5AVYB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 20 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avyB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avyB02
4I2LC 4HYTB 4RETB 2WPRA 5APVA 1GD2E 5AVUB 5AVXB 1HWTC 2WTYA 2H7HA 2ZXEB 2WWWA 3A2AA 4C7NB 3NMDA 5AW4B 1FOSF 3T97A 2XU6A 3M91A 2WT7A 3M9HA 5AW3B 1JNMA 2Z5HA 5APSA 2E43A 3A3YB 3TK1A 1CSBA 3VMXA 1IO4A 4GT1A 3VN0A 2P2UA 4AUWA 3M0AA 2P67A 5AVSB 4AYCA 3L36A 1A02J 2Q5UA 1GU4A 4B86A 1YYCA 1SP4A 1HJBA 3HE5A 1NWQA 2Z5IA 3NTNA 3WGUB 1G2CB 4JYCA 3A5TA 1GU5A 1OWAA 1T2KD 1MV8A 3NFQA 1H88A 4RESB 3TNUB 2YNYA 5APWA 1CZQA 1H89A 1HBWA 2BASA 5AW7B 1KQLA 3KDPB 1GZLA 5AVRB 3VYIA 3L37A 3M06A 2Q3IA 2C9NY 3WGVB 5APYA 3OAKA 2R32A 5APQA 2YO2A 2R5BA 3HE4A 1NAFA 5AW0B 1JUNA 2E42A 2YO3A 2QM7A 1H8AA 1CI6B 5CMZA 2WT7B 1X8YA 5AVQB 1GK6A 3LIDA 2W6AA 5AW6B 2C9LY 5AW8B 2N9BA 2QM8A 3VMZA 1GTWA 2XZRA 2WPSA 3KQGA 5AVWB 5AW2B 2JJLA 2WPQA 4LC1A 4DZOA 4EOTA 5APTA 3SWFA 5APUA 1S9KE 4GKGA 2ZFCA 3O8ZA 5AW5B 3UIAA 4AQRD 3HE5B 1MFZA 4C7NA 3I5CA 2R3CA 1FAVA 2R5DA 5AW9B 3HTKA 1SLQA 1MUUA 3P8MC 2KP8A 2VRSA 3VMYA 5AVTB 4M3LA 3LIEA 5AVYB 2IPPA 3B8EB 5AVVB 3TYYA 3M9BA 5AW1B 4C46A 1S9KD 4KHXA 3IR9A 1DH3A 2Q7CA 3VTPC 1CI6A 1A02F 3HE4B 2XV5A 3A7OA 3V4WA 1T2KC 3V4QA 1FOSE 4I6MC 3TNUA 3L35A 4XE5B 3P7KA 1GK4A 1HUCA 3MD0A 3NXSA 5AVZB 3V5BA 2W27A 3MGNA 2P7JA 3P32A 1OXZA 3M0DA 4JYBA 1J2JB 5APXA
chains in the Genus database with same CATH superfamily
1H6EA 3VI3B 1UWEH 5DFWH 5C0EB 3L70E 5C08B 1RUAH 2LTQB 4H7VA 2GK0B 3P0YL 4TMPA 3HUJB 3WU1A 3UTTB 2VLME 1RHFA 2EDOA 4YDVA 3F62A 2VKXA 2JKTM 2HN7B 3N85L 1UADC 5E2UH 4P9MH 3C2AL 3U2IA 4ISVA 4CRPA 5BPPA 1I1CA 3H2WA 1QSFA 2HG5A 3DVFA 5HGAB 3U9UA 1R5IB 5EMYA 1QVGO 3Q5SA 1FYTE 3SODB 2A45G 3E80A 1HEZA 2W65A 4KDTC 3EFOA 3V5HB 4WCYH 1NKNA 1HHGA 1RI8A 1ET5A 2WXNA 3ESOA 5F1NA 1I8LC 3H9SD 1K8IB 3L7FB 5JOPD 3S3CB 3PWVB 3QAZC 2FWOB 4RFEA 1OW7A 1EXGA 3PUUA 1YA5A 4ZNEA 3BWUF 2XNAA 3QA3B 5IBLD 1OW8A 3QFGA 4LFHG 4QOKB 4A7SA 2K1MA 3RPIB 3NFSH 5J6HB 1ZV2A 5JNYB 1AGBB 1IQWH 1IFHL 4GW1A 5LGHH 3OR7A 1RQUA 1X9QA 5BZWB 4KAQH 4M7KH 4HKBA 2HUEA 4M93B 1U8KA 2K0RA 5DHDA 1S5IL 1DBML 4MKMA 1BZ7A 4OFKA 5ADPL 3AGWA 3LQAH 3WJLC 1R24A 2NRDA 4H5SA 3VFMA 4AQ8C 4D7BA 5G4NA 3T0BA 3N55A 3TNNA 4HEMA 1FP5A 1A1MA 4JLRA 5C0AB 4G8GD 5CP7A 5C7ZA 1MFEL 1UB5A 4FXKC 1V7NH 3T0EB 2WPQA 4DKAA 4UB6E 2XN1A 3B1TA 3EFDH 3OKMB 4AIOA 1CLOL 1AHKA 3ZKNC 4X7EC 2N1TC 2ZVOB 4LOVA 3ZE0B 1L9MA 4YHLH 1H8SA 2GSGA 2VM4A 2XTJC 2UZYA 3Q01A 4EAEA 3EJUA 4YHKH 4Y28J 1JF1B 2WAHA 3TH2T 4F9PC 4I1LA 3S4RA 2OSLA 2DH3A 3L9YA 3GBLA 3ZL4H 5H4ZA 2BW4A 3HG1A 3DYPA 5FB8B 3EJJX 3PDOA 4AQZA 2GITA 4YJZL 3D39D 2D3NA 5IV2A 3T04D 3BX7C 3WE6A 3F7VA 1AXIB 1H3PL 2EIJB 2Z1KA 1OCWL 2EKSA 3L3DB 3JWOC 2ITDA 2W0FB 5F9JA 1IX2A 3IPEA 4NBZB 5B4MD 2J4WL 5TH2B 4XXCC 4NQSB 1X5KA 1VIWA 5FA4B 3DX9A 2M5AA 1XSIA 1ZK9A 4WI0A 4ZUWB 5EU4A 4UB0L 1VLXA 2CO6A 1PZ5A 4OCWH 4ZBJA 4HK0B 2R7EA 4K5NA 4WFEE 4NAQA 3WO3B 1F58L 3SDCA 4HIIA 3RWFA 4C83B 3K1DA 3L3OB 3I74A 2B1AL 2ZUWA 1SQXE 4DP8X 4AG4H 1ANUA 1KLGB 2F7IA 3UBXA 4IOFD 1MAML 1MKMA 5DHYA 1TYJA 3OJMB 3H9HB 3N2JA 5DI8B 2R1XA 2MKLC 1V55B 2V5YA 1SBSH 1TZAA 5GS3A 4PGCB 1TO5A 3QAQA 3VXMA 4D0BB 5KSBE 1HNFA 4G1EB 1S7SA 2W9EL 3VXOB 3QDGD 1YCSA 1GU4A 5DFVD 5AYTA 2NLJA 1CBJA 3CVDA 3D0LA 3A21A 4DP6X 3QS3A 1SQXK 5H37A 3GG2A 2XWBB 2RMZA 4JYCA 2X4RB 4GLRI 4JO3L 5DHVB 5FO7B 4ALAL 5KYUA 2JKVA 5I8OH 5CEZH 2WN2A 5J1SC 1F2QA 3L75E 4LVNB 1AI1H 3EH1A 3IPBA 3MBEB 5E7FA 2YAEA 3QZWA 2QJKC 1KXVA 1U36A 2H3XC 3HE6D 3PJSA 1CGTA 2Q3IA 4ZMYA 5FEBA 5I1EL 1D6VL 1LP9F 5J12B 3ARYA 3WFBH 3BASA 4HHAB 2AQRA 3W11C 1RZ7H 3CUPB 5CZKA 2Y36H 1KGWA 3GSVA 5A2IH 3KM1A 3DHMA 2AVGA 3NJMA 4P5MA 2VXUH 3VSTA 5DS2A 2AERT 4GKOA 2YAHA 3ME0B 3UTSE 5AVQB 3LKSA 3G5YB 2VQ1A 5KG9A 1W9XA 3HCVA 2V5RA 4RO0A 2X3AA 2Y7LA 1R5SA 2J12B 3PABA 1R8EA 4WKZA 3NJLA 1UXWA 1P6WA 2E6QA 2HUHA 3GRWL 1E50A 4ODVH 4B41A 5EIIA 4K15A 3RL0D 3TBSB 4AQAA 4PCSA 2LFEA 5JQIB 1TEFA 4Q58C 4RMQA 5BXFA 1JPSL 3DX6B 2Y1ZA 5E70A 4UM9D 3L5XH 2YQ3A 1FS0E 4Y9FA 4P23D 4GI6A 3LEVL 4R4FL 2JO1A 2F08A 5DHMC 4ZZKA 4KUCD 1WF5A 3S97C 4HMEA 1VENA 1PGRB 4Z7UE 3QEQD 3TV3H 3D4ZA 4XPBL 1YJDL 1TTCA 3ATEA 1LEGB 2JXMB 4P8QA 3DYOA 1PKQE 3VFSA 4FNQA 4L4VB 3LV3B 2PR9A 2WXIA 4JQIH 2ZKXA 4S1SH 2KERA 3UC0L 3N0PB 1R5LA 4QHPA 2IPTL 1Q2NA 1CFQA 4HIQA 3RTQB 5ICYA 1P53A 5FK9B 2RACA 5ENWA 2F7QA 3H0TB 3NUKA 3ARGC 4AYID 4JE4B 4NM4L 1FBIH 3HRZB 3MJ7B 3P4OB 4R8WH 3STZB 4DESA 1DSFL 4JFQA 2FJSA 2OJZH 2WLLB 3UABA 4DIXA 2FD6H 1C8QA 6TAAA 1DBKH 3MCYA 3AEDC 3CFJB 4ZMOA 3Q6FA 4XMVA 1RURL 5FWRA 4EBQL 4FDWA 7PAZA 2ENQA 3US9A 5CF3A 2HG0A 1T3FB 2XPYA 1XGYH 1X79B 1W8EA 2YWYA 3GMRA 4HCIA 4HA1A 3ZDXE 1BYNA 5EU6D 4HH8A 4YEEA 2FX9L 4TL4A 4F7EA 2G5RA 1WPCA 1Q0XL 3UDWC 3ARFB 1FZEA 1JGVH 2CLZB 3L4FA 1HCYA 1QRNE 1QYGL 2KC0A 4PY8I 4XP4H 4Y1AD 5JIIA 4WU7B 2H0EA 4PS4L 5AOJA 3RWIA 2RMNA 3UACA 4WUUE 2B1HH 4RBPK 2VIRB 3MREB 4G8AC 4X5PA 2VWEC 1KILA 4LLYB 3QUHA 1OSZB 1P4IL 2WPVB 1N7SC 2EICA 3ILPA 1HCZA 4PI0A 5BUAA 2IPUK 1CG9A 1KLFA 5BU5A 1AKPA 5GGUA 4OJEH 4ZTOL 4MNHA 1KQLA 4FMFA 2YJLA 4M8QA 4UIMB 3S48A 3US1A 4EPSA 1OVRA 3M06A 2IH8A 4DZBB 4RIRB 2X70B 5E5UB 2LXCB 5LHDA 3NN8B 1Q1PA 4Y1SA 1V3MA 3ZSTA 3OKDB 3LXAA 5DJTB 1NL0H 6CGTA 2XV3A 5H35B 2XSKA 5EDXA 5F7NC 2DLFH 5D7SH 2ITFA 4PJHA 1NUGA 4I18B 5CJ4A 3RAJL 3R8QA 2IV8A 2EO9A 5IM7A 1CYXA 1OB1B 3GQFA 1KIPA 1WAEA 2WPSA 4PG2C 3EYOA 4W9HC 3LW5H 5AYQA 2YOCA 4GYBA 2J1WA 1ADQH 2PW2A 4LBEA 2V7NA 5ERWB 2FZ3A 5HY9B 3NIGB 5CMAB 4FG6D 5L7XL 4MAZA 3MRMB 3G04B 5HHMD 3DIDA 5C0CD 3LQZA 4OCLC 1I7UB 2JKWA 5J8OA 1MW0A 2AEQL 2H32B 2PWEA 2WWKO 2X0VA 4EEEA 5I8EB 3ZYZA 2PPCA 2JKRM 4X83A 3LMJL 4BSVA 5BS0D 2ENYA 3EDJA 4NT6B 1E8XA 4URTB 5DT1L 2OJEA 4XWOC 2CDFA 2XY2A 1NPNA 1W72B 5JO5B 1NTZG 2B2XH 2ORBH 2ZSWB 4LBAA 4OCYH 2GIXA 4JDEA 5GGQH 1SDDB 5D2NA 4ZMPA 3UIYA 2J73A 1PD1A 2J56A 1FNAA 4R2GB 4HUXB 4LDLB 3V0GA 3SPCA 2YKLH 5EZIH 1RLBA 1XCWA 2VDML 2XN9D 2X4TA 3D08A 3DETC 3O0RH 4A2LA 1I8UA 1ZKAA 3BKYH 3MNZA 3K1KC 3A0HE 2DD8L 2R0WH 3K72B 4HEME 3RUGF 2GEQA 1JSYA 3IF4A 4WVRA 5AVXB 2DQTH 2HJFA 5IJKA 3GTVA 3CDZB 3AS0A 5T1DH 3QDJB 4EI6A 4MB1A 1AVYA 1M6OA 1E2ZA 2XXCB 5DXWA 1CFNB 3EJSA 3ESVF 5LCVH 4KMTH 1F02I 3KPQB 1PX8A 2V9UA 1MW3A 4LLWB 1A1NB 3L71D 1HOCA 5HHVL 3VXNB 5C2BL 4XMTA 3OKEB 3HA0A 2Q86B 3ARXA 2ROYA 4UBDC 4TLTA 2XN0A 4UT6A 3ILQD 5A2CA 1GMJA 1I3RA 3OPZL 3STLA 4M7LH 3UYRH 1SOXA 3DO4A 3HG1E 4TQ8A 3HE5A 1YZZA 3BXNA 2FSEA 4B6ZA 4WFGE 2EILB 1GU5A 1M1JA 2JMRA 3CC5A 1QR1A 1MQKH 3SB3A 2PUQT 4N2CA 5D7IF 1AHWB 4Y4FD 1UVQA 4JFYA 4AGOA 4P2OA 2L5GB 3H1LG 3FSVA 4JJ5B 4E9VA 2CHDA 4ZRGA 3D48R 3MV9A 2ARJA 1JZHA 2F2HA 4JHWL 3MZWB 1JK8B 1HQRB 2ZOOA 4FQ1H 1WT6A 4TNVF 1KULA 4P2RA 4LE8A 4NN5B 1QL1A 4Q6IB 2JEEA 1FUNA 3CVHH 5CLTA 3ZLQC 5MEOA 3GHBL 3KXDA 4FI6A 1PFCA 3ZMEA 3FOLB 1CI6B 4ZJ9A 2WW8A 3OM3B 1DO6A 2NSQA 2UVFA 4TM9A 3ZN6A 2EEDA 1RUPH 3TFBA 2IDFA 3C87A 2WSFH 1LD9B 3BH8A 2FL5A 3C8HA 5PAZA 1SQVE 3L6FA 3VXQB 5IW3A 4Z78A 3TYGH 1DX7A 5EPMA 4CBPA 5EZOL 1J86A 1TU2B 2JTDA 2WWMD 3V0FA 3VXME 5JQHC 4MCMA 5KLVJ 2F53A 2UY6B 2WLMA 2CO7A 5ID1A 4I88A 4LSTL 5T1KD 5CN1A 1QG3A 2YSSA 4NQXB 4XPTL 1A4KB 1BBJA 4FQ2L 4R7XA 4K8RH 1IB5A 2GUOB 1RULL 3U4KA 1U8PB 3X13B 4MAYD 1CFTB 4TVPH 3NJNA 3I75A 3U46B 3BFQG 1IGCL 3DJRA 4GUQA 1NDTA 2YXRB 1A4BA 1OSPH 4FLRA 3GF8A 4FFYA 4NZRH 5K1NA 2HFFA 1NTKD 3TGUE 3H3PH 1J1DB 5DJ0A 15C8H 4KX9A 4CVZB 1XCQB 2DQFB 2VW7A 3O6KL 4TTDD 1FJKA 1QFOA 3W9DB 2VQTA 4NQEA 4DTGL 3BDYH 2EXYC 1U3ZA 4U1GB 4ZW7A 3HN5A 1II4E 3APFA 3N41B 1C08A 1G0YR 3GSUA 2DQEH 3NQKA 4LLUA 4OZ4B 4QRTB 1OTSD 4XMKH 4CGUB 1E28B 1HXKA 1T89A 3R0MA 1UIXA 3ELAT 4HUCA 5E94B 3PJSK 2FEDD 1TTUA 5BUGA 2QQLH 1LWJA 3KWWA 5GGVL 1MREH 1M42A 1R34A 2X6VA 3RJQB 3CU1A 4TQEL 5DVKA 5J13B 4FN0A 2LU7A 3DVGB 1FZCB 4R90L 1WIPA 4KPHL 5A6LA 5CWSB 3WMPA 4M93C 3EYSL 2JK5A 3PL6A 5J4MA 3BPOB 1QO3A 2HWZH 1MAKA 5IWLC 4XVSH 4GP5B 4AIEA 3S3JA 3RK3B 1JGDB 3EBGA 3SCMB 1M56B 4NWUH 1NC2B 1EZVD 3EF7A 4C56A 4QXGH 4Y2NA 4L3EA 4HKXB 5JYLA 4AGNA 1W0WA 1K9MQ 1IAMA 3I9AA 5HYEA 1KCWA 5FM5O 2ZQKA 5DC2A 3IN2A 1B2WH 1BCCG 3L7EA 3V4PH 3AT0A 1TJHH 1U8CA 1YY8A 2KBGA 5CIPA 3T0EC 5EOCL 3HN3A 3VFNB 3QCVH 4PW9A 1NJ9A 4UV4H 4WUKL 5CEYA 3UBXI 4OF6A 4XH2B 1G4MA 4XO9A 4FFVC 4CVWA 4FEMA 4ZPVB 3DHUA 5D7LA 2E42A 3WFHB 1GTNA 2DIBA 1BFOA 3SDDD 4K3EL 3LN5B 4DVBA 3MRPA 5AYUL 1ZGLP 2BOCA 4XMXA 2JLPA 2GYSA 3D5OF 3QRBA 3SWKA 2FT8A 4ZUUA 3T3PF 4NENA 3ZW3A 5D1ZA 4JANA 4MQTB 2ZOKA 5D96B 2QT6A 1JZ5A 2OK0L 4XMPH 4FNRA 1UCBH 2A38A 2DQJL 3SGEH 2R1YB 5I6NA 4OV5B 2E7HA 1DQIA 4G43A 1IC5H 1JY3N 5LKNA 4YBHA 3CU7A 4N0FA 1O6TA 4PJ9D 3BQUD 2IH3A 2CGZA 1NBYA 2AP2A 3CI9A 1Y18B 1XL4A 1KZQA 2UUDH 3DGGA 1DH3A 1OGSA 1EJOH 2CMRL 3L3OC 3NP4A 4K7PX 4N4YB 4WW1B 4WY4D 6FABH 4UT6L 5FWQA 1DE4B 2Q8AH 2BY0A 1GMEA 4M56A 4NWTH 2XIDA 1A7RL 5ESVB 4TSAL 1NFIB 3BD3A 2BCCE 2PXYB 1Y6MR 4JZOA 4DAGH 2I60H 2EC9T 1Z9SB 5IW6B 3HG0A 4OCRL 4JBSA 2OTUA 1RMFH 4LLMB 2KKQA 2CPUA 3OV6A 3BLBA 3OZ9L 4MMZB 4Q14A 2ETWA 3WUVA 3L5WA 2VRQA 3QQ4B 4OGAD 3ZY7A 1J87A 4BELD 1QLRB 1G1IA 1RU9H 4PJHE 3T65A 2YUXA 3WFEL 5DD0L 2KUTA 5G5DA 4WNSA 1BDYA 3DPDA 2NYKA 2HAZA 4AWJC 3GZOA 4JE0A 3IPFA 3T0VA 2XWTB 1U2HA 3FFDA 3TBVB 3OZLA 1TJGL 1GZPA 1HH0A 4LVNC 4PY7A 3MBEC 5DUMH 1AANA 1UWGH 4GBXA 3CPLB 3PGDA 4QLWA 2VOTA 3BRDA 1BE3D 2EYTB 4WHCA 1H3UA 2DQGH 5J12C 3TPKA 4XBEH 2VAJA 3WHXB 4OF3A 1DBJL 1FL6A 35C8H 3ARQA 3LPWA 4UIKH 4V2CB 3DX2A 5IP4A 1YN6A 4P4KD 5GRUL 4XP5L 1T1WB 2X2YA 4OZIB 1L0LD 3H32A 4X6BA 2BVEA 1IVTA 1G1CA 1OGPA 3NZHH 2R23B 3D39B 1G1JA 3BWAB 3MCKA 3PWJB 1OT2A 5D2NE 1QUNA 4KKRA 4F2ME 5AW7B 4Z1PA 1X5XA 1GZLA 3V4VB 1NTZK 1S9KC 3ARZA 5C6PB 1CGSL 4NUJB 2AEOA 2GIYA 2D0FA 1U8HA 5G55A 5B3JE 2R4RH 5E6YA 4HQQL 3QG6A 4YTPC 4EQ2A 5IB2B 2NW3A 1H3XA 4FFYL 4X9GA 4YVNA 3WN5A 3S5LA 3S36X 1SQQG 4Q4IA 2IGFH 1ZS8A 1IGYB 2UZIH 3KW8A 2NR6C 1VL2A 1F8TL 5FCSH 3T4AB 5I6OA 4GQPH 4QUOA 3HHSA 4KJMA 4IU2B 1KIQA 1RUKL 1HGVA 4MLSA 4MXVE 4XCEA 4AL8C 3VXUD 3VI3F 4PRAB 4Z7WA 1YC8A 5I28A 2L0DA 4LASL 1KGCD 2XKUA 3Q5YA 3HUJF 1E3XA 3NA4A 3VJ6B 2YFOA 1PG7H 3DUUB 4HIXL 3K2UL 1MDTA 3KYAA 4OFYD 4DEUA 1NCOA 4D0DB 1G7HB 3RTQC 2GJZA 1MJJA 4JKNA 1GL2A 2AABL 2BP3A 3HLAB 1INDL 1KIRB 5A2AA 4YL9A 1JMXA 3PG2A 4J7RA 3HKZA 4G7VH 1UUNA 3HRZC 2HTKC 1B0GA 3QJHA 1FA4A 3AU0A 1U8QB 2H8PB 2QKSA 5C09B 1AZRA 4PLNC 4YSQA 1ZAGA 5EZLA 5HHQB 2M26A 3MV9E 3QWOB 1KBPA 2POHA 1KJ3L 2H9GA 2KDGA 2WBWB 3GF7A 4ZZFA 4G7YH 1FNSL 1SQXJ 4J3UA 4JFZL 2E4FA 5GSVB 4F93B 3TNUA 4LGDE 2I27N 2KZWA 3O6FD 3QHZL 4RGMB 4UZUA 5GGTA 1KLUB 1K4DB 3B43A 5FHAL 4YXLH 3ARFC 4RGND 3IMBA 1QL2A 3NAAH 3S88H 2RH0A 4IKIA 4ZOEA 3T3MB 4CU8A 3CZLA 4XN8A 5JR1H 5DDHB 1RZKL 5E2VH 5TDNB 3RWCA 2WXJA 3EZJB 4FTVD 4KQ4L 1S9WB 2GAZA 3B7SA 4LF3A 2GY5A 1BHGA 4MYWB 4U1IA 1MWAL 1REIA 1VF5D 4PWHA 3QQNA 4FL4C 5KLIB 3FPXA 1RVFL 1PX3A 3PWPA 1V8HA 5LWYH 2MHAB 2E7DA 2VDNL 4HJIA 4HT1H 2DQIH 1AO7A 1PY0A 2QSIA 3TK1A 4Q9BA 5ILTL 3GB7B 1PS3A 2GTZA 2QGCA 3OMNB 4KVPA 2G3ZA 4MRCA 2ADIB 4PY8J 4DGYH 5BQ7B 5C3LD 1VCBC 1IM3A 1RPQA 2HB0A 2VUYA 2CKBB 4P23B 3ZE0F 1HYSC 5FO8A 1OVUA 5FF6A 1K5NB 2V2TA 1CZ8H 2KQMA 4QHUA 3GMOA 2UWEA 1TUPA 1KV7A 3QEQB 1KCRL 1YNTA 2N0MA 2WIIA 1JZDC 1HGZA 4OD3L 5IQNA 3U0WL 1JYVA 3P8CE 3GZKA 5E2JA 1X5JA 3U6RB 3BP6A 2ZYDA 4RDBA 2Q7YB 1G0DA 5D8JL 3WGVB 1WA2X 3REVA 1C12A 4F58H 1JCCA 1H8LA 1K8DB 4N9GA 1B4RA 2HYNA 2WCSA 3GXIA 1F90L 3QRLA 1IL1B 1JTHA 1NU1E 1G7PA 1FAKT 1NUFA 1PSKH 1L7IL 1KDIA 1XH3A 3BJ91 3BUTA 5E6IA 4P05A 3U1CA 2GEEA 3QO1B 4JRYD 5DUPL 2OMXB 1HILB 2H45A 1QBMH 2V7QJ 1DVFD 1TEYA 4JQVC 4NKOA 4GAYB 2QGBA 5EO0B 1CLYL 3LD8B 1DQML 5FR3A 2NY5C 4XZUA 3H7LA 4DVRL 1X5ZA 1I1RA 5IMKB 4E9WA 3ULSA 3MLZH 2FLBT 1OTTD 4K4KA 2YPVH 5EULV 5F9OL 4K3DL 5DFAA 4ZS7L 5GRJL 4OFVA 3TBBA 2CLRA 2WK2A 4R2GC 4POZC 4RWYH 2KLVA 2GJPA 4YK4B 4ODHH 4RMWA 4Z3FA 3GO1L 1AJYA 4EE2A 1T0OA 3PU7A 3Q2LA 3ZTCC 2DJMA 3GRBA 1S4IA 3E8VA 4XC1H 4L3EE 4M9OA 1BEYH 3MV8E 4XVUD 4YHOH 2VDLL 2AK4E 4NC0B 2ZOTA 3U9PL 4G9FA 4BCZA 2RAMA 4GKSB 3FF8A 2NW2A 1LEKB 2YGNA 3WKYA 1UATA 1V5JA 2P24A 1PKOA 3ZE2E 1DEEG 1JGLL 1KYAA 1UFUA 1FL5B 5AB2A 4IEFB 5DVLA 3OC8A 4TULH 4J8RA 5SWZA 3RRQA 2CWRA 3HC3H 2ZONA 4JDVB 3FSOA 1CBVH 4DCQA 5I2IA 3LDBB 3EOBA 3I6KA 4MXQC 3KYMA 5LBSA 1HHJB 4RAVB 5FKAB 1NTMG 3U4BL 5GS2H 1ZT4B 3VMAA 3LKPA 3KG5A 5KJ7D 4AMKH 1LVEA 2IPKB 1AHWC 2C4FU 2MEJB 3Q3GA 2CO3A 4ODUB 3TT3L 2HJLA 5DJ2A 3ULUD 7PCYA 2FBWC 1GMIA 1WFOA 3FK3A 3UCRA 3RI5K 3AEFC 3SZKC 3MRFB 1G6RH 1F42A 1YEKL 1SFCB 2P52A 3QZNA 4PJ7A 4PGEB 1XXFC 2CBTA 3KCWA 1KCUH 4NN5C 3ZK0A 4JW3A 4Q6IC 4NZFA 1HDMA 3V0HA 2TSAA 4G1MA 4MDJA 2QPDB 2OW7A 1G9NC 1PP9G 1HXYA 3T2QA 2WYHA 4LCIH 4R97B 5IBTH 1YEIH 3T0AA 4LCCA 4PJ6A 4WK4B 3KDPB 1TSHA 4EUPA 3P9MA 3VYIA 1EXJA 4M03A 5ALBL 4ELKA 3NSDA 5IEHA 1Q0EA 1MCFA 4MB4A 1YG9A 3RVVC 3EQ2A 2AXGA 2VO5A 5TJWK 1OP3K 5KJRL 3WEXB 4LKXB 3WD5H 5C0JB 4XTRD 4XXDB 5IG7B 2LE9A 5AW0B 3F7LA 2J58A 1KFAH 4M43H 4Z6AT 1A6WH 3MLVH 3VUAA 3MYZA 1E4HA 4YSPA 5EUOB 4WAFA 5TPWH 2BMKB 3H1ZA 3RPBA 4LLDB 3QUMH 5GPRA 1S3RA 2Y7QA 3CPUA 3FUIA 5GGTL 2Y5QA 4X0KB 3VXSD 3ULVC 8FABA 4KZ0A 1BXXA 4XPHH 2E5TA 1HT6A 3EGXB 3LB6D 1FZAA 4NQDD 3MR9B 3HE7A 3W0WD 3ISRA 2A77L 2ADJA 4KI5E 1J1DC 2WM0A 3Q0HA 5D1QA 2D0HA 1UM4L 1TTRA 5AQ0A 4NRZA 2HPCA 2HT4C 5DJZA 2OR9L 1IBZA 3FFOA 4W6XB 3VI4A 2TRHA 4HUUB 3OJVC 2JWAA 4PJCB 5I1LA 2YGOA 3K0YA 1VQPP 3X14B 4XOAA 5B39A 5CM1A 2OW6A 4CC1A 1N73A 2VMFA 3NRPA 2APTA 3INUL 3ZTJH 3CC1A 1E5CA 2NY4C 2K9YA 4YPGA 4PRPD 2PKDA 1VQ8P 3KPRD 3VX1A 3Q3DA 3GKWH 1BF5A 1T2KC 3GLZA 3QH9A 1R3HB 1TLKA 1TNNA 2NPSD 3TIEB 2WTPA 5IW1A 1U21A 1SJMA 3L95B 3OD3A 5D1ZI 3DX1A 1FZCC 5J13C 4GLRH 2CBPA 4NZJA 4FFZH 4KH9A 4I7ZC 5E8EB 5DZLA 3ZUCA 1XGRB 5IR1B 2IZ1A 4A7GA 1QLED 2H88C 3ECWA 1XCXA 1PCSA 3BPOC 3TOPA 1SQQK 1YN7A 1G7QB 4PJXE 1Q90D 3S2AA 3CMGA 1MFDH 3RK3C 3ETTA 1UM5L 4MNQA 3UYPA 2EIDA 3SCMC 4X4MA 3KL5A 2ZWNA 2OYPA 4X98B 1SY6H 3D6YA 3EBIA 3WYRA 5KW9H 2R8SH 2OCJA 1PFOA 1QBLH 2G5BB 2N0KA 3NCJH 5IVZA 2O3JA 1DYZA 1W6LA 4JKLA 1XT5A 3NIGF 1OM3L 2DL2A 1ZV9A 1JK9A 3FHQA 3HI5H 2P67A 1GGIL 5T1KB 2HKFH 2Y0EA 3LQMA 5CBEA 1GSMA 1HN1A 5BVJB 4LSSH 2Q9OA 3RZCB 2F1BA 1FZKB 2FT7A 1X7QB 2EDBA 5IOPA 4MAYB 1OLLA 3TBYB 4FI8A 1IZKA 4I3SH 4K23L 2DYPB 4U0QB 4BXSV 2O6FA 4XP9L 1NSNH 3VXRA 3IETA 1U93A 3EBAA 4L4TA 3GMQA 3QK0A 3G5WA 1HBWA 4YZWA 2A4CA 2XBDA 5FGSA 4AGMA 5KTEH 3JVGC 1OAXL 3VH8B 3UZVA 1FORL 2ZCKL 1I4FB 5IQ9A 1FO0A 3V0WL 1QQDA 5ISZD 5D96C 1D5IH 1SQVJ 3RWDA 4EZKA 1FRGH 1FAIH 3ROOB 4E42A 2WVVA 4APXA 2Z91B 1A25A 4RFOL 5FS5A 4D9RD 2WAQA 4J39A 3ZGIA 1QFPA 1NAMH 1S5HA 1FN4A 2ZCHL 2P5WE 3L4CA 3MUHL 5EU3A 4R96A 1GK6A 3S35H 3FQXA 3V5KB 1AQKH 4PQXA 2D7QA 3WELA 3VMZA 3PWPE 3DO7B 1L9QA 4EI5A 4HF5H 3PQYD 2NRGA 3F5HA 3SWFA 1ZXQA 5LBSL 5IBLC 4DPRA 1AO7E 5CCHD 1TJIH 3LZNA 4MYPA 3VACA 12E8L 2ZP9A 4G5ZH 1L0NE 2COQA 3THMH 4DT2A 3TGUJ 1DTUA 3KH3A 2WKLA 3BGMA 3M17A 3EGSB 1NCCH 1XF4A 3LYRA 4PGZA 4XMWA 5DJXB 3SDYH 1JY2N 1CFVH 4MCNA 5DTFB 1Z7JA 3UZQA 3BT2H 1IK7A 1E43A 1W8OA 2VDPB 3IGAB 3IM1A 4FJ6A 2UWEE 4N0CD 4MMZC 4ZMNA 3FFCE 4Q2ZA 3QNFA 4P2CG 3G9AB 4HEPA 4GINA 5KVFL 3HN8A 3GZPA 2WBXA 4BV1A 4PMFA 4TXVB 1H6TA 2ATAA 1GW0A 3ECUA 5KUKA 2ESVA 2XVBA 5FYKL 3RGHA 1G2CA 5CLWA 5IIEA 2VAAA 3H7BB 3MLTB 4L05A 2Z0BA 4PGBA 3BZ4A 3G6JE 2Q2EB 3MXVL 5E0QA 1SEBB 2QQKL 5HVHC 1EFXD 3Q5OA 1WT5A 1C5BH 1R46A 5CCJA 2LV4A 1NGWA 3BVDB 5HHOA 3BZEB 2BNQA 1FH2A 3FHEA 3BEWB 3MXWH 2CH8A 1AGFB 4HH9A 3U0TA 1VPCA 1EBAA 4NKQB 1XGQA 1HOEA 2F54D 3PRZA 3MLXH 4X7SH 2I5YH 4XRCB 4QT5B 2C9RA 3R4DA 4OV6F 5BRQA 5GJSL 1Q9WA 4X7CC 3M9QA 3RNQA 1CIDA 5BJTA 2R2BA 2I1KA 3LKRA 5B4MC 3T6ZA 5L4FA 3B6SA 1KJ2A 2XPGA 2Z4QB 2PO6A 3GMMB 4HGWB 1FVCA 4KHTH 4YZFE 1L9NA 4FHJA 4J3OD 2HVKB 4MJ5A 1CL7L 1U8MB 4PYGA 4S0TD 4OLYH 3T4AC 2A6IA 5LXGL 2CALA 1FZOB 4G9FE 4OCMC 3ULVF 1BDDA 4Y2DD 4OF7A 1QA9A 1FG9C 5C07B 2H4EA 3JWDC 5IY5B 2VXVH 4HWZA 2GK0A 3QP3A 3MPCA 4AQ1B 2J2ZB 4IOFC 1BZDA 5E00B 2WZPA 5SWZE 4F7MA 3GTTA 1LO0L 4N2LA 1N4XH 2UYLA 1FVDA 2YC1B 4LRIA 1SM3L 3II2A 1EJ6A 3G6EP 3B5NB 1CE1H 1JUNA 4A2FA 5DK0B 2Z3FA 3J7HA 3MHVA 3NCYP 4OLWL 3GF3A 3S4SB 3K71A 1R5IA 4KRNA 3HNTL 1WCQA 2QZ5A 3NJVA 2OCFD 3N41F 1OCCB 2IBZX 1AXSB 3CXHH 1KB3A 1AD9A 3EHBD 3ZOAA 4D7PA 1QI3A 3VA6A 5HGDB 3MLWH 4WBAA 2DJSA 3IDGA 3PWVA 2OTWA 3KXFA 4PJFA 4M62H 3OWRA 3P11H 3PXLA 3QEGH 4HS6B 5DJYB 3QWOC 3QA3A 4KJPD 4PJ7E 3U30B 4I0PA 3RPIA 5FM4A 2DBLH 1IEAA 1SDYA 4F9LA 2FECL 4LSQH 3L74G 1PLGL 5J6HA 1N8ZB 4UT7L 4RGMC 4LVOB 3WFCH 3RWEA 3U25A 1I85A 2CJUL 1HVVA 1I1FA 4BBWA 1VA9A 2BCCJ 1JWMB 1OAZL 4NKIL 5IOKA 2ICCA 1QZNA 4P4KB 2W9DL 3NIFF 2IAND 3DX8B 5TFSL 3RGBA 2CDEB 2VZOA 2Z92A 1IGJB 2Y3NA 2XWDA 1JMZA 4X7FC 2O1KA 4UNIA 2K6ZA 2D03L 4U1SB 1Y9BA 4YVUA 2FHBA 1F1DA 3F12A 1DBBH 2XWZA 4YIQA 3DC0A 5E51A 3ZDZE 3SOTA 3IRZA 4O4YH 4E9XA 3QYNA 3BLPX 5GGVY 5ITBH 1E90A 1U3HB 1X5YA 2VSDA 2FQFA 4WEMB 5FYJL 2RKLA 1XR9A 4AGLA 2NX5D 4EIBA 2VLJA 2A9NL 4P23C 4YDNA 5AVUB 1FO0L 3APDA 3EDFA 1JF1A 3U4AA 5F7LB 3L5IA 5EOCJ 3F3HA 4LNRB 4Y5YB 1QSEA 2FJHB 4X6CA 4FQXA 3SD5A 4C8XA 2FYYB 2YD5A 3ETBF 4U1MB 1J1PL 2B16A 4ECNA 2A9BA 3FUJA 1HHKB 4K5PA 5HDQH 4PVNA 4E0RB 2R0ZL 1RQVA 5EO9A 4K7PL 1RF1B 1SJXA 3PS6A 3QBTB 2J8UB 4MVBC 3VI4E 1PPJD 3F84A 3A47A 3CSTA 1T2QL 3ZHLA 2L7QA 4CSSA 1AD0A 3ULAB 4M1DL 1C1EL 3LCYA 2CAKA 2Z31A 2Q3EA 1XF3B 3ASWA 5EORH 4BSWB 4YMPA 2BCKA 5FA4A 4I9WD 2OTKE 4D6TD 2LU3A 4BKLA 1RIUH 5CJQH 5IEKA 1VACA 1YEJH 4HK0A 4AIXA 4PBDA 1J9QA 5AZ2H 2NUPB 2BASA 2Y7SA 3FT2B 3U7YH 2BVOA 3QDMD 3MRHA 2IJ0C 1GC1H 1UOKA 4FLOA 3LD8C 4TRPL 3H1HE 5E5MA 5TQ2H 4AJYV 2G2RB 2P7TA 1DR9A 2ZF8A 1N9PA 3O6FB 4PREB 4A68A 3ATDA 1ACCA 4IRSA 3QXAA 3U7AA 2O5XH 4FS0A 4FZ8H 3JTTB 5SX5K 2VZ3A 2XICA 4FQLH 3CBJB 1L5GB 4YK4C 2VLMD 1WITA 4G1EA 4CDHA 1L3WA 1FIGL 2QRXA 1T4KA 1IEBB 1QW9A 1RZIA 3HI6H 4X4ME 1J1XH 3SKMA 3IDJA 4UAHA 2DLHA 3QUGA 1KB5A 3BCCE 1KB9E 3ALPA 4FRWA 5D2LB 5HHPA 1NCIA 2BH0A 2A4EA 4X8CA 2IOIA 5EFWB 2I32A 3GSWB 3MO1B 4W9KC 1LT9A 2HODB 1BJ8A 3MKGA 3MCLL 1HAWA 3AXHA 1IILE 4HHAA 3D6ZA 3CUPA 3QSKB 2WXLA 2CK0H 3N04A 3VFUA 2OYHA 4DHLA 2BZ7A 3GHEL 4JHAH 3HAEB 3WLBA 1M90Q 4HLJA 4OZIF 4XOCA 3U1PA 1KCSL 1G4RA 1ZLWK 4AMWA 2NY1D 1KJ2L 1KB9K 4UDUB 4JG1H 2ZUQB 2YQBA 4WFHE 4E41D 3A22A 5BRZA 4D9QD 2FATL 1MFCH 4G71B 3VB9A 1LE5B 4BINA 4CJ0A 4FQIL 1JZ2A 4AGPA 2EIKB 3EJTA 3JSVC 1PZ2A 3O6QB 1CL7I 5I6XC 3C8VA 1UG9A 1SFCC 2FEJA 4FG6C 4A66A 3EOTH 4XCNB 2EVGA 3K46A 4FXGB 1OF2A 3P9LA 2WQAA 4JRYB 1NO4A 2NY6B 2QSCL 4L8CA 3JWNE 4ZAKA 3TJPA 2IH1A 5E2WH 1DVFB 1S5LX 1ZVYA 2P8PB 1J05B 3I2CH 4KMLB 4UF7C 2XU6A 4R97C 2WN3A 4U1JA 2JCCB 5KANG 1KN4L 3VRJA 2XTSA 4C4KO 4JFFD 3IDYB 1DP0A 1MIML 2VXQA 3FQRB 2O1JA 5FKPA 3KWUA 3WG7B 1XL6A 3ZT5A 2CJ3A 2BVQA 5MENA 3WNKA 3HOGA 2VITB 1MIEH 4I1NB 5CJ5A 4TT3H 1WFMA 2TRYA 3U59A 3U4EA 2KQNA 1A0QH 1IV8A 2VR9A 5FK9A 5CJBA 1F5WA 3EO1B 4E5XB 1FGVH 4QIRA 5CU9A 2ZUUA 2PABA 3CFKA 1ZANL 4UTAL 2B3IA 4CAGA 1OAYH 3NCMA 1IFDA 1NU1J 3P4OA 1J5CA 4HB1A 2ESVE 4H20H 2VJ0A 4PD4K 1JHLH 5ACZA 4JY4A 4KUZH 3NSYA 5T3ZL 1SXAA 1GJWA 2Q3ZA 3CFJA 2JKJA 3IJHB 4MJ2A 5JPNC 3U0PA 3VYOA 4L74A 3AE9C 4PB9H 1B0RB 1T3FA 3N6YA 3UH8A 3GS0A 5L4MA 3D18B 3B8SA 1N6UA 3KYKH 3G9RA 4B96A 5HHOE 2J8HA 2BNQE 5BNXD 5GGSA 1KB9I 2E5YA 2VC2B 4X9IA 1T1XA 1UWXH 3T3MF 3MMEA 2VERN 4DN3H 2PYED 1OGAD 4WU7A 4HZAA 1J0KA 3U82B 4B9YA 4GKNB 2ED8A 3CLFL 1JPGB 1U4EA 4LC1A 3QNXA 4LLYA 3N4XA 4Y4FC 2OMZB 3O8XA 5I17B 1T4WA 1BXAA 2NNAB 1KPRA 3UJTH 1HSBB 1QBBA 1QHQA 3D8MA 1SXCA 3G08A 5C0IA 2AJZB 4N0RA 5DO2D 3PV6B 3WUZA 3RVXD 1FZMB 5B1JA 2Z0UA 4I3RL 1V7ML 3Q43A 1BZOA 3H42L 3X11B 2EADA 3NN8A 4ADIA 3VWJA 1ZR2A 1F3DJ 2WLKA 4UQIM 3S37H 1URZA 1OE3A 2H3NB 4H0IA 4QMEA 3GHGC 3AY4A 1A7NH 3QZBA 4ZYKB 2X4UB 3BP5B 4KUCF 5JIPA 1A1OB 2JJSC 3HC0B 4IHOB 1CUOA 3P77B 4G6JH 1D5RA 4S1DD 2IDQA 4I18A 5F7UA 1P7QA 3BUBA 1I9RH 1OB1A 3IFPB 1S7XB 1VB9A 1CVSC 4JREC 3ARPA 4O51A 3U6XS 1WHPA 1ZT1B 3Q2VA 3B3IA 2WWMC 3MVSA 1H3WM 5GS1B 4DP7X 5KVEE 1NC4D 2X4OB 4IBTA 2BIPA 2M8RA 2AGJL 3TPUB 4X9YA 3TZVD 5GJTL 4JRXB 4NO0B 3HPLB 2XT1B 2L91A 1F4XH 1ZVHA 2ZOLA 4APQD 4PW3A 1HWWA 3RDTB 3N1MC 4MAYC 3OAYK 4OT1L 3NACH 2VLKB 1RERA 3KXFE 4PJFE 5DJ8B 3RIAK 5C1MB 4LEOB 3HNSL 5I1IH 4AEEA 1I7ZB 4NQDB 2X4SA 3CX2A 3QNYB 4NRXA 3U36B 3CN1A 1P2CB 3VM7A 3D3VD 3FW6A 4Q9QL 1E79H 4TTDC 5FYLE 3S34H 3SYQA 3VQ1C 1NKZB 2YD1A 3V2NA 3L3KB 1EAPB 4BDVB 5CJ0A 2VXSL 1KB5L 4PLJD 4L23A 4PJIA 4Z5RA 5ITFB 5T3XE 1LEIA 3NTCH 2GT9A 3KPOB 3GMPB 3K72A 4M5ZH 3WIFB 3C9IA 4LCWA 4Y16B 2FEDC 3IWUA 3FB8B 1IAIL 5T33H 3TT1L 3IJSA 3KGSA 4UQAA 1IM9A 3MJ8A 2R32A 1G7IA 1H8NA 4OWFA 2CIKB 2Q3XA 1RIHH 2XWCA 4XVTL 3UADA 5FCUH 3KPQA 4AX3A 4LKCA 2VLJE 1NFAA 2VLLB 1S7QA 1P4BH 1QLEB 4G9DA 2YMKA 1QSEE 4X6CE 2Y5EA 3AXIA 4YDJB 3UO1L 3OXRB 1VEOA 3Q8AA 2X9WA 3BKJH 5AOKA 3OGCB 2BHFA 1P5UB 1S9VB 1RY3A 2I7OA 1RP9A 4YSRA 3C08H 1AOZA 1PAMA 2RHEA 3RL2B 1ZWIB 4HHWA 1A3LH 1WBXA 2PAJA 2AJYL 2OP4L 4MJID 1FAVA 3CCEP 1HH6A 4PV8A 5IK3A 5T1LA 4WIQA 2IG2H 4QRPE 3HZYB 4WENB 1HQRA 1HZLA 4IKJA 5CCGA 3CG8A 3BMVA 3EYUL 2P5EE 1PG7W 2DQUH 1MCPH 1SQPE 3DGDA 2GBUA 3DA0A 1EEYA 4JFXB 5EBWB 3SDDC 3B2DC 5D6DC 4DZ8B 1WG3A 2VM3A 5C2UB 4ZMXA 4JG0H 3QIUA 3GXFA 1CI6A 5D1XB 3HI1A 3SDXA 2J1ZA 2UZXB 1BGYJ 1RHHB 3GM8A 4UQ3B 1KT2B 4W9FC 4ZOBA 3UJJH 4XB7A 3M88A 2EE9A 3IMSA 1FGNH 1YEFL 3DURB 2JJTA 4EZJA 1XGZA 3KDMB 2OZNA 4LIQH 3WFZA 4XI5C 4YHNB 3LX9A 1YEDA 4YSCA 3O9WA 1TU2A 2R2HB 4G2AA 3EOYG 4PCKA 1QSVA 3SZ6A 3BCDA 3KLSA 4Z7IA 1DSYA 2O6EA 1ZLEA 1X5MA 4LPCA 2GHZA 4YNYA 3NCFB 5DS8A 4AK1A 5B7MA 4NQXA 2FR4A 2B20A 5BV7B 1QSFD 1PGJA 4PJ9C 2HG5D 4MZRA 4AE1A 4FA6A 4UTBA 4HD9A 2QKIB 3QORA 3OAUL 1WAPA 1E8WA 4UZSA 1USZA 1AA0A 4WJ5B 5E8NA 4ZFOB 1KENL 4WO4A 2WINB 1KZYA 2B9BA 3E1RA 1GGBH 4FQJH 4OM1H 3W67A 2KPWA 4DJGA 3HZMA 4AQ1C 4G11A 4WTXA 1KIUB 4B86A 3R7RA 1XCQA 1LO4L 2V2WB 4KKCD 4DKTA 2NXZD 5HHXH 4Z3TA 1P1ZA 3P3SA 3D09A 1TKWA 3A5TA 4ENED 4PJCF 1ZV5A 4E2OA 4XX5A 3RWJB 3Q6GH 1CE6A 4AT6A 1PLAA 5KSUB 3N0AA 4GKZA 2ZKHL 1JG9A 4XMZA 2D3LA 3MA9L 2B4CL 4LP4A 3PNRB 3FRPA 3A0OA 1IO4C 5BRZE 4N3YB 2WQVA 2IBZG 1QLFB 2DTSA 4Z7QE 4TOYH 4L1LA 4WI6A 4PLKD 5M7QA 4HJ0C 5GZNA 3OB8A 2J55A 3S3SA 1EFXB 1Z9MA 1JXKA 1O75A 2H6PB 3RVWD 2FY8A 2X7LB 1L0NJ 1FH5H 5TDOB 3FQYA 3FBQA 3CWBE 4Q9CA 2CZNA 1BDCA 6PAZA 4P4KC 5FW7A 4YXKL 4JKMA 2X2HA 3MGOB 5AW2B 4DUVA 2QVKA 1E27A 4W68A 1T0MA 1KCKA 1VGEH 1Y0LB 4LSRH 2WSCH 5DK3A 3ZYJA 4WNQB 2ATKA 2VDKB 4GRLB 4H8WC 1I8MA 1MXDA 1HS6A 3HG1D 3ES6B 3RY6C 3FUEA 3MRRA 1IJDB 5MERA 4OIIL 5ES4B 1YQ4C 4N6RB 1R3KB 4OCXH 5FUZH 5CR1A 2X4QB 3M86A 4TQPA 1U3HC 4GP4B 3P54A 1CLZL 5DLML 1YEGH 1MLCB 4M6OL 5K59F 1HYRC 2CHXA 3NCWA 4Y2LA 4ZPVA 1UEYA 4ZO8A 4Z7VE 1DQDL 4YDKH 4KFZC 1ID2A 1IUZA 1JNNL 2A9DA 1XTGB 3QJOA 5M95B 1ZA3A 1SMDA 3LN5A 4Y2DB 5KUMA 2HPOA 3GSXB 4JPSA 2H26B 1CU4L 3KPSA 5KEZA 4Y5YC 1NDMA 4JF7A 4UU9B 3SDCD 2CK3H 5E9AA 2A45I 1A3RL 1OF0A 3VP8A 1F4AA 3OB0K 2QFRA 3QYCA 2P3YA 4U33A 1NVOA 2XZQH 4P04A 4OLZH 1RF1C 4AV5A 1X7SA 1NAYA 1IGIH 2WP3T 2IBGA 5B3SB 4OV5A 3ETSA 4HXAL 1URQA 4JPKH 3G7TA 4P5SA 1AVOA 2RBLA 1I31A 3LRGA 1BF8A 1WZMA 2IBBA 2XFGB 4DW2H 3L4TA 1IAII 2VDOH 3VXMD 3C8KB 1NEZG 2WT7A 2Z35B 3H8NA 4KV5F 5HI4D 4PJBB 2GJ6A 3QISA 2W6BA 3SJVA 4WW1A 2YS4A 5FUCC 3VFVA 4I2XE 5I6KA 3HG4A 3N06B 3GMAA 1QR4A 1IAKA 3UX9B 5K39B 4ONGL 3O6FC 2ICEA 3UAFA 1DZBA 2PXYA 4HS8L 4QRUA 2PCXA 3ZE1F 4PRDB 1Z9SA 2HFEA 3BW9A 1OSYA 4HFUL 5JDSB 3I9GL 1EX0A 1S6NA 3QWRA 4JM4H 1H88A 3MFFB 5FA3B 1PNDA 3QQ4A 4ODTL 2BZDA 1G6VK 5KYXB 1N86A 5FUOL 3D70A 3WXWH 2BFVH 4GW4B 4NKDA 5I1HL 3OR6A 1BVNP 4NM8L 2C34A 3BZFA 4B3VA 4CNIB 3SBWC 1HCFX 1NCDL 1S78D 2WSEJ 3M1BB 4UOQA 1IFNA 3PNWB 1M9WA 1HHHB 3BI9X 4IDJH 1A6TB 3SDAA 1MFMA 1G9NL 3NIDB 3FT4A 2PP6A 4M48L 3WKMH 3KR3L 1YYMH 2NUTB 2QVMA 2ILLA 1OY3B 3PUCA 1T0NB 1JMMA 3HG2A 4WWPA 4PAZA 3LNHA 5IROA 4JB9L 1CQYA 3BH9B 3QQDA 1QOKA 1QD0A 1T1WA 2R0LL 1LJ2A 1ZVNA 5DEGA 3BAKA 1ETB1 4PUBH 3PIQA 3AEAC 2ZUQC 4B9IA 3WS3A 4NRYB 4C4KT 2UX6A 3V4VA 1K85A 4DP9X 4OB5L 1A7QH 4HWUA 1XMWA 2VR6A 3BO8A 3QUXA 3E8UH 1DUZA 5EEZA 2D9CA 3QHFL 3MACH 4AKOA 3IAQA 3ULUH 3FQ4A 3OMAB 4FXGC 3ZTNH 2TSBA 3H56A 2WSKA 3AE6C 4LCWE 4NPJA 3ZX1A 4IU2A 4YX2H 2YPLB 4RMRA 2AZAA 1GGYA 5E9DD 1DVFC 2VDRB 1IFPA 3IXTA 5F1IB 3BPCB 5JORA 3GJFA 2MPAH 2KXPB 2G5UA 4W9LC 5ACMA 2J1KA 3VJ6A 5T5FH 5J6GB 3NP3A 4YO0B 1KBGH 4NQCA 3CFBB 4YDZA 5F21B 3M0DA 3F05A 4HJGH 3HS0B 2Y5TA 3PP4L 3GSQA 1SMOA 2BO0A 4GQRA 4K73A 2ODIA 1TQVA 2BDNH 3DK0A 2UX7A 5BVPL 1ZP0C 2V17L 3HMWH 5TE7L 3UTPE 1IIKA 1OZTG 4OUUB 2FYUG 3FH5A 1RZJL 2HT2C 2O93L 4BQ8A 4XVUC 2B87A 1P84H 5AW3B 1ND0B 4FC3E 1FYTB 3US0A 5I1GH 4L8SB 4M9PA 3BPLB 1HSAA 2H2PC 4JFDE 2YZ1A 4IIQA 1LYQA 3N9GL 4XVOA 4CA4A 5HHQA 1KILD 3CFNA 4BFGA 3GIZH 4XR8C 4OZGA 3P0GB 1D7FA 3AVEA 3MBXH 4OUOA 4JPVL 4HIJB 4F3FB 4TNGA 3P0VL 4KK6D 3H1HJ 4HFWB 5EG6C 5CSZA 5I73B 2H89C 3CN0A 5B38G 1OANA 3O3BB 3T1WA 3BIBX 4HUMB 1UGKA 4ZTEA 5DJCA 1F41A 4XNUL 4NFDA 2BCCD 3F00A 5DRXB 5TDNA 3GUTA 2XUWA 1LGVA 5IB1B 1XGTA 4ORGA 5GS0C 3VGBA 4NXSA 1JNLL 1TCRB 5KJ7C 4HS3B 4QRRE 4XXWA 5EF2A 4E41B 2YAQA 1SYVA 3MRNA 1DN0B 3ULUC 1S7RB 4FQHB 2JB5L 3MNDA 4PJ0E 4A7TA 4MTMA 1FNGB 3AU1B 2MHAA 2O5YL 3V7AE 5JMRA 3BCCJ 3UG5A 1U8IA 1KB9J 2DRUA 5AKVA 1AGEB 1JPTH 3LNGA 4OCNC 4Y4KA 3IFLL 3QQ3A 4JZNA 1O9VA 4LRNH 3L5JA 4AEIL 3RL0g 4OI7A 1XCTA 3D50A 4KGJA 1BOGB 3PXHA 1NTZD 1YQ3C 4LAQH 2WXQA 1Z9LA 2W80C 2VLRA 5FX3A 3UTZB 4ZI8A 1FDMA 2ZPKH 4ZFZA 4QHMB 1YY9C 4JDZB 3AT8A 4XN2A 5FHBL 4QLRA 1AIFB 1EZUA 2WXGA 4P59H 1RQ5A 2Q7YA 4LU5H 4OLXH 2J8UF 4ZS6C 5HDLA 5DD5L 4XTRC 2R27A 1XR8A 2X6MA 3T6VA 1JZFA 3WNOA 5GS1C 4BZYA 4ENZA 4UDTA 3Q5PA 3ZT6A 2DKUA 4N8UA 3VE0A 1J8HD 1JOIA 5CILL 5J1TC 1TNMA 4OGXL 3NEEA 2D9QB 4FNLL 4MWFB 3ZHKA 2EXWD 4PRID 4HPOL 1PZUB 4P46A 2DMCA 3P4NA 3U2SB 1U8OA 3NYKA 3QPXL 3CDGA 1NAMB 3LB6C 3L35A 1T83C 3MOAL 4PG9A 1NBVH 4BXVA 4OH8B 3MLUH 3C9NB 3IFNL 4ZX3A 4RISH 4X9HA 1OCOB 2F7OA 2WXOA 4PD4J 1EDIA 1F6AA 4DO6A 5IB4B 4H26A 3RLSA 2DMHA 3HUSB 1W2KT 3X1NA 4K7PY 4C7RA 2F8IA 1C5DA 1ZLDA 3G6AA 4BWUA 2PYEB 1OGAB 3MGTB 4L9LA 2MOGA 2YEZB 1LK2B 4F7CB 3LY6A 3FO1A 3CFEB 2CIIB 1IAOB 2XN2A 4HZ1A 2ZG2A 1GZHA 4JR9H 4OF5A 3X3GH 4GIOA 1BF2A 1DEBA 3L9RA 4Y16C 5EFIA 1FNEB 1JDAA 5I15L 3RU8L 3BVNB 2Q6WB 2IXQB 4ZXBA 3IMTA 4JQXC 5D2LF 2RQEA 5G2NA 2NPSC 3H1LE 1NFDE 2JB6B 4IBZA 4F8PA 1YYCA 1DQJA 3OHXC 3VYPA 4P2OD 1DVUA 3WY2A 4TF4A 3H9ZA 4NUGL 3BN9D 2EYSA 4M4RA 1KYFA 5CLZA 4JDVA 1LTSC 1T04B 1UJ3B 4R83A 3LRKA 1L9OA 3GDBA 4KZEL 4P2RD 4GIFA 4RAVA 3V4VL 3CSGA 4K5MA 4K3JL 1HI6B 3KPSE 2OX5B 2Z8SA 5T1MB 5FOBB 4RQQB 1P5UC 1CXIA 3FU6A 2WHVA 4FD0A 4HLZG 1SN5A 2X6BA 2NSMA 4MX7B 3TBWB 5I23A 1ZTXH 3OKNA 4P9HH 2CGRH 2V5TA 4QTIH 4MHHG 4ZD3L 1TZ8A 4WWKA 5F8RC 5KAIE 3SHSA 1AQDB 1T1ZB 3QZPA 1FZBA 4DH2A 3VFRA 4OIFA 4PGEA 2PLTA 4BQCA 3OAZH 5C8JA 2XX0A 4MA7L 4APQB 2F53D 3TDKA 3RGVD 2DPKA 3Q1SL 4H40A 4D9LH 4GSXA 2GJ6E 4OJFH 4FQCH 4AYFA 2HX7A 3U48A 3O8ZA 1JERA 5I1JL 2JCCF 2C9UA 2VZTA 4X7TA 3IVKB 4R7DA 1OAQL 4JY5L 1OD7A 2P8MA 1RH5B 3DIVA 4I1RA 2HVJA 4N0UB 3QIBD 4F27A 1Q9KB 1WBYB 3W39B 2M83A 1LTJA 4PMEA 1PKQB 5AVVB 3DHJA 4XXDA 2OCCB 5I1AB 4U0RB 5EUOA 2QEXP 2IAMB 1MNUL 5DK2B 3IDNB 5BV7C 3INOA 4LSPL 4HV8A 4NQED 1M8OB 3MBWA 1U8LA 1W2BO 2XHNA 2VN7A 4N8VG 2QKIC 3C60D 3JC22 4N5ED 5JIQA 2APBA 4NAMA 4G6KL 1IC4H 4J5VA 4NQQA 3MRCA 5CCHC 4FAAB 2KYVA 2VL5A 4EI2A 3ZU8A 1IC7L 2ADYA 2EP6A 5DS1A 5IFHL 4JRFA 2AQQA 5GHWH 3F89A 3T4YB 1FPTL 1HWTC 4DK5A 1IC2A 3BRGC 2ITCB 1UASA 5B1BB 3DSFH 2LLNA 4PS3A 3UTQB 4CN1A 1DLFH 3ZDXB 1JZ7A 1FOSF 4PRHA 3B9KB 4R4BB 3C6LA 3PL6D 2YUWA 1N26A 4OIAA 4X6DA 3VD3A 2WSEH 1GYVA 1E9OB 4KKNA 1JWUB 1QRNB 3ABKB 4XP6H 1L0YA 1MJ8H 2NTFA 1GZQA 4ZUVB 5EBMA 3ULUF 4PWGA 2K1AA 4ZOCA 4GT1A 2OTJP 3O2WL 4C56D 4AEFA 2IFMA 1A02J 3DTUB 4U6VH 1BCCE 3OKOA 5F2FA 4PP2A 4ZTPL 2WUBH 4GQ9H 2SEBB 1EXUB 1YHPA 1BECA 2ZCLH 3HS8A 3S2CA 1G1YA 4QJ3B 2KYIA 4OZFH 3WNPA 1KJMA 1RF0A 3CK0H 4HBCL 4NC1E 4KXCA 1T3JA 2ZOWA 2GUVA 2YIUB 5IR1A 1YEHL 3X3FH 1NGQL 1JGUH 1G7QA 5D7LD 1N5AB 3EBHA 3DX0A 4FMKA 5SX4I 5LQBH 4W9ZA 4ZPTA 4NQCE 2BNUA 4GRLC 5L88H 3WIHH 4LZKA 5HGBA 7FABH 5I71C 2XXGA 2G5BA 5DMIL 3TL5A 2DKMA 2CHZA 1UACL 4YDVB 4IBYA 3VX0A 5D1ZD 4KY2A 4XE0A 5AZEL 3AWEA 5F1OB 1XTCC 3DXAA 3V0VB 1WFUA 3H6JA 4ISVB 4TLKA 4ASVA 1QKZL 4J3OC 4DKFL 5C0RH 1QSFB 4PJ8A 4B5ZA 3RZCA 3U9UB 3GJFK 5I6MA 4YFDB 1HEZB 2W65B 3EFOB 2OMWA 1SQPJ 2FYUK 2DYPA 4Y2DC 1HHGB 3K74B 5F1NB 4OZGE 1ACYH 3B7TA 4IOSA 2WSDA 5BMFH 4K9EL 4YHIA 2FT6A 4GMSH 2N59A 1QFWL 5TE6H 3V6OA 2YGVA 1JFQL 4XB3A 1VZIA 2BP8A 4XPAL 4QO1B 2QADB 4GW1B 4LCVA 2B1OA 4WEEA 4YGVA 3FHAA 4WTWA 3C6EA 4HKBB 2R2CA 2WWNA 4R7LA 1U8KB 4Z8FL 4HAKA 2ZT9B 1NTKG 3EH2A 2CO2A 3HVNA 1WS8A 4UCFA 5FGBA 4K3HA 1Y47A 1BZ7B 2XQ0A 1VQMP 1Q0YL 4FP8L 1MFAL 4KI1A 3VH8G 1KEGH 1R24B 4KU1A 4FZEH 1MW1A 5ECJE 4H4NA 5L2KD 3BAEH 3VFMB 2D2CB 3SQRA 4Y5VA 3TNNB 4UOW0 1HUCA 1A1MB 4JLRB 1ZPLA 4KJPC 4P2YA 3BKMH 3IXAA 4S10A 5CP7B 1UB5B 4YFLI 5BZDA 2Y06L 4GAFB 1N5YL 1JD7A 1A6UH 3FO0H 5FO9A 4YBQD 4HK3J 3TO4A 3AACA 1RUQL 1J48A 4HJJH 4I77H 2ZSVA 2IDUA 1K2DA 5E7BA 4BQ6A 5I30H 1IJNA 2BP0A 1RUMH 5HDRA 2GSGB 2E7LC 2UZYB 3SPVA 5AAWA 4MD4A 3N44F 3LTVA 3S9OA 2OSLB 4XAWL 3V0EA 1MDAA 1MVFA 1TPXC 3HG1B 3VQLA 4ERSL 2AJSL 3IJEA 2AJXL 3PDOB 4NAJA 2JVUA 5AVSB 2GITB 2XWXA 2YBRA 3MRDA 1LE9A 3QPKA 3F7KA 3H7BA 3MLTA 3ESPA 1SQQD 4B0MM 1JDDA 3WE6B 3F7VB 3IDMA 4PGDB 1NH6A 2EKSB 2YZ8A 1M2OA 4XCCH 5IHHA 2ITDB 2X9YA 5F9JB 2YRLA 2PR4H 1JZ4A 3K6NA 1MFBL 2BHYA 3MN8A 2CRIA 5HP5A 2VN4A 1TZGL 3DX9B 1FBIL 4PBVC 4JM2A 2XFXA 4WI0B 3BD5A 3GLMA 3CWBJ 2Z6FA 1UWEL 4RSVA 1A7OH 5EU4B 2JKSA 2CO6B 2W90A 1BZEA 2R7EB 2VJ8A 3SDCB 1FDIA 4EN3A 2DN7A 3LPOA 3L73E 4HIIB 4QT5A 3RWFB 1VGKA 2C4XA 2ICWI 1BGYD 5CEXA 1XEDA 5E2UL 4P9ML 3UBXB 4B9ZA 2E9JA 2UVEA 4H88H 1H9VA 5DHYB 4ZFGH 4DPBX 1UXMA 5DVNA 4FEIA 2R1XB 3QPQD 4JQIA 1BFTA 3IBOA 3A6BH 4WCYL 4RX4A 3VXMB 1LNUA 1GL2D 2CG9X 1S7SB 3VGGA 2VKWA 5I18H 2BSTA 5I1CH 5EOTA 1PG7X 2NLJB 4L0PB 3D0LB 5F96H 4MQXD 2PPDA 5MHSE 1KTLB 4D3CH 4IBQA 4C7NA 2WPGA 3B5HA 4MZ2A 4H0LB 5C07A 1RZFH 2CCLA 2I85A 3NFSL 2VDMB 4J23A 1IQWL 3KGRA 5LGHL 3WAJA 1XMEB 4KAQL 4M7KL 1XSKA 1PL3A 4Z95H 3LIEA 3ZTEA 2FH6A 5DURD 2MTPA 2VZVA 3QZWB 3PJSB 3B5NA 4FNUA 4NQVA 5DK0A 3O3EA 4LEBA 2APVA 3LQAL 3S4SA 2BS9A 4J2QA 4PWKA 3FQNB 2A6DA 2APWA 3GSVB 1DN2A 1KACB 1ZTMA 1MI5A 4XODA 3SE8L 4OFIA 1HQ4A 1LDSA 4P5MB 4WHDA 5DU7A 3AADB 1KXQE 2B77A 4L8SC 3BPLC 4P4RA 3LKSB 4TSBH 3UGXA 1V7NL 2LW3A 2XRAH 5AVZB 2VQ1B 5KG9B 1Z9OA 3HCVB 1HCVA 3EFDL 1RK0A 4HH2A 3AE8C 1NOFA 3FB7A 2IDBA 1DUYA 1RV6X 3QARA 4MXWH 5GGSY 1YUHA 2JJVA 4I2LC 1CTMA 1Q8MA 2C8NA 3PABB 1UXWB 3PWPD 4OZHA 4WKZB 2XG5B 3IJ8A 4FNSA 3N85H 1N8ZA 1QEXA 5EIIB 3C2AH 5I73C 1K5WA 4YHLL 1SZNA 2H5UA 2Q8BH 3ZTDC 1X5HA 1A64A 4YHKL 1UEMA 2CQVA 3ZKND 2X5PA 5BXFB 3FC8A 1IM3D 2DWXA 4Y88A 2XKNB 1GPOH 1X5GA 3GBML 2H1XA 4HIPA 2XWJA 5EDSA 3LS5H 2NY1C 1ZHKA 3N43B 1IGJA 1S46A 3O81A 3AQXA 3O45A 5ECGA 4U1SA 4FA7B 5JHDA 1MRCH 2OQJA 2QSTA 4X5XA 4X5QA 2N1TE 1AACA 1EXIA 1OIPA 3MRIA 4Y5XA 3VFSB 2OMYA 2XTJE 4FLQA 2E6PA 1L0LG 1W0YT 1CFQB 4MCZA 2R1WB 1K72A 3N42B 4Z3JA 5ICYB 3B9AA 4J3OF 3ZKXB 5ENWB 5APWA 3EUUA 4AM0A 1S5IH 2X1PA 1ADQA 6PCYA 5B1CA 5ADPH 3AJ7A 1MZYA 5E6ID 5HI5C 4LNRA 2VRKA 4AG4L 2ALAA 1QFWI 4JFQB 2QSVA 4KXAA 4LOUD 1O6SA 3Q6FB 4RRPA 4KQ3H 1OOAA 1JY3P 1KY6A 2AAAA 2WBKA 3BZ5A 5KVEH 5J11B 2MCPH 3GMRB 1NGYA 4F7EB 4JDTH 4K07A 2GKIA 4PRHE 5K9QI 2FYVA 4X6DE 1O5PA 4AVIA 1LTIC 2GQHA 3TYFA 5EEWA 1BX2A 5E03A 1GW4A 4Z0XA 5I8OL 3ARDA 4PJBF 1GCYA 5CEZL 2EDEA 1KILB 4QHNA 4JQ0D 1HE7A 5EUKA 1AI1L 1AR2A 3EIFA 3ILPB 4BRJA 1JY3O 1CG9B 1KLFB 4A6YH 5GGUB 4MNHB 4FHBD 2HT3C 3ZZSA 3RL1A 3WFBL 5ANHA 3CQFA 2Y2TA 3U1QA 1RZ7L 3C12A 3HUSC 5JXEA 1DHKA 3KLAA 2Y36L 2J4WH 3EFFA 2Q6QA 3IAPA 4RDQF 3P3YA 5LVEA 5T3XH 5LCVA 2XV5A 2LFGA 1NTME 1SMAA 5IFJA 1USDA 4XMLH 1QX8A 1EK3A 1P4LA 1RK1A 1COBA 2Q2LA 3I6GA 2CJTA 4TNWK 5DWPA 4PJHB 1A7BA 3MGNA 2VRAA 5IM7B 3HMXH 3O3DA 1HINH 4ODVL 2C9LY 3ESNA 2EIEA 1KIPB 5DO2C 1BBDH 3RVXC 1OXYA 3DXAE 3EYOB 1G9EA 1ZDSA 2PW2B 3GSWA 2V7NB 2FZ3B 3KD4A 1UD5A 4K94H 2VDQH 2AEJA 3L5XL 1EA9C 1UJ3C 2N4IA 1ZRTD 2R9HC 2W9EH 2X09A 4ELDA 3LQZB 5FYKD 3KWTA 1MRFH 3L9EA 3FCUB 3F5WA 4M7JL 1PP9E 3WJJC 2NY7H 4GEJA 4NZTH 4BSVB 3POHA 2Z7UA 4JO3H 3CVHA 4RH4A 1UKSA 4KRPB 4S1DC 3V2QA 2OJEB 4KJQC 4S1SL 2CDFB 3V6OE 3QEHA 4HPYL 4JVWA 5D7JA 4DQAA 2EE3A 4JDEB 4DP4X 3HAEG 4Q89A 2E74D 5D2NB 3KPPA 1S8DA 4GAJL 4F2MB 5I1EH 5KVDE 4X7DC 2XDJA 4AI7A 3TZVC 3BVUA 1TFPA 1RXLA 1EIBA 4BFFA 3D2UB 3WY4A 5TK4A 4APQC 4PJAA 4R8WL 1R3LA 2C9SA 2X4TB 3ARGD 2OJZL 4J27A 4WJG3 2FD6L 3QFJD 1CCZA 3QXUA 3C5JA 5HPOA 1DBKL 1CB4A 4MA3A 3PLYA 2P8PA 4AYGA 1AZNA 4ABQA 1SN2A 2WNWA 5J06A 2GFBA 2GSMB 2HJFB 4JGJA 2J25A 4M8VA 5DUBA 3FQRA 2C3VA 5FAAA 1XGYL 4QPEA 3V52H 2OMVA 2ENJA 1M6OB 1UM6H 2GK2A 5IB3A 3B34A 4RSYA 3ZHFA 3HE7D 4R4NC 4H1LG 3AWGA 4XP4L 4GQZA 4JFEA 1HOCB 1ORQA 5D1QD 3H1JE 2A45H 3FH7A 4U0RC 3I85A 1I3RB 3STLB 4ADJA 1CICA 1L6PA 4PJDF 4R4FH 1HIML 3HE5B 1T7YA 3BXNB 1ONQA 3FOMA 2FSEB 4WNJA 2R5DA 3CC5B 3NJKA 1M1JB 1UKQA 1QR1B 4P3WA 4WTQA 4ODSH 4XPBH 1DJHA 2WY3B 1UVQB 1BWWA 1S7WA 2VE6A 4P2OB 1QVFO 1LL1A 4WGWB 2YN5A 4EKJA 3MV9B 2ARJB 3MOQA 4G80A 3KLHD 2HMID 4EZMA 3PP3H 2V9TA 1NL0L 4H8WL 4I3GA 5JUEH 5CKAA 3G5VA 4ALAC 3VSVA 4WI9A 1AAJA 4KRMB 1JVLA 4NM4H 5MEOB 4EXPX 3B9KC 4GKNA 2DLFL 4NO2A 5D7SL 3WOVA 1OK0A 1J5HA 4UWQB 3ZO0A 2LABA 4XE5B 4NNPH 5F7HA 2OMZA 4V1DA 1E4KC 4JO4H 4MNQD 3KVPA 1ADQL 2EE6A 5AZUA 1RURH 3BH8B 2FL5B 2CLVB 3CDFA 4Z78B 1X7TA 2GVYA 2AJZA 2NZ9C 3MTXA 4K3AA 5EPMB 1FZMA 3VTTA 3QH3A 1SFDA 1KB9D 1ESOA 2F53B 2OFQA 1CF1A 3MRBB 1X9UA 2VISA 5KVMC 4XOEA 3A24A 3CZNA 3RX9A 4BXLA 2CO7B 3QUZA 3V4PA 1GIGL 5ID1B 2YIUC 1MCWW 4ZW5A 1DCLA 2YSSB 4PVMA 4U7SA 1BBJB 4PS4H 2L7JA 2VXQH 1CF8H 3OJAB 1T6VN 2IZ0A 5C0FA 1A1OA 4IHOA 3UZEC 4F7PA 3P77A 3I56P 4U6XA 3T6QC 4ZX4A 2B2XL 1OVVA 4OCYL 3VXRD 3E6FA 3PWNB 5GGQL 2V0AA 1CURA 2M3EA 3D0VA 4L4TD 4TLUA 5FYJD 3TO2A 2HFFB 5CO1A 3IJ9A 3GHPA 3KBFA 1OQOA 2BNRE 5DD6B 4IS6A 2K3RA 5FW8A 3C1LA 5DJ0B 2YKLL 5EZIL 3AREA 3O0RL 2L3BA 3BKYL 2MNUA 4DETA 2P28B 4GXFA 4NQEB 2R0WL 1YJDC 4LLVA 5D5MA 2FBRA 1A4JA 5EOQH 3RDTA 4N2KA 4O2FA 4GFTB 2DQTL 3DETD 2PETA 2VLKA 2AVFA 5CHXA 1C08B 5T1DL 3GSUB 4CILA 1SVCP 1NAFA 4QEGA 5SWSA 3KS0J 2VDOB 5LCVL 4KMTL 4OZHE 2YO3A 5C0BD 3C75A 3KWWB 2IOOA 3OQ3B 5IJBC 5LJYH 1AQTA 5FOJA 4KKCC 1ZLSH 3MUDA 4PD4D 5K9JH 2WQ8A 2V9QA 3S35X 1EAPA 1N59A 2K6WA 2V3FA 4EVNA 2B89A 1NJIQ 1JXFA 4GSUA 1KYOH 4HJSA 2JK5B 3JUZA 1BW8A 3PL6B 5ITFA 1QO3B 5IESH 1MQKL 4UQ9A 1NLDL 3LMJH 3GMPA 2RFXB 3O2VH 3WIFA 3AC0A 5F97E 4U4IA 2D2CC 3FB8A 3MNVA 1WP6A 5IBUB 4L3EB 4PLKC 1AMYA 1W0WB 3MV8B 4N2GA 1QW8A 4FQ1L 5E1HB 3L7EB 2YRZA 1U8CB 2ZJSE 1YY8B 5CIPB 4F80A 5BJTB 3RVWC 3IKCA 4URKA 5JLZA 1NJ9B 3CVHL 3GEWB 5CEYB 2ZVNB 4WEBH 3ZL2A 3MUUA 5D7LB 3G5XA 3EFGA 1MHCA 3AS1A 1BFOB 5HHOD 2DD8H 2VDNB 2WBJB 4MB5A 4DVBB 1HTLC 3EGDB 1DJWA 1YECL 2ZICA 1G1OA 3IU4H 2BOCB 3FCTA 3BMWA 3TYGL 1ZWIA 3POCA 3JZ7A 5APTA 1RKRA 2CR3A 4GRMB 4ZUUB 5F6IB 1IKFH 3EYVA 5D1ZB 4JANB 1M7DA 4BKTC 2ZOKB 3CLEH 3FSZA 4GW5A 2DQ6A 2PCPA 2PMZA 2VH5L 3LRSA 2Q76A 3VNZA 5C2BH 1N64H 4K8RL 4IMKA 4HIEA 1F56A 1N18A 2D3JA 4G43B 3CHOA 4XB8A 4TNEA 2PO6D 4TVPL 3UYOD 1MH5A 4N0FB 2WNGA 3GXNA 4GXVH 2J8OA 4HHGA 2AMGA 5D1XA 4HALA 1OSPL 3I50H 2IH3B 4N6QA 2I26N 4NZRL 4F57H 1NBYB 3SDCC 3EYFA 1KT2A 4R5XA 3RILA 5E2TL 3DGGB 2OYMA 4ZKPA 2DLGA 2FRGP 2WLJA 3H3PL 4HISA 4F7TA 1KBWA 3HIZA 1U8JA 1NIFA 1UWYA 3FONA 5DC9B 5KSVA 3K5RA 3UTTD 1E42A 2WZPD 5IQ7H 3BDYL 4JZOB 5ABDE 4PJEA 3VI3E 1PQZA 1CTOA 2XYBA 3S96B 3UAJA 5C08E 2OTUB 2NCEA 2DQEL 4XMKL 3V7MA 1ETZA 1R3JA 2BXYA 2X10A 3L5WB 4F91B 3UGEA 2RR3A 4KKZA 5HI4C 3PAVA 1XSJA 2QQLL 3T65B 5FFLA 1RZGA 1KN2H 5G5DB 4BFEA 1T0PB 4H0LC 4ZFOA 1LTTC 5MEQA 3EFFK 3FFDB 5GS0L 5JW4N 1GKEA 4NNXA 2FCBA 5EZOH 4PY7B 2EUXA 1KIUA 1O5DT 5IHBA 4GBXB 4QOKD 1T6BX 3PGDB 1KXVC 3VRLF 1K9TA 3FT3A 3HHRB 2J7LA 4LARL 4LSTH 4XVSL 4KMQA 4XPTH 3P3UA 4FQ2H 1FL6B 1CD1B 4M7ZC 4NWUL 5T3ZD 1YN6B 4QXGL 4WV1A 3CX5E 4WTZG 4BRYA 3H32B 3TEUA 2BERA 1IGCH 3BIKA 4X6BB 1S78C 2YRPA 1B2WL 1PLCA 2IALA 3FZUC 5K33A 2Q87A 3V4PL 3MCKB 4GODA 1ORSA 1QUNB 2WXFA 4K2UH 3QCVL 4UV4L 4I48A 3ALXA 3K8KA 2KS1B 1TMCB 4N78E 1YMMA 4G8EA 2XA8H 4N2AA 3ELQA 2WV3A 2CUAA 2Q7CA 1KEMH 2DQCH 4FCHA 1KUMA 4JCLA 1U8HB 4PJAE 1PL5A 3TASA 3IKKA 4S1RL 3QG6B 4DTGH 3WN5B 4WU5B 3S3BB 3VCLA 5GTHH 4N2EA 3S5LB 2LAGB 3QJRB 5I1DA 5IJCC 1ZS8B 3WO4B 3JV5A 2MOQA 3VDCA 3HHSB 3T0EE 4XCEB 3W37A 5IF0A 3NJHA 1NUDA 2KS0A 1Y1DA 4PJXB 4TVPE 4Z7WB 3AG2B 3MUZ1 2IADA 4JYBA 3KLLA 2FAUA 1PZBA 3T6XA 1FZJA 5HVGB 4YHYB 4EYYQ 3H25A 4XMPL 3ZE0E 2J20A 1R3KA 1UCBL 2E7BA 5HYSG 4TQEH 2OLDA 1IC5L 2H6OA 2ZP8A 1O7DE 1AR1B 4G8FA 2PTVA 3GWJA 1Q94B 1L4AA 4BWTA 2GJZB 3N50A 1MJJB 2PP9A 3V95A 2AS5M 1GL2B 2UZPA 3EYSH 3I84A 3OZKA 4MS6A 4BQBA 4WO0A 3ENEA 2Z31D 4DOHE 2KOGA 1W5CE 2J1YA 1MCLA 4WKXA 1EJOL 1B0GB 3QJHB 4OTXH 6FABL 1ILUA 4AENA 2E46A 2H26A 3VGDA 1ZA6A 1JTPA 4UU9A 4AYEC 3DVIA 4NWTL 5EZLB 2HRLA 4UTCA 4ZT1A 4J3OG 2WYIA 3T2PA 4JGUA 3WNIA 3L73J 2F5AH 1HL8A 4F2FA 4N2DA 4DAGL 5CFAA 5DURB 4L8BA 1F1GA 4NOFA 1FDOA 4NYLA 5DWUH 3I9IA 5TTRA 2A73A 5J11C 3TNUB 5F3HA 1RMFL 1XTMA 3QUYA 4IRSD 3OSKA 1QEWB 2O01N 2IAAC 4HSQA 5BCAA 1G7MA 1RU9L 2YPVA 1WWCA 3CFCH 4ANVA 4YAQA 3OF6D 4MA1B 3RJOA 5I6LA 1VFOA 3RWCB 3KCPB 2B08A 4V1DE 3MQIA 5A3IC 2R29A 2GAZB 1ZE3H 4LF3B 3F04A 2P5WB 3GSNH 1RZ8A 4U1IB 2RCSL 1N12A 1KILC 1FV1A 2HRPH 3V6BR 5IHZA 1H8AA 3R06A 1MHPL 1UWGL 3PWPB 1X8YA 2E4TA 1JY2P 4KK6C 3CX5I 2BINA 2BSCA 2K70A 4WI2A 2DQGL 1HL4A 4FG4A 3QXDA 4XBEL 2X4NB 3IB4A 3V4LA 1AO7B 1ID5I 2OK0H 1N68A 3ALWA 2QDVA 2GTZB 4UIKL 1N8OE 5JDSA 2EUWA 3DI2B 3CCVP 1NBCA 4O2CB 2F74B 2MRYA 5D4IA 5FO8B 5FF6B 3NZHL 4Y9BA 4GW4A 1KPVA 4QHUB 7CGTA 1BD2A 2UWEB 3GMOB 1YNTB 2WIIB 4FG0A 4UT9L 4X4XA 3M1BA 4M3LA 1WE5A 4RDQG 1C8PA 2YUVA 3FUDA 1HHHA 4BRVA 4CGTA 1S9KD 2AXFA 2R4RL 3MRJA 4OW6A 5AG9A 3DJ9A 2NZ2A 1A6VH 2NUTA 1C12B 4ABVA 3K5BA 2KDYA 1H9DA 3G6JB 2IGFL 2CCWA 4N9GB 2UZIL 3BP7B 3TWYA 5BW7A 4Q9RH 1JTHB 3VB8A 3D25A 1Z6JT 5EWIH 3R4YA 2FGZA 1G6RA 1XH3B 3V0IA 3RX7A 4GDOA 4B9CA 4YFEA 1G1KA 3B2MA 5SWQB 2AQTA 5F9DC 3TCLA 1PG7L 1U7MA 3PHOA 1SXBA 5BVZA 2AQ1A 4KRPC 2CA3A 3SY6A 1I9IL 4NKOB 3RB7A 3TF4A 4NRYA 1J1OH 1QNZH 1IBYA 1JL8A 3PTZA 1MY7A 4XZUB 5KAIH 3ULSB 5J89A 2TAAA 2F58H 4PJ5A 4WW2A 3DX4A 3QZMA 3WEAA 2HH0L 5D2NC 2BP5M 2MTAA 3KHQA 1EHLL 3G5ZA 2I9LA 1GAFL 4ZFOL 3GFUA 4G7VL 2YMOA 5JYMA 2YA1A 1DBJH 3IS0X 2EYRA 2K6YA 4U3HA 2JNZA 3KS0H 4JK0D 3NZUA 1PPJG 3N5AA 1D9KB 2VXTH 3M0AA 4KO6A 4AUUA 2BFGA 2UUDK 3DUSB 1R0AH 5F1IA 1TSRA 1UT2A 1R6VA 2V3EA 4NP4H 3QUMA 1I1AA 4QXVA 2V5SA 2MFNA 2YLHA 5KVGE 5IJKC 1ITBB 4G9FB 3LS4H 1P1VA 2AV7A 2NW2B 5IMMA 2P24B 3PDDA 2A4ZA 4FFWD 4RGOH 2W95A 1HXMB 5KWYC 1NIDA 4YXLL 1FCGA 3HS0A 4Z3HA 1AIZA 3II3A 3S88L 2C9XA 3L9BA 4J8RB 5SWZB 3BWSA 3UMTA 4GB9A 5JR1L 3IGLA 3F8UB 5L0QB 1KCVH 2WCGA 2Q3AA 1CPUA 4DCQB 5I2IB 1NANH 3KYMB 1G7JA 3ARFD 3L3GA 1F8TH 2E3VA 1THAA 4JKWA 1L2PA 3B7YA 4JZJB 1OX3A 4HW6A 1SVFA 4C4BA 2C7UA 3HKFA 1FYTA 1NBQA 1M1JC 5LWYL 1RIVH 4EO5A 1OM9A 4HT1L 5LO7A 5A43C 4I87A 3Q3GB 2HJLB 3O8XD 3K2UH 2OXHA 5DJ2B 2UY7A 2ED6A 3L13A 4GG8A 4P2OC 4Z23A 1L9TA 4DGYL 2CBQA 2Z93A 3KJ6H 1HTYA 1PLBA 5LGJA 3EDDA 3BN9C 3SPJA 3PAZA 4PJ7B 3E9UA 1ZDQA 2VDKL 3H9SA 1ZHLA 3DSNA 1CZ8L 2WXKA 1AC0A 1E6JL 1HDMB 5EBGA 3B9EA 4OZFB 4G1MB 4MDJB 1KTMA 5IB1A 3MJ9L 4FFZA 3N43F 4KX7A 1HXYB 3U7WL 1FBMA 4PRNA 1YEWA 4MAUL 2Y07L 4FYQA 4QAWA 4WVZA 3KEHA 1JFHA 1SF5A 4EUPB 3P9MB 3T97B 4RAUA 5DSCA 4F58L 4ELKB 2E74B 1FNSH 3LOWA 5DEZA 5IEHB 2WUCH 5KANI 4PJEE 1OCRB 2AXGB 4JFTA 5E23A 4AJWA 1AGEA 1PSKL 1SY6A 1VADA 1JV5B 4HUWA 2EEFA 3ZDZB 4ZX6A 2IF7A 2W38A 5FHAH 1D3CA 1CK0H 2BIMA 5TQ0H 4YE4H 2XV0A 3AWFA 2W83C 4P49A 1QBML 4X80H 4KQ4H 1OQXA 1BLNA 4PR5A 3P7KA 1R3IH 2QQQA 2BHUA 4Y19E 5I19H 4L5FH 4QHMA 1YLBB 3EH3B 1EGJL 8FABB 3N40F 1WIOA 3VG9B 3MLZL 1BVZA 5FW6A 4LVEA 5DHXB 2L7UA 2YPVL 1EJ8A 4RNRA 2QVTA 1GY1A 4NLAA 3HE7B 1T66C 5TK2A 3BUQA 3SE9H 2ADJB 4ODHL 4XN1A 1XGUA 3JT0A 3DMMA 5D1QB 5F3FA 2Z8WC 3B4NA 4JPWH 2HPCB 4NRZB 5DJZB 5F7DA 2QJDA 4WSGA 4R2GD 4XC1L 1S7TA 3VI4B 3WSQH 4JMXA 1WIUA 3OX8A 5I1LB 1P69B 4YHOL 5I0YA 5B39B 2X6UA 3NZSA 1I7TA 4MNGE 1N73B 3C60C 4N5EC 1A6ZA 4WFFD 3T8VA 3O2DL 1LTXA 2C9VA 2K9FB 4YPGB 1T89C 1GW6A 1X44A 5L8LB 1NAMA 3E3QE 1YMME 4B97A 3GKZA 3HS9A 3R8BB 5I74B 4TULL 1IM9D 3COOA 3KPTA 5JA9A 3MFGB 1CBVL 3FTVA 5IW1B 5I76A 4CSZA 2FXOA 5E99L 3WHE0 3GW6A 4JHZA 2Y7MA 4KK9D 1IFRA 2E59A 4N3UA 3MGTA 3QDJE 4UUJA 3PL6C 2IYPA 3A4DA 4MXQD 3H1JJ 1Z2KA 3CFEA 2CIIA 1YN7B 2PPAA 2X4PA 4KVCH 5KSBA 4AMKL 1SQXG 3JZYA 2P80A 3UYPB 1HH9A 1IMHC 4FE9A 4LEXL 2P58A 4Z7OF 4PJHF 1TQUA 5FO2A 4DQOL 2D7OA 1TJMA 4MMXA 4O5LL 2NOYA 5CKGA 4W80A 4TUUA 5IVZB 1RZKC 1OHZA 1KCUL 5T1LD 1KD1Q 5TDPB 1JK9B 3AMLA 1ZSDA 4XPGH 2IFNA 2QE7H 5CBEB