2A45G

Crystal structure of the complex between thrombin and the central "e" region of fibrin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
48
structure length
48
Chain Sequence
SACKDSDWPFCSDEDWNYKCPSGCRMKGLIDEVNQDFTNRINKLKNSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Thrombin light chain
publication title Structural basis for sequential cleavage of fibrinopeptides upon fibrin assembly.
pubmed doi rcsb
total genus 10
structure length 48
sequence length 48
chains with identical sequence J
ec nomenclature
pdb deposition date 2005-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2a45G00
1JY2N 1JY2P 1LWUC 2OYIB 1RE4A 1N86A 2XNXA 1LT9B 1M1JC 3GHGA 1N73C 1FZEA 3BVHA 2OYHB 1W2EA 1FZFA 2HLOA 2OYIA 3HUSB 2FFDB 1RF1B 1RE4C 1FZAA 1LT9A 2H43A 1FZCB 2HODB 3GHGC 1LTJB 3H32B 1RF0A 2OYHA 1LWUB 2Z4EA 1FZBA 1JY3O 3HUSA 1RE3A 1RF1A 1FZGA 2HPCB 2OYIC 2FFDA 1JY2O 1N73B 1LT9C 1M1JB 3H32A 1FZCA 1LTJA 1RF0C 2HODA 2OYHC 2HPCA 2A45H 1LWUA 1FZCC 3HUSC 1RE3C 2FFDC 2Q9IA 2A45I 1RF1C 3GHGB 1JY3N 1M1JA 1JY3P 2A45G 1N73A 3E1IA 1LTJC 1T3UA
chains in the Genus database with same CATH superfamily
4NPEA 1SQVE 1JMMA 1LWUB 1SQBK 4IL6X 2B88A 1JMBA 2E74B 2ITAA 1MUUA 3KPEA 2QM8A 2XNXA 2FYUK 3L71G 2OYHB 4WWIA 4DOJA 4C7RA 1PP9E 4PV1C 1SQXD 1Q81Q 3HTKB 1MKMA 1SQQJ 3M0DA 1X22A 2W8ZA 3N7NA 3CX5I 4HYTB 1BSNA 3L72D 2OTLP 1EDJA 3OAKA 1IFMA 3CMEP 3H1LG 1VF5D 1BDDA 3AE9C 1H88A 3GHGC 1W2BO 4H44D 2FYNB 3IN6A 1K9MQ 3W68A 5H2FE 3CCVP 2KNCA 2JO1A 5AW4B 1N73A 5APYA 3V2NA 4AQRD 1LWUC 3CD6P 4IFDK 1P84D 4JYCA 2W27A 1HUCA 1Y8AA 3BCCG 1BGYD 1FS0E 1S3JA 2Q7CA 2AXTH 3A5TA 3V2QA 1VQLP 4U3FG 2ZFCA 2P58A 3H1HJ 3IR9A 2WSEJ 1W2EA 3RBZA 1HTLC 1URQD 1J2JB 5AW9B 5TISE 1M90Q 2KNCB 1OXZA 2PP6A 2CPSA 1KC8Q 4UB8H 4OVNF 1OW7A 4BXLA 1S5LX 3A0HH 2IBZG 3L74G 1KILD 1UIIA 1SQPK 3CMAP 2AXCA 3BASA 4OGQD 3LW5H 1BE3J 3ABVC 1SS1A 1PZQA 1KD1Q 3A3YB 4R4MA 3EQ2A 2N1TB 1KYOE 4IFMA 1JTHB 2LXCB 1EDKA 1SQXE 1NTKK 2FXPA 1LTGC 1QVFO 3AE1C 1VQ5P 3L70D 2BCCG 2JP3A 3L72E 3VP8A 3AEAC 2K37A 5KAFH 1HGVA 1KORA 5GTIH 4O9BA 1T2KD 2R3CA 1CZQA 1NTZJ 3TF5A 3SWYA 3H1KD 2BEQD 4PD4D 1P84E 3M9BA 3CC7P 1HBWA 2M5AA 2OTKE 3K5BA 2N1TC 2QJYB 3L75J 1SLQA 3RK2C 1KB9H 1RE4A 1M1KQ 4GKGA 2WSSH 1VF5B 1Y9BA 2A06E 2UWJE 3V6IA 4L76A 3G6EP 1LT9C 4H44B 1FBMA 1FOSF 1URQA 2PAJA 1M1JA 2O1JA 1L0LD 1S1CX 1HJ0A 5AW0B 1YBKA 2JEEA 1OFCX 2Q3EA 1CI6A 3VTPC 2Y0DA 1FE6A 2M5AB 1DX7A 2K1AA 4BRYA 1KILE 1OMIA 4XA4A 5KAIH 2KLVA 2H8PD 1KILA 2K9JA 1KQSO 1M57D 3LIDA 5CCGD 2KB7P 3AEBC 1SVFA 2QJKB 1USDA 1URQB 1U7MA 1YYCA 3V4QA 2ZVOB 1M1JB 5E79H 1D7MA 3CX5H 1BCCG 1S2EA 2KXPB 1VL2A 1IC2A 2WSCJ 3L70E 1VQ7P 1CI6B 2HYNA 2Q5UA 4HH2A 2BEZF 1DEEG 4BRYB 1JUNA 1NU1J 1R8EA 1JCDA 3AE3C 3BRTB 1KILB 2K9JB 1WRGA 5AVXB 3PJSK 4W80A 1YQ3C 1NKZB 2MKVA 4OGQB 1LT1A 1GW3A 3PRJA 4PD4E 3S9OA 5KKZB 1OW8A 1GDTA 2IYPA 3WU2H 2FFDC 1IK9A 2W6AA 4KJMA 3HRNA 4JBZA 5AVUB 4H0LD 3O6QA 3KDPB 3L71D 5B5EH 2KUBA 1FJPA 3CWBG 1L0ND 2QA4P 3KZIE 1BE3G 2WSEH 2WWWA 3CXHI 1L0NJ 4YXWH 1RF1C 5AW1B 3G3ZA 5KLVG 2K9YA 3A7OA 3ITKA 5CBNA 2M8RA 1L0LE 3I56P 3MUDC 3G4SP 2E75C 3GF3A 1AFOA 1ZOYC 3VOPA 3RL0D 4OGQC 2W6JH 4AUWA 4RO0A 3P32A 4WY4D 1U7JA 2R5BA 4D6TD 3O6QB 3MZWB 1NAYA 3BATA 4NPDA 2N9YB 2C9NY 3BCCD 1PGQA 3NMDA 1SQVJ 5CCGA 4U3FD 4C7NA 3BRVB 5AW8B 5APWA 4CPGA 4HJGH 1RY3A 1CW5A 1T2KC 1M8OB 3CCRP 4OWFA 3CI9A 1Q2NA 4EYYQ 3R4YA 3ZDMA 1PP9J 1J1EB 3H1IG 2AEFA 3GLMA 3VN0A 1JY3P 1VQ6P 2E5TA 1N8RQ 2B89A 2NPSC 1MZ9A 3L74D 4A7PA 2KP8A 1E5WA 2YKQA 1PGJA 2IFNA 5GTHH 3LIEA 3GHGA 3M91A 1L2PA 1HVVA 2R32A 1SQBG 1E79H 3L71E 2KIKA 4XFJA 2W6BA 1M56D 1LNQA 3JCUH 2W83C 4WBAA 4IL6H 2WTYA 1LWUA 1NTMD 2BCCD 2FYUG 3NTNA 3MIWA 1HF9A 3Q2YA 2O01N 2B87B 3H1LE 3AE7C 4ZNCA 1J1EC 3RK2D 4YXDC 1W5CE 5AW3B 5CJ0A 3S4RA 2Y9ZA 2RMZA 5CCGC 4I7ZC 2G8YA 4D6TE 2Q1KA 3KYQA 3CC4P 1IFPA 4UB8E 4H0LB 2R5DA 2YXQB 3BCCE 5B66E 1PIXA 3B71A 4ZMDA 4U3FE 3PHLA 1ZMEC 4ASVA 2P1JA 1JOCA 2OQQA 3CCEP 1AVOA 4RESB 1LTTC 3RL0g 1IFIA 2J59M 1X79B 2V7QH 3AE5C 1KYOD 2IYOA 2OTJP 2GM4A 1CSBA 3HD7D 3RL0B 3P8MC 2R3SA 3A2AA 1SQXJ 4WY4B 3TYYA 2JKVA 1LTSC 1JY2P 1EZVG 1TU3F 1JO5A 1NU1K 3L72J 5KAFE 2WPSA 2C9LY 2W90A 2IBZE 1PPJG 3L74E 5GTIE 3FXEA 4H0LC 2IX7C 4BWNA 1EXIA 1K05A 1PL5A 4OH8B 3KHUA 3Q1MA 3U1AA 1S5LH 5APSA 2HODB 1GU5A 4HB1A 1SQPG 2QRXA 2K3RA 2IPPA 3CXHH 1N7LA 1BGYJ 1BCCD 3L73G 2HPCA 1YITP 3CC2P 5CMZA 1HWTC 2OARA 5BVZA 1NTME 1N7SC 1P84I 2BCCE 2A06D 4GDOA 3RL0C 3TGUG 1YI2P 1NTKG 4WY4C 1FZBA 1GMJA 1L0NK 1QVGO 3MP7B 2N1TA 2WZ7A 3II6A 1JTHA 2A45I 3GW6A 1T3UA 3SWKA 1NAFA 4IOIH 1PP9G 1FZFA 4UB6H 1LT9A 3PTZA 3AE6C 2HPCB 2E75D 2HFED 3B5NC 3SSUA 1SQVK 3CWBD 5AW5B 1NO4A 3RK2B 3P7KA 2AEJA 4ASWA 3D6ZA 3AEDC 1HJBA 1VQOP 3AE2C 2IFMA 1KMIZ 1SFCD 3Q5SA 1LT9B 4N3YB 1MV8A 3L70J 3VMAA 3NFQA 3IF4A 2CPBA 2Y0CA 3KQGA 5CCHC 1T3JA 2GA1A 1JY3N 2ZT9D 3D71A 5DJTB 1NKNA 1VQ4P 3H1JG 3VMXA 4L74A 5H2FH 2O1KA 3FXDA 3H1KJ 5APTA 2NPSD 3HD7B 1BCCE 3PLNA 3WU2E 1FU1A 1KFNA 3JSVC 4PD4I 2Q6QA 1DH3A 1PGPA 1OX3A 1OVRA 4K3AA 3U1CA 3L4FA 1KN7A 2FFDA 1IK7A 1T6AA 1YJNP 1AJYA 4L75A 2ZYDA 3H1ID 4I1LA 4LC1A 2GUVA 1QLED 1NTMK 4IFFA 1WMKA 1SQQG 5TISH 2C0XA 1NWQA 1L0LJ 2QVAA 1K04A 1RF1A 3AEGC 2K88A 5AVSB 2POHA 2KLUA 4EOTA 4EIJA 3MUDA 2E76D 1R5SA 2L91A 1ZN5A 2GUSA 2FFDB 1SQBD 1H8AA 1Y47A 3HD7C 3EFGA 3E1RA 3CWBE 4I6MC 3FWLA 4Z1MH 2YXRB 2KS1A 1OVUA 2ZYGA 4TLFA 2B9BA 1DD3A 2FYUD 1VQ9P 3VMZA 1WT6A 1KFMA 5KLVE 5KJ7D 2ZYAA 1BGYG 1GL2C 1RF1B 3H1HG 1GU4A 3SFDC 1SP4A 1SQXK 3C1LA 2AEMA 2E75B 1PGOA 3R2PA 3VMYA 2KZJA 1JY2N 2XNDH 2IZ1A 1M7LA 1YJ9P 1QGKB 2KS1B 1GTWA 3H6PA 3D70A 4LLHA 1VDFA 3VYIA 3RK3E 3P8CD 3HE4A 1A02F 5GTHE 1FZCC 2O3JA 1OZHA 1P84H 2NPSA 1RH5B 1X8YA 1ZLLA 3Q5PA 1SFCB 1AA0A 5APUA 3OW2O 3L71J 3OJAB 3CXHD 1T8ZA 2QE7H 2A45H 3VP9A 1LTIC 3H1IE 3C8VA 4N78D 2QIWA 2ZT9B 1N86A 1EZVD 3H1LD 1RHZB 1FDMA 3RGUA 4DJGA 1N7SD 1PPJD 3H1LJ 1FZGA 3HE4B 1AQTA 4GOFA 2NPSB 1FDOA 3TK1A 2H7HA 4U7JA 3A0BH 1XTGB 2M0BA 2I8DA 4D6TJ 1MFZA 1IZNB 4ZKPA 3AE8C 2CK3H 1NTZG 1SQBE 2RN0A 2Q3IA 2Z4EA 1SQPD 1JY2O 1JNMA 1SFCC 3BCCJ 3L73D 4M3LA 3L37A 3NXSA 4U3FJ 2FYUE 3H1KG 3SWFA 1VQNP 2LR2A 1YQ4C 3TGUD 3B5ND 3LW5J 1NTKD 3L75G 2ZT9C 1FDIA 1RE3C 3N4XA 2H88C 2E76B 3RK3C 2IBZD 5AVVB 4Y99C 4I7ZB 2B87A 4WVZA 3L74J 3P8CE 3CCJP 5CCHD 4DZOA 2R44A 1ZXGA 4Y28J 1S5LE 2M3EA 2AXTE 1QL2A 2P7JA 3CXHE 2RKLA 1KB9D 4N78E 4W7YA 1G1IA 3W67A 2PGDA 1VQPP 1EZVE 3KZIH 3TNUA 1NTMJ 1L4AC 2I1JA 2BCCJ 2ZVNB 3L35A 4KT0J 2E76C 1PPJE 5AVQB 4WB4A 3B8EB 4GODA 1N7SA 2YMKA 3HUSC 1Q86Q 1IJDB 3JC22 1LTJC 1NU1G 5AVZB 2E43A 2NZ2A 1L0LK 4WY4A 3S1KA 3H1JD 1KQFB 3A0HE 4ZKUA 1SQPE 3Q3DA 4JF7A 1VQKP 1RF0C 2YKOA 5KJ7C 4LGDE 3WMM0 3L73E 2WT7A 1J1DC 1K73Q 3O8ZA 3TNUB 1LTAC 2QJPB 2WITA 2I1KA 1H89A 1AV1A 3M9QA 3TGUE 1PV3A 2YIUC 2OYIC 1N7SB 4MN4C 2WSCH 1NTKE 1S72P 5KLIB 2G3AA 3V5BA 3CCSP 2HODA 3B5NA 3CX5D 2FY8A 3SFEC 1JM0A 4XE5B 2Z5IA 2RH0A 1SQQD 1KYOI 1KQLA 2C0WA 1L0NG 2NRGA 4H13C 1GL2D 2WT7B 2FXMA 5BU8B 3MTUE 1YTZT 1A02J 4EDFA 2MJZA 2FYZA 3PP5A 5CCHA 2M3BA 3B5NB 3M06A 1GK6A 3OA7A 3WUVA 3Q5RA 2QJPC 4D6TG 4PJ0H 2PRRA 1SQVG 1BCCJ 5KLIC 3FGAD 1KZUB 1KB9E 2E74C 1QEXA 2KSJA 1OVVA 3V4WA 3L36A 5BU5A 3D6YA 5L8RJ 2QEXP 3H1HD 3KXDA 3H25A 2OYHC 3GG2A 4HKZH 1FOSE 3B4SA 1MFTA 1VQMP 1JCCA 1HGZA 2E5YA 1NVOA 2JWDA 3H1JE 1IFDA 1N73B 2O01J 1HH0A 2N9BA 1QL1A 4I2LC 1NGMB 2PFXA 4QMAA 3AEFC 5APXA 5KAIE 1VQ8P 1ZR2A 4KHXA 1YJWP 5CJ4A 2FYNC 3CCMP 5B66H 2XDJA 3FWNA 4RKUJ 1NJIQ 1BE3D 1FC2C 5AW6B 1N2DC 3CWBJ 1ZV8A 2D2CD 5E79E 3M0DC 3CX5E 5KLVD 3HD7A 1RQVA 5AVTB 1SQQE 5KLVJ 1YTZI 2WSFJ 1PFIA 3PH0A 3CLQA 2LXBA 2ZJSE 1NTMG 3HE5A 3TSIA 1FZAA 1RQUA 1GL2A 3MHVA 1BSHA 2XZRA 3I5CA 1N73C 1IFJA 2Z5HA 1S4XA 2OGUA 3AECC 2V4HA 3FX0A 1NTZD 1AVYA 3U59A 3RK3D 1LTBC 1NH4A 4GT1A 2FBWC 4GIFA 1OIPA 3WUTA 5CHXA 2KI7B 2XU6A 5CBOA 1BGYE 5B5EE 3L75D 3V2PA 1K8AQ 2JR8A 3HE5B 1FZCA 3H1HE 1NHLA 3G9RA 1GL2B 3AEEC 2FKWB 3H1IJ 2LKMA 1R5LA 2H43A 1NOHA 1SQXG 1JEKA 1DEBA 1L4AD 3CCLP 1JB0J 4EI2A 1LP1A 3L72G 3CL3D 4DT0A 1ZRTD 1Q7YQ 5TJHA 3AE4C 3M0AA 1KTMA 2IDBA 1YIJP 1Q90D 3A0BE 2KZIA 1FZCB 2JJLA 1JY3O 2P67A 1XTCC 1SQBJ 2XKMA 1BE3E 1Q82Q 2Q9IA 4DCKA 1GD2E 4GOEA 4JPZB 3IAOA 3CPWO 3BVHA 2Y9YA 1KYOH 2YO3A 2FYUJ 4RJTA 2QJYC 1SFCA 5APQA 1OW6A 3MGNA 1FJKA 1LP1B 2FXOA 1VF5C 2V7QJ 1X9VA 2A45G 2KOGA 2WPRA 2KYVA 4JYBA 1X0TA 1NU1D 4R4LA 2A06G 4H44C 2ZXEB 3MD0A 2OYOA 1GZLA 1SQQK 2H89C 3RBXA 1RE3A 2DW3A 2QSIA 3EFFK 1NTZE 4PV1D 5AW2B 1DD4A 1IO4A 3E1IA 2E42A 4H13D 2D2CB 5DJUB 5AVYB 1NYHA 3GMAA 3H1KE 1EDLA 3E7KA 1RE4C 3M9HA 2KK7A 4TT3H 3H32A 3L75E 3QH9A 4AYCA 3JCUE 2BASA 2P10A 2QJKC 4IL6E 1YHQP 1H0TA 1URQC 1M1JC 3F89A 4K35A 1Z56A 5AVRB 2E74D 1EDIA 1GW4A 4N6JA 3EWKA 3RK3B 2Y0EA 2QM7A 3L70G 1VPCA 4Y99B 1S9KD 1L4AA 2JWAA 1EZVI 1KILC 1ZRTE 2O01H 2WPQA 4W7ZA 2HLOA 3T97A 3H32B 1QX8A 3HUSA 2D2CC 5KTBA 2IZ0A 1LTJA 1H0TB 1SQPJ 2KSEA 1LJ2A 4JQ0D 1SQVD 5KKZC 3L73J 2WVRA 1G2CA 1ZP0C 2YO2A 5EFWB 1RF0A 3CCQP 1GK4A 5KJ7A 1ZR4A 2JDIH 3TGUJ 1L4AB 1NTKJ 2WSFH 2HG5D 5AW7B 2ZXXA 3T97B 5KLVK 1NU1E 1PP9D 1EXJA 3I55P 3USSA 2OYIA 3HUSB 2YKPA 1LTJB 1EQ7A 1G1JA 5M1BA 2SPZA 2WMMA 3F5HA 1G2CB 1KV4A 1L0LG 4NPFX 1BDCA 1ZW0A 2L5GB 2XV5A 4PD4H 2YMYA 1DIPA 4C7NB 2IBZI 1USEA 3GF7A 1J1DB 3TDKA 1NTZK 5C39A 4C46A 3V2RA 2WQYC 2YIUB 1IFNA 2OYIB 1FZEA 4PJ0E 1UIXA 2QG4A 2YNYA 2J5UA 1L0NE 5APVA 4YTPC 3C9IA 5AVWB 1OWAA 1LGHB 1U57A 3CCUP 1AQ5A 2J58A 4PV1B 2VRSA 4B86A 3IFMA 1KB9I 1S9KE 4H13B 4YPCA 5K5GB 4L73A 2N1TD 2OYHA 1EC5A 2ZAEB 3G71P 4UB6E 2WPVB 3H1JJ 2P2UA 1FAVA 3HTKA 2HR3A 3UIAA 3GHGB 3WUUA 3QWOC 1KQGB
chains in the Genus database with same CATH topology
1ZR2A 4KHXA 3BATA 5CJ4A 1ZN5A 2GUSA 2C9NY 2FFDB 1H8AA 2XDJA 3HD7C 3EFGA 1JMMA 1LWUB 1SQBK 3NMDA 4I6MC 5CCGA 4C7NA 5AW6B 3BRVB 1N2DC 1ZV8A 5AW8B 1MUUA 5APWA 3M0DC 3KPEA 3VMZA 1WT6A 2QM8A 3HD7A 1KFMA 2XNXA 5KJ7D 2FYUK 1RY3A 5AVTB 1CW5A 2OYHB 1T2KC 4DOJA 1GL2C 1RF1B 4C7RA 1YTZI 1PFIA 3CI9A 3CLQA 3HTKB 1GU4A 3M0DA 1SP4A 1SQXK 3N7NA 1J1EB 4HYTB 3VN0A 3HE5A 1JY3P 3TSIA 1FZAA 3R2PA 3VMYA 1JY2N 3OAKA 1IFMA 1GL2A 2XZRA 3I5CA 1N73C 1IFJA 2Z5HA 1H88A 1M7LA 1MZ9A 2NPSC 3GHGC 1GTWA 3H6PA 2KP8A 3U59A 1E5WA 2YKQA 4LLHA 1VDFA 1LTBC 2IFNA 3RK3D 3VYIA 1NH4A 3P8CD 3HE4A 1A02F 4GT1A 5AW4B 1N73A 1FZCC 5APYA 3V2NA 3LIEA 4AQRD 1LWUC 2NPSA 4GIFA 4IFDK 1X8YA 1ZLLA 3GHGA 1SFCB 4JYCA 2W27A 3M91A 1HVVA 5CHXA 2XU6A 2R32A 1HUCA 5APUA 2Q7CA 2W6BA 3A5TA 3V2PA 3V2QA 3OJAB 4WBAA 3HE5B 1FZCA 2WTYA 1NHLA 1T8ZA 2A45H 1LWUA 2ZFCA 1GL2B 3VP9A 2FKWB 1LTIC 3IR9A 4N78D 3NTNA 3MIWA 1N86A 2LKMA 1W2EA 1FDMA 1J1EC 1HTLC 1URQD 2H43A 1NOHA 3RK2D 1J2JB 1N7SD 5AW9B 1FZGA 3HE4B 1OXZA 5AW3B 1DEBA 1L4AD 5CJ0A 2NPSB 5CCGC 2PP6A 2CPSA 3CL3D 3TK1A 3KYQA 2H7HA 3M0AA 1XTGB 1MFZA 4ZKPA 1FZCB 2R5DA 1KILD 2Q3IA 2Z4EA 2JJLA 1JY3O 1JY2O 1JNMA 1SQPK 2P67A 1XTCC 1SFCC 4M3LA 2XKMA 3L37A 2Q9IA 3BASA 1GD2E 2P1JA 1JOCA 3LW5H 3NXSA 4RESB 1LTTC 3SWFA 3A3YB 3BVHA 3EQ2A 1IFIA 2YO3A 2J59M 1X79B 3B5ND 2N1TB 4IFMA 5APQA 1SFCA 2GM4A 1JTHB 3MGNA 1FJKA 1CSBA 1NTKK 3HD7D 3RL0B 1LTGC 3P8MC 3A2AA 1X9VA 1RE3C 3N4XA 2A45G 4WY4B 3TYYA 2KOGA 2WPRA 2KYVA 4JYBA 1LTSC 1JY2P 3VP8A 1JO5A 2ZXEB 1HGVA 3MD0A 1NU1K 1GZLA 3RK3C 1SQQK 2WPSA 5AVVB 4Y99C 2C9LY 4O9BA 1RE3A 1T2KD 2R3CA 1CZQA 2IX7C 5AW2B 1IO4A 3P8CE 3E1IA 2E42A 3SWYA 5CCHD 5AVYB 4DZOA 4OH8B 1RE4C 3U1AA 5APSA 3M9HA 3M9BA 2HODB 1GU5A 2IPPA 3H32A 1QL2A 1HBWA 1N7LA 4AYCA 2HPCA 2P7JA 2BASA 2N1TC 5CMZA 1SLQA 2OARA 1URQC 1HWTC 5BVZA 3RK2C 1N7SC 1RE4A 1M1JC 4N78E 4W7YA 4GKGA 1G1IA 3TNUA 3RL0C 1L4AC 2I1JA 1Z56A 3L35A 4WY4C 1FZBA 5AVRB 1L0NK 1LT9C 5AVQB 4WB4A 1FBMA 2N1TA 1FOSF 2WZ7A 1GW4A 1URQA 3B8EB 4N6JA 3RK3B 3II6A 1N7SA 3HUSC 1JTHA 2A45I 2PAJA 1IJDB 1M1JA 2QM7A 1VPCA 1LTJC 1T3UA 4Y99B 1S9KD 2O1JA 1L4AA 1KILC 1NAFA 5AVZB 5AW0B 2O01H 2E43A 2WPQA 1L0LK 4W7ZA 4WY4A 2JEEA 1FZFA 2HLOA 3T97A 1CI6A 1LT9A 3VTPC 3H32B 4ZKUA 2HPCB 3HUSA 1DX7A 5KTBA 1LTJA 4JF7A 1RF0C 4XA4A 2YKOA 2KLVA 4LGDE 5KJ7C 3WMM0 2H8PD 1KILA 2HFED 2WT7A 1J1DC 3O8ZA 3B5NC 3LIDA 3TNUB 1LTAC 1G2CA 5CCGD 2WITA 2YO2A 1SQVK 2KB7P 2I1KA 1SVFA 1H89A 3M9QA 1RF0A 1URQB 1GK4A 1NO4A 5AW5B 3RK2B 2OYIC 1N7SB 1YYCA 2WSCH 5KJ7A 3P7KA 3V4QA 1M1JB 1ZR4A 3V5BA 2HODA 3B5NA 1HJBA 1L4AB 2WSFH 2HG5D 2IFMA 5AW7B 1IC2A 1SFCD 4XE5B 2Z5IA 1CI6B 2HYNA 1LT9B 4N3YB 2Q5UA 4HH2A 5KLVK 1MV8A 2OYIA 3HUSB 1KQLA 2C0WA 3NFQA 1JUNA 2YKPA 1LTJB 1JCDA 2CPBA 1EQ7A 3BRTB 1KILB 1G1JA 1GL2D 1WRGA 3KQGA 5AVXB 5CCHC 2WT7B 1T3JA 2FXMA 5BU8B 3MTUE 1JY3N 1G2CB 4W80A 1NKZB 1YTZT 2L5GB 2XV5A 2YMYA 1A02J 1NKNA 1GW3A 4C7NB 2MJZA 2FYZA 3PP5A 3VMXA 5CCHA 1J1DB 2M3BA 3B5NB 3M06A 1GK6A 3OA7A 1NTZK 2O1KA 5APTA 2NPSD 1GDTA 3HD7B 2FFDC 1IK9A 2W6AA 4C46A 3V2RA 1FU1A 1IFNA 3HRNA 2OYIB 5AVUB 1KFNA 1FZEA 3KDPB 1KZUB 1DH3A 1FJPA 2KSJA 2YNYA 3V4WA 3L36A 3U1CA 3L4FA 5BU5A 5APVA 2FFDA 3C9IA 5AVWB 2WSEH 2WWWA 1OWAA 2OYHC 1LGHB 4I1LA 1AQ5A 2J58A 1RF1C 5AW1B 4LC1A 3G3ZA 1FOSE 2VRSA 2GUVA 3A7OA 1NTMK 4B86A 2M8RA 3IFMA 1JCCA 1S9KE 4IFFA 1HGZA 2N1TD 2C0XA 1AFOA 1NWQA 2OYHA 3VOPA 1IFDA 1RF1A 3RL0D 1N73B 1HH0A 2N9BA 4AUWA 1QL1A 5AVSB 2POHA 4I2LC 2P2UA 3P32A 1FAVA 4WY4D 3HTKA 4EOTA 3UIAA 2R5BA 3GHGB 4EIJA 3MUDA 5APXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY2 N;  1JY2 P;  1LWU C;  2OYI B;  1RE4 A;  1N86 A;  2XNX A;  1LT9 B;  1M1J C;  3GHG A;  1N73 C;  1FZE A;  3BVH A;  2OYH B;  1W2E A;  1FZF A;  2HLO A;  2OYI A;  3HUS B;  2FFD B;  1RF1 B;  1RE4 C;  1FZA A;  1LT9 A;  2H43 A;  1FZC B;  2HOD B;  3GHG C;  1LTJ B;  3H32 B;  1RF0 A;  2OYH A;  1LWU B;  2Z4E A;  1FZB A;  1JY3 O;  3HUS A;  1RE3 A;  1RF1 A;  1FZG A;  2HPC B;  2OYI C;  2FFD A;  1JY2 O;  1N73 B;  1LT9 C;  1M1J B;  3H32 A;  1FZC A;  1LTJ A;  1RF0 C;  2HOD A;  2OYH C;  2HPC A;  2A45 H;  1LWU A;  1FZC C;  3HUS C;  1RE3 C;  2FFD C;  2Q9I A;  2A45 I;  1RF1 C;  3GHG B;  1JY3 N;  1M1J A;  1JY3 P;  2A45 G;  1N73 A;  3E1I A;  1LTJ C;  1T3U A; 
#chains in the Genus database with same CATH topology
 4NPE A;  1SQV E;  1JMM A;  1LWU B;  1SQB K;  4IL6 X;  2B88 A;  1JMB A;  2E74 B;  2ITA A;  1MUU A;  3KPE A;  2QM8 A;  2XNX A;  2FYU K;  3L71 G;  2OYH B;  4WWI A;  4DOJ A;  4C7R A;  1PP9 E;  4PV1 C;  1SQX D;  1Q81 Q;  3HTK B;  1MKM A;  1SQQ J;  3M0D A;  1X22 A;  2W8Z A;  3N7N A;  3CX5 I;  4HYT B;  1BSN A;  3L72 D;  2OTL P;  1EDJ A;  3OAK A;  1IFM A;  3CME P;  3H1L G;  1VF5 D;  1BDD A;  3AE9 C;  1H88 A;  3GHG C;  1W2B O;  4H44 D;  2FYN B;  3IN6 A;  1K9M Q;  3W68 A;  5H2F E;  3CCV P;  2KNC A;  2JO1 A;  5AW4 B;  1N73 A;  5APY A;  3V2N A;  4AQR D;  1LWU C;  3CD6 P;  4IFD K;  1P84 D;  4JYC A;  2W27 A;  1HUC A;  1Y8A A;  3BCC G;  1BGY D;  1FS0 E;  1S3J A;  2Q7C A;  2AXT H;  3A5T A;  3V2Q A;  1VQL P;  4U3F G;  2ZFC A;  2P58 A;  3H1H J;  3IR9 A;  2WSE J;  1W2E A;  3RBZ A;  1HTL C;  1URQ D;  1J2J B;  5AW9 B;  5TIS E;  1M90 Q;  2KNC B;  1OXZ A;  2PP6 A;  2CPS A;  1KC8 Q;  4UB8 H;  4OVN F;  1OW7 A;  4BXL A;  1S5L X;  3A0H H;  2IBZ G;  3L74 G;  1KIL D;  1UII A;  1SQP K;  3CMA P;  2AXC A;  3BAS A;  4OGQ D;  3LW5 H;  1BE3 J;  3ABV C;  1SS1 A;  1PZQ A;  1KD1 Q;  3A3Y B;  4R4M A;  3EQ2 A;  2N1T B;  1KYO E;  4IFM A;  1JTH B;  2LXC B;  1EDK A;  1SQX E;  1NTK K;  2FXP A;  1LTG C;  1QVF O;  3AE1 C;  1VQ5 P;  3L70 D;  2BCC G;  2JP3 A;  3L72 E;  3VP8 A;  3AEA C;  2K37 A;  5KAF H;  1HGV A;  1KOR A;  5GTI H;  4O9B A;  1T2K D;  2R3C A;  1CZQ A;  1NTZ J;  3TF5 A;  3SWY A;  3H1K D;  2BEQ D;  4PD4 D;  1P84 E;  3M9B A;  3CC7 P;  1HBW A;  2M5A A;  2OTK E;  3K5B A;  2N1T C;  2QJY B;  3L75 J;  1SLQ A;  3RK2 C;  1KB9 H;  1RE4 A;  1M1K Q;  4GKG A;  2WSS H;  1VF5 B;  1Y9B A;  2A06 E;  2UWJ E;  3V6I A;  4L76 A;  3G6E P;  1LT9 C;  4H44 B;  1FBM A;  1FOS F;  1URQ A;  2PAJ A;  1M1J A;  2O1J A;  1L0L D;  1S1C X;  1HJ0 A;  5AW0 B;  1YBK A;  2JEE A;  1OFC X;  2Q3E A;  1CI6 A;  3VTP C;  2Y0D A;  1FE6 A;  2M5A B;  1DX7 A;  2K1A A;  4BRY A;  1KIL E;  1OMI A;  4XA4 A;  5KAI H;  2KLV A;  2H8P D;  1KIL A;  2K9J A;  1KQS O;  1M57 D;  3LID A;  5CCG D;  2KB7 P;  3AEB C;  1SVF A;  2QJK B;  1USD A;  1URQ B;  1U7M A;  1YYC A;  3V4Q A;  2ZVO B;  1M1J B;  5E79 H;  1D7M A;  3CX5 H;  1BCC G;  1S2E A;  2KXP B;  1VL2 A;  1IC2 A;  2WSC J;  3L70 E;  1VQ7 P;  1CI6 B;  2HYN A;  2Q5U A;  4HH2 A;  2BEZ F;  1DEE G;  4BRY B;  1JUN A;  1NU1 J;  1R8E A;  1JCD A;  3AE3 C;  3BRT B;  1KIL B;  2K9J B;  1WRG A;  5AVX B;  3PJS K;  4W80 A;  1YQ3 C;  1NKZ B;  2MKV A;  4OGQ B;  1LT1 A;  1GW3 A;  3PRJ A;  4PD4 E;  3S9O A;  5KKZ B;  1OW8 A;  1GDT A;  2IYP A;  3WU2 H;  2FFD C;  1IK9 A;  2W6A A;  4KJM A;  3HRN A;  4JBZ A;  5AVU B;  4H0L D;  3O6Q A;  3KDP B;  3L71 D;  5B5E H;  2KUB A;  1FJP A;  3CWB G;  1L0N D;  2QA4 P;  3KZI E;  1BE3 G;  2WSE H;  2WWW A;  3CXH I;  1L0N J;  4YXW H;  1RF1 C;  5AW1 B;  3G3Z A;  5KLV G;  2K9Y A;  3A7O A;  3ITK A;  5CBN A;  2M8R A;  1L0L E;  3I56 P;  3MUD C;  3G4S P;  2E75 C;  3GF3 A;  1AFO A;  1ZOY C;  3VOP A;  3RL0 D;  4OGQ C;  2W6J H;  4AUW A;  4RO0 A;  3P32 A;  4WY4 D;  1U7J A;  2R5B A;  4D6T D;  3O6Q B;  3MZW B;  1NAY A;  3BAT A;  4NPD A;  2N9Y B;  2C9N Y;  3BCC D;  1PGQ A;  3NMD A;  1SQV J;  5CCG A;  4U3F D;  4C7N A;  3BRV B;  5AW8 B;  5APW A;  4CPG A;  4HJG H;  1RY3 A;  1CW5 A;  1T2K C;  1M8O B;  3CCR P;  4OWF A;  3CI9 A;  1Q2N A;  4EYY Q;  3R4Y A;  3ZDM A;  1PP9 J;  1J1E B;  3H1I G;  2AEF A;  3GLM A;  3VN0 A;  1JY3 P;  1VQ6 P;  2E5T A;  1N8R Q;  2B89 A;  2NPS C;  1MZ9 A;  3L74 D;  4A7P A;  2KP8 A;  1E5W A;  2YKQ A;  1PGJ A;  2IFN A;  5GTH H;  3LIE A;  3GHG A;  3M91 A;  1L2P A;  1HVV A;  2R32 A;  1SQB G;  1E79 H;  3L71 E;  2KIK A;  4XFJ A;  2W6B A;  1M56 D;  1LNQ A;  3JCU H;  2W83 C;  4WBA A;  4IL6 H;  2WTY A;  1LWU A;  1NTM D;  2BCC D;  2FYU G;  3NTN A;  3MIW A;  1HF9 A;  3Q2Y A;  2O01 N;  2B87 B;  3H1L E;  3AE7 C;  4ZNC A;  1J1E C;  3RK2 D;  4YXD C;  1W5C E;  5AW3 B;  5CJ0 A;  3S4R A;  2Y9Z A;  2RMZ A;  5CCG C;  4I7Z C;  2G8Y A;  4D6T E;  2Q1K A;  3KYQ A;  3CC4 P;  1IFP A;  4UB8 E;  4H0L B;  2R5D A;  2YXQ B;  3BCC E;  5B66 E;  1PIX A;  3B71 A;  4ZMD A;  4U3F E;  3PHL A;  1ZME C;  4ASV A;  2P1J A;  1JOC A;  2OQQ A;  3CCE P;  1AVO A;  4RES B;  1LTT C;  3RL0 g;  1IFI A;  2J59 M;  1X79 B;  2V7Q H;  3AE5 C;  1KYO D;  2IYO A;  2OTJ P;  2GM4 A;  1CSB A;  3HD7 D;  3RL0 B;  3P8M C;  2R3S A;  3A2A A;  1SQX J;  4WY4 B;  3TYY A;  2JKV A;  1LTS C;  1JY2 P;  1EZV G;  1TU3 F;  1JO5 A;  1NU1 K;  3L72 J;  5KAF E;  2WPS A;  2C9L Y;  2W90 A;  2IBZ E;  1PPJ G;  3L74 E;  5GTI E;  3FXE A;  4H0L C;  2IX7 C;  4BWN A;  1EXI A;  1K05 A;  1PL5 A;  4OH8 B;  3KHU A;  3Q1M A;  3U1A A;  1S5L H;  5APS A;  2HOD B;  1GU5 A;  4HB1 A;  1SQP G;  2QRX A;  2K3R A;  2IPP A;  3CXH H;  1N7L A;  1BGY J;  1BCC D;  3L73 G;  2HPC A;  1YIT P;  3CC2 P;  5CMZ A;  1HWT C;  2OAR A;  5BVZ A;  1NTM E;  1N7S C;  1P84 I;  2BCC E;  2A06 D;  4GDO A;  3RL0 C;  3TGU G;  1YI2 P;  1NTK G;  4WY4 C;  1FZB A;  1GMJ A;  1L0N K;  1QVG O;  3MP7 B;  2N1T A;  2WZ7 A;  3II6 A;  1JTH A;  2A45 I;  3GW6 A;  1T3U A;  3SWK A;  1NAF A;  4IOI H;  1PP9 G;  1FZF A;  4UB6 H;  1LT9 A;  3PTZ A;  3AE6 C;  2HPC B;  2E75 D;  2HFE D;  3B5N C;  3SSU A;  1SQV K;  3CWB D;  5AW5 B;  1NO4 A;  3RK2 B;  3P7K A;  2AEJ A;  4ASW A;  3D6Z A;  3AED C;  1HJB A;  1VQO P;  3AE2 C;  2IFM A;  1KMI Z;  1SFC D;  3Q5S A;  1LT9 B;  4N3Y B;  1MV8 A;  3L70 J;  3VMA A;  3NFQ A;  3IF4 A;  2CPB A;  2Y0C A;  3KQG A;  5CCH C;  1T3J A;  2GA1 A;  1JY3 N;  2ZT9 D;  3D71 A;  5DJT B;  1NKN A;  1VQ4 P;  3H1J G;  3VMX A;  4L74 A;  5H2F H;  2O1K A;  3FXD A;  3H1K J;  5APT A;  2NPS D;  3HD7 B;  1BCC E;  3PLN A;  3WU2 E;  1FU1 A;  1KFN A;  3JSV C;  4PD4 I;  2Q6Q A;  1DH3 A;  1PGP A;  1OX3 A;  1OVR A;  4K3A A;  3U1C A;  3L4F A;  1KN7 A;  2FFD A;  1IK7 A;  1T6A A;  1YJN P;  1AJY A;  4L75 A;  2ZYD A;  3H1I D;  4I1L A;  4LC1 A;  2GUV A;  1QLE D;  1NTM K;  4IFF A;  1WMK A;  1SQQ G;  5TIS H;  2C0X A;  1NWQ A;  1L0L J;  2QVA A;  1K04 A;  1RF1 A;  3AEG C;  2K88 A;  5AVS B;  2POH A;  2KLU A;  4EOT A;  4EIJ A;  3MUD A;  2E76 D;  1R5S A;  2L91 A;  1ZN5 A;  2GUS A;  2FFD B;  1SQB D;  1H8A A;  1Y47 A;  3HD7 C;  3EFG A;  3E1R A;  3CWB E;  4I6M C;  3FWL A;  4Z1M H;  2YXR B;  2KS1 A;  1OVU A;  2ZYG A;  4TLF A;  2B9B A;  1DD3 A;  2FYU D;  1VQ9 P;  3VMZ A;  1WT6 A;  1KFM A;  5KLV E;  5KJ7 D;  2ZYA A;  1BGY G;  1GL2 C;  1RF1 B;  3H1H G;  1GU4 A;  3SFD C;  1SP4 A;  1SQX K;  3C1L A;  2AEM A;  2E75 B;  1PGO A;  3R2P A;  3VMY A;  2KZJ A;  1JY2 N;  2XND H;  2IZ1 A;  1M7L A;  1YJ9 P;  1QGK B;  2KS1 B;  1GTW A;  3H6P A;  3D70 A;  4LLH A;  1VDF A;  3VYI A;  3RK3 E;  3P8C D;  3HE4 A;  1A02 F;  5GTH E;  1FZC C;  2O3J A;  1OZH A;  1P84 H;  2NPS A;  1RH5 B;  1X8Y A;  1ZLL A;  3Q5P A;  1SFC B;  1AA0 A;  5APU A;  3OW2 O;  3L71 J;  3OJA B;  3CXH D;  1T8Z A;  2QE7 H;  2A45 H;  3VP9 A;  1LTI C;  3H1I E;  3C8V A;  4N78 D;  2QIW A;  2ZT9 B;  1N86 A;  1EZV D;  3H1L D;  1RHZ B;  1FDM A;  3RGU A;  4DJG A;  1N7S D;  1PPJ D;  3H1L J;  1FZG A;  3HE4 B;  1AQT A;  4GOF A;  2NPS B;  1FDO A;  3TK1 A;  2H7H A;  4U7J A;  3A0B H;  1XTG B;  2M0B A;  2I8D A;  4D6T J;  1MFZ A;  1IZN B;  4ZKP A;  3AE8 C;  2CK3 H;  1NTZ G;  1SQB E;  2RN0 A;  2Q3I A;  2Z4E A;  1SQP D;  1JY2 O;  1JNM A;  1SFC C;  3BCC J;  3L73 D;  4M3L A;  3L37 A;  3NXS A;  4U3F J;  2FYU E;  3H1K G;  3SWF A;  1VQN P;  2LR2 A;  1YQ4 C;  3TGU D;  3B5N D;  3LW5 J;  1NTK D;  3L75 G;  2ZT9 C;  1FDI A;  1RE3 C;  3N4X A;  2H88 C;  2E76 B;  3RK3 C;  2IBZ D;  5AVV B;  4Y99 C;  4I7Z B;  2B87 A;  4WVZ A;  3L74 J;  3P8C E;  3CCJ P;  5CCH D;  4DZO A;  2R44 A;  1ZXG A;  4Y28 J;  1S5L E;  2M3E A;  2AXT E;  1QL2 A;  2P7J A;  3CXH E;  2RKL A;  1KB9 D;  4N78 E;  4W7Y A;  1G1I A;  3W67 A;  2PGD A;  1VQP P;  1EZV E;  3KZI H;  3TNU A;  1NTM J;  1L4A C;  2I1J A;  2BCC J;  2ZVN B;  3L35 A;  4KT0 J;  2E76 C;  1PPJ E;  5AVQ B;  4WB4 A;  3B8E B;  4GOD A;  1N7S A;  2YMK A;  3HUS C;  1Q86 Q;  1IJD B;  3JC2 2;  1LTJ C;  1NU1 G;  5AVZ B;  2E43 A;  2NZ2 A;  1L0L K;  4WY4 A;  3S1K A;  3H1J D;  1KQF B;  3A0H E;  4ZKU A;  1SQP E;  3Q3D A;  4JF7 A;  1VQK P;  1RF0 C;  2YKO A;  5KJ7 C;  4LGD E;  3WMM 0;  3L73 E;  2WT7 A;  1J1D C;  1K73 Q;  3O8Z A;  3TNU B;  1LTA C;  2QJP B;  2WIT A;  2I1K A;  1H89 A;  1AV1 A;  3M9Q A;  3TGU E;  1PV3 A;  2YIU C;  2OYI C;  1N7S B;  4MN4 C;  2WSC H;  1NTK E;  1S72 P;  5KLI B;  2G3A A;  3V5B A;  3CCS P;  2HOD A;  3B5N A;  3CX5 D;  2FY8 A;  3SFE C;  1JM0 A;  4XE5 B;  2Z5I A;  2RH0 A;  1SQQ D;  1KYO I;  1KQL A;  2C0W A;  1L0N G;  2NRG A;  4H13 C;  1GL2 D;  2WT7 B;  2FXM A;  5BU8 B;  3MTU E;  1YTZ T;  1A02 J;  4EDF A;  2MJZ A;  2FYZ A;  3PP5 A;  5CCH A;  2M3B A;  3B5N B;  3M06 A;  1GK6 A;  3OA7 A;  3WUV A;  3Q5R A;  2QJP C;  4D6T G;  4PJ0 H;  2PRR A;  1SQV G;  1BCC J;  5KLI C;  3FGA D;  1KZU B;  1KB9 E;  2E74 C;  1QEX A;  2KSJ A;  1OVV A;  3V4W A;  3L36 A;  5BU5 A;  3D6Y A;  5L8R J;  2QEX P;  3H1H D;  3KXD A;  3H25 A;  2OYH C;  3GG2 A;  4HKZ H;  1FOS E;  3B4S A;  1MFT A;  1VQM P;  1JCC A;  1HGZ A;  2E5Y A;  1NVO A;  2JWD A;  3H1J E;  1IFD A;  1N73 B;  2O01 J;  1HH0 A;  2N9B A;  1QL1 A;  4I2L C;  1NGM B;  2PFX A;  4QMA A;  3AEF C;  5APX A;  5KAI E;  1VQ8 P;  1ZR2 A;  4KHX A;  1YJW P;  5CJ4 A;  2FYN C;  3CCM P;  5B66 H;  2XDJ A;  3FWN A;  4RKU J;  1NJI Q;  1BE3 D;  1FC2 C;  5AW6 B;  1N2D C;  3CWB J;  1ZV8 A;  2D2C D;  5E79 E;  3M0D C;  3CX5 E;  5KLV D;  3HD7 A;  1RQV A;  5AVT B;  1SQQ E;  5KLV J;  1YTZ I;  2WSF J;  1PFI A;  3PH0 A;  3CLQ A;  2LXB A;  2ZJS E;  1NTM G;  3HE5 A;  3TSI A;  1FZA A;  1RQU A;  1GL2 A;  3MHV A;  1BSH A;  2XZR A;  3I5C A;  1N73 C;  1IFJ A;  2Z5H A;  1S4X A;  2OGU A;  3AEC C;  2V4H A;  3FX0 A;  1NTZ D;  1AVY A;  3U59 A;  3RK3 D;  1LTB C;  1NH4 A;  4GT1 A;  2FBW C;  4GIF A;  1OIP A;  3WUT A;  5CHX A;  2KI7 B;  2XU6 A;  5CBO A;  1BGY E;  5B5E E;  3L75 D;  3V2P A;  1K8A Q;  2JR8 A;  3HE5 B;  1FZC A;  3H1H E;  1NHL A;  3G9R A;  1GL2 B;  3AEE C;  2FKW B;  3H1I J;  2LKM A;  1R5L A;  2H43 A;  1NOH A;  1SQX G;  1JEK A;  1DEB A;  1L4A D;  3CCL P;  1JB0 J;  4EI2 A;  1LP1 A;  3L72 G;  3CL3 D;  4DT0 A;  1ZRT D;  1Q7Y Q;  5TJH A;  3AE4 C;  3M0A A;  1KTM A;  2IDB A;  1YIJ P;  1Q90 D;  3A0B E;  2KZI A;  1FZC B;  2JJL A;  1JY3 O;  2P67 A;  1XTC C;  1SQB J;  2XKM A;  1BE3 E;  1Q82 Q;  2Q9I A;  4DCK A;  1GD2 E;  4GOE A;  4JPZ B;  3IAO A;  3CPW O;  3BVH A;  2Y9Y A;  1KYO H;  2YO3 A;  2FYU J;  4RJT A;  2QJY C;  1SFC A;  5APQ A;  1OW6 A;  3MGN A;  1FJK A;  1LP1 B;  2FXO A;  1VF5 C;  2V7Q J;  1X9V A;  2A45 G;  2KOG A;  2WPR A;  2KYV A;  4JYB A;  1X0T A;  1NU1 D;  4R4L A;  2A06 G;  4H44 C;  2ZXE B;  3MD0 A;  2OYO A;  1GZL A;  1SQQ K;  2H89 C;  3RBX A;  1RE3 A;  2DW3 A;  2QSI A;  3EFF K;  1NTZ E;  4PV1 D;  5AW2 B;  1DD4 A;  1IO4 A;  3E1I A;  2E42 A;  4H13 D;  2D2C B;  5DJU B;  5AVY B;  1NYH A;  3GMA A;  3H1K E;  1EDL A;  3E7K A;  1RE4 C;  3M9H A;  2KK7 A;  4TT3 H;  3H32 A;  3L75 E;  3QH9 A;  4AYC A;  3JCU E;  2BAS A;  2P10 A;  2QJK C;  4IL6 E;  1YHQ P;  1H0T A;  1URQ C;  1M1J C;  3F89 A;  4K35 A;  1Z56 A;  5AVR B;  2E74 D;  1EDI A;  1GW4 A;  4N6J A;  3EWK A;  3RK3 B;  2Y0E A;  2QM7 A;  3L70 G;  1VPC A;  4Y99 B;  1S9K D;  1L4A A;  2JWA A;  1EZV I;  1KIL C;  1ZRT E;  2O01 H;  2WPQ A;  4W7Z A;  2HLO A;  3T97 A;  3H32 B;  1QX8 A;  3HUS A;  2D2C C;  5KTB A;  2IZ0 A;  1LTJ A;  1H0T B;  1SQP J;  2KSE A;  1LJ2 A;  4JQ0 D;  1SQV D;  5KKZ C;  3L73 J;  2WVR A;  1G2C A;  1ZP0 C;  2YO2 A;  5EFW B;  1RF0 A;  3CCQ P;  1GK4 A;  5KJ7 A;  1ZR4 A;  2JDI H;  3TGU J;  1L4A B;  1NTK J;  2WSF H;  2HG5 D;  5AW7 B;  2ZXX A;  3T97 B;  5KLV K;  1NU1 E;  1PP9 D;  1EXJ A;  3I55 P;  3USS A;  2OYI A;  3HUS B;  2YKP A;  1LTJ B;  1EQ7 A;  1G1J A;  5M1B A;  2SPZ A;  2WMM A;  3F5H A;  1G2C B;  1KV4 A;  1L0L G;  4NPF X;  1BDC A;  1ZW0 A;  2L5G B;  2XV5 A;  4PD4 H;  2YMY A;  1DIP A;  4C7N B;  2IBZ I;  1USE A;  3GF7 A;  1J1D B;  3TDK A;  1NTZ K;  5C39 A;  4C46 A;  3V2R A;  2WQY C;  2YIU B;  1IFN A;  2OYI B;  1FZE A;  4PJ0 E;  1UIX A;  2QG4 A;  2YNY A;  2J5U A;  1L0N E;  5APV A;  4YTP C;  3C9I A;  5AVW B;  1OWA A;  1LGH B;  1U57 A;  3CCU P;  1AQ5 A;  2J58 A;  4PV1 B;  2VRS A;  4B86 A;  3IFM A;  1KB9 I;  1S9K E;  4H13 B;  4YPC A;  5K5G B;  4L73 A;  2N1T D;  2OYH A;  1EC5 A;  2ZAE B;  3G71 P;  4UB6 E;  2WPV B;  3H1J J;  2P2U A;  1FAV A;  3HTK A;  2HR3 A;  3UIA A;  3GHG B;  3WUU A;  3QWO C;  1KQG B; 
#chains in the Genus database with same CATH homology
 1ZR2 A;  4KHX A;  3BAT A;  5CJ4 A;  1ZN5 A;  2GUS A;  2C9N Y;  2FFD B;  1H8A A;  2XDJ A;  3HD7 C;  3EFG A;  1JMM A;  1LWU B;  1SQB K;  3NMD A;  4I6M C;  5CCG A;  4C7N A;  5AW6 B;  3BRV B;  1N2D C;  1ZV8 A;  5AW8 B;  1MUU A;  5APW A;  3M0D C;  3KPE A;  3VMZ A;  1WT6 A;  2QM8 A;  3HD7 A;  1KFM A;  2XNX A;  5KJ7 D;  2FYU K;  1RY3 A;  5AVT B;  1CW5 A;  2OYH B;  1T2K C;  4DOJ A;  1GL2 C;  1RF1 B;  4C7R A;  1YTZ I;  1PFI A;  3CI9 A;  3CLQ A;  3HTK B;  1GU4 A;  3M0D A;  1SP4 A;  1SQX K;  3N7N A;  1J1E B;  4HYT B;  3VN0 A;  3HE5 A;  1JY3 P;  3TSI A;  1FZA A;  3R2P A;  3VMY A;  1JY2 N;  3OAK A;  1IFM A;  1GL2 A;  2XZR A;  3I5C A;  1N73 C;  1IFJ A;  2Z5H A;  1H88 A;  1M7L A;  1MZ9 A;  2NPS C;  3GHG C;  1GTW A;  3H6P A;  2KP8 A;  3U59 A;  1E5W A;  2YKQ A;  4LLH A;  1VDF A;  1LTB C;  2IFN A;  3RK3 D;  3VYI A;  1NH4 A;  3P8C D;  3HE4 A;  1A02 F;  4GT1 A;  5AW4 B;  1N73 A;  1FZC C;  5APY A;  3V2N A;  3LIE A;  4AQR D;  1LWU C;  2NPS A;  4GIF A;  4IFD K;  1X8Y A;  1ZLL A;  3GHG A;  1SFC B;  4JYC A;  2W27 A;  3M91 A;  1HVV A;  5CHX A;  2XU6 A;  2R32 A;  1HUC A;  5APU A;  2Q7C A;  2W6B A;  3A5T A;  3V2P A;  3V2Q A;  3OJA B;  4WBA A;  3HE5 B;  1FZC A;  2WTY A;  1NHL A;  1T8Z A;  2A45 H;  1LWU A;  2ZFC A;  1GL2 B;  3VP9 A;  2FKW B;  1LTI C;  3IR9 A;  4N78 D;  3NTN A;  3MIW A;  1N86 A;  2LKM A;  1W2E A;  1FDM A;  1J1E C;  1HTL C;  1URQ D;  2H43 A;  1NOH A;  3RK2 D;  1J2J B;  1N7S D;  5AW9 B;  1FZG A;  3HE4 B;  1OXZ A;  5AW3 B;  1DEB A;  1L4A D;  5CJ0 A;  2NPS B;  5CCG C;  2PP6 A;  2CPS A;  3CL3 D;  3TK1 A;  3KYQ A;  2H7H A;  3M0A A;  1XTG B;  1MFZ A;  4ZKP A;  1FZC B;  2R5D A;  1KIL D;  2Q3I A;  2Z4E A;  2JJL A;  1JY3 O;  1JY2 O;  1JNM A;  1SQP K;  2P67 A;  1XTC C;  1SFC C;  4M3L A;  2XKM A;  3L37 A;  2Q9I A;  3BAS A;  1GD2 E;  2P1J A;  1JOC A;  3LW5 H;  3NXS A;  4RES B;  1LTT C;  3SWF A;  3A3Y B;  3BVH A;  3EQ2 A;  1IFI A;  2YO3 A;  2J59 M;  1X79 B;  3B5N D;  2N1T B;  4IFM A;  5APQ A;  1SFC A;  2GM4 A;  1JTH B;  3MGN A;  1FJK A;  1CSB A;  1NTK K;  3HD7 D;  3RL0 B;  1LTG C;  3P8M C;  3A2A A;  1X9V A;  1RE3 C;  3N4X A;  2A45 G;  4WY4 B;  3TYY A;  2KOG A;  2WPR A;  2KYV A;  4JYB A;  1LTS C;  1JY2 P;  3VP8 A;  1JO5 A;  2ZXE B;  1HGV A;  3MD0 A;  1NU1 K;  1GZL A;  3RK3 C;  1SQQ K;  2WPS A;  5AVV B;  4Y99 C;  2C9L Y;  4O9B A;  1RE3 A;  1T2K D;  2R3C A;  1CZQ A;  2IX7 C;  5AW2 B;  1IO4 A;  3P8C E;  3E1I A;  2E42 A;  3SWY A;  5CCH D;  5AVY B;  4DZO A;  4OH8 B;  1RE4 C;  3U1A A;  5APS A;  3M9H A;  3M9B A;  2HOD B;  1GU5 A;  2IPP A;  3H32 A;  1QL2 A;  1HBW A;  1N7L A;  4AYC A;  2HPC A;  2P7J A;  2BAS A;  2N1T C;  5CMZ A;  1SLQ A;  2OAR A;  1URQ C;  1HWT C;  5BVZ A;  3RK2 C;  1N7S C;  1RE4 A;  1M1J C;  4N78 E;  4W7Y A;  4GKG A;  1G1I A;  3TNU A;  3RL0 C;  1L4A C;  2I1J A;  1Z56 A;  3L35 A;  4WY4 C;  1FZB A;  5AVR B;  1L0N K;  1LT9 C;  5AVQ B;  4WB4 A;  1FBM A;  2N1T A;  1FOS F;  2WZ7 A;  1GW4 A;  1URQ A;  3B8E B;  4N6J A;  3RK3 B;  3II6 A;  1N7S A;  3HUS C;  1JTH A;  2A45 I;  2PAJ A;  1IJD B;  1M1J A;  2QM7 A;  1VPC A;  1LTJ C;  1T3U A;  4Y99 B;  1S9K D;  2O1J A;  1L4A A;  1KIL C;  1NAF A;  5AVZ B;  5AW0 B;  2O01 H;  2E43 A;  2WPQ A;  1L0L K;  4W7Z A;  4WY4 A;  2JEE A;  1FZF A;  2HLO A;  3T97 A;  1CI6 A;  1LT9 A;  3VTP C;  3H32 B;  4ZKU A;  2HPC B;  3HUS A;  1DX7 A;  5KTB A;  1LTJ A;  4JF7 A;  1RF0 C;  4XA4 A;  2YKO A;  2KLV A;  4LGD E;  5KJ7 C;  3WMM 0;  2H8P D;  1KIL A;  2HFE D;  2WT7 A;  1J1D C;  3O8Z A;  3B5N C;  3LID A;  3TNU B;  1LTA C;  1G2C A;  5CCG D;  2WIT A;  2YO2 A;  1SQV K;  2KB7 P;  2I1K A;  1SVF A;  1H89 A;  3M9Q A;  1RF0 A;  1URQ B;  1GK4 A;  1NO4 A;  5AW5 B;  3RK2 B;  2OYI C;  1N7S B;  1YYC A;  2WSC H;  5KJ7 A;  3P7K A;  3V4Q A;  1M1J B;  1ZR4 A;  3V5B A;  2HOD A;  3B5N A;  1HJB A;  1L4A B;  2WSF H;  2HG5 D;  2IFM A;  5AW7 B;  1IC2 A;  1SFC D;  4XE5 B;  2Z5I A;  1CI6 B;  2HYN A;  1LT9 B;  4N3Y B;  2Q5U A;  4HH2 A;  5KLV K;  1MV8 A;  2OYI A;  3HUS B;  1KQL A;  2C0W A;  3NFQ A;  1JUN A;  2YKP A;  1LTJ B;  1JCD A;  2CPB A;  1EQ7 A;  3BRT B;  1KIL B;  1G1J A;  1GL2 D;  1WRG A;  3KQG A;  5AVX B;  5CCH C;  2WT7 B;  1T3J A;  2FXM A;  5BU8 B;  3MTU E;  1JY3 N;  1G2C B;  4W80 A;  1NKZ B;  1YTZ T;  2L5G B;  2XV5 A;  2YMY A;  1A02 J;  1NKN A;  1GW3 A;  4C7N B;  2MJZ A;  2FYZ A;  3PP5 A;  3VMX A;  5CCH A;  1J1D B;  2M3B A;  3B5N B;  3M06 A;  1GK6 A;  3OA7 A;  1NTZ K;  2O1K A;  5APT A;  2NPS D;  1GDT A;  3HD7 B;  2FFD C;  1IK9 A;  2W6A A;  4C46 A;  3V2R A;  1FU1 A;  1IFN A;  3HRN A;  2OYI B;  5AVU B;  1KFN A;  1FZE A;  3KDP B;  1KZU B;  1DH3 A;  1FJP A;  2KSJ A;  2YNY A;  3V4W A;  3L36 A;  3U1C A;  3L4F A;  5BU5 A;  5APV A;  2FFD A;  3C9I A;  5AVW B;  2WSE H;  2WWW A;  1OWA A;  2OYH C;  1LGH B;  4I1L A;  1AQ5 A;  2J58 A;  1RF1 C;  5AW1 B;  4LC1 A;  3G3Z A;  1FOS E;  2VRS A;  2GUV A;  3A7O A;  1NTM K;  4B86 A;  2M8R A;  3IFM A;  1JCC A;  1S9K E;  4IFF A;  1HGZ A;  2N1T D;  2C0X A;  1AFO A;  1NWQ A;  2OYH A;  3VOP A;  1IFD A;  1RF1 A;  3RL0 D;  1N73 B;  1HH0 A;  2N9B A;  4AUW A;  1QL1 A;  5AVS B;  2POH A;  4I2L C;  2P2U A;  3P32 A;  1FAV A;  4WY4 D;  3HTK A;  4EOT A;  3UIA A;  2R5B A;  3GHG B;  4EIJ A;  3MUD A;  5APX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...