5AVYB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 20 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avyB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avyB02
3M9HA 3IR9A 5AW3B 1HBWA 2WPSA 1GU4A 2XU6A 3KQGA 1FOSF 5APQA 3M0AA 1FAVA 3L37A 1CI6A 3P7KA 5AW9B 2XZRA 3SWFA 1J2JB 1GK6A 5AVZB 2P7JA 3B8EB 5AVWB 5AVUB 1NAFA 1SLQA 2R3CA 1NWQA 5AW0B 2W6AA 2WT7B 3TNUA 2WTYA 3A2AA 2QM8A 1T2KC 1MUUA 5APUA 2C9NY 4GT1A 2VRSA 3HTKA 2Z5IA 3TK1A 1H8AA 5APXA 1GD2E 1X8YA 4LC1A 1FOSE 1IO4A 5AW7B 3M9BA 1MFZA 3MGNA 1JUNA 4AQRD 3T97A 2Q7CA 4AYCA 3V5BA 3M91A 4I2LC 1G2CB 2YO2A 1S9KD 2WPRA 3VMYA 3UIAA 3WGUB 5AVRB 1SP4A 4HYTB 2E43A 1CSBA 3MD0A 1T2KD 1A02F 1HUCA 2QM7A 3A3YB 1CI6B 2C9LY 5AW2B 2Q5UA 2ZXEB 2E42A 5AVQB 1GTWA 3HE4A 2P67A 4DZOA 3TNUB 4RESB 1HJBA 5AW4B 2W27A 5APWA 4EOTA 2YO3A 5AVVB 3VYIA 3L36A 2JJLA 5APYA 1HWTC 3TYYA 5APTA 4AUWA 3M06A 4M3LA 2P2UA 1MV8A 2R5DA 3I5CA 3A5TA 3KDPB 5APVA 1JNMA 3OAKA 1OWAA 3LIDA 3V4QA 1H88A 3VTPC 2R32A 3VN0A 3M0DA 5CMZA 4C7NA 1OXZA 3NXSA 3WGVB 1GK4A 4I6MC 1H89A 3VMZA 3NTNA 3L35A 5AVSB 2BASA 5AVXB 3NFQA 3LIEA 2Q3IA 5AW5B 1GU5A 3HE4B 2WPQA 1A02J 1DH3A 3P8MC 2Z5HA 2WWWA 4XE5B 2N9BA 5AVYB 4JYBA 3V4WA 2H7HA 3P32A 4RETB 5AW8B 5AW6B 5APSA 2YNYA 2IPPA 4C46A 3HE5A 3VMXA 2WT7A 4B86A 1CZQA 2KP8A 3HE5B 3A7OA 5AW1B 4GKGA 1GZLA 4JYCA 1S9KE 1KQLA 3NMDA 4C7NB 5AVTB 3O8ZA 4KHXA 2ZFCA 2XV5A 2R5BA 1YYCA
chains in the Genus database with same CATH superfamily
1ZT4B 4GMTH 1D9KC 4P4KB 3RIAK 3MGOB 3QFJE 3TBTB 4OGQB 1NQBA 2G3ZA 2NPSB 4A6YA 2KNCA 1F3DJ 4HW6A 1OXYA 3RK3B 1LO5B 3LEXA 4H8UA 3SGKC 4IS6A 3U0TB 3X12A 4B9IA 4EBQL 3U2SB 1DBBL 2W9DL 3KNBA 2DS4A 3AUWB 4JFDE 4LDLB 5T5FA 2WANA 3F7LA 1TPXC 4G82A 4BKSC 4QJ4B 4D6TJ 5LN8A 3QJRB 1MAMH 1AXIB 3QEHB 3Q48A 5E2WH 4E9QA 3RUGE 1BVZA 5I1CL 3MA7A 3CHRA 2PPEA 4G8FA 4N3TA 4XVOA 1HXYB 5EH1A 1EAJA 3QIWB 3WNOA 3W56A 1CXKA 3ARBC 5KZCB 1EXGA 1CTNA 3HS9A 4R5TA 4O4YH 1ZEAL 2R69A 4UTBA 5LN4A 2G2RA 5FB8B 1BIHA 1LT9B 2BPBA 4DK3A 1E5UI 2DAVA 3NH7L 1SP4A 5C0EA 1LILA 3RBXA 1IFIA 4MNHA 3A3YB 2ZZUT 1C5BL 3GGWB 4KJQC 3FH7A 3QFJD 5CWSB 2MCPH 2VW4A 4NUGH 3QORC 3QUZA 1D5MA 4PJ5A 2BW4A 2GC4C 4CN6A 1BF8A 5EF2A 3TNMB 3VSTA 2R27A 2K8MA 3GSOA 3MQIA 4JFDD 1OALA 1VA9A 2HR3A 2VN6A 1NMCB 5HHOB 5GS1B 5C6TL 3ZMNA 2XJKA 1NCCH 2DICA 3F89A 4YHZH 4BKLB 2X6VA 1JD7A 4X42A 5JTWA 5I73C 3FQWB 3D25B 1WE5A 1HI6A 2XOTA 4KHXL 5IQLA 4NLHA 1JWSB 2BJMH 4UQ3B 1BCCG 1YYMH 1A9EA 1G9NL 1H9VA 1T1YA 2EO9A 2UY6B 4FI8A 5E94B 5HDRA 1XGTA 5B1KA 4APQA 5F6IB 1BMWA 2YC1B 4F9LA 2IH3B 3Q43A 5LGHH 4IOIA 3CWBE 3TBYB 3GIVA 4DPCX 2JKJA 4XNXH 3SKJL 5T3XE 3GTTA 2DMHA 3DKHA 3BKJL 5GRJL 1MCWW 1V3JA 2G30A 1KBGH 3O3EB 4GKNA 4MJIA 1SOSA 3CVHH 4N2BA 4RZKA 3WFDL 1SF5A 4H44D 3O9WA 2EO7A 5TQ2L 5E51A 2BNRB 1U3HD 4TVUA 4P9ML 2CDEA 1BX2B 1AHKA 2ICWJ 2XTJB 2J21A 3P40A 3WOVA 1IAOA 3L4ZA 4KV5E 1B4JL 2WXFA 1XF3B 1QL2A 4JAMB 1GZLA 1IGMH 1Z5HA 2V3EA 1XF4A 2PWFA 1SQPE 4YX2L 3T3PB 1F58L 2W9EL 5D4IA 3SJVB 4TNWF 2ZTBA 4XPAH 3EYOB 1G2CA 5I1HL 1T0MA 5J0BA 1OAQH 1LK2B 3CZJA 3ZOAA 5GSVB 3SFEC 1KD1Q 4FXGC 4C8XA 1H8OA 2KL6A 2J5UA 3T2LA 1U3NA 3VX1A 2GEEA 3WDIA 3CWBD 3PNWB 4NM8H 4CADA 3BN9C 5T3XD 3HUSB 3LEVL 1LDPH 5IVXF 3BCFA 3V2RA 2NY2C 1NGPL 1MFDL 2DJSA 2VRSA 1FVEA 4F7CA 2J72A 3WNKA 1LP9E 3N7NA 4FF9A 4R7XA 3ZDXE 3HLKA 3B5NC 2R2BB 3VGDA 3ZYOA 4J28A 5EPMB 4IL6H 1NIBA 1R3LB 1ZTMA 4PJBB 3QEGL 1CDHA 3VFNB 2VDKH 4V1DA 3G5VA 5GRWA 5I8EB 1Y1UA 4GG6E 4LGPB 1SQPD 5EIIG 3H8NA 3WGUB 1HINH 4GKZB 4IIZA 1CCZA 4OFKA 5KVGL 2FWSA 4KKBD 1E9QA 3CDCA 4XMZA 3FU9A 2CU9A 4FQPA 3SDDA 3MTRA 3VNZA 4L29A 1Y8AA 4KRMB 5SX5K 3PJSK 1U58A 1J87A 4EKJA 4QRPA 1JTHB 4LCIL 1SVBA 4NQEB 5F88A 2X7LB 3IDMB 5HYJE 3P4NB 4G8GB 2FYUE 2NY1C 4H0IA 2YAPA 3AE7C 1BE3J 5GZNA 1H19A 3NGBB 1AHMA 1IBYA 1GYUA 1ZJAA 1EDHA 1KGIA 3UDWA 5KYYA 3B83A 4K5NA 2VO8A 1HXMB 1T7XA 4JFWA 4L37A 3SDXE 2NT1A 1H0TB 1NAKH 4WV1C 1NCIA 4BZ1A 2LAGB 4NFDA 1DQDH 3QJUB 4TN9A 4DKFH 5KYXB 2B88A 4OLZH 1RJLA 4RQQB 5ADOL 4PJIA 5HJBA 3CQQA 4ODUA 4OI8A 3RVUC 4HH9B 1I3VA 1T8ZA 4JYBA 1HH6A 4MSWB 1IKNC 4XPBL 1QTYT 2XFXB 5AW8B 2SEBA 4IRJB 1KXQA 4EN3D 2K45A 3T9WA 4OJAA 2EYTA 5HYJD 2A6DA 1LP1B 2FYUD 2GFBA 3GK8L 2DEYX 1FZOB 2J56A 3A7OA 1DFBL 4QHUA 4M8UA 4NQXA 3PG2A 1TVBB 1A6AB 3RTQC 1Z9SA 3THMH 2L8AA 2VZSA 3Q5RA 1N64H 4P5MA 1URLA 2K9YA 3TGUE 4R8WL 2DWEA 1MPAL 3S36X 3NJIA 4XXWA 5GS2D 4GNKB 5J7CC 2QQNH 1RUKL 1A4AA 5EN2B 3UJTL 2EVJA 4Z5RB 1MFMA 5FW6A 4BCYA 1IE4A 3ZXAC 3G6DH 4GH7B 1YPZE 1IQWL 2WXPA 1BD2D 2CKBH 2JR8A 2IG2L 1EZVX 3B9VA 1FDLL 5AVUB 1Y6MR 1QR1A 3FFOA 4M6NH 3T6WA 3ULUF 1B3JA 4FYSA 3BZEB 3QAZC 4FP8L 3S8WA 4S0HA 3ZYZA 1IO4C 2AQRA 2ICWB 4WJ5B 3BZFA 2NY6C 1T3JA 2EEDA 2ZSWA 5F6HI 2Y5TA 4R96B 4A55A 3D85B 3QRBA 1K4CA 3K0WA 3QFJA 2JJVA 1DVXA 3NCYP 3T3PF 3MRPA 1KB5A 1ZJBA 5FK9A 1TVHB 5L8KB 1SQBJ 3O8XC 1IM3D 4EI2A 5EDSA 1MJ7H 1TNNA 4JFDA 1YEKH 4X4ZA 3VFPB 3TGUD 2ADJB 3MD0A 1WFMA 1MLCA 2PWDA 5TE6H 3HS0A 3EGDB 4JPKL 3EHBB 5DJTB 3IJSA 3AY4A 5FGCE 4MB5A 1TENA 2VC2L 5DEFB 3RUGA 4KRPD 2HKHL 2YPLE 3DX9B 2E7LA 4N0YL 1JVKA 2ZCLH 3FX0A 4OZHF 4TTDD 4QD2E 1BMZA 3O45B 3C6SB 1W15A 5I1IL 2A74C 3QDAA 2FUQA 1LWUA 4QXTB 4JB9L 4YDVA 3V6OE 1OTTC 3AG4B 4CC1A 5FWRA 3CXDL 3F7YB 5FA3B 5DEJA 2ID5A 4DUWA 4FG4A 5ISZB 2GHZA 4KITB 2HRLA 5B3JE 1QD0A 4KKQA 4NP9A 1TFHA 2AXGA 3WUWG 1GTNA 2Q6WA 3BH8A 3DX8A 2UXTA 2IO5A 3HI6L 4KC3B 1JNHB 1QRKA 4AM0Q 5E5MB 1NBYB 2AABL 1HK6A 5F7MC 4B9FA 3JYBA 1WA2X 1U3HA 5FFGA 1K73Q 2DH2A 1A1NB 5KG9B 5F89B 3Q8EA 4JQXC 2VB5A 3D69A 4E9TA 3CPLA 2EVHA 2I7SA 1HEJC 2YR3A 2GITB 1ZLVK 1G7MA 1KQGB 2N7SA 5GGRY 4LSUL 2YPLD 1I1FA 1UIXA 4WKZA 1S9VB 5CHNA 1IAII 1WIUA 5E8OA 3MACL 5KLVK 5D93B 2B7DT 4U1KB 3T77A 3TBVB 4YAQA 2N9YB 2XQYA 2CK3H 5F9OL 3T3MB 3GHBL 4WCYL 2QADB 4GKGA 1AD9A 2CRMA 2Q10A 3WFZA 3U46A 3L9EA 1JZGA 3TH2T 3ZE0E 3NMDA 4YO0B 1TO5A 5DYFA 3JT0A 4J8QA 3SD2A 1QZNA 5G4NA 1LMIA 3TNNB 2M83A 2AXTH 1J1OH 3EOYG 3G6AB 2AEIT 4EUPH 4MMYA 1Q9LB 5E8EB 4PB9H 1Y0LB 1CI5A 4XP5H 2ARJA 2A9AA 4CC4C 2P5WE 3WAKA 5BUGA 1NTMK 1DJSA 1HWHB 4AEIL 1R6VA 4I4WA 2J8UE 2JI3A 3JWNH 3AS3A 5JA8B 1W8OA 4AQ1B 5HJGA 1DJYA 4H8VA 4JZOA 5I0XA 4CJ1A 1U33A 3FU0A 3AE3C 2C9AA 4XMKL 3WJMB 2CALA 1JF6A 3FDWA 1FL5B 2Z64C 5KAIE 3GXTA 4MA3B 4W81A 5D5ME 4O9HH 1HFUA 4AIOA 1UVQB 1LEGA 4IU2B 2ADGB 3ZE1B 4U3FE 1OAUL 5C3LD 1GD2E 1DN0B 4C55A 1MIML 2EH8H 1OFCX 2DV6A 3FOMA 1ZAGA 5A43C 4AQRD 1IUZA 3QR1A 3WS3A 5GRUL 4PY7A 2MHAB 3RL0D 3RGVB 1MJ8H 2JQZA 4Y5YA 5EZOH 3SHSA 4GKSB 2PTUA 4UIMA 3MUY1 4ZFFB 3EOAA 2HLOA 1P5UC 3VFVA 5EBWA 4HKBA 1VQ5P 3PXJA 4UDUA 4TQPA 3DGCR 4FD0A 4LEXH 1DDHB 1ACCA 1PP9G 5KW9L 1L0YA 5EZLB 1OVVA 2IXQB 4Y7OC 3L75G 2W80C 2P5WD 2QQKL 1T04A 5ANHA 4WSKA 3RL2B 1NEUA 5KBDA 1DQTA 3C2SA 4RCAA 3V4PA 2AVGA 4OM0L 2WITA 3BEVB 1U6AL 2BP8B 1AJ7H 1HE7A 1JXDA 4PD4H 4GG6A 5I8CA 3KPRE 2VE6B 3L1EA 3MRKB 5DJ0A 4ZS6C 5A6LA 1AGDB 1WS7A 4YHOH 4RAHA 4DAGL 2G4GA 1CYWA 4PGEB 3ZHNA 1N68A 3QNZB 2B0SL 3RI5F 3HI1B 4RZCB 3ZTEA 1VPCA 2JLPA 1TZHB 2CG9X 2XG5A 4X4ME 3WN5A 3FPXA 4EN3A 4HF5L 5DJ6A 2IQAB 4XPHL 5HYJA 4LSVH 4WJG3 4YLBA 3MRBA 3FC8A 4GAYB 1Q81Q 5FO9A 6FABH 1MFNA 3GJEA 1R24B 4Z7UB 5PCYA 1QTSA 1XQ4A 1CFVH 3OAZH 4LVNB 4TTGA 4QTIH 1XGQB 4ZMAT 1FCGA 5B1JC 3CFDB 5CGBA 3TVMC 1QBML 5B4MC 1N7MH 4I2XB 4LOFA 4WKXA 4TSAL 3ARDD 3KYNA 3BH4A 4YPJA 4R84A 5IMLA 2OYKA 1IC5L 3SDXA 5F9DC 1D6EB 2QE7H 4YBLC 3SKNB 2J5LC 1HHHA 1KCUL 3ISYA 1EJFA 4OZIB 1BD2A 1U8IA 2DWDA 3KPRD 2LR2A 4RGNB 1AS6A 3G04B 4BELD 3ESNA 4AUJA 2CK2A 2EDJA 4FXKC 1A9BB 3GHEL 3P69A 4GQRA 4KK6D 1V05A 3ABGA 3IS1X 2OSXA 3K6SB 2AMGA 5IK3B 4A38A 2RIKA 5MEND 3NMEA 3BW9B 3I6GA 5ES4B 2XKNA 5TGBA 1PIFA 1E79H 1PBYA 3NZHH 1NGMB 1A4JA 3CFEA 5AL8A 4KY1H 2QQQA 3ZKMD 5E95B 1NAFA 2SPZA 1IM3A 1EMTL 2BCKB 4GAJH 2D7NA 3QDJE 2O5ZL 2FX7H 3V10A 4RWYL 2UXFA 3C6LC 5GSRA 3VWKD 1HQRA 1IILE 3FO9B 2WY3B 5JW5A 3DVNA 3E7JA 1AIFB 3QZWB 3T3MF 1AKPA 1R3HA 5DGQA 2RQ8A 3D09A 1CIUA 5C0IB 4Y5VA 1NTZJ 2QIWA 4WHTB 2FBWC 1PEWA 4IKLA 2PR4L 1EBPA 1YPZA 2BY1A 3M91A 2BERA 4R4NC 1FV1A 3DSNA 2K6WA 5CCHC 1K9MQ 1K72A 4BCZA 4OGYH 1LTSC 1KIUB 2DIBA 1CLOL 1E27A 1E4KC 2Z92A 3SPJA 3GLEA 3HG2A 3QFGA 3V4UH 4IMKC 2X9WA 4A7SA 1YIJP 1KTLA 3VXPA 1WWCA 3DMMA 2KDYA 2NXYC 1X5IA 5INCB 2YGOA 3FB5A 1XD1A 1YNLH 1UA6L 4OM1H 5E4EC 3CH1A 4FQHA 5IB5A 2JCCF 4QNPF 5JW4R 4LO9A 2KPNA 3ZYJA 1JXJA 1OE1A 5BOJA 2VO5A 3QDJD 1HCYA 4UNVA 4H88L 1FN4B 4C83A 5LKNA 3H6JA 4PJFA 1J8RA 3KS0H 1WBYA 1YLBB 5KJRL 3I5CA 4HLZH 1RHHA 5HJ3B 2C3XA 2OI9C 4KXZH 4G7YH 1SQPK 1NDGB 1Y6KR 3O41A 4J3BA 5D2LB 4F15C 2XPGB 1P5VA 3DECA 3MRJA 2NNAB 4O2EB 4HUWA 1E2VA 4F2FA 2QQLH 2KKQA 1UJTA 4XN1A 5F1KC 2C3GA 4ZS7H 5BNXD 4A6YL 3Q9PA 1DBAH 3V6OA 5KUMA 3MOAH 2KC0A 1SBSH 5DJ8B 3NAAH 3EYSH 4HJ0C 4UMGA 5EZJB 1UWXH 2AMUA 2MQGA 3CDZA 5CAYB 2OK0H 2VDRB 5T5FL 2P45B 3AT0A 2ZKHL 5C2BH 5IFJA 1Z5LA 1QPPA 1B2WH 5DI8B 1QUPA 1R5IB 3CLEH 4FA7B 1UM6L 3AWEA 5CBEA 3AT9A 3MNWA 4Q9CA 3ARQA 2J7LA 3L70E 4FQIH 4KXZI 3EOTH 1AR1C 3IDJB 4P2RB 2FB4H 1RURL 1XF5A 2E7BA 4J3SA 1AXSA 5EU6A 3V6ZA 3PGFH 4OF8A 1G7QA 2FLBT 1MHCB 4K3EH 3T0AA 1JNLH 5F3BB 1H3GA 3G5ZB 1EXUB 1FAIL 2AJSH 2BWDA 5E5RB 1OLLA 3V9EA 1QWHA 1CJYA 2ALWA 4ENZA 5CJ8A 3CHXA 3BGMB 1ZPUA 1LO4H 5HGHB 4LASH 4GSXA 2JELH 2W94A 2XNAB 2Z31C 4IGBC 3N4XA 1ZPLA 4Y4FC 1IFHH 2JKXA 1TCRA 3LKRB 1IIKA 2FYUK 5C0ND 3UZEC 4KUZL 4JN1H 1L7TL 1YEHL 2GTQA 3D52A 5JQHC 3WIFB 5FCUL 4AMKH 1RXLA 3BZDA 1PDKA 4Y4HD 5EV7A 3V4VA 3FYIB 2CUIA 3LJ3A 3MRLA 2CH8A 3W5NA 1NFDB 2HTKC 4OZIF 2VMCA 4GI8A 1WT5A 3TFBA 2QGCA 2N56A 2P5WA 2L4OA 3L70D 3JYCA 4NWTH 3F65A 2WSEJ 4U1HA 2J8UA 2LVCA 4DZBA 1KBKA 2YFNA 3TWCL 3MUUA 5EUOB 1AGEA 2FT7A 2Q7YA 5F7LB 4IKIA 5A2JH 2A6JB 5D5MA 3G5XA 4NX0A 3EFDH 5HHME 1R0AH 2JDIH 4E41B 3MJ8A 4FYQA 1KJ2B 4FQJH 5BO0D 4OCWL 5EFWB 1EERB 3ZSTA 3ML9A 5HVWA 3IETA 3FO2A 4ASVA 3CUPB 3LRGA 4XPFL 1BG9A 4MS8D 1Z3GL 4KROD 2M0BA 2HJLB 1HH9B 2ATPA 5ICXB 4OD1H 4FLRA 4P3WA 4BRJA 2PW2A 5DZ9A 4KZ0A 2X4PB 3WBDA 1M53A 1OP4A 2J2ZB 2Z93A 4F20A 1LHZA 2ZAIA 2XA8L 5H35A 4AYEC 2JKNA 3K1DA 4AUWA 1WJ3A 4ALAH 1WAAF 1PJ9A 1TJGH 5E5LA 1Z56A 3NCYS 4I3RH 4JM0A 2D7PA 1W2KT 3FBKA 2PO6C 3MZTA 4DGIL 1IGJB 1KXHA 2NXZB 4G80B 1KMIZ 3RPIB 3QP3A 3GZOA 3X1EA 2O61A 3QUMA 2F8OA 5DT1H 2RB8A 3WUTA 1GK4A 3ARDA 4HHGA 1L0LG 3RL0g 2YAQA 5TDPB 3VH8G 4HMDA 4PP2B 5BVPH 2ORBH 1GTFA 1SQVG 4GEJA 3QQ9D 2KS1B 4R2GB 4XO4A 2X2UA 5DD0L 4ZTOH 3CSPA 2XFGB 1QBBA 2W07B 3QWOA 4IDJH 3KPRA 5HHMD 4H4NA 3X1GA 3LQAH 2J8OA 2DLFL 2UXVA 4NXKA 5BV7L 1N4XL 1S5IL 4NGHL 3T1FB 4UBDD 5CIPB 4C46A 4UTAL 4JPIA 5E1AA 2GJZB 2P52A 2YIUC 3U7YH 1A4KB 5IQ9B 5MENA 2BOCB 4DP4X 2JE8A 1O6SB 2IFFL 1U8PA 3VSVA 3V9CA 2RGSA 5B21A 1MJJA 5J12C 1AI1L 4KQ3H 4LRIA 4YDZA 3VO0A 1QFUL 1X4XA 5B22A 1WICA 3NIFB 4XNUH 4I0PC 1F90H 1SQQG 2A9MH 3BDXA 4NBXB 5CU9A 2HWZH 3VQLA 4UQ2A 3VI3E 3GO1L 2YXMA 3CH8A 3IU3B 3VWKA 4RBPH 4OF3A 1THAA 4PWKA 5C0DB 1TQUA 3LB6C 4DN3H 3BFQG 3LTVA 2VC2B 1VQ4P 1G7IB 2EIEA 5AW9B 5DD5L 5TDNB 1RJYA 1DSWA 1OB1B 3OAUH 3TCXA 5JDSB 4UQIM 2CUAA 4G43A 1PZQA 3VXTB 3H1IG 2AGJH 2K9UA 3OR7A 4BQBA 4HPYH 4LQFL 1EEQA 3CZNA 3QIUB 5SWQB 3P9LB 1C08B 1U95A 3U0WH 2X9XA 1AGBA 3G6JF 1OAKH 3WE6A 4K3DH 1EHXA 4QWWD 2YZ8A 4ABUA 5C3TA 5T1MA 1MW2A 2PPAA 3V5KB 1NCAL 4MKMA 4ZW3A 4K35A 4RX4D 1MEXL 1CICC 1MHPH 4IFDK 2VDOH 3ZIYA 3FFDA 1UA3A 1Z5YD 1NC4D 3GRWH 5ABZA 1Z9NA 5HGBB 4IYKA 4WW2F 3RVXD 3EOBA 5F0MB 5J8OA 1OAXL 1VGKB 5I1KH 2DI7A 2YUVA 1TG8A 5T1KB 2X3CA 1KOAA 2PCFA 3ULVF 2GTZA 2V9UA 4LF3B 2CO4A 4PJ8D 1VZIA 4OCXH 4DT2A 5KSBE 1HOCB 2CXKA 2UYLB 4AYMC 2XT1B 3KZIE 8PAZA 1EWHA 2YKQA 1EXJA 1A5FH 2FJGB 4MYPA 3CFMA 3DXAD 3FCSB 1NFDF 5INDB 4WVZA 3LPWA 3T65A 4JJOA 5IMKA 1P0SE 5JOEA 1MZ9A 3P3TA 3NABH 3LIDA 5DD1L 4NPJA 3ILPB 3LRHA 5FUOH 3HZVB 3SOBH 2N1TC 4H7VA 4M62H 4AL8L 5I0YA 3BE1H 1EVUA 3Q2VA 1RVFH 5CZRA 3MUDA 2EDQA 2VXSL 5F96H 2I7OA 4YXHH 5FECA 1DL7H 4TOYH 3QNYA 4DVBB 3PJNA 1PZ5A 4D9LH 3PWNB 4YSAA 4S0TD 2R8SL 4ISVB 3GJFH 1DVTA 3JZYA 3F05A 4MJ6A 3QXAB 5E6YA 1ETZA 3QC5X 2F1BA 3GMRB 3LN5A 2DBLH 2C1OA 3GMQB 3HPJB 3TT3H 3LHPH 5E8PB 5FR3A 4ADJA 7CGTA 3RHWK 1WG3A 2PXYC 3HRPA 5CBAA 2OMXB 3BAYA 3TA3B 4LLQB 1BEYL 1SXNA 2K3HA 3C8KA 4V2BA 1F3JB 2CGYA 3RX7A 3JVGC 4UINH 4Q4IA 3GMNB 4P04A 3GMOB 2X41A 5FLUA 1N26A 1KB5L 2AEPL 5JR1H 4JVUA 5KS9E 2BY3A 4Z7IA 2IPTH 3RVTC 2X88A 4XI5C 5AEAA 1OK0A 3CAFA 4DCQA 1RZKH 4A7TA 3I6KA 3S35H 1JCKA 3BPNB 3H0TB 3WTUA 4D6TG 4CC0A 4FYRA 1ERNA 3HE6D 4FJYA 2JLLA 2ZCKL 5JPNA 5BQ7B 1E43A 1XEDA 1JCCA 1IEAA 4BDVB 5IVZB 1ZA6B 3WFBL 1K2DB 2AV1A 2BZ7A 1A2YA 5I19H 2WQ8A 3KZIH 3IRZA 1IV8A 4TQEH 1AKJD 4PGBA 2D7TL 4A2FA 4JM2F 4Y1SA 2VABA 3CX5E 1YN6A 1PX8A 2XN9B 4O58L 4PJ9B 2X4TA 5CMAA 2PCYA 3NIFF 3QDHA 5IG7A 2MPAH 2V7QH 4HUUA 1OP3H 1LEIB 1UIIA 1KN4L 2I5YL 2A4ZA 5CCGE 3J7HA 3VMYA 2FQFA 2QJDA 4ZXBC 4ELDA 1KPRA 2B5IB 2XX1A 1IGCH 3TBSB 4ENEC 1MW3A 1QFWH 3BGFC 3DUSB 1PGQA 3FU8A 1QABA 3TGXA 4IK6A 4RISL 5C0FA 2CMRH 1U4EA 3OGCA 3OPZL 4HPHA 3HZMB 2P5PA 2VR5A 1BQKA 3MVSA 3EBHA 1MFBH 1VADA 3V79C 3T8XA 1KELH 2F15A 1ODUA 1WWBX 2H1PL 1LNUB 4MB3A 1ZLWH 4A39A 4PV8A 3DX0A 2X70B 3PWPB 1E5WA 2B4CC 2E4TA 3RQ3A 1TCMA 2YRPA 5HBBA 2YEZB 2M26A 5I1JH 1BVKA 2C3WA 3KWWA 4PJ7E 1GCYA 3ZZ1A 1GRWA 3VXSB 3GW6A 4U7SA 3BUQA 3QZPA 5M95B 3NUKA 5T3XL 2UX7A 5D55A 1S78D 1GW0A 2N3JA 1ULVA 4W9JC 5LNEA 4YHLL 3KBHE 1QFWI 4N8UA 3ZO9A 1ORSA 4E0RB 2WP3O 5CCGD 3IJYA 1DLHA 3HC4H 4LHUG 2OMZA 5KYWA 2FX9L 5CZKA 5HPMA 3R8BB 2EDWA 4XR8C 5F70A 2L7EA 2ZKWA 1RFDH 4X8CA 1KJ3H 2QPFA 4XP9H 1AJYA 2JV6A 2KLVA 3RZCD 1TJMA 3E8VA 4FHJA 3KGSA 3LN9A 1ZWIB 2R1XB 3IU4H 4CSZA 3HE5A 2X6UA 1SRDA 2J1XA 1JZEA 1TYJA 5J6GA 3CX5H 5A3ID 4EF3A 1GMEA 3ECVA 2XWBA 3OKDB 3B8YA 2QTEA 3IGFA 3KCWA 3UTTE 1NUGA 5BJTA 3U4AA 2HMIC 1YYCA 3MN8A 1K5NA 5F8RC 3TO4C 5MI0C 3WNIA 3QUXB 1AE6H 1BZOA 4KAQH 4Q0XH 3LZQA 2VGLM 2FCBA 2OP4L 5DHVA 1QFOA 4YDLB 1FAVA 4PTTB 1G1IA 2QVAA 4UYQA 1Q1PA 1UB5A 3RWFB 4BFIB 3V0VA 1TTGA 5HP5A 1CLYH 3DTDA 1WUNT 3RA7H 5JIKA 1KMGA 1RUPL 3KYKL 3V4PL 2V2WB 4RX4A 4FNPA 3ZUNC 4AKOA 4R7DA 3SGDH 4JFFB 5IW6B 2ZX6A 4Z7NE 1JMZA 3RIAF 2X1XR 2Z5IA 3CX5I 1NC4A 3LZRA 3VI3A 1D2PA 5JZ7C 3RDJA 1X8YA 4BFEA 3AU1B 4L76A 3CZUB 3DHPA 3IDUA 4GBXB 3Q1EA 3ULSA 4WU7A 3MLRL 4HK0A 4OGAC 3UBXB 4FTVB 1FVCB 4M7JL 3MZGB 3OJAB 2XX0A 1PIXA 3CFIC 3PJSB 5KLIB 1ZK5A 1N10A 4PJ8A 5C92A 3GI9H 4NKMB 1FH5L 3AEAC 3LH2L 2ITDA 2NNXA 4LCCC 3A0HE 1GJIA 5DO2D 3LY6A 2D3LA 5JHDE 2A83A 3UTTD 4JBZA 5KLVJ 3DXAA 1BE3G 2KNCB 4AIZA 1RK1A 3UJIL 3BRTB 4JFVA 2GY7B 3Q05A 3TPUB 3WY2A 3LEXB 2ZOKA 4F7PB 1DQQA 4IS6B 3X12B 5ITBH 1L0NE 4ZKPA 3K8MA 3KNBB 4XBPA 1YAIA 3WDHA 3J8F7 2Y36H 5DFAA 3KD4A 2EIDA 2XVLA 4OQTA 5ID1A 4TPRH 2WXIA 2WXOA 3ILDA 4DPRA 2YKLL 3FT0A 3MA9L 2X44D 3MA7B 2DMGA 4G8FB 3CC7P 3FHEA 1RH8A 2H2SC 2ZYGA 2FWLB 5DHDA 5EU5A 3A4FA 3L13A 5DVNA 1U41A 4QRSA 1NTMJ 3A22A 3Q13A 3U4BL 2WBJD 5CHXA 3RZWA 1MCOL 2G2RB 3VD7A 1WRGA 5JHLA 2CO1A 2B3IA 5FWQA 3QH3A 5C0EB 2J58A 5KSBA 2E5YA 5AVSB 5E2UH 1HHIA 4MNHB 3GYRA 5EWIL 1PL5A 3CCHA 5CLZA 5E79E 3ZE0B 5JHDD 1IAIL 4GSDH 3OKLB 1M7UA 3HEIB 5KJ4A 3QUZB 1D5MB 4P05A 3FMGL 4JANA 4PJ5B 2E46A 2VDPB 3TO2A 2B08A 1KIPA 1T20A 2JIXB 2R56H 4XNYL 1N7LA 3MHVA 2BIQA 3F5WA 5DJCA 4MZIA 3F12A 2BSED 1PG7W 1FNHA 2KZIA 4JPWL 4B3EA 3LW5J 1ZV5A 2QVKA 3HE6A 2D9QB 4K23H 4QXWA 2HSIA 1CLZL 1NIDA 1DIPA 4YXLL 2ADYA 4P0DA 2GTWA 2H0JA 4X0KA 1MF2L 5DJDB 2KLRA 1HI6B 5L4JA 5D7JB 3SFDC 4XCEB 2KLSA 2XZAH 4XTRC 4M5YL 4TLFA 1A9EB 1T1YB 1EX0A 1XGTB 4IHBA 4APQB 1RE4A 5KAQG 2RCSL 1AKJA 4HBQA 1MCIA 4M7ZC 1Y6NR 1LEKA 4WIQA 3GIVB 3OKEA 5EC1A 3FCGA 2P44B 1FE8H 1HGVA 3Q8FA 1T1XA 3US0A 3ZBMA 4DPBX 1F1DA 3BDYH 4LKXA 1I4FA 4XAWL 5FKAB 2PWEA 4GKNB 4AM0A 1GC1L 4MJIB 4BH7A 1HJCA 4TVSa 4ZUSB 2CAKA 3O9WB 1DSFH 1SQBG 1H3VA 4LAQH 5E56A 3SDAC 3HG0A 1I8LA 2ZCHH 2APTA 1HHGA 2CDEB 5BZWB 5D6DA 5DFTA 1C1EH 3T0XA 5I1DA 1W6WA 1IAOB 2ZYRA 5FA4A 5K9QG 2BC4A 3S9DB 2CGRL 5AAWA 4GW4A 1DEBA 1XF4B 2RQEA 4XP6L 4RO0A 2LHAA 5DA0B 4MHHG 3CVCA 4WEBH 3HE7C 2P7TA 1WC7A 3IJ7A 4YDIH 1G2CB 4PWIA 1T0MB 4TULL 2WPRA 2EZ0C 3BAJA 3BIBX 4G8EB 3MLTA 5F0JB 4XE0A 3PHOA 5EDXA 5FHBH 5D4QA 3OAYH 4BSWB 1BYNA 4CADB 1SYSA 1XEUA 5BV7B 1UYWH 4FQ2L 2XWRA 1NBVL 1ZHNA 4R83A 5ELIA 4U7KA 3ZTNH 2CM6A 3O2WH 4U6VL 4F7CB 1FVEB 4S11A 3ESMA 2HX7A 2WYIA 5F7AA 2NW2A 3C6EA 3EJUA 3GBML 2YMXH 7PAZA 1A47A 2JJLA 5CCGA 2J5WA 1AQHA 3V5HA 4BUGA 2ITAA 3AZUA 2YN3A 2Y7NA 5AZ2L 5LVEA 2GUVA 1BSIA 3HCVB 5FGBA 4F58H 3EXLA 2B9AA 1UQSB 3WKML 1JHKL 4BEIA 1RF1C 2BVTA 4V1DB 3G5VB 3RZCA 2XUWA 4F7MA 1GR7A 3GKZA 3H42H 4P4KC 1FO0A 2J1YA 3LCYA 1I3GH 2VSMB 2WTPA 2F1EA 3LX9A 1E9QB 3N6YA 2NPSC 5E0QA 4WI5A 5PAZA 4XPTH 5CJQH 2C0WA 1G1JA 3SDDB 2XBZA 3KLAB 3GJFK 4L29B 3RK3C 2G0KA 4XH2A 2AERT 5FEBA 1DH3A 1RE3C 1U58B 3QZWG 4PJ7A 4QRPB 1EEZB 1K85A 4GXVH 2WUBH 1TEYA 2E27H 2QJYB 3OWRA 3VM5A 1JRHH 3BKYH 1CPUA 1UXSA 1X4YA 3ITKA 2CBMA 5H37G 3KCPA 2DWSA 3QFDA 1UKTA 5LBVA 4JDTL 4PU2A 3V4VL 3QIWC 3MBWB 1TEGA 4JVPA 4XCNA 2ODIA 2DM4A 3V95A 1QSZA 3B9DA 5F72S 5KYYB 1X44A 3CWBJ 3HNTL 4OZFH 4L37B 1LT9C 2Z4QB 3WLWC 2YD0A 3CMGA 5TQ0H 1WGOA 3L2LA 3MO1B 3TM6A 1I53A 1U36A 4X4KA 4WWKD 1NCBH 1RJLB 4JM4L 1EFXA 4PJIB 3D2TA 1GPOL 2ATAA 4ODUB 4KJWD 1PJWA 3F5HA 1FZCA 3LEYH 1HYSC 5IBTH 4Z76A 1HH6B 2CDGA 1GOHA 5A2KH 4MWFB 1YC7A 4FFVD 1E8ZA 4WO0A 2SEBB 1YMMA 2XA3A 1FBIH 4HWBH 3O11B 4PM1A 1SQPJ 1OAJA 2O5YH 1NMCC 1YN7A 2GFBB 3UTTA 4UZGA 3QS2A 4QHUB 1INQA 2X2IA 3CFBA 4TRPL 3N0PB 4NQXB 4BQCA 2YMYA 3PL6D 3ML8A 1P84D 2CO2A 4DW2L 1Z9SB 5I6PA 3F7PC 2KK7A 2HH0L 4UANA 1S9XA 1HVXA 3VW3H 3FXIC 1T4KA 1P6AB 3QUML 2DWEB 3UERA 4Z1MH 3EJZD 5GGUA 2CHNA 3W67A 1BIIA 5DU7A 5CKGA 4AYSA 2RN0A 4WTZA 3CMOH 3P2TA 4DVRL 4M6ML 3VG9B 2WBJA 1SUJA 1S4XA 1PLGH 1ZHKA 3ARRA 4N8VA 2WZPD 4F8TA 3ULUC 2OR8A 4JLRA 4U1JA 2ITEA 4BWWA 3EDEA 1MREH 3BZFB 3GG2A 2XTJC 2ZSWB 3MUHL 4HUXA 4GQ9L 1FNGA 2Y5TB 1JHTA 5BRPA 5JHDA 1K4CB 3QFJB 4Z6AT 1KJVA 1XBRA 1KB5B 1USDA 1KXVC 5FK9B 3M0DC 1X5FA 2A45G 1FAKT 4FX5A 3C2AH 4ZFGL 4MA7L 3MZWB 2VITA 4JFDB 2XWTA 1H89A 2WC7A 2BSEA 4DJMA 1HL5A 4EXPX 1TMCB 2UZYA 1MLCB 4LPXA 3HS0B 2N59A 1BGYD 2FYUJ 3Q01A 3IJSB 3VDBA 3RUGB 4FG6C 2X3AA 1I7UA 2F58L 5CP3H 3ULVD 4QT5A 4ZO8A 1SNRA 3HUSC 4H1LA 3QHZL 3JT2A 1LWUB 1KY6A 3L81A 1PG7H 3NA9L 4UIKH 4YDVB 3BSZL 1ND0A 1A7QH 1FFPA 4IRZH 1QVOA 2MH4A 2CHXA 1CZ8L 2I60L 1EDQA 3P4OA 2QGEA 3SPCA 3DSFH 4JDVA 4GO6B 3CX5K 1QLRA 4JRFA 2FEJA 1A0QL 4XCFH 2Q6WB 3BH8B 3DX8B 4XPGH 4XO8A 2YBRA 3PAVA 5DZNA 3US1A 2J55A 2A9DA 4HWZA 4MBRA 3LPFA 2DLHA 1AC0A 2ZWSA 1F8TH 2L7QA 2VDNH 1YQVL 4X6CF 3JWOL 4H0GA 4H44B 4WI7A 4BSVA 5DQ9A 3VD9A 3OKKA 1U3HB 4XWOD 1FLRL 1AGCA 1IQDA 3TJEH 1CFBA 4YUEL 4P3CH 2JI2A 4IDLA 3P11L 3MRCB 4F92B 2PYFA 3Q06A 4KO5A 1UM4L 2LQRA 3Q3GA 1NTZG 1LQBC 1L0QA 1I1FB 2HVKB 4WKZB 1MAKA 5CHNB 5E8OB 3LIUA 2WW8A 3ARFD 4BZ2H 4L48A 3DX4A 5HI4C 4YAQB 3T77B 1CURA 3NGBC 5D96B 3WHXA 5KBNC 3TGUJ 2GHWB 2FWOA 3VXUE 5AW7B 1CXEA 1AD9B 3BZ5A 3U46B 2E9GA 3JTBA 1Z7JA 3OWEA 1XB8A 4HCGA 4X7SL 3L3KA 1OTSD 1JGVL 1HU8A 3H3PL 1D5XA 2VAJA 1CDCA 4MMYB 1U2YA 2MSPA 3EF7A 5AVRB 4NQCA 1MFAL 5GGVY 5L2JA 2ARJB 4U1SA 2D0HA 5T3ZE 5JW4Q 2DQIH 3N85H 4I4WB 3QQ4A 5DLML 5F9WB 2OJZL 4JZOB 3DVIA 3L7FA 4KHTL 5HVHB 1J0ZA 4IRJC 2AEWA 3BVWA 4UNTA 2HYNA 1RY7B 4E9SA 3KW7A 1HJ0A 2MNWA 2Q3XA 4JPZB 5IR1A 3V0AC 4NN5B 4GOFA 1CFQA 5BVJA 1THCA 5A2FA 1A64A 3FOMB 5HD8D 5I9QB 4MX7A 3Q1SH 3WS3B 1CWVA 4PY7B 3VXUD 4UQEA 2IX7C 4Y5YB 4JGMA 2R32A 4UIMB 4BXVA 3VFVB 3T2QA 2FRGP 4HKBB 5EBWB 2CZNA 3UP1A 5HYQA 1D6VL 4UDUB 1YUKB 1AS8A 3HZKA 4LHJB 5CJOL 2E6JA 2EEFA 4TVPE 4IHOA 4J3OD 3ZDXB 5E2VH 1T04B 5T3ZD 1S4IA 2DMBA 2YXVA 2YPVH 1X5YA 2G2PA 4KY2A 3KJ6H 3ATBA 4I88A 4ZMOA 4DIXA 3N1PC 4NAQA 1TYRA 4GG6B 1DBML 5I8CB 1KFAL 4WWKA 4CVUA 5DJ0B 2VT0A 3WV0A 3C5JA 1NGYA 2EINB 4M4RA 5AW1B 4KXCA 5K1JA 4Z7AA 2EDEA 2CKBB 5AKVA 3ILEA 3MU3A 4K2UH 2XG5B 3CDGA 2Q3AA 4YSUA 1AZZC 2OYOA 2DWYA 2QPDB 4UF7C 5DJ6B 4EN3B 3GUTA 5HYJB 5KVFH 1MH5B 3MRBB 5CSBA 2YRLA 3GJEB 2XU6A 3RUGF 3S88H 1D7DA 1SVCP 3HC3L 4H25A 3WSQH 3SCMD 3PL6A 1WD9A 4K7PL 1CI6A 2X4RA 3VOPA 2ZG1A 4TVPD 2ERJB 4ZO7A 4RGOH 4A2GA 1YYLH 1L0NK 3RKDD 2B1HH 1S3RA 3RY6C 1SMDA 4KPHL 5IHBA 2WWKO 3TASA 3KYNB 4XNDA 5IMLB 3SDXB 2Y06H 1SN5A 25C8H 1OGTA 2J88H 4ANWA 1HHHB 1XSIA 1BD2B 1U8IB 2DWDB 1NIEA 1EO7A 3T97A 1AS7A 4MQXD 2WZPA 2OQJA 3BKML 3I3DA 3NCEB 2IYPA 4JCLA 4PRHE 1LT1A 2YSSA 2EABA 1YEFL 5DC4B 3VACA 3VD1A 3I6GB 2XKNB 2FYYA 4I18A 5TGBB 5IQOA 1FGNH 3CFEB 5B66E 1A4JB 4L4TE 2I85A 3O0RH 1U2HA 2WSFJ 1FORH 1UH3A 3OAYK 4P9HL 5E99L 2P67A 1E5YA 1IM3B 3QK0A 1U8NA 3FQ2A 5E8DH 5IQMA 4JHBA 3NTCH 5GSRB 3NACH 4OQ1A 3P30L 3QDME 2N7BA 5D93C 3TONA 4WTWA 2K88A 4K15A 1HQRB 4GW5A 1A1MA 5AVVB 1KYAA 5JW5B 4K8RL 3DVNB 5I28A 1CO1A 5IEHA 4FNRA 4J2QA 1R3HB 3IE4A 4HBCL 4YFLI 4G6MH 4IFFA 2QADC 1MFVA 4YEFA 1DQJA 1ETB1 3SN6N 4KRPB 2CA4A 3VFGL 5A2CA 5GS0D 2HT3D 2EC8A 1YPZB 1L9OA 3DGGA 4LLUB 2GPZA 2V5RA 1FV1B 3DSNB 3WGVB 4G83A 1IBDA 3BH9A 4NI3A 5L7XH 1H8LA 4G3YL 3IS0X 2GBUA 1E27B 2Z92B 4PRHD 4FTDA 3ZRFC 5JHAA 1KTLB 3VXPB 3HW7A 2ICEA 1GU5A 4G70B 1F1AA 4AQ1C 3FB5B 4L4TD 4JKWA 3CH1B 3TH4T 1A3RH 3ATEA 5IB5B 4W6YB 4YPGA 3AE2C 5T33L 4PB0L 4UTAA 1MKMA 1INEL 1RZPA 1EGJA 2K9JA 4ZQKA 2EXSA 2HP4A 2TSBA 2Z4TA 2ZWKA 3ZO0A 4X6DE 1OW0C 4U3SA 4EUPB 4C83B 2KDGA 3QUYA 4XC1H 1KEML 4NFCA 2IGFH 4MXQD 3QPXH 1WBYB 1N6QH 3VTMA 3IN6A 1RHHB 3PUCA 3OSVA 5ILTL 5FGCB 3RGVC 2YPLB 3O41B 1F11A 1RIUL 2J6WA 1JFQH 1VF5D 1P5VB 4I13B 3ARFA 4JFZL 3WJLA 4U1NA 1KIQA 3GTNA 4HUWB 3M9HA 4ODBD 1AO7E 3ZL4H 4MXVE 3QXDA 2Y6TE 4WQOA 1FC2D 2MTPA 3S8GB 1GHFL 1LP9F 5BPPA 1XGUA 2MQ0A 3RILA 1VCAA 3ZDXF 3BEWA 1A6ZA 2C9PA 5I0WA 1YEDA 2NNFA 1CXLA 1SFCD 3WIHH 5AG9A 4H0HB 3CDZB 4YLQT 1JF5A 3RU8H 5IFJB 4LLMA 1Z5LB 4YL9A 1T7YA 4OQTL 2C9RA 4OD3H 4GG6F 4A7PA 5CBEB 3MNWB 2ITCA 4NUQA 1GAFL 1NH4A 1MLBA 2WMPA 5IEKA 3IGLA 4KXBA 2LLGA 2BVUA 1XF5B 2DQGH 4X9IA 3V6ZB 2X1OA 3MCKA 1G7QB 2DLIA 2V2XA 2KXPB 1UOVA 5JHLL 2Y3NA 4N2FA 4RFEB 5DMIL 5DTFA 2YMTA 4FXTA 4EZLA 3IFNL 1BYOA 4FEIA 5CCKH 1I3RA 1AO7D 1CGYA 1HZHH 1I85C 4PRPD 3NIDE 3R06A 4IJ3B 4GSUA 3VRLE 4ZUTA 3VXUA 3RL0B 3TH3T 3A6BH 3VFMB 2Y3AA 1JV2A 1T6BX 1TCRB 1ZSDA 3ZL2A 3VCLB 3MODL 3SDXF 4CVWA 2Y0CA 3C5XA 1QBLL 1EXHA 1PDKB 3V4VB 3MRLB 5AG8A 4XXDA 5I71B 2P5WB 4RGNC 3P0VL 4XN2A 5DHEA 3SQOH 4HKZH 1E9PA 1A3QA 3L9RA 1F4HA 2WQRA 2J8UB 4MLSA 3OAKA 4U1HB 3VI4E 1KC8Q 1X6LA 4BK8A 1BOYA 4NP4H 4C7NA 1AZNA 1CD9B 1AGEB 3FQNA 4J2XA 2Q7YB 1WTLA 4GEIA 5D5MB 1T22B 1VCBC 3G5XB 4XNBA 3MJ8B 5AOLA 5I18H 3EBAA 3NZUA 4ATWA 1OVUA 3IETB 2WSCH 3FO2B 2YLHA 4HIJA 5TJHA 1VL2A 4BK5C 2ATPB 1IGTA 4E36A 2GVYA 4PLKC 3FTZA 4S1SH 2DTML 3EYUL 2NZ1A 4NZJA 2PW2B 3SO3B 2C9XA 3UBXG 1YVLA 2Z93B 3GXMA 3NDYE 5TF1L 3S4SA 5H35B 1FRGL 1EJOH 3AB0B 1HCVA 4IOFC 1U9KA 1CGSL 5AKRA 3GEWB 2AI0H 1J5OH 2I8DA 3IF4A 3SCMA 1CFNA 3BUDA 1YPZF 1QASA 4AVKA 1A7RL 2VM4A 2VQUA 3OVUB 4B0MB 4DEPB 2O61B 5D7SH 3QUMB 2BSCA 1S7RB 3IKKA 1BCIA 1G9NC 3ARDB 1EAPA 3H85A 3C9IA 4U3XA 3MLVL 3HRZA 2ZOTA 3QXVA 4IKJA 1CXFA 3B9AA 4JY5L 4GAGH 4N2IA 1NAMA 4O5LH 1KJMA 3TYGL 4HS8L 1ACXA 1AY1L 5APQA 1LJMA 3QWOB 4PCKA 3L37A 1AHWA 1W0VB 3KPRB 3QE5A 4HJUA 3CFCH 4R7VA 1KCVH 3SWFA 1GK6A 3ARVA 1IRAY 2M8RA 2KLTA 2P5EE 2Q76B 4X7SH 2NCEA 3WTXA 3L70J 2AQNA 4PGZA 3VB9A 3DNKA 3MYZA 4BUHA 5ADPH 1KN2H 4JN2A 4XP1L 5E1AB 4N22A 1KTBA 3CDYA 5MENB 3TK1A 2ZKMX 1LTTC 1U8PB 1C12A 2PPFA 3L17A 4URTB 2V5SA 1XIWD 2A0LD 3GXPA 1M2VA 1F4XL 2PABA 4JE0A 1NUFA 4NQSA 8FABA 4AQ8C 4DTGL 3C60D 2AXFA 1INDL 2YN5A 3DBXA 4GRLD 1HOEA 2EECA 4ABVA 4EDWH 4UQ2B 2WQXA 1FO0L 1UM5L 4OLXL 4RMTA 1YQ4C 1Z2KA 2UUDH 1PYWA 3VWKB 2OBGA 1T2KD 3WIIL 3ARYA 5B8CA 3IFPA 1UJ3A 3KLSA 4QJ3B 1RJYB 2G60L 4MA1B 3BMWA 4G43B 4PBDA 1WF5A 1W8EA 1BOGA 1N73A 2YQBA 2DI9A 3MNZA 3OR7B 1V7MH 1RUMH 2R1WA 1HZLA 2P5ED 1A8JH 3HI5H 1U95B 1LD9A 4NAJA 4XCCH 5GGQL 1AGBB 1DUZA 3FT9A 5E4IA 1PX4A 3WE6B 3RFZB 4PRHA 3UJJH 3H56A 1KT2A 3USSA 4EPSA 2CQVA 3FHAA 4EIGB 1CG9A 2WO3B 4FG2A 3Q2WA 5I30L 4Z3IA 5T1MB 5KN5B 2XU9A 3Q2YA 4YHNA 5I8OH 3KHUA 4L4TA 2MPVA 2YKPA 3QPQC 4DKAA 5DD3L 1IM9D 1P53A 3I9AA 2WJ5A 3FFDB 2WBWB 3QDJB 3NZ8A 3MRFA 3O2DH 3PLYA 4AY0A 4DKTA 2LU7A 3D06A 3PABA 5F97E 1Z9MA 1VLXA 2FGWL 3EOBB 4WW2C 5DJ2A 1QLFA 4R6UA 4RRPM 3MRGA 3RWDB 3HN3A 3QBTB 5K69A 2GTZB 4LESA 3ULVC 4QOKE 1R34A 3KWVA 15C8H 5LGYA 2JWDA 3WG7B 1YTZT 4HXBH 4JZNB 4K7PX 3SKMA 1KYUA 3PP4H 3HMXH 2LR4A 1JMXA 4NO0D 5D70H 3T65B 1EBAA 1DO6A 5IMKB 1JZ6A 4LEOA 4BFGA 4HJIA 3V52H 4M7LT 1SFCA 4HJ1A 1VZGA 2J8UF 4FI6A 2XWEA 4YBHA 2NY5H 1AQKH 1LM8V 2EUZA 3RHWF 3SZ6A 4XZUA 1MWAA 1WZAA 3SY0A 4W68A 4YHKL 1T66C 3DUUA 3C5ZD 1OZUA 5D5MF 5FECB 4Y9CA 3QNYB 2EDKA 1G9ML 3GSWA 3R4DA 1AQ8A 5TH2A 2FFDA 4X6DA 3BMVA 4MYWB 2JF1A 4MJ6B 3QQNA 5ETUB 1ETZB 3QS3A 3AG3B 3LN5B 2C1OB 4ETQA 4B9PA 2EIJB 1WFOA 4L8DA 1DJIA 4ZZFA 5CBAB 2VJ0A 2CWRA 3CZLA 2XPYA 3DJZA 4KFMA 1DZBA 1VGEH 4MA8H 3C8KB 1NBZA 2EIMB 2IGLA 1H8AA 1I31A 1AO7A 3KL5A 4PRPA 5KLVG 3ZMRA 1AXTL 1NMBH 1ZGLA 2NXZC 4D0DA 1KZQA 4F93B 2XACC 2APSA 2FATL 3T4YA 5GPRA 3I6KB 4OVVA 3LRMA 3HNSH 1BJ1J 3APDA 2I25N 4LIQH 4MD4A 3INUH 2UV3A 3SGJA 4N1HB 1XCTA 2ZNXA 4KVCH 2CR3A 4NPKA 4R2GC 4Y4HB 3X3FL 3DPBA 2B8OT 4D9RE 5JPNB 1KGJA 3B2DC 3GF3A 4DGVH 1IEAB 1NKRA 1KQSO 1QLEH 3KYMA 3DJSA 4AGMA 4N0CC 1NTMG 4R9HA 5G55A 4HU8A 5CZVH 4EDXA 4Z7QE 4PVMA 4PGBB 4KDTC 2RMNA 4PJAA 2W9LA 2VABB 5IROC 4JM2C 2DYPD 3VP8A 3SBPA 5HHXL 1YN6B 1DUYB 2V5TA 4N1EA 4F7EA 5AZEH 5LGJA 3KYOA 3L1OL 4KKPA 2X4TB 5CMAB 4KROB 1L6ZA 1JPSL 5IG7B 1S9YB 4HUUB 5LBSA 1B9ZA 1DVUA 1BM7A 4LARL 5B1BB 3HN8A 4ADIA 1JGEB 5HI3D 1KPRB 1X3DA 2ZICA 3H7BB 4AK2A 3NZSA 3MLXL 2A77H 5GJTL 4CMHB 4KMLB 5A2LH 5C0FB 5CNHA 4P5TC 1LWHA 5MEOA 3OGCB 1NKNA 4D9RD 1E3ZA 1Q0XL 1VADB 3QIUC 2DQTL 3FTWA 4KO6A 3T8XB 2BHFA 2FECI 3ISRA 3VI4A 3D70A 2VZOA 3N43B 5FYJU 3V0JA 1G7LA 4PV8B 5M7QA 4L18A 5EEXA 4PLJC 2ZPKL 1BVKB 1Z9LA 2BHUA 3KWWB 4NC1C 4O02H 5HHMB 3JSSA 2AEMA 2GYSA 1HDMA 3REVA 3E3QC 1ZOXA 3U36A 4TSBL 5ENWA 4Y2DD 1BGXL 3NCBB 2LGNA 1ORSB 1MFCL 1JY2N 1T03L 2CHWA 3IJYB 1DLHB 4XRCA 3W0WE 2OMZB 1ZVNA 2Y7QA 5KYWB 1XIWA 5HPMB 4OFYD 2V37A 1J1DB 3L4CA 4GRLA 1YI2P 3UAFA 4HS6A 4G1MA 2EXTA 3PPSA 4U6XA 4HGWA 4CU6A 3HS8A 2QPSA 1PPJE 3U83A 2ZAEB 1XO8A 4QHNB 4X50A 3D05A 2F5BL 4N90E 5D7LA 2QHRL 5J6GB 2BEQD 3F7VA 5A6IA 2DQFA 4Z3HA 4CW1B 3P1VA 1T1WA 1EEUA 4W9KC 4PYGA 2XWBB 3EJQA 4OFVA 3AADB 3IFMA 3L4FA 3QO0A 3FL7A 4HISA 3MHZA 5BJTB 4JO4L 5EFIA 4DP5X 1YITP 2P5EA 1OT2A 1K5NB 1M6OA 2AJUH 2YJQA 4K73A 1SOXA 3W38A 3U2JA 3CGTA 1JVOA 4EI6A 5IESL 4XC3L 4JDEA 5DHVB 3TCTA 3GBNH 4GUCA 3QJOA 1UACH 2YQGA 1SY6A 4M7KL 1UB5B 5ESVA 3W0WD 3V0VB 2B39A 2OTUA 4WBAA 2NX5E 1AQDA 1QUNA 2AEQL 4G6FD 4TUKH 1BLIA 4AIXA 2F08A 3OB0H 2FEEI 2ZT9D 4PWEA 4R7DB 1IM9A 3UACA 1IFPA 4LXFA 4MXWL 3TA3C 5I5MA 4U2YA 3ET9F 4NENB 1NC4B 3SSUA 3LRLA 2H32A 3QUGA 3FSAA 3VI3B 1YEJL 1PPJD 2ZUVA 2FBJH 3EO9H 3NPSB 1RK7A 3HBQA 3ULSB 1I8UA 2BIOA 4GMSL 4N90D 1GGTA 2AJXH 3R1GH 1ZIAA 2DDQL 4FXLA 2CBPA 4FZ8H 4L3AA 3KPNA 4XA4A 1RUQL 3S37L 3CFTA 4PJ8B 3QT2A 1NTKE 2NY4C 3ATDA 3H1ZA 3CCRP 4FQLH 3RNKA 2Y07L 1IC4H 3ESUF 2ITDB 3AWFA 3BPNC 3FUDA 3UH8A 5KBKA 4HH8A 4L1BA 4DK5A 1E4HA 2A83B 5IJKC 3BWUC 4I48A 1CF8L 2DW3A 3GXIA 3DXAB 3QC6X 2IMMA 3G5YA 3RWGA 4NO0A 4D0BA 1RK1B 4GJTB 3NFQA 2JCWA 1E30A 2ZOKB 4JZJA 1DQQB 4BWTA 2EVIA 4JQIA 4UB0L 2XQYG 3HAEA 4XBPB 3F2LA 5IB2A 2HTLD 1UD8A 5ESAA 1FFQA 3W11C 2NX5D 2YK1H 2BHYA 3CWBG 5ID1B 2V8MA 3L54A 3QRGH 5B39A 4X5RA 1JN6B 4MJ2A 3C5ZA 1HC1A 1AFVL 5K9OB 4R0LC 5IJCC 2HKFH 3P73B 2IPKA 12E8H 3PHQA 2FIKA 2OTWA 5EU5B 1QNZL 4ZODA 4PJ9C 5E2WL 3EDJA 2FX8L 1AVOA 1F42A 1HSAA 5BMFL 1GZHA 3I9PA 5KBPA 1VFBB 5AUMA 3KLDA 5AVTB 3AWGA 2DQJL 4WAFA 4X8GA 3QH3B 4QOKA 3OMAB 1NTKD 1MCSA 1Q1JH 2B15A 5KSBB 1HHIB 2B5IC 3DX6A 3HN5A 4OLEA 2J44A 2WLNA 1SQPG 1IBFA 3CCHB 3UOAB 3UTZA 4ANVA 2EEAA 3MGTA 4G5ZL 4KQ4H 4AENA 3DURB 2GI0A 3NCJH 3A21A 3GMMA 3TO2B 1KIPB 1T20B 4Z78B 4OLYH 2OZ4A 1KLGA 5CM1A 5I1GL 3F5WB 5DJCB 4OGXH 4NUJA 1N18A 1VQMP 3MLSH 4BGDA 3F12B 3MLYL 4D9QE 5H4YA 3TEYA 2GM4A 4DKEH 2ZX7A 3FW6A 4G72B 3H32A 3SJVE 1LO3H 1SXAA 3CL3D 3HE6B 4U1MA 2IVFC 4X0KB 2GTWB 4WK0B 3QH9A 3RE0A 5DVPA 3WD5L 1I9EA 4MCYA 1J8HE 3PHSA 4NO5B 4AYCA 2LFEA 3Q2NA 1OSYA 2IADB 2H6OA 4A63A 1AKJB 2Y24A 5J4MA 4YE4H 2UUDK 1LEKB 3UTPE 2DYPA 3LN4A 4A66A 4ZDHA 3OKEB 3I9GL 4QY8A 5IVOA 4M56A 1S7XA 5EC1B 1V27A 3SE4C 1T1XB 3PP3K 4LKXB 4AM0B 1I4FB 4BH7B 4U6YB 4X80L 3BRDA 3U9PL 1G43A 4P5SA 3HFFA 3MGAA 4CUCA 4XN7A 3PPEA 4XMXA 1EGJL 1Z9PA 4G59C 2EH7L 2PKDA 1HHGB 3SE9H 1D7MA 4N5ED 5I1DB 5FA4B 1ASPA 2BMKA 2EDBA 3TZVD 2BC4B 3VXNA 4D9QD 2ED8A 2GW5A 3NG5A 5JQ6H 3U6RA 4GW4B 2FYUG 2IIJA 2JQAA 2BS9A 4FZEL 5SV3A 3N3EA 2HX9A 1WC7B 2P7TB 3Q2LA 2ZOOA 3WJJA 1EDIA 1J8HD 2QT6A 3MLTB 1YQ2A 5IT2L 1D2OA 5JIQA 1DZ0A 3KPSE 3TDKA 5IBLC 1JTPA 2V9RA 5AVXB 3PHOB 4MVBD 1EDJA 5LXGH 3UTPD 1BEXA 1SYSB 3RNQA 2OTKE 3RYMA 1ZHNB 2BSBA 4J5VA 4NN7B 5AB1A 5BZZA 3RJDA 4AJWA 4Y2DA 4H8WC 3VI3F 2NW2B 2VKXA 2H4EA 2AZAA 3V5HB 4H13D 1Q9WA 4GBXC 2HG5D 1ILUA 1Q9KA 4OFYA 2LV4A 3OZ9H 3GDBA 3MLUH 3BWZA 1R5VB 4GQPH 2GJJA 3HC0A 4BYHA 5KLIC 3O6LL 3VG0L 3RZCB 1PY0A 4QR7A 2BRRH 3BVUA 5AKTA 3ZMEA 1F4YH 2H6PA 4F7MB 5FM4A 1FO0B 2C9VA 1E4XH 2OARA 4XB8A 3VD4A 1CFSA 3A6OA 5BVZA 1PSKH 1XCWA 3MRHA 5K93A 2YS4A 1XDTT 2DYRB 3OLEA 4F91B 2ZOLA 4XH2B 1MRFL 3TGUG 2XN1A 3KPSD 3TL5A 1XGYH 1L6PA 4QRBA 4OFQA 5HXMA 4PJ7B 1TOXA 2NY7H 3L4YA 4OLVL 2AK4E 4NBYB 4UI2A 1BDYA 2ZP0T 3ARUA 3DJRA 1X7TA 4J1UB 4N9GB 1OK8A 4JVWA 1UH4A 4YNYA 1OW8A 2X28A 3KCPB 2WP3T 3QFDB 3HTKA 5B5EH 4YXKL 1OT1A 1D7BA 1D5IH 1V54B 1W2BO 2OX5B 1UKQA 4FJZA 4XCNB 5D9SA 2A6IA 2Y6SD 1AP2A 3W0WA 5T3ZL 5LQBL 3QHFL 5DK3A 1IGIH 4JFHE 1V3LA 1T5XA 5KSBF 1A7NH 2ZJSE 1P9MA 2C7FA 4M7LH 4GXUM 1IK9A 5E23A 4EIBA 5EMYA 32C2A 2VDMB 3HBZA 4M03A 3WL9A 3LIZA 4AT6A 3TT1L 1NCTA 3QUZC 2ADFH 3DTXA 4EUPG 4Z76B 2CDGB 3OKNA 1YECL 2XXGA 4PV1D 1ZV8A 2C34A 3ERXA 3GB7B 2DKMA 1KLUA 2AK4D 1YN7B 5HJDA 2FSEA 2ZUUA 3M1CA 3UC2A 1GGIH 3UTTB 4F37K 3FQUA 5A16A 1IBHA 1BQLL 3VYIA 1INQB 3CFBB 3N1QC 4ODXA 1MHEA 3OMZA 3B7TA 3QCTL 3OR6A 1OF2B 1P7KA 4OVUA 4HIXL 4PTUA 4QHPA 3RDTA 2OR9L 2ROYA 4S1QH 4TVPL 4PRAB 2R0KL 5D7JC 5E08H 1S9XB 2W0LA 1T4KB 1FYTE 1OO2A 2CJTA 2NY2D 2X1PA 1RV6X 2NX5A 4UOW1 4JHUA 4JFHD 4APQC 1FNFA 5GGUB 1NOFA 4ZNEA 4AYID 1ETJA 4Z7NB 1XH2A 5ABAA 4A7GA 1BIIB 1NAML 3CCLP 3NQIA 3B5ND 1WBXA 3NJVA 2R29H 4C58B 1BBDH 4JQ0D 5JXEA 2ZAGA 4NHCH 2WBJB 5K1VA 1ZHKB 4N8VB 3ZGHA 3BN3B 3RRQA 4KWUA 1OAZH 3B2MA 5KS9F 3O9WC 2GSIA 3NCCB 4JLRB 5D1ZD 4U1JB 3FU3A 3X3GL 4I0KA 3D87B 1S7WA 1EHLH 2LFGA 3I2CL 1UXLA 2Q6QA 1KCRL 1MCPH 1R4XA 1FNGB 1S3KL 4N78E 2YBGA 4IBQA 4BFOA 1QPKA 5JHDB 5EF1A 1CGWA 2MQ3A 1KJVB 5EOCJ 5H2FH 1A6WH 2AJ3B 2B1AL 2ZG3A 3T71A 5C71A 1FGVH 3GLAA 4Q58C 1N8ZA 4UUJA 2HRPH 7FABH 1WEJH 1T3FA 2VITB 3L74D 1XR8A 2KQNA 4GO8A 2XWTB 1FYTD 1ZANH 2H7WA 2UZIL 5T1DL 2C9SA 1HKLH 2GBTA 2UZYB 2AJYL 4YGAB 2W1NA 1SUHA 3I74A 3L7EA 4ODHH 4RAVA 5ABDE 9PCYA 1P4BL 2AAAA 4XBEL 3LHAA 5SX4H 1L2PA 1MJ7L 4QT5B 5GS0L 2VLJE 4PVLA 3ZHLA 4H1LB 5BV7C 3GSNA 1JCDA 2VDLH 1P84J 4PJEF 1KORA 2DQDH 3UZVA 4HIIA 2PTVA 2PYEE 5KEZA 4FMVA 1IARB 3FSWA 1ND0B 3TFKC 5L2KE 1JTOA 1K8IA 1FFPB 1A1OA 1JNNH 1QVOB 1O9WA 1HESA 3Q3DA 2E7MA 3P4OB 1OOWA 3BYYA 4JDVB 3RY4A 1MY5A 1ZLEA 2GQHA 2Y7LA 1EZVE 1E3FA 2DLEA 1U8HA 1XSJA 2G5RA 1B4TA 1BQSA 4N78D 2YBRB 1TZIA 1OM3H 4HWZB 2MNJB 3H6AA 2PP8A 4U3FG 1I3UA 4BSVB 2YAMA 1ASOA 3QUHA 5DQ9B 3SQBA 4L1TA 3OKKB 1D9KA 4E5XA 3TJHC 1QX1A 1AGCB 1IQDB 4GLRH 4L23A 5SX4I 4KH2A 2VAAA 3S37X 2C9UA 5SV4A 3TZVA 3SDDC 3GIZH 4RDBA 1P7QD 2PYFB 5D1ZI 2A5UA 4PJ7F 5FYKE 4JO8A 4JY6A 4LP8A 5KVEE 1I9JH 1SLUA 2J4WL 3PV7A 3Q3GB 3M1OA 4OVNF 2VLJD 1J18A 3OB0K 3QDGD 4PJHA 5TE7H 3MRMA 1J8HA 3LQZA 2PYED 3BCCE 4A7UA 3WHXB 3G9VA 3I56P 2AQ3A 5L2KD 2IOIA 3DRTA 4J4PD 1BGYJ 4L4VE 4XN8A 5APTA 3UDWC 4HWEH 3IMWA 3Q6GL 1XF1A 3ARBA 3K80A 4JPSA 1BZQK 2MKVA 5KYNA 3MCYA 1EZVD 4AEHH 3CV5A 3L3KB 1FDMA 4TLKA 1GW6A 1TO4A 4XXCA 1D5XB 1NIAA 3ME0A 1S7VA 4FRWA 1OCWL 3CXHE 1OCRB 2W91A 2WQVA 2W60A 3CLFL 4GLRI 1MWAL 4PRNA 4OCSH 4U0QB 3V55A 3U1CA 4H2CA 5L2JB 4U1SB 1G4MA 2NY6D 3UBXA 2V3FA 3DJ9A 1E67A 4UM9D 3S3PA 4NM4H 5EEWA 4Q9BA 3I02A 3UO1L 4KJPD 2JNZA 4PB9L 3L3OA 2QSCH 1JF1A 3L7FB 1WQVT 4XP5L 1WITA 5FYKD 2EE6A 1VIWA 3S36H 1RMFL 1QW8A 1UGNA 5DZJA 5IR1B 1BA9A 3B5TA 1CFQB 2MKLC 5BVJB 1KCWA 2H2PD 2NY3D 5TDOA 5IW1A 1P7BA 4HOZA 2JKIS 3JUZA 2RA1A 3BCCD 4YTPC 4MX7B 3KPSA 4LGSB 4FC3E 4L4VD 1MCWM 4AG4H 3KEHA 1NA8A 4JG0H 2JKWA 4XXWC 3CBRA 5HYQB 5JXAL 2Y5EA 1G5AA 1O6TA 1IKOP 2WCPA 5KOVC 1L0LK 3CXHD 4Z7NF 3EJYD 4IHOB 1SN0A 4R4BA 1CDBA 2L91A 1AZVA 2YAEA 4LSSL 4HCRA 2Z7WA 1IAMA 4ODTL 2I27N 3L4TA 3LZNA 4L3EE 5DFVD 3UG5A 3VG9C 4CAGA 5KVEH 1OPGL 5TFSL 2WGNB 3WKNA 3S1KA 2NYZA 2GBAA 5HVGB 1HL4A 4WWKB 3IRCA 1EZVI 1A21A 4OFDA 2WGXA 3C5JB 1NGYB 1KFMA 4M4RB 3EADA 2FZ3B 4FQCH 3IM1A 5GJSL 4NEHB 3CDGB 5LBSL 3GUTB 1NTKK 2OYPA 2AK4A 2JTDA 4M5ZL 3DUHA 4P5KA 1GL2D 3HS0C 3MOBL 1MOEA 2MMXA 1FL6A 3KG5A 2CO7A 4M6OL 4H25B 5HDQL 2J6EH 3PL6B 3Q6FA 4PYHA 1CI6B 2X4RB 5CS7A 1P6FA 5F9JA 2N0KA 5I8KH 1E90A 1UWEL 1LWUC 3BT2H 1FNAA 1HIML 2WIIA 3CK0H 4L3ED 3KWXA 3CCQP 4L5FH 4QTIL 4J23A 4AE1A 1NPNA 1OGTB 1MKFA 3CI9A 3WAJA 3B5NA 1JGUL 5KSAD 5E2JA 3FCBA 1UZ8B 3W39A 1YEIH 1S5LX 3T97B 1SHSA 2O5NA 4FI7A 4HKJB 3CXHI 2OQJB 1RERA 4H44C 1I75A 2YSSB 5D1ZA 2OYIA 1U3HC 3OD3A 4EBQH 4XGZB 4HSAC 1I1CA 3BRGC 1N7SD 1DBBH 2JJWA 3VYOA 4I18B 3MRQA 4KBPA 2P8MB 1VSCA 4X4YA 5CILL 4U1IA 1Q0YL 2B59A 2DQHL 4HIEA 1R5SA 4A2HA 3BISA 1XHHA 1AQMA 1U8NB 1JSYA 5ERWA 3VFSA 4D8PA 5I1CH 3JWDL 4KJMA 1F2QA 1DBJL 4R26L 1WSST 1FYTA 4GW5B 1A1MB 2GG1A 2QV2A 3K6DA 2V5YA 4XNQB 2ENQA 5D96C 5IEHB 1ES0A 1ZEAH 4AYDC 1FSKB 3GRGA 4GRMB 1KXTA 1DQJB 3V0IA 3NH7H 3EIFA 3BVXA 3LMJH 4DHLA 1KSRA 2WLIA 2F74A 1C5BH 2GK0A 3OKOA 4KDVA 3DGGB 2HLAA 1P4LA 4ODVL 5TK2A 1R9FA 2R1YA 3BPLB 3BH9B 3L70G 1WHOA 5IQNA 1PD6A 1NCWL 3W1ZA 3B2VL 2E76D 4ZS6D 1JP5A 3QZNA 1SY6L 2ICEB 1XTMA 4XCYA 5F9WC 1G0XA 4NO2A 4OGYL 5C6TH 2MCMA 2LXBA 2ZWYA 3BJLA 4XNZC 4YPGB 3V4UL 3HBGA 4A67A 5DWUL 2K9JB 4UB8H 1NWQA 3M07A 3KDMA 2OFQA 4NKQB 2IMNA 2R44A 4NN5C 4KKBC 4U3SB 4EZKA 5H37H 4KHXH 4OM1L 3KPMA 1NYHA 5LHDA 4EJ1C 2KZ1B 1G9NH 1P7QA 1YY8A 5KVGE 4NN6B 1A65A 4IIQA 4PRBA 1GDTA 4Y5YC 1RPQA 5I6XB 1F11B 1KBWA 3H9SE 2H3XC 3MX0B 3SKJH 3CLQA 3QDGA 3ARFB 2XNXA 4U1NB 1KIQB 4YDNA 4JREB 5DC9B 2XY1A 2PYEA 4MD5A 1HZKA 3FO0L 4WUKL 5GRJH 3UJTH 4HYTB 1A6UH 5L2KA 1XGUB 2E75D 2HLEB 3BEWB 1A6ZB 3HVDA 2OZNA 1YEDB 5TQ2H 2BVEA 3MPCA 3P02A 4JQIL 3ROLB 1JBJA 4AZUA 4GIPD 1W5CE 5I1AA 1H0DA 3N1FC 1B4JH 4LLMB 4MCZB 2VZTA 3HBPA 5AW4B 1UTDA 4YX2H 3AS0A 2ITCB 4ZO9A 1F58H 2OK0L 2W9EH 3VQMA 2FQGA 4PJ6A 4Z7OE 2WMPB 1KILE 4UM9A 5IEKB 2F53E 5I1HH 4OCRL 3BQVA 3M06A 2CKNA 3BAEL 5FO7B 3BLPX 3EH2A 3OG6B 1A7PL 2X5PA 2YOAA 3D4ZA 1HL8A 4E41E 2ZE0A 3MCKB 1CFTA 4FQIL 4EN3C 2OLDA 5DTFB 3TTSA 4YHML 3EOTL 4L9LA 5LAXA 1KCSH 2ZXAA 1AOZA 3H9SD 2Q7AA 3LEVH 5IY5B 5I2IA 5IWLA 4F24A 1LE9A 1NGPH 2HA1A 1MFDH 5K9KA 1YHQP 2XVGA 3R06B 3BP5A 1IFJA 3GSXA 4ZUTB 2ERJC 3VXUB 2OZ4L 1XR9A 1JV2B 2A74A 1ZSDB 2WMMA 1AMXA 3MLZH 4JKMA 4YSTA 5AOMA 3IDYB 1AACA 4QMAA 1WPCA 4LT7A 2WT7A 4BRYA 4XXDB 4FHKA 5DMGD 1ZXKA 1KILD 1E9PB 4UV4L 3L9RB 2F53D 1BFTA 2YD6A 1QVFO 2VW6A 3GXDA 5F7BA 4G42A 3B8SA 2ZKXA 2A45H 3GM0A 2UY7A 4C7NB 1MFUA 4NZRL 5MEQA 2WWNA 1U3JA 2HN7A 3FQNB 1XAUA 1RULL 4LCIH 1IX2A 2OYHC 3T6ZA 4UB6H 4JQXA 4CSSA 4P23D 4HIJB 3I9IA 1FC1A 5IF0A 2EDFA 2XQBL 5D2NE 1CGUA 1IGTB 1KCBA 2WZ6A 2Y1YA 1YY9D 3R4YA 3AROA 1R0AL 4ANXA 3LZOA 4FQJL 3HB3C 4NZTL 2R23A 4BIKA 2OGUA 2TRYA 4NLAA 4X6EA 4F8PA 2O93L 3VRJA 2DF3A 3KVDD 3H3KA 1GL2A 1GZQA 2APVA 4NQQA 5TJWK 3S4SB 3HG4A 5IBUB 3LRSA 3D2UD 3T5WA 2FL5B 1GOGA 4I8DA 1A14L 5E8NA 3SCMB 1CFNB 2WSDA 4KRPC 2A2QT 4XVSL 1NCHA 4HJ0D 1XH3A 4TTDC 3WFCL 5IQ7L 2ED9A 5ADOH 2QGBA 1ZP0C 4Y2NA 2WSCJ 2X9YA 3GXNA 3T2PA 4YZWA 5J11C 5TE4L 1KJ2H 1QSFE 1EAPB 4L3EA 3HRZB 4XPBH 4QGTA 3FU5A 2XVKA 4OIAA 2FEEL 4CC4A 1KJMB 3BATA 5IHHA 1AHWB 2ITFA 3QA3A 3U7WL 1NUDA 5KSAA 2FWUA 4L2LA 1F6FB 4PLOB 4M1CC 2ORBL 3GK8H 5F21B 1GC1C 1BYPA 4OIBA 1CLVA 2FXPA 1DFBH 3QZMA 2PWHA 2EIKB 2IAAC 2BP3A 5K59E 5APWA 3LQAL 5HTSA 4WGVB 1N7SA 1C12B 4TUJA 1BAWA 5FGSA 4Z3TA 5LO7A 2KSEA 4R8WH 2OMVB 3LSOA 1N8RQ 1J1PH 4HGKC 4PGCB 1M2VB 1CR9L 5DUBA 4NQSB 2YHGA 2O6PA 2AXFB 3DBXB 5MHSE 2Z31D 4ZJ9A 5IFHL 4NCDA 1TQCB 4GAAA 3TEWA 4H0LC 2WIMA 1IQWH 2WWKT 4Y4FD 5F7EH 3A4EA 2IG2H 1ADQA 1P5UA 2ZSVA 1BPVA 1PYWB 1FDLH 5DC0A 1G84A 1QSFD 4XMPL 4XNUL 3V6OC 2AVFA 5ITFA 1F90L 5B8CB 1XL4A 2K78A 3IFPB 1UJ3B 4B97A 2IFMA 3O4LE 5CIPH 1LTIC 4O2CA 1BOGB 3PP5A 1N73B 2XCMC 3MNZB 1ZVHA 3QJQB 4J3XA 4NSKA 4X99A 5AVYB 1G9EA 4LAJH 2R1WB 3WI9A 1VDGA 3U82B 5EBLB 1LD9B 1DUZB 3WXWH 4AUUA 2QTVA 2DB8A 1NGWA 4PRHB 43C9A 3FTXA 1KT2B 4UQAA 1G1CA 5DO8A 4L73A 3MV7E 2KS0A 1F5WA 3JTSA 1CG9B 4Z7WE 4YHNB 1C9SA 2X10A 3ARED 1T7WA 4BWUA 4L4TB 4UU9A 4JPKH 5E9AA 5LJYH 2VC2H 2X2HA 5MHSD 2HKHH 3O0LA 4M8QA 3NZ8B 3MRFB 4N0YH 1JUFA 3PABB 4G7VH 5DJ2B 1QLFB 3MRGB 3LIZL 3KQGA 4JB9H 4YDJB 2C3VA 2HFGL 4OIIH 4XODA 4IJ3C 4PP1D 1Z1WA 3CXDH 2PO6D 5CEZL 2D0FA 3RL0C 1J12A 3O4LD 3EBGA 5B1JA 3TVMA 3DARA 3IFOA 4HFUL 3ZK0A 5IFAH 1VF5B 2H43A 3O3DA 5BW7A 3SKMB 1S2EA 3MDJA 2F7QA 4G1EB 1SGKA 3HI6H 2BIMA 4B9YA 1JPEA 2YXWA 4L1SA 4RMVA 5IGXL 3N55A 1RIHL 2F5AL 2H0FA 2AABH 2O4EA 3CHQA 4MLIA 1WT5C 4JG1H 4O00A 4W1TA 4LEOB 4LC1A 2HVJB 4ASWA 3A4AA 4WGKA 2NTSP 7PCYA 3BI9X 3GF8A 4W4OA 1SFCB 2K9FB 3MV7D 3DI2B 1NGXA 1K3IA 1GH7A 4FXKA 3EYVA 1MWAB 2A3TA 3SY0B 1H3TA 2OXHA 3CXHK 1JGLL 3DUUB 3VU1A 1QSVA 3EW3B 3GSWB 2AFNA 43CAB 1RLBA 4LSUH 5FUOL 4WWID 3SOBL 1JXFA 4X6DB 4YE0A 4YSRA 3BE1L 3ARSA 1TJXA 4PJGE 1RVFL 4AQOA 5GZOD 2Y1AA 2KBGA 2CR6A 3MNDA 3QI9D 4ETQB 2GT9A 1DL7L 1KV4A 1SFDA 2AJZA 1X9UA 2OPCA 4L8DB 4YFLF 4QKXB 5F9OH 4B50A 4D9LL 4I0PD 3SO3C 1ZHLA 3GHBH 3AE5C 2WSEH 1NBZB 4J8RA 5CKAA 3H9SA 3AB0C 3QIBD 4IEFA 1DBKL 5CD5C 2AV7A 4OJYA 1YNKL 3FN0L 1AO7B 1HWTC 1PZAA 4PRPB 5CSZA 5AOZA 4EZJA 1ZGLB 3VB8A 3RBZA 1U3YA 3FFCA 4D0DB 3L8QA 4DEPC 3T4YB 4PVNA 5I6OA 3A23A 2P48B 5LG6A 1MG2C 1AVYA 2Z6FA 3JZ7A 3A6CL 4AEIH 1KV7A 2F54E 5DRWA 1J05A 4MD4B 3KYAA 1XCTB 2EC9U 4UT7L 1E4KA 4HHWA 5IHLB 3PWVA 2X4OA 3DPBB 3S35L 3QWOC 3P8CE 4MRCA 1C5CL 2VXUL 4OB5L 1OAUH 2N1TE 4KK8D 2JWYA 3PWPE 3S34L 2F53A 1BAFL 4NC2B 1MIMH 3KYMB 1NAYA 2P10A 2XIBA 1UH2A 2BVOA 1I7ZA 4MQ7A 3B4SA 2J1WA 2Y2TA 4GRWE 5GRUH 2YD5A 4KDWA 2IOMA 3NVQA 3WEBA 1PFOA 3ABMB 5LGJB 1T3UA 3O6KH 4F7EB 3KYOB 2ZOWA 3GSRA 2YFOA 4LRIC 4TQEL 5J6HA 4XNAA 3ZKMC 4HEME 3NIDB 3TYFA 5KW9H 2XTSA 4M3KB 1KQLA 2YD2A 3T6VA 1IT9L 4NPEA 3BQUC 2WXMA 2QQKH 2VZ1A 3MCLL 3L3GA 3EJPA 5BRZE 2F54D 4RAUA 3D2UA 3QCVH 4OM0H 1D5RA 3F83A 5FYLH 2YZ1A 3EH5B 3GEFA 1U6AH 4MA1C 4QJ5B 5MEOB 1SJVA 5KSUA 3QJVB 4WU5A 1XTCC 1F13A 3BXNA 5CEXB 1DHKA 3GLMA 4DAGH 2QJPB 3HG3A 2N1TD 2IGTA 3N44B 3NFSL 3VI4B 5I6NA 3ZQXA 1G7LB 2B0SH 4N87A 3RFZC 1FZMA 2X05A 2WKOA 1HH0A 2EDOA 4ODWA 3N9GL 2P49B 1R33A 4AVHA 2AJVL 2BRQA 4HF5H 2YIHA 4XPHH 5MEPA 4PSPA 3QCUH 3FUEA 4BA0A 2VLRE 4HIHB 2P1YA 3REVB 4J39A 3GFUA 3JWOC 5D2NA 3U36B 2VLKE 1JO5A 3MJWA 4I7ZB 5ENWB 3SBWA 3V5BA 2PXYD 4BD4A 3ABKB 4N8VG 4XRCB 1LO0H 3E80A 2QZ5A 2Y7QB 1QBMH 1XIWB 5DHYA 1NOHA 3HJEA 4TSAH 4MJHA 1N6VA 5BRZD 2ZYDA 4ZBJA 1IC5H 1X5GA 1G1YA 3C60B 4GRLB 3UAJD 2Z31A 2P8LA 3UABA 1B9KA 4HS6B 4G1MB 4U6XB 4HGWB 3FZUD 1KCUH 4GG8A 4Y4FA 5I0ZA 1IJ9A 1RFDL 3QJXA 3VDAA 3MTXA 1QSFA 3ECQA 1YJWP 1L0NG 3F7VB 1WBZA 2WZ7A 3GHEH 1T1WB 4EQ3A 4Z3FA 1HTLC 5AYTA 5E6SB 1KGXA 2VQ1A 1UEMA 3B2UC 1RZFH 1EDKA 3QO0B 3ALPA 5EFIB 1VENA 2P5EB 2VLRD 4H1LG 1M6OB 1TTCA 4MJ4A 4EI6B 2VLKD 5L9DH 2CK0H 4JDEB 3V7AE 1EMTH 4X6DF 4AIEA 2O5ZH 1M9SA 4RWYH 5ESVB 5CU5A 2OTUB 1GOFA 2E6PA 1AQDB 1T83A 3P0YL 5FKPA 1AE6L 2OXGA 2Z7ZA 4Q0XL 2GCYA 3ZPDA 4OZ4A 1IM9B 1MCHA 2MKWA 1M6UA 4YXDC 2P8PA 3RA7L 4EOWL 1ZA3A 3L72E 2MCAA 3QXWA 4ENED 1FZBA 4L75A 2FD6L 1MNUL 3AJ7A 2E59A 4MXVF 1ZGLP 4ZUWA 1GGCL 1SXZA 2HRHA 3KPNB 2PO6A 3WXVH 1TQBB 1T2XA 1CLOH 3O4LA 4N8PA 4P2QE 1BFVL 1HTYA 4LLHA 2DKUA 3RNKB 3SE3A 5GHWL 1PVHA 3O8ZA 3OC8A 4FMKA 2I24N 3M7FB 2N0MA 3EDKA 1TITA 5DVLA 1YEEL 3P3UA 4I48B 4Y4HC 1UA6H 3RWGB 1SJHB 2A9NH 3G5YB 4NO0B 4D0BB 4KO9A 4YGVA 4F33A 2XYBA 5JPNC 4JZJB 4ALAC 1ORQA 3HNVL 4LVHB 2EUWA 3MV7A 3HAEB 2QFRA 3KW8A 5IB2B 4QF1A 3GHGA 5ESAB 1HHKA 4LFHG 3L71E 5D72L 1NICA 4POZD 5B39B 5KJRH 3KHQA 1YNTA 1L9SA 3C5ZB 2BVQA 5F44A 3WO4B 4AYGA 2LW3A 1XXFC 2P46B 1CGVA 4WWIA 2IPKB 2Y36L 2ZJSL 3MNMA 2FIKB 3PHQB 3POCA 3PFQA 3KPLA 4PEEA 2WPVB 4QRAA 2YWZA 1Z3RA 3TIEA 2XKSA 5GZOA 3L72D 4MS8C 3IDNA 4KROC 1UURA 1HSAB 2X2JA 3P3SA 1DN2A 3QUKA 4LKCA 3VRLF 1W72A 5AUMB 4A6YH 4I0PA 4AW4A 5CLYA 5J1TC 1MRCH 4QOKB 2OCFD 4P2QD 4PS7A 4YLCA 3DX6B 3QIBA 4M1DL 2X12A 5T5FH 3AMKA 3UTZB 4MDJA 5JORA 2ZKHH 3MGTB 1F4WL 4XN9A 3UTSA 4CMHC 1J10A 2JFCA 4AENB 5K9JL 3GMMB 3BUIA 1R17A 1UM6H 5E2UL 2QEJA 2DW5A 2WYZA 4WRLA 2FAUA 4NUJB 3VI4F 2YLKA 2E0PA 3EFGA 3U30C 1Q94A 2HUEA 2HMID 4EAEA 3L71D 1ZKAA