B 2P1JA 2B1HH 3MBXL 4F7TB 3BZEB 5E4EC 5C92A 3OZ9H 4OGQD 1NIAA 2X38A 4K5OA 5AYUL 3NFNA 3KLKA 1RY3A 1PP9J 2OKMA 4IKNA 1L4AC 1OTTD 1P7KA 3GGWA 4RWYL 1FVCB 1EK3A 1YY9C 1HHHB 4MNQE 1D5BA 2ZYSA 2CGRH 2KZ1B 3G5VA 3UIZA 2IWEA 4K8RC 1ET5A 2ADIB 2YA2A 3HUJF 3LEYL 4BSVA 1G2CB 2OYPA 2BSSB 2DEXX 3I85A 4K07A 2VXSL 3RY6A 3WYRA 1NOFA 5LQBL 1HOCA 2H2PC 2JKLA 4GBXD 4LF3B 5KVEL 4QO1A 2AJ3A 2WLZA 4Z7NF 2Y6SC 4WIQA 3NIGB 2V5YA 4Z5RB 3AM8C 4MJ6B 3L5WA 4WZ9A 4POUB 5FKPB 1NO4A 3CQQA 1OW7A 1VQOP 3VM5A 4J39A 1WT5A 3HI5H 5C08E 4NFCA 5D7JB 2YQ2A 1IAMA 2QQKL 4QOKB 2FJFB 4UNIA 4L8DB 5DYOA 1TQWA 2DQJH 1YG9A 4JG9A 3BRGC 2A9CA 5K69A 3MTXA 3H1HJ 4EI5D 3EO1B 1BQKA 3ARFC 2FO4A 4GUQA 1EIBA 1DQTA 1GH7A 2CO7A 3WNKA 4M61B 2A9MH 2Y24A 1U57A 3SGKC 3HMWH 4WFED 1RZIB 3O3EB 1QG3A 1EAJA 3OKMA 4HF5H 4X9GA 4XP1H 3S34H 4AYMC 1G1OA 1ROCA 4JZNB 5FO7A 5FYKU 3U1PA 1F4WL 1AMYA 1S7TB 2Y1AA 3H1HE 3D2UD 3L1OH 4I89A 4RETB 3KGRA 4BE5A 1NLDL 4Z7VF 1S7UA 4PS4H 4JHZA 4E9XA 1AO7D 3TEXA 1T0NB 4GAAA 3VFWB 4BFNA 1D5IH 2D7QA 4WO0A 3LPGA 1SY6A 2B0SH 3WFDH 3HG0A 2CDGA 4EDWH 3JVFC 1R1CA 1DQKA 2V5MA 3GXPA 4PU2A 3VTMA 4M5TA 3I6KA 4N0CD 3QUKA 2PF6A 3AAZB 5L4FA 5DU7A 5E03A 3GEFA 3T4YA 5BZDB 3CCRP 4IIZA 2OCFD 4AEIH 2XYBA 2BOCA 4X6DB 1A7PH 1CFTB 2AABH 4NRYA 2ZUSA 2M1KA 1NTZE 5IHBA 5TISH 1L9TA 5CIPB 3FAXA 3NJHA 1CD9B 3U1QA 5I71C 1UWXH 1NU1D 1CLZL 3ECVA 3NACH 4LCYB 2EDXA 4LSSL 4J6RL 2IBZG 3QWQB 1E9QA 3K8KA 4NN5B 5DS2A 3T0EC 3CN1A 4NP4L 4H0HB 3NCJL 1HHKA 1YNKL 5IR1B 4N1EA 3T0XA 3EO9H 4UINH 2YNYA 1HOEA 4I9WE 4OLEA 3SPVA 4FXTA 3TFKC 3LD8C 5C0BB 1G43A 2WQRA 3RKPA 3OR7A 5APYA 1IM9A 3MRPB 1BF5A 3FCTA 4XTRD 5ITFA 3FTUA 2R69A 2XQYA 4R8WL 2NUTA 4DVBB 2LU5A 2EDDA 1AGFB 4NCC2 3WKYA 5HDBB 4R3SA 3QZPA 5L7XL 1RZ7H 1BE3D 2OMXA 2P52A 5IROD 4HK0B 1V8HA 2C3XA 3ARZA 5KSUB 3MLWL 3C8VA 3P0VL 3F7QA 2XNAB 1H3PL 3LB6C 4KY1H 4M7ZC 5IEHB 1JPFB 3MV9D 4GOEA 3L3KA 3DV6B 5IHLB 4X98B 3ZPDA 2F54D 5DVMA 2MCAA 1JDAA 1ZHNB 4X7CC 5TDOA 3T4AC 4ZK8A 3LQZA 1QHQA 4EZMA 4HCFA 4FNLL 3X3FH 4PJEB 5CKAA 2R1YB 2KKQA 3GMPB 3ZZQA 1DZ0A 1NFDB 3CDCA 5IB2A 4YZWA 3DIFB 3VRLE 1OAYH 3FQNB 1A65A 4N9GA 1FYHB 1WCBA 3IJ9A 5E23A 8CGTA 3MXVL 1AGDB 3BIKB 1QKZH 3O3AA 2CCLA 1RQ5A 4U1HA 4JO1H 4KAQL 1UQSB 3NTCL 1JMZA 3JV5A 1RJYB 4S1RH 4Y5XA 5J56B 5BZXA 1MFCH 3EH1A 4ORZC 4WJ5B 4XH2A 4XX1G 5D1ZD 3L9BA 3VCLB 3S48A 1T1YA 2XFXA 2QJKC 3MRHA 2D2CD 4XZUB 3HBPA 2G0KA 5JNYA 5D1XD 3BSZL 4PJ7F 3TIDA 2GSGA 4G71B 2NY3D 2VR8A 3BFWA 3FONB 4UT6L 4WEEA 5I19L 3V9EA 3VUAA 5L4MA 3SDCC 2XZQH 3UTSE 1NH6A 1QYGH 2CBMA 4U6XA 1YEGL 3D48R 5JW3L 3N43F 2PXYD 2JJUA 4EOTA 2VJ8A 4HCIA 4W9CC 4G9FB 3P4NB 4YR6B 5BRZA 5IHWA 5J4MA 1NU1K 1F1AA 3L75D 4MJID 5C0EB 4FXKC 2CIKA 1YJNP 2QJPB 3TSIA 3MBWA 1GZHA 2YUVA 3ECBB 4NQCE 4UT9L 3IDJA 5GS1A 2Q20A 1VFOA 2AEQL 2ZUVA 2IOMA 4Y9CA 5KSBA 1FZFA 4EOWH 4XNZC 3C5SA 1AG0A 4LSQL 5ANME 2GIMA 1H9VA 5T1LA 2R4SH 2KS0A 2ZYGA 4M29A 4NO5A 2GG1A 2W6BA 3QIWD 5CCGD 4BFBD 4JDZB 4ZX5A 2ARJB 2BIMA 4J3WA 1PZSA 3ZRCC 4PD4H 1KTDB 3KLAA 4H0LC 4G5AA 1X6LA 3F7RA 3NJNA 1NC4A 2HG5B 1N7SD 5L9DL 1H9DA 1Y6KR 4HH9A 3HE4B 2WBJD 2ADGA 3LPWA 3V7MA 3Q5YA 2ZG2A 3B1UA 2K88A 5I5IA 4HJTA 3HNSL 4N3UA 2OS7A 4LHUG 3ESOA 4WWKB 1MEXL 1KN7A 2Q7CA 4OKDA 3WNLA 2IAMB 1PCSA 4AMKH 5DK2A 1EUTA 2V2WB 1ZMYA 4HIIB 3FU7A 4HWUA 4O00A 5SWSE 4OD2A 4X7TA 3HN5A 2Q76B 3BZ4B 4LIQH 4P2OB 2AAVA 2HKHH 3KW8A 4POYA 4PW9A 5A2CA 6PCYA 5I6MA 1OIPA 3QQDA 5JDSB 3H1ID 4M7KL 4ACPA 4I1LA 1OAUH 4MBOA 2W0KA 4P2RA 1FAIH 1FL5B 3N06B 3NG5A 4H8WL 1JGEA 5KVDL 2GHWB 5ISZD 3SCMD 1ZGLA 1ZRTD 4NENA 2WN2A 2QV4A 1JNLL 2BVEA 3BQVA 1WA1X 1I8UA 2VMDA 2WWWA 4JHAL 5KN5A 1E4JA 3K6DA 1ETZA 2Y07H 4P2QE 3AE1C 4KK6C 4MA1C 5KS9B 4U1NA 5CN3A 4DQAA 4NZUH 3GMOA 3U4EA 2WQYC 2JKXA 1CTOA 4WGWB 2NPSA 2B08A 1YEKL 1Y6NR 5HGDB 2GTQA 1BVNT 3GSVB 4HKZA 2R0ZH 3CG8A 4PD4I 3V2RA 3AXLA 2BNQE 1QUNB 4GI6A 4HZLA 5H4YA 5E70A 1H5BB 3O6FA 5I2IB 1B2WH 4QAMB 2QADC 5TPWH 3NSDA 4D0DA 4KJYB 4WUUD 3MBEB 5E79E 2VLKE 1F6AB 1XR9B 1UM5L 4FHKA 4Q9RH 4PJGB 4XPBL 3LDBB 5I1JL 2F53D 4OKVA 4PCKA 4CVXB 2YAOA 1WAAA 3QSKB 3BDBA 4G6FB 4B9FA 4CDGC 2PO6B 4D6TD 1S7RB 4NQDE 5DJYA 2N7BA 3GRBA 1IGFH 2R1XA 4QCIA 5DRWA 5F0PB 3MRLB 3BRDA 3S3PA 1M7IA 1U9KA 2WHVA 2H45A 1FH2A 2HRPL 2G5RA 3T97A 3U59A 2PABA 3O41B 4IMKA 3BJ91 1AP2B 4ZMNA 4JDVA 1IFGA 3MROB 2A77L 4OCYL 4K73A 3X1BA 4G6KL 3U6XA 5DUPH 3ZTEA 5I1GL 3DI2B 2IBGA 2XTLA 1RF0A 1PYWB 5E08L 5E9DE 3VB8A 4M8RA 3A4AA 3GMAA 4FQXC 3PL6A 3ESVF 1I9JL 3KXFA 4PJCA 1TTUA 4PRNA 5IB4B 4DP9X 5ACZA 2NW3B 2JJWA 4BFIB 4PJDE 1N68A 1JVKA 1OCOB 3JWOC 3V8OA 3DXAB 2Q6WB 1UJTA 3UTZA 4R4FL 2E7DA 2LAGB 4P49A 2BVPA 5HDQL 2JI2A 1QR1A 1MWOA 1Q1JL 4UDUB 3P9WB 1FE6A 2IQAA 3IMSA 4QKXB 3MODL 4DTGL 3F58L 4G59C 1BCIA 5E94B 3H3BC 1DQML 1T5KA 2E3VA 5DXWA 3N1PC 5SX5K 4N85A 1H88A 2ATPA 2VXUL 2MJWA 3CX5J 5C08A 5DD0L 3GPSA 4XX5A 4M7LT 5JTWA 3LH2H 3GSOB 3NZHL 2G3XA 4LPUA 3HC2A 3MBXH 3LW5H 1KIUA 4WEUD 3NPSB 1IEBA 4N78D 1IFHL 1NAMB 5ICZA 2FY8A 4G8EA 1OWWA 1UXWA 4PRHB 3C8KB 2ZT9C 3H25A 5EU3B 4R0LB 1CDJA 2EC8A 3I56P 4RWYH 4P5TD 3BVDB 5C0AE 1IL1B 3D51A 2H26A 2XQYG 1SQQJ 4K3AA 2RTTA 3OJMB 1UOLA 3G6DL 4OLXL 3SDDD 3LEYH 1Z66A 1DBJL 2JKNA 2K1MA 5AKSA 1TSHA 1UURA 2OJZL 4AUWA 1CXFA 2VXSH 2GPZA 2VLRB 3AS1A 3VJ6B 5LQBH 4XOEA 5F89B 5KVEH 1LGVA 4UV4L 3WFHA 2Z7YA 1PL3A 3I5CA 1SQQE 4YGVB 1N5AA 4IHOA 1FO0H 4Z7OF 3NXSA 3V7AE 3QK0A 3IETA 3UCRA 5JYLA 2EUZA 1HK6A 1ZPLA 2XX1A 3A5TA 2FBOJ 3SE8L 5FPIA 1KT2B 4NQUA 3WY4A 1AD9A 1LT9B 3WN5B 4RDQG 1C12A 2QQKH 2D03L 3CU7A 2FYVA 1CZ8L 5I24A 4JRLA 2QGEA 1KXTB 2DYSB 1GHFL 1P7BA 2VMEA 3CFCL 3RWCB 1Q81Q 4XOCA 5KAQG 5LCVL 2ZVOB 1CC3A 3US1A 1GXEA 1T5XA 3S3BB 3MUGB 3V0FA 4KO9A 3AUWB 3LXUX 1G5AA 4K9EC 4YPCA 4WDIA 1F4WH 4DUWA 3V4VB 5L2JA 2EDQA 1AHWB 1DJYA 4G6AD 1NLDH 1EEQA 1LWJA 2V7HA 3VRIA 3L7EA 4JFYB 1GL4B 5C0GB 3D39B 1HFUA 4XCYB 1G1IA 1MFNA 4G1EA 4L8SA 4NP9A 2VQ1A 3PHSA 1D5ZB 3ARDB 3GTVA 1G1CA 2L7JA 2L7EA 2PTVA 1YUHB 3MLUL 2UV3A 4H8UA 2A6JA 5A2AA 1FZGA 3KYKH 1CU4L 3ZE1B 1XAUA 4F33A 5FC9A 3HCVB 4Y16C 4EN3B 4CUCA 1NTDA 2ESVD 4ZS6C 1ZT4B 3TGUJ 4H1LH 1FDMA 4K7PX 3JWDC 4ZOBA 3U9UA 1SLQA 5D6DA 3WKQA 1Y9BA 1CLZH 4RLDA 5HVWA 4KQ4L 4U1JA 4YDZA 4LSSH 4J6RH 3RX8A 1OW0A 3JTSB 3RK2D 4GRLC 2C34A 1ZGLP 1HQRA 4QHKI 4Z18A 5JXEC 3NCJH 3NK3A 5AOZA 1YNKH 2AXHA 4PV8B 4G11A 5KSAB 1G84A 1A4JA 3N1GC 2I1KA 1KTJA 5FYKD 1NIBA 4PJXF 5IM7B 1XIWB 3BPLC 3QDMA 7PAZA 1GK6A 3FUHA 2IAND 3EDDA 3GLMA 4NJ9L 4X7SL 5HSFA 3AE9C 5EUOA 3D06A 4IBZA 4U0RC 2XPGA 1MCFA 3TTYA 4F7EB 4MQXC 2GIXA 1VF5B 4R8WH 1QFWM 3QORA 4QRTB 4UB6E 1I1YB 2CPCA 4W9LC 3MLWH 1MCSA 3V6FA 4QYAA 3P0VH 2VDNB 3MGTB 3VWJD 1F4HA 3PNWA 1H3PH 3FFDA 4ZXBA 1LWUC 3AZUA 2ZOOA 4PV1B 3DO4A 4DN3L 4JFFB 4XAKE 1X5LA 4L2LA 4OZHE 4TVPE 3NZUA 1AGCA 1AMXA 2MH4A 2SPZA 1P7QB 2CD0A 1KXQA 3GS4A 3LKOB 2NSQA 3QEUA 1URIA 4JFXA 4KRLB 1ACYL 2HAZA 5IHZB 4DUVA 1LP9A 3QEGL 3RWIA 1U0QA 4E9LA 1KOAA 5AVVB 1MVFA 3QI9D 3NJIA 3MXVH 1F11A 4XP9L 4XODA 1RZPA 3VXPB 4LXFA 3QUXA 4H13B 1T2KC 4DT0A 1WBYB 2FJGB 2C4FT 2BS8A 3NTCH 4GKSB 2KOGA 4KAQH 3BHBA 1KTRL 2BWIA 3QCUL 4MJ5A 1L9NA 3WCYA 3KL0A 5GXBB 4HAKA 4ZUTA 4JANA 1IVTA 2DB8A 3AECC 4IDJL 3B2UC 3BSZH 4OFVA 3WLBA 3WIHL 3C8DA 1GJUA 5I19H 4UT6H 3ARGC 1QRNA 2ENPA 3CFUA 1A02J 5ICUA 1JV2B 1MIMH 3MRBA 1S5HA 1YEGH 3C9NB 2EH7L 5IEKA 1AXSA 2XWJB 5IOKA 4YDLB 5JW3H 1JWMB 1FZCA 2DM2A 3MREB 2DJUA 4JG5A 3L3DA 5C97A 3JCUH 3BMVA 4NPFX 5E5UB 1UD4A 2E9IA 1K5WA 1YNLL 4UT9H 3UAJC 1N0XL 2YRZA 5DJZB 2CRIA 1MW2A 3QVAA 4B7IA 2AEQH 1S7SB 2UZYA 4YZFE 1P6WA 2PYEA 1ZR2A 1LO3L 1UT1A 2JCCB 4LBAA 3TO2B 2E4FA 3IPFA 3ARSA 5FDWA 3N41B 2R2CA 1ZXQA 1E2WA 4X5WB 4HWZA 1OPGL 4RJTA 4PGEB 4AYBA 2ZZUT 3UZVA 1R5IB 2FIKB 2WTRA 5ADOL 3MA7A 4RA3A 5DO2C 4JLRA 1P84J 1KPRB 3COOA 3WO4C 5L9DH 2N01B 3RGHA 3FH7A 3ES6A 4B9KC 4QRRA 3HG1A 5GS0D 4HJJL 4N90D 4QXGL 1MLBB 4X4ZA 1GRWA 3HNSH 1TJGL 2X0VA 1BF8A 1X5GA 1MEXH 4AENA 2AJVL 4N4YB 3D7PA 1PG7W 3VGGA 2EDJA 4DERA 5IV2B 1NEUA 4ETYA 2OK0L 3RVXD 3F7YA 3HZKB 2HJKA 4NKQB 5EU6A 1BVNP 2RD0A 43C9B 2JI3A 4FDWA 3QEHA 4Y9BA 1JNJA 1VQ5P 4H25A 4M7KH 1OTSD 3DVFA 3B83A 4Y0GA 3T6ZA 4H8WH 2VSKB 5KVDH 2HX9A 3RL2B 1VKXA 1OGAE 3P3RA 1U8OB 3QQ3B 5D2NE 2AK4E 1JNLH 3K5SA 4GRWF 4LFHG 3IGFA 1U3NA 4JHAH 4UQBA 3D3VE 1QBAA 3TP4A 2N1TC 1QSFE 2EIKB 4POZD 1QPKA 2G5BA 3P2BA 3U9PL 5TDNB 1G7MA 3C8HA 4QXTA 4X5LA 1CFNB 4U3SB 2WVSA 5E1HB 5J13B 5APUA 5LVEA 2VLME 4PYHA 1YEKH 4OF5A 3D8MA 4PJIA 5F2FA 4ZMXA 1EJFA 4LGSB 4ICWA 4XVUD 3B4NA 2AXGB 4Y28J 2X4UB 1HGZA 4N2HA 3QA3A 5CJOL 2NY5C 3FQXA 2NOYA 4XRCB 3WENA 1G1JA 1B0GA 1QSEE 4XE5B 1L9MA 1FYTB 3FFCB 4XPBH 5I1JH 1X9QA 1EDLA 1Z9PA 5D7KE 4GT1A 1HI6B 1ORQB 4IEFB 1U8IB 1OD7A 4Y99C 3BDXA 3ZE0E 5JW5A 4L3EE 4MDIA 3MUY1 2X70A 5KBKA 2V3FA 2WO3B 4OF8A 5MP6L 1YMMA 1VACA 3B3BA 4YHKL 2ZJSL 3DETD 3U4BL 2HRPH 4CNIB 5L2KE 4ACTA 2WVVA 1T1ZB 4ONGL 5GGTL 3T3PF 2A77H 4QI3A 4OCYH 4P3DA 1XB6A 3ARWA 4G6KH 1D6EA 1OF0A 1NTKK 4J4PD 1CF1A 1AANA 2X4PB 4LAQL 4WLCA 3LIZL 3GMLB 4JHVA 5I1GH 2FR4A 4CMMA 5EU7E 1FVDB 1QA9A 4H1LA 5E08H 1EO7A 5CBNA 4Z7WE 2XN9A 1RPUA 1UUSA 1I9JH 5HYJA 4LGPB 4JKLA 4C56B 3HR6A 3S5LA 4NNYB 2KLSA 4KUCF 3CHPA 4P2AA 2GY7B 2VITB 2OCJA 4MAUL 2CXGA 3UAAA 4FNRA 4AC4A 3VI3F 1ECYA 2C1PA 1YEDB 3IN2A 2IH9A 1IBZA 2NTFA 3NIDE 4R4FH 2VR6A 4NNXA 2R1WB 1U3ZA 2W8ZA 1RUKL 5HDQH 3IF1B 1Q1JH 4LHUB 4P5MB 3ZYZA 1WFUA 3H1ZA 4X4KA 5SWQB 5DLLA 3S8FB 1B0RB 1H6TA 4DTGH 3MODH 5FWRA 3F58H 5C09B 1PFOA 1DQMH 2ZUUA 3NK4A 4DKDC 4J3OG 2VXUH 3HE6D 5D1QE 4QF1A 1SOQA 3QPKA 4KK9D 5KLVE 1PPIA 5DD0H 1Q86Q 2V6HA 3NZHH 1ZVSA 5I5JA 5ES4B 5HVHB 3DJRA 3LKPA 1J0ZA 1YJDC 4HS8L 2J1XA 3V5HA 1IFHH 4BFFA 3DMMA 3DGDA 3NFNB 1ZLDA 1EZVD 2WSPA 1ACZA 4M02A 5IUSA 3NSXA 4FABL 1P7KB 3FMGL 3GGWB 2XX0A 3EADA 1KQLA 1D5BB 1KFNA 4KJWD 2ZAIA 4Q74A 3G5VB 1SOKA