2A45G

Crystal structure of the complex between thrombin and the central "e" region of fibrin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
48
structure length
48
Chain Sequence
SACKDSDWPFCSDEDWNYKCPSGCRMKGLIDEVNQDFTNRINKLKNSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thrombin light chain
publication title Structural basis for sequential cleavage of fibrinopeptides upon fibrin assembly.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 10
structure length 48
sequence length 48
chains with identical sequence J
ec nomenclature
pdb deposition date 2005-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2a45G00
2FFDB 2XNXA 2OYIA 1W2EA 1RF0C 1RE4A 1FZCA 2A45I 2Q9IA 1RF1B 1FZEA 1N73B 1N86A 1LT9C 2HODB 3GHGC 2OYHB 3HUSA 1LWUC 1LT9B 1FZAA 1RE3C 3GHGB 1T3UA 1LTJA 1LWUB 3H32A 2OYIC 1M1JA 1RE4C 1FZCC 3BVHA 1JY3N 1FZBA 2HPCA 2OYIB 1JY3O 1FZCB 3HUSC 1FZFA 2HLOA 2FFDA 1JY3P 1RF1A 1N73A 3HUSB 1LTJC 2OYHC 2HODA 2A45H 2H43A 1LTJB 1RF0A 2OYHA 1JY2N 1M1JC 2A45G 1JY2O 3H32B 1LT9A 1M1JB 3GHGA 1JY2P 1FZGA 1LWUA 2HPCB 2FFDC 1RE3A 2Z4EA 1RF1C 3E1IA 1N73C
chains in the Genus database with same CATH superfamily
3L74G 3R2PA 1T2KC 2Y0CA 3B5ND 5B66E 5E79H 1L4AD 1SQPG 1SQQD 1NO4A 2ZJSE 3TYYA 1H88A 4WY4A 1HJ0A 1NU1D 3JSVC 5KLVK 3CXHH 1H8AA 1IFDA 2N1TC 2Q1KA 2QJYB 1L0NE 1EDKA 2QIWA 3P8MC 2POHA 2OQQA 1Y8AA 2KLVA 4OGQC 3M9BA 1YJ9P 1KMIZ 3B5NB 3SSUA 1L4AB 2OYHA 2A06E 1L0NK 3G6EP 1SQXE 2GUVA 2W90A 4ZMDA 3W67A 1NTZJ 2YKPA 1GD2E 4L73A 2H7HA 3IAOA 1U57A 1SQXK 3L75G 3TDKA 1M1JC 2E76C 3R4YA 1BE3J 1VQ7P 2M5AA 5KAIH 4I7ZC 2P58A 2Z5IA 5CBOA 2N9YB 1BGYG 3P8CE 4BRYA 4NPDA 2QVAA 3OA7A 4XA4A 3A3YB 1YYCA 3H1IE 1JY2O 2FYUE 1VQ6P 1LWUA 3CWBJ 2M0BA 2YMYA 5CCHA 2FYUK 2JEEA 4UB6H 4PJ0E 1VQ9P 3H1HJ 3L37A 3Q2YA 2QSIA 2YO2A 1K04A 1NAFA 3CC7P 3TGUD 2HODB 2RN0A 3KYQA 1SQQG 2KI7B 1NJIQ 1SP4A 1T6AA 1FZCB 3GF7A 2K1AA 2R3SA 3RBXA 1NU1G 4C7NB 3AEAC 1DD4A 3RK2C 3MUDA 1YJWP 2AXTE 2P7JA 5AVWB 1L0LD 1S72P 5H2FH 3VYIA 2E75D 3AE8C 3CPWO 2HLOA 2AEMA 1RF0A 1X8YA 1PFIA 1J1EC 1T3JA 1Q90D 3IR9A 1SFCA 4MN4C 5DJTB 2ZYGA 4Y99C 4L74A 2E75B 2ZYDA 3L35A 1ZR4A 2JWAA 3GHGA 3VMAA 4PV1C 1PGOA 3HTKA 1EZVD 4H44D 3H6PA 3V4WA 1G2CB 1EXIA 3HUSA 1HJBA 3M0DA 1RY3A 3L75J 5AW8B 1A02F 1P84H 4GOFA 3I5CA 3A0BE 4H44B 3TF5A 2KK7A 1NTKE 2OYOA 5CCGA 2KLUA 1N73C 2YKQA 2V7QH 2W8ZA 1NTKK 4EI2A 1HUCA 1H0TA 2PP6A 1OVVA 1FZBA 1IC2A 2WSCH 5KAFE 3QH9A 1PP9E 4TT3H 2WZ7A 1FE6A 2VRSA 2Q7CA 1USEA 2QM8A 1KN7A 4IFFA 1G1IA 2L5GB 2NZ2A 2UWJE 4U3FE 2WPRA 3CX5D 2HPCB 1RF1C 4JQ0D 3CXHE 1OIPA 1URQD 1VF5D 5AW5B 2BASA 1BGYE 3L70D 1SQBD 2Y0DA 1LTAC 3C9IA 1VQKP 4WY4C 1MFZA 3VOPA 4JF7A 1L0NG 2E5YA 2QRXA 5APUA 1KTMA 1CZQA 1URQB 1VF5B 1YJNP 1FZFA 1GZLA 1LP1A 2YXQB 3N4XA 2H43A 3B8EB 4DJGA 5K5GB 2A06G 1SQVJ 3AE2C 2OYHC 3FX0A 2QJPB 5KKZB 2QG4A 1SQQE 3H1LD 3AE9C 2RH0A 1EC5A 1OMIA 1EDJA 1JY2N 2NRGA 1T2KD 4UB8H 1SQQK 1E5WA 1GW4A 1KQSO 4A7PA 3BCCJ 2BCCJ 2IPPA 1ZR2A 1M90Q 3A5TA 1FDIA 4C7RA 3H1IG 4XE5B 2FYUG 2N1TD 1QL2A 1JTHB 3CCJP 2WITA 3B5NA 3GG2A 1LWUC 1L4AA 1AV1A 2R5DA 2FYNC 1D7MA 2L91A 2WTYA 1X22A 2FBWC 2O01N 3HD7D 5CCHC 1QGKB 3AE7C 4N78E 4M3LA 1MKMA 2AXCA 3L70G 1SQBG 1KC8Q 2J5UA 3A7OA 1NKNA 1J1DC 2E76D 2ZXXA 1HBWA 2H8PD 3FXDA 5APYA 2C0WA 2E74D 3HD7B 2QM7A 1PP9D 2PAJA 4D6TJ 3CC4P 4PD4D 3MUDC 5KLVJ 4C46A 1OVUA 1VQ5P 3BRVB 2C9LY 1SVFA 2W6AA 3L72D 1KB9H 2A45G 1M1JB 4U3FD 4XFJA 3TGUE 2E76B 3VN0A 1RF0C 2A45I 3G3ZA 4W80A 3H1LG 2E74B 3CXHD 2I1KA 1EQ7A 3OJAB 5BU8B 1Q2NA 1M7LA 4Y28J 3ZDMA 1SFCC 2HODA 3KZIH 3P7KA 1GU5A 3ABVC 1SQXJ 3EWKA 4DZOA 1S5LE 2Y0EA 3MP7B 1L0LE 3RL0C 1FZCA 3GHGC 2JWDA 1X79B 2ITAA 4GDOA 4C7NA 3JCUE 2OYIB 3HUSC 3CCMP 1L0LK 3M0DC 5CJ0A 1VQ8P 2OTLP 3HE4B 2IZ0A 3FWLA 1Y9BA 2HR3A 3JC22 2I1JA 5KLIC 4DT0A 3G71P 3HRNA 2JR8A 1NTKG 2ZXEB 3L36A 1OXZA 1EZVE 2P67A 3M0AA 5GTHH 1IFJA 1EXJA 3L73D 4H0LC 1LGHB 5CCGC 2XNDH 2PFXA 2YO3A 2E5TA 3V6IA 4PV1D 1Q7YQ 3VMZA 1G2CA 2WT7B 1QVGO 2IFMA 1PP9G 2Q6QA 2AEJA 3D6ZA 1NTMJ 1E79H 3A0HH 5CJ4A 1BDDA 1HGZA 3L72G 4GOEA 1QL1A 2W83C 4U3FG 1NH4A 1N7LA 3CCLP 4PV1B 3CCUP 1YI2P 1S9KE 2YIUC 5CBNA 3CXHI 1OX3A 4N78D 2QA4P 3AEDC 2MKVA 3O6QB 3H1JE 2WSEJ 1KFNA 1LTBC 3BATA 3NTNA 4H13D 4EYYQ 1JOCA 3KPEA 1PGQA 1KQGB 5AVZB 2IX7C 2RMZA 3CCEP 4HB1A 1S2EA 3V2PA 4B86A 1HWTC 3L71D 1JY3P 3G9RA 3GMAA 3RK3D 3H1KD 5TISH 3CX5E 1G1JA 3V5BA 1CW5A 1VPCA 4GKGA 4H13B 2Y9YA 1M56D 2BCCD 3BCCD 3VP8A 3L70E 2I8DA 2MJZA 1SQBE 2HPCA 3LIDA 2JO1A 4BWNA 4ASVA 3EQ2A 1LNQA 1FZGA 3RK3B 1NTZE 5DJUB 2FKWB 5AVVB 1SQBK 3L74J 5AVQB 5L8RJ 2Z5HA 3Q1MA 1P84D 2O1KA 1QVFO 1NTKJ 1SQPJ 1ZXGA 5AVRB 1HGVA 1MZ9A 1VQOP 1TU3F 1AVOA 1BE3E 1M57D 1URQA 1OW8A 4YTPC 1LTIC 1IFPA 2QJYC 1W2EA 1N8RQ 1JCCA 3H1LE 1LT9B 2M3EA 1YHQP 2IYPA 1WRGA 1YQ4C 1NYHA 1RH5B 1N7SD 1RE3A 2IFNA 3GLMA 2D2CD 1RQUA 1OZHA 3TK1A 1R5LA 2AEFA 1ZOYC 1FAVA 1J2JB 3EFGA 1KILD 1KB9E 1GTWA 2WSSH 1OFCX 2FXMA 1JUNA 5TJHA 4KJMA 2O01J 1N7SB 1JEKA 1GK6A 1PV3A 1ZV8A 3L71G 3H25A 2D2CB 4KHXA 1BGYJ 1JTHA 1H89A 1BCCD 1WT6A 1RQVA 1JY2P 3KZIE 2E43A 2XDJA 5AVSB 2G8YA 2K3RA 3TGUG 3E1IA 1ZMEC 1KILB 2Q9IA 1VL2A 1QEXA 3KXDA 3S9OA 2FY8A 3AE3C 1XTCC 1S9KD 2IZ1A 5AW6B 3TNUB 3U1CA 2KSJA 3FGAD 2GA1A 2C9NY 3H1JD 2K9JB 1VQNP 1L0LG 1PPJE 2FFDB 4PD4E 1QLED 3CCQP 1MFTA 1GL2D 1ZRTD 2WSFJ 2Q3EA 1SQQJ 1FZCC 1P84I 2JDIH 5E79E 3HD7A 2LKMA 3L72E 2GUSA 1OW7A 1NU1J 2NPSA 2R3CA 4TLFA 2W6BA 2G3AA 2LR2A 5AVXB 4IL6H 2YMKA 1M1JA 2IBZD 1R8EA 1GL2B 3I55P 3Q5SA 4ZKUA 3OW2O 1FBMA 1EZVG 3RGUA 1IJDB 1SLQA 5KJ7D 2CK3H 1EZVI 2FYZA 4JPZB 4Z1MH 5AW7B 1FDMA 4CPGA 1NTZD 3F89A 1NTMD 1LTJA 3BVHA 3USSA 1VQMP 3G4SP 2E75C 1S3JA 1X0TA 1IK7A 3RL0D 4HYTB 1S4XA 3LIEA 4IL6X 3SWFA 2OYIA 3MGNA 1BE3D 1SS1A 5KAIE 1FZAA 1NOHA 2J58A 3HE4A 1LTTC 2KZJA 3OAKA 3WUVA 2QJKB 1VQPP 3O8ZA 4I2LC 2KSEA 4LLHA 4GIFA 3HE5B 3L73E 2YNYA 1JNMA 3AE5C 3WUUA 2PRRA 4GODA 1YTZT 3CWBD 3E7KA 4H44C 4PJ0H 1KZUB 3H1JG 2C0XA 1DD3A 4UB6E 3VP9A 3H1HD 4QMAA 3TGUJ 1KB9D 3KDPB 4OGQD 3AEGC 2O3JA 2WT7A 1NHLA 2YXRB 2OTKE 1NWQA 3H32B 3C8VA 2AXTH 3T97B 3CX5I 2XNXA 1IO4A 2N1TB 3L74D 4OWFA 4GT1A 5C39A 1K9MQ 5H2FE 2WSEH 5APSA 4OGQB 2B87B 2A45H 3QWOC 1Z56A 4N6JA 4DCKA 2E42A 5APWA 2ZAEB 1NTZG 3NFQA 1KYOH 3O6QA 1RE4A 3VMXA 1PPJD 3Q3DA 4N3YB 3LW5J 3L71E 3AE4C 3S4RA 3RK3E 3H1KE 3MD0A 1IFIA 1BE3G 3ITKA 4AYCA 2KNCB 3BCCE 2BCCE 2KOGA 1KV4A 1FJPA 4I7ZB 1L0NJ 5B5EH 1VF5C 5AW1B 2KB7P 1L2PA 1K8AQ 3CCSP 2KZIA 3L75D 1YQ3C 2WVRA 3M06A 4EIJA 3CWBG 1JCDA 4OVNF 4EDFA 2KS1B 2QJPC 5KKZC 3IFMA 1P84E 3M91A 1RE3C 4ASWA 2ZT9C 1JY3O 3C1LA 3E1RA 3RK2D 3EFFK 5CHXA 1KB9I 2YKOA 1IFMA 1A02J 2ZVOB 5KAFH 1JMBA 2XV5A 2H89C 1LT9A 1IFNA 3H1IJ 2FYUJ 2BEQD 3RK2B 1IK9A 4D6TE 5KLVE 4JYCA 1AVYA 1JM0A 1PGPA 5AW4B 3MIWA 4HJGH 1KILE 3A2AA 1OWAA 2ZFCA 3CC2P 4IFDK 1NKZB 1J1EB 3CMEP 1PPJG 3AEFC 2O01H 3AE6C 3CMAP 3S1KA 4IL6E 4PD4I 3L70J 1SQBJ 1BCCE 1Q81Q 2BEZF 4Y99B 1PGJA 1GMJA 1N7SA 2DW3A 3WU2H 3HD7C 4AUWA 4YPCA 1FC2C 4NPFX 2NPSC 1CI6B 1T3UA 4L76A 4W7ZA 4W7YA 3SFDC 1KILA 3V2QA 1DEBA 1ZRTE 1KORA 3PTZA 5AW2B 3TNUA 2WSFH 1FOSE 1SQVD 2E74C 5AVYB 3H1LJ 2LXCB 2KYVA 2K9JA 1X9VA 1Q86Q 1YITP 2LXBA 2FFDA 2OARA 1CSBA 1LTJC 1ZW0A 2KP8A 1KQLA 4UB8E 4RO0A 2R5BA 1N73B 2IYOA 2WPVB 3RBZA 2IBZE 2OYIC 3W68A 1UIXA 3L73G 1S1CX 3MHVA 3CL3D 1GL2A 1N86A 1OVRA 1NTME 1MUUA 3KHUA 3PJSK 2Q3IA 4K3AA 2K88A 4K35A 1U7MA 2FXPA 1XTGB 5CMZA 1NTZK 2SPZA 1NTMK 4I6MC 1Q82Q 4WY4D 1DIPA 5APQA 1RF1B 5AW0B 5EFWB 5GTIH 1BDCA 3B5NC 1DX7A 1DEEG 5APVA 1L4AC 1QX8A 3AEEC 4U7JA 3CCVP 5KJ7A 3VMYA 2W6JH 1PP9J 2Y9ZA 3CWBE 1KYOE 3D70A 4WY4B 2B89A 2XKMA 1VQ4P 1U7JA 4D6TD 1ZN5A 3WUTA 3HE5A 5KLVD 4YXWH 3M9HA 3VTPC 3L72J 1M1KQ 3L4FA 3N7NA 3H1HE 3FXEA 3Q5RA 4U3FJ 4NPEA 1SQVG 3V2NA 3MTUE 1W2BO 2P1JA 1FU1A 2OYHB 1LTGC 3GW6A 3B4SA 5B5EE 1L0ND 1RE4C 1LJ2A 2W27A 3H1KG 2IDBA 1FOSF 2H88C 2ZVNB 1S5LH 1VQLP 4R4MA 2A06D 3L74E 1SQXD 1AQTA 3U1AA 3BCCG 2BCCG 3JCUH 3H32A 4JYBA 2KUBA 5APTA 1SQPE 1JY3N 3T97A 3D71A 2M5AB 5CCHD 4RESB 1KQFB 4DOJA 2N1TA 4BRYB 4H13C 1HVVA 1SQPK 4BXLA 2B87A 4WWIA 5B66H 2R44A 3LW5H 2J59M 2PGDA 1LWUB 2XU6A 2FYNB 4HH2A 1S5LX 3P32A 4HKZH 3P8CD 2WPQA 2O1JA 4WBAA 2HFED 1RHZB 3RK3C 3H1ID 3L73J 2FYUD 5GTHE 3SFEC 3FWNA 1AJYA 1KFMA 1YTZI 4KT0J 3L75E 2KNCA 2CPSA 1J1DB 1JMMA 3M9QA 2M3BA 2RKLA 2CPBA 1R5SA 4D6TG 1LT9C 3CI9A 5KLVG 1LTSC 3A0HE 2V4HA 1SFCD 2WWWA 1KD1Q 3CD6P 3TSIA 1HF9A 3AEBC 1WMKA 2KS1A 3AECC 3WU2E 2P10A 3B71A 4WVZA 2ZT9D 1VDFA 1M8OB 2P2UA 2ZYAA 1FS0E 3BASA 2KXPB 1BCCG 3CLQA 2R32A 2B88A 3BRTB 5AVUB 1SFCB 5AVTB 1FJKA 3UIAA 1SQXG 1N7SC 3PP5A 3RL0B 2GM4A 1T8ZA 3GHGB 5AW3B 1JB0J 1KYOD 2D2CC 3HTKB 3V2RA 4RKUJ 3L71J 4IFMA 2ZT9B 2FXOA 3H1KJ 1NU1E 3CX5H 3SWKA 3HUSB 4WB4A 1LT1A 1ZP0C 1DH3A 5TISE 1JO5A 4H0LD 1AQ5A 4O9BA 1KILC 5KTBA 1PZQA 1YBKA 5CCGD 1GU4A 2WPSA 3WMM0 5BU5A 3V4QA 1NU1K 2XZRA 5KLIB 2OTJP 1BSNA 2JJLA 2OGUA 1NGMB 4EOTA 1N2DC 4L75A 4OH8B 2QE7H 2FFDC 2Z4EA 2M8RA 2KIKA 4ZKPA 1PL5A 4R4LA 1L0LJ 1FDOA 4AQRD 4H0LB 1AA0A 1NAYA 2IBZG 1ZLLA 3RL0g 2HG5D 5BVZA 4LGDE 2IBZI 2HYNA 1GK4A 1NTKD 1SQPD 3PH0A 2B9BA 1H0TB 3PHLA 1CI6A 1PIXA 2NPSD 1SQVE 1NTMG 2V7QJ 3AE1C 1K05A 1GL2C 4YXDC 5GTIE 3IF4A 1SQVK 1OW6A 2WSCJ 2N9BA 1AFOA 2JP3A 3U59A 1GW3A 2K37A 3CCRP 1IZNB 3SWYA 2NPSB 1URQC 2YIUB 2JKVA 2WMMA 1GDTA 1K73Q 1N73A 3F5HA 2WQYC 1NVOA 5AW9B 5APXA 4JBZA 1YIJP 5KJ7C 3A0BH 2QJKC 1KYOI 3D6YA 1MV8A 4RJTA 3II6A 2K9YA 1BCCJ 1Y47A 3H1HG 1BSHA 3PLNA 1BGYD 1LTJB 1EDLA 3Q5PA 3NMDA 1HTLC 1W5CE 3K5BA 1LP1B 1FZEA 5M1BA 1UIIA 4IOIH 4LC1A 1HH0A 3IN6A 3PRJA 4I1LA 3KQGA 4ZNCA 3I56P 3H1JJ 1RF1A 3GF3A 1EDIA 3MZWB 1USDA 4PD4H 3NXSA 2Q5UA 2QEXP
chains in the Genus database with same CATH topology
2FFDB 3R2PA 1T2KC 1GL2A 1N86A 2WITA 3B5NA 1GL2D 1LWUC 1MUUA 1L4AA 3B5ND 2R5DA 2Q3IA 1FZCC 1L4AD 2WTYA 3HD7A 2LKMA 1NO4A 3TYYA 2GUSA 3HD7D 1XTGB 5CMZA 1NTZK 4WY4A 1H88A 5CCHC 1NTMK 4I6MC 2NPSA 4WY4D 2R3CA 2W6BA 5KLVK 1H8AA 5APQA 1IFDA 1RF1B 2N1TC 4N78E 4M3LA 3P8MC 5AVXB 5AW0B 2POHA 1M1JA 2KLVA 3M9BA 1GL2B 3B5NC 1DX7A 5APVA 3A7OA 3B5NB 1NKNA 4ZKUA 1J1DC 1L4AC 1FBMA 1L4AB 1HBWA 2OYHA 2H8PD 5APYA 1L0NK 3VMYA 5KJ7A 1IJDB 1SLQA 2C0WA 2GUVA 3HD7B 5KJ7D 2QM7A 2FYZA 2YKPA 2PAJA 4WY4B 1GD2E 2XKMA 5AW7B 1FDMA 2H7HA 1LTJA 4C46A 3BRVB 3BVHA 1ZN5A 2C9LY 3HE5A 3M9HA 3VTPC 1SQXK 3L4FA 3N7NA 1SVFA 2W6AA 3RL0D 1M1JC 2A45G 4HYTB 1M1JB 3LIEA 3SWFA 3V2NA 3MTUE 3VN0A 2P1JA 2OYIA 1RF0C 2A45I 3MGNA 3G3ZA 1FU1A 4W80A 2OYHB 1FZAA 2Z5IA 1LTGC 1NOHA 2J58A 3HE4A 2I1KA 1EQ7A 1LTTC 1RE4C 3OAKA 3OJAB 3P8CE 2W27A 5BU8B 3OA7A 1M7LA 1FOSF 4XA4A 3A3YB 3O8ZA 1SFCC 1YYCA 2HODA 4I2LC 4LLHA 1JY2O 4GIFA 3HE5B 3P7KA 1LWUA 1GU5A 4DZOA 2YNYA 3RL0C 1JNMA 1FZCA 3U1AA 2YMYA 3GHGC 1YTZT 1X79B 4C7NA 3H32A 4JYBA 5APTA 1JY3N 5CCHA 2FYUK 3T97A 1KZUB 2JEEA 2OYIB 3HUSC 2C0XA 5CCHD 3VP9A 1L0LK 4RESB 3M0DC 4DOJA 5CJ0A 3L37A 2N1TA 3HE4B 2I1JA 2YO2A 1NAFA 1HVVA 1SQPK 2HODB 3KDPB 3KYQA 3LW5H 2J59M 2WT7A 1LWUB 2XU6A 1NHLA 3HRNA 1SP4A 4HH2A 1FZCB 3P32A 3P8CD 2WPQA 2O1JA 2ZXEB 3L36A 1OXZA 4WBAA 1NWQA 4C7NB 2HFED 3H32B 2P67A 3M0AA 3RK3C 3RK2C 3MUDA 1IFJA 2XNXA 1IO4A 2P7JA 1LGHB 5AVWB 2N1TB 5CCGC 3VYIA 4GT1A 1KFMA 2WSEH 5APSA 1YTZI 2YO3A 2HLOA 3VMZA 2A45H 2CPSA 1J1DB 1RF0A 1G2CA 2WT7B 1JMMA 1X8YA 3M9QA 1PFIA 1J1EC 1Z56A 2M3BA 2IFMA 2CPBA 4N6JA 2E42A 5APWA 3NFQA 1RE4A 3VMXA 1LT9C 3CI9A 1T3JA 3IR9A 1SFCA 1LTSC 5CJ4A 4N3YB 2WWWA 1SFCD 1HGZA 4Y99C 3TSIA 3MD0A 1QL1A 3L35A 1ZR4A 1IFIA 1NH4A 3GHGA 1N7LA 3HTKA 3H6PA 3V4WA 4AYCA 2KOGA 1G2CB 3HUSA 1S9KE 1FJPA 1VDFA 1HJBA 2P2UA 4N78D 3M0DA 3BASA 5AW1B 2KB7P 1RY3A 1KFNA 3CLQA 5AW8B 2R32A 1LTBC 3BATA 3BRTB 3NTNA 1SFCB 5AVUB 5AVTB 1FJKA 3UIAA 3M06A 4EIJA 1A02F 1JOCA 1JCDA 3KPEA 1N7SC 3PP5A 3RL0B 3IFMA 3I5CA 2GM4A 3M91A 5AVZB 1T8ZA 3GHGB 1RE3C 2IX7C 5AW3B 3HTKB 3V2RA 4IFMA 1JY3O 3V2PA 1HWTC 4B86A 1JY3P 3HUSB 3RK3D 4WB4A 1G1JA 3RK2D 3V5BA 1DH3A 1JO5A 4O9BA 5CCGA 1CW5A 1N73C 1KILC 1VPCA 5KTBA 5CHXA 5CCGD 1GU4A 4GKGA 2YKQA 2YKOA 1NTKK 1IFMA 2WPSA 3WMM0 5BU5A 3V4QA 1HUCA 1NU1K 2XZRA 3VP8A 2JJLA 2MJZA 2PP6A 1FZBA 2HPCA 1A02J 1IC2A 3LIDA 2WSCH 2XV5A 4EOTA 1LT9A 1IFNA 1N2DC 4OH8B 3EQ2A 1FZGA 2FFDC 2Z4EA 2M8RA 2WZ7A 4ZKPA 3RK3B 3RK2B 1IK9A 2FKWB 5AVVB 1SQBK 4AQRD 5AVQB 2Z5HA 1ZLLA 2VRSA 4JYCA 2Q7CA 2O1KA 2HG5D 5BVZA 4LGDE 2QM8A 5AVRB 3MIWA 4IFFA 1HGVA 2HYNA 5AW4B 1MZ9A 1G1IA 1GK4A 2L5GB 3A2AA 1OWAA 2ZFCA 1CI6A 2WPRA 4IFDK 2HPCB 1NKZB 1RF1C 1J1EB 1URQA 2NPSD 1LTIC 1W2EA 1URQD 2O01H 1JCCA 1LT9B 5AW5B 1GL2C 2BASA 1WRGA 1SQVK 4Y99B 1N7SA 3HD7C 2N9BA 1LTAC 1AFOA 1N7SD 3U59A 1RE3A 3C9IA 2IFNA 4AUWA 4WY4C 1MFZA 1GW3A 3VOPA 4JF7A 2NPSC 3SWYA 1CI6B 2NPSB 1URQC 1T3UA 3TK1A 5APUA 1CZQA 1URQB 1GDTA 1FZFA 1GZLA 4W7ZA 4W7YA 1N73A 1KILA 1FAVA 3N4XA 2H43A 1J2JB 3B8EB 3EFGA 1KILD 3V2QA 1GTWA 5AW9B 1DEBA 2FXMA 3TNUA 5APXA 5AW2B 2WSFH 2OYHC 1FOSE 1JUNA 5KJ7C 5AVYB 1N7SB 2KYVA 1GK6A 1ZV8A 1MV8A 4KHXA 3II6A 1X9VA 1JTHA 2FFDA 1H89A 2OARA 1CSBA 1LTJC 1WT6A 1LTJB 1JY2N 1T2KD 1JY2P 2E43A 2KP8A 1KQLA 2XDJA 3NMDA 5AVSB 3E1IA 1SQQK 1E5WA 1GW4A 1HTLC 2R5BA 1KILB 2Q9IA 1N73B 1FZEA 2IPPA 4LC1A 1ZR2A 1HH0A 2OYIC 4I1LA 1XTCC 3KQGA 1S9KD 5AW6B 3TNUB 3A5TA 3U1CA 2KSJA 1RF1A 2C9NY 4C7RA 4XE5B 2N1TD 3NXSA 1QL2A 2Q5UA 1JTHB 3CL3D 1AQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FFD B;  2XNX A;  2OYI A;  1W2E A;  1RF0 C;  1RE4 A;  1FZC A;  2A45 I;  2Q9I A;  1RF1 B;  1FZE A;  1N73 B;  1N86 A;  1LT9 C;  2HOD B;  3GHG C;  2OYH B;  3HUS A;  1LWU C;  1LT9 B;  1FZA A;  1RE3 C;  3GHG B;  1T3U A;  1LTJ A;  1LWU B;  3H32 A;  2OYI C;  1M1J A;  1RE4 C;  1FZC C;  3BVH A;  1JY3 N;  1FZB A;  2HPC A;  2OYI B;  1JY3 O;  1FZC B;  3HUS C;  1FZF A;  2HLO A;  2FFD A;  1JY3 P;  1RF1 A;  1N73 A;  3HUS B;  1LTJ C;  2OYH C;  2HOD A;  2A45 H;  2H43 A;  1LTJ B;  1RF0 A;  2OYH A;  1JY2 N;  1M1J C;  2A45 G;  1JY2 O;  3H32 B;  1LT9 A;  1M1J B;  3GHG A;  1JY2 P;  1FZG A;  1LWU A;  2HPC B;  2FFD C;  1RE3 A;  2Z4E A;  1RF1 C;  3E1I A;  1N73 C; 
#chains in the Genus database with same CATH topology
 3L74 G;  3R2P A;  1T2K C;  2Y0C A;  3B5N D;  5B66 E;  5E79 H;  1L4A D;  1SQP G;  1SQQ D;  1NO4 A;  2ZJS E;  3TYY A;  1H88 A;  4WY4 A;  1HJ0 A;  1NU1 D;  3JSV C;  5KLV K;  3CXH H;  1H8A A;  1IFD A;  2N1T C;  2Q1K A;  2QJY B;  1L0N E;  1EDK A;  2QIW A;  3P8M C;  2POH A;  2OQQ A;  1Y8A A;  2KLV A;  4OGQ C;  3M9B A;  1YJ9 P;  1KMI Z;  3B5N B;  3SSU A;  1L4A B;  2OYH A;  2A06 E;  1L0N K;  3G6E P;  1SQX E;  2GUV A;  2W90 A;  4ZMD A;  3W67 A;  1NTZ J;  2YKP A;  1GD2 E;  4L73 A;  2H7H A;  3IAO A;  1U57 A;  1SQX K;  3L75 G;  3TDK A;  1M1J C;  2E76 C;  3R4Y A;  1BE3 J;  1VQ7 P;  2M5A A;  5KAI H;  4I7Z C;  2P58 A;  2Z5I A;  5CBO A;  2N9Y B;  1BGY G;  3P8C E;  4BRY A;  4NPD A;  2QVA A;  3OA7 A;  4XA4 A;  3A3Y B;  1YYC A;  3H1I E;  1JY2 O;  2FYU E;  1VQ6 P;  1LWU A;  3CWB J;  2M0B A;  2YMY A;  5CCH A;  2FYU K;  2JEE A;  4UB6 H;  4PJ0 E;  1VQ9 P;  3H1H J;  3L37 A;  3Q2Y A;  2QSI A;  2YO2 A;  1K04 A;  1NAF A;  3CC7 P;  3TGU D;  2HOD B;  2RN0 A;  3KYQ A;  1SQQ G;  2KI7 B;  1NJI Q;  1SP4 A;  1T6A A;  1FZC B;  3GF7 A;  2K1A A;  2R3S A;  3RBX A;  1NU1 G;  4C7N B;  3AEA C;  1DD4 A;  3RK2 C;  3MUD A;  1YJW P;  2AXT E;  2P7J A;  5AVW B;  1L0L D;  1S72 P;  5H2F H;  3VYI A;  2E75 D;  3AE8 C;  3CPW O;  2HLO A;  2AEM A;  1RF0 A;  1X8Y A;  1PFI A;  1J1E C;  1T3J A;  1Q90 D;  3IR9 A;  1SFC A;  4MN4 C;  5DJT B;  2ZYG A;  4Y99 C;  4L74 A;  2E75 B;  2ZYD A;  3L35 A;  1ZR4 A;  2JWA A;  3GHG A;  3VMA A;  4PV1 C;  1PGO A;  3HTK A;  1EZV D;  4H44 D;  3H6P A;  3V4W A;  1G2C B;  1EXI A;  3HUS A;  1HJB A;  3M0D A;  1RY3 A;  3L75 J;  5AW8 B;  1A02 F;  1P84 H;  4GOF A;  3I5C A;  3A0B E;  4H44 B;  3TF5 A;  2KK7 A;  1NTK E;  2OYO A;  5CCG A;  2KLU A;  1N73 C;  2YKQ A;  2V7Q H;  2W8Z A;  1NTK K;  4EI2 A;  1HUC A;  1H0T A;  2PP6 A;  1OVV A;  1FZB A;  1IC2 A;  2WSC H;  5KAF E;  3QH9 A;  1PP9 E;  4TT3 H;  2WZ7 A;  1FE6 A;  2VRS A;  2Q7C A;  1USE A;  2QM8 A;  1KN7 A;  4IFF A;  1G1I A;  2L5G B;  2NZ2 A;  2UWJ E;  4U3F E;  2WPR A;  3CX5 D;  2HPC B;  1RF1 C;  4JQ0 D;  3CXH E;  1OIP A;  1URQ D;  1VF5 D;  5AW5 B;  2BAS A;  1BGY E;  3L70 D;  1SQB D;  2Y0D A;  1LTA C;  3C9I A;  1VQK P;  4WY4 C;  1MFZ A;  3VOP A;  4JF7 A;  1L0N G;  2E5Y A;  2QRX A;  5APU A;  1KTM A;  1CZQ A;  1URQ B;  1VF5 B;  1YJN P;  1FZF A;  1GZL A;  1LP1 A;  2YXQ B;  3N4X A;  2H43 A;  3B8E B;  4DJG A;  5K5G B;  2A06 G;  1SQV J;  3AE2 C;  2OYH C;  3FX0 A;  2QJP B;  5KKZ B;  2QG4 A;  1SQQ E;  3H1L D;  3AE9 C;  2RH0 A;  1EC5 A;  1OMI A;  1EDJ A;  1JY2 N;  2NRG A;  1T2K D;  4UB8 H;  1SQQ K;  1E5W A;  1GW4 A;  1KQS O;  4A7P A;  3BCC J;  2BCC J;  2IPP A;  1ZR2 A;  1M90 Q;  3A5T A;  1FDI A;  4C7R A;  3H1I G;  4XE5 B;  2FYU G;  2N1T D;  1QL2 A;  1JTH B;  3CCJ P;  2WIT A;  3B5N A;  3GG2 A;  1LWU C;  1L4A A;  1AV1 A;  2R5D A;  2FYN C;  1D7M A;  2L91 A;  2WTY A;  1X22 A;  2FBW C;  2O01 N;  3HD7 D;  5CCH C;  1QGK B;  3AE7 C;  4N78 E;  4M3L A;  1MKM A;  2AXC A;  3L70 G;  1SQB G;  1KC8 Q;  2J5U A;  3A7O A;  1NKN A;  1J1D C;  2E76 D;  2ZXX A;  1HBW A;  2H8P D;  3FXD A;  5APY A;  2C0W A;  2E74 D;  3HD7 B;  2QM7 A;  1PP9 D;  2PAJ A;  4D6T J;  3CC4 P;  4PD4 D;  3MUD C;  5KLV J;  4C46 A;  1OVU A;  1VQ5 P;  3BRV B;  2C9L Y;  1SVF A;  2W6A A;  3L72 D;  1KB9 H;  2A45 G;  1M1J B;  4U3F D;  4XFJ A;  3TGU E;  2E76 B;  3VN0 A;  1RF0 C;  2A45 I;  3G3Z A;  4W80 A;  3H1L G;  2E74 B;  3CXH D;  2I1K A;  1EQ7 A;  3OJA B;  5BU8 B;  1Q2N A;  1M7L A;  4Y28 J;  3ZDM A;  1SFC C;  2HOD A;  3KZI H;  3P7K A;  1GU5 A;  3ABV C;  1SQX J;  3EWK A;  4DZO A;  1S5L E;  2Y0E A;  3MP7 B;  1L0L E;  3RL0 C;  1FZC A;  3GHG C;  2JWD A;  1X79 B;  2ITA A;  4GDO A;  4C7N A;  3JCU E;  2OYI B;  3HUS C;  3CCM P;  1L0L K;  3M0D C;  5CJ0 A;  1VQ8 P;  2OTL P;  3HE4 B;  2IZ0 A;  3FWL A;  1Y9B A;  2HR3 A;  3JC2 2;  2I1J A;  5KLI C;  4DT0 A;  3G71 P;  3HRN A;  2JR8 A;  1NTK G;  2ZXE B;  3L36 A;  1OXZ A;  1EZV E;  2P67 A;  3M0A A;  5GTH H;  1IFJ A;  1EXJ A;  3L73 D;  4H0L C;  1LGH B;  5CCG C;  2XND H;  2PFX A;  2YO3 A;  2E5T A;  3V6I A;  4PV1 D;  1Q7Y Q;  3VMZ A;  1G2C A;  2WT7 B;  1QVG O;  2IFM A;  1PP9 G;  2Q6Q A;  2AEJ A;  3D6Z A;  1NTM J;  1E79 H;  3A0H H;  5CJ4 A;  1BDD A;  1HGZ A;  3L72 G;  4GOE A;  1QL1 A;  2W83 C;  4U3F G;  1NH4 A;  1N7L A;  3CCL P;  4PV1 B;  3CCU P;  1YI2 P;  1S9K E;  2YIU C;  5CBN A;  3CXH I;  1OX3 A;  4N78 D;  2QA4 P;  3AED C;  2MKV A;  3O6Q B;  3H1J E;  2WSE J;  1KFN A;  1LTB C;  3BAT A;  3NTN A;  4H13 D;  4EYY Q;  1JOC A;  3KPE A;  1PGQ A;  1KQG B;  5AVZ B;  2IX7 C;  2RMZ A;  3CCE P;  4HB1 A;  1S2E A;  3V2P A;  4B86 A;  1HWT C;  3L71 D;  1JY3 P;  3G9R A;  3GMA A;  3RK3 D;  3H1K D;  5TIS H;  3CX5 E;  1G1J A;  3V5B A;  1CW5 A;  1VPC A;  4GKG A;  4H13 B;  2Y9Y A;  1M56 D;  2BCC D;  3BCC D;  3VP8 A;  3L70 E;  2I8D A;  2MJZ A;  1SQB E;  2HPC A;  3LID A;  2JO1 A;  4BWN A;  4ASV A;  3EQ2 A;  1LNQ A;  1FZG A;  3RK3 B;  1NTZ E;  5DJU B;  2FKW B;  5AVV B;  1SQB K;  3L74 J;  5AVQ B;  5L8R J;  2Z5H A;  3Q1M A;  1P84 D;  2O1K A;  1QVF O;  1NTK J;  1SQP J;  1ZXG A;  5AVR B;  1HGV A;  1MZ9 A;  1VQO P;  1TU3 F;  1AVO A;  1BE3 E;  1M57 D;  1URQ A;  1OW8 A;  4YTP C;  1LTI C;  1IFP A;  2QJY C;  1W2E A;  1N8R Q;  1JCC A;  3H1L E;  1LT9 B;  2M3E A;  1YHQ P;  2IYP A;  1WRG A;  1YQ4 C;  1NYH A;  1RH5 B;  1N7S D;  1RE3 A;  2IFN A;  3GLM A;  2D2C D;  1RQU A;  1OZH A;  3TK1 A;  1R5L A;  2AEF A;  1ZOY C;  1FAV A;  1J2J B;  3EFG A;  1KIL D;  1KB9 E;  1GTW A;  2WSS H;  1OFC X;  2FXM A;  1JUN A;  5TJH A;  4KJM A;  2O01 J;  1N7S B;  1JEK A;  1GK6 A;  1PV3 A;  1ZV8 A;  3L71 G;  3H25 A;  2D2C B;  4KHX A;  1BGY J;  1JTH A;  1H89 A;  1BCC D;  1WT6 A;  1RQV A;  1JY2 P;  3KZI E;  2E43 A;  2XDJ A;  5AVS B;  2G8Y A;  2K3R A;  3TGU G;  3E1I A;  1ZME C;  1KIL B;  2Q9I A;  1VL2 A;  1QEX A;  3KXD A;  3S9O A;  2FY8 A;  3AE3 C;  1XTC C;  1S9K D;  2IZ1 A;  5AW6 B;  3TNU B;  3U1C A;  2KSJ A;  3FGA D;  2GA1 A;  2C9N Y;  3H1J D;  2K9J B;  1VQN P;  1L0L G;  1PPJ E;  2FFD B;  4PD4 E;  1QLE D;  3CCQ P;  1MFT A;  1GL2 D;  1ZRT D;  2WSF J;  2Q3E A;  1SQQ J;  1FZC C;  1P84 I;  2JDI H;  5E79 E;  3HD7 A;  2LKM A;  3L72 E;  2GUS A;  1OW7 A;  1NU1 J;  2NPS A;  2R3C A;  4TLF A;  2W6B A;  2G3A A;  2LR2 A;  5AVX B;  4IL6 H;  2YMK A;  1M1J A;  2IBZ D;  1R8E A;  1GL2 B;  3I55 P;  3Q5S A;  4ZKU A;  3OW2 O;  1FBM A;  1EZV G;  3RGU A;  1IJD B;  1SLQ A;  5KJ7 D;  2CK3 H;  1EZV I;  2FYZ A;  4JPZ B;  4Z1M H;  5AW7 B;  1FDM A;  4CPG A;  1NTZ D;  3F89 A;  1NTM D;  1LTJ A;  3BVH A;  3USS A;  1VQM P;  3G4S P;  2E75 C;  1S3J A;  1X0T A;  1IK7 A;  3RL0 D;  4HYT B;  1S4X A;  3LIE A;  4IL6 X;  3SWF A;  2OYI A;  3MGN A;  1BE3 D;  1SS1 A;  5KAI E;  1FZA A;  1NOH A;  2J58 A;  3HE4 A;  1LTT C;  2KZJ A;  3OAK A;  3WUV A;  2QJK B;  1VQP P;  3O8Z A;  4I2L C;  2KSE A;  4LLH A;  4GIF A;  3HE5 B;  3L73 E;  2YNY A;  1JNM A;  3AE5 C;  3WUU A;  2PRR A;  4GOD A;  1YTZ T;  3CWB D;  3E7K A;  4H44 C;  4PJ0 H;  1KZU B;  3H1J G;  2C0X A;  1DD3 A;  4UB6 E;  3VP9 A;  3H1H D;  4QMA A;  3TGU J;  1KB9 D;  3KDP B;  4OGQ D;  3AEG C;  2O3J A;  2WT7 A;  1NHL A;  2YXR B;  2OTK E;  1NWQ A;  3H32 B;  3C8V A;  2AXT H;  3T97 B;  3CX5 I;  2XNX A;  1IO4 A;  2N1T B;  3L74 D;  4OWF A;  4GT1 A;  5C39 A;  1K9M Q;  5H2F E;  2WSE H;  5APS A;  4OGQ B;  2B87 B;  2A45 H;  3QWO C;  1Z56 A;  4N6J A;  4DCK A;  2E42 A;  5APW A;  2ZAE B;  1NTZ G;  3NFQ A;  1KYO H;  3O6Q A;  1RE4 A;  3VMX A;  1PPJ D;  3Q3D A;  4N3Y B;  3LW5 J;  3L71 E;  3AE4 C;  3S4R A;  3RK3 E;  3H1K E;  3MD0 A;  1IFI A;  1BE3 G;  3ITK A;  4AYC A;  2KNC B;  3BCC E;  2BCC E;  2KOG A;  1KV4 A;  1FJP A;  4I7Z B;  1L0N J;  5B5E H;  1VF5 C;  5AW1 B;  2KB7 P;  1L2P A;  1K8A Q;  3CCS P;  2KZI A;  3L75 D;  1YQ3 C;  2WVR A;  3M06 A;  4EIJ A;  3CWB G;  1JCD A;  4OVN F;  4EDF A;  2KS1 B;  2QJP C;  5KKZ C;  3IFM A;  1P84 E;  3M91 A;  1RE3 C;  4ASW A;  2ZT9 C;  1JY3 O;  3C1L A;  3E1R A;  3RK2 D;  3EFF K;  5CHX A;  1KB9 I;  2YKO A;  1IFM A;  1A02 J;  2ZVO B;  5KAF H;  1JMB A;  2XV5 A;  2H89 C;  1LT9 A;  1IFN A;  3H1I J;  2FYU J;  2BEQ D;  3RK2 B;  1IK9 A;  4D6T E;  5KLV E;  4JYC A;  1AVY A;  1JM0 A;  1PGP A;  5AW4 B;  3MIW A;  4HJG H;  1KIL E;  3A2A A;  1OWA A;  2ZFC A;  3CC2 P;  4IFD K;  1NKZ B;  1J1E B;  3CME P;  1PPJ G;  3AEF C;  2O01 H;  3AE6 C;  3CMA P;  3S1K A;  4IL6 E;  4PD4 I;  3L70 J;  1SQB J;  1BCC E;  1Q81 Q;  2BEZ F;  4Y99 B;  1PGJ A;  1GMJ A;  1N7S A;  2DW3 A;  3WU2 H;  3HD7 C;  4AUW A;  4YPC A;  1FC2 C;  4NPF X;  2NPS C;  1CI6 B;  1T3U A;  4L76 A;  4W7Z A;  4W7Y A;  3SFD C;  1KIL A;  3V2Q A;  1DEB A;  1ZRT E;  1KOR A;  3PTZ A;  5AW2 B;  3TNU A;  2WSF H;  1FOS E;  1SQV D;  2E74 C;  5AVY B;  3H1L J;  2LXC B;  2KYV A;  2K9J A;  1X9V A;  1Q86 Q;  1YIT P;  2LXB A;  2FFD A;  2OAR A;  1CSB A;  1LTJ C;  1ZW0 A;  2KP8 A;  1KQL A;  4UB8 E;  4RO0 A;  2R5B A;  1N73 B;  2IYO A;  2WPV B;  3RBZ A;  2IBZ E;  2OYI C;  3W68 A;  1UIX A;  3L73 G;  1S1C X;  3MHV A;  3CL3 D;  1GL2 A;  1N86 A;  1OVR A;  1NTM E;  1MUU A;  3KHU A;  3PJS K;  2Q3I A;  4K3A A;  2K88 A;  4K35 A;  1U7M A;  2FXP A;  1XTG B;  5CMZ A;  1NTZ K;  2SPZ A;  1NTM K;  4I6M C;  1Q82 Q;  4WY4 D;  1DIP A;  5APQ A;  1RF1 B;  5AW0 B;  5EFW B;  5GTI H;  1BDC A;  3B5N C;  1DX7 A;  1DEE G;  5APV A;  1L4A C;  1QX8 A;  3AEE C;  4U7J A;  3CCV P;  5KJ7 A;  3VMY A;  2W6J H;  1PP9 J;  2Y9Z A;  3CWB E;  1KYO E;  3D70 A;  4WY4 B;  2B89 A;  2XKM A;  1VQ4 P;  1U7J A;  4D6T D;  1ZN5 A;  3WUT A;  3HE5 A;  5KLV D;  4YXW H;  3M9H A;  3VTP C;  3L72 J;  1M1K Q;  3L4F A;  3N7N A;  3H1H E;  3FXE A;  3Q5R A;  4U3F J;  4NPE A;  1SQV G;  3V2N A;  3MTU E;  1W2B O;  2P1J A;  1FU1 A;  2OYH B;  1LTG C;  3GW6 A;  3B4S A;  5B5E E;  1L0N D;  1RE4 C;  1LJ2 A;  2W27 A;  3H1K G;  2IDB A;  1FOS F;  2H88 C;  2ZVN B;  1S5L H;  1VQL P;  4R4M A;  2A06 D;  3L74 E;  1SQX D;  1AQT A;  3U1A A;  3BCC G;  2BCC G;  3JCU H;  3H32 A;  4JYB A;  2KUB A;  5APT A;  1SQP E;  1JY3 N;  3T97 A;  3D71 A;  2M5A B;  5CCH D;  4RES B;  1KQF B;  4DOJ A;  2N1T A;  4BRY B;  4H13 C;  1HVV A;  1SQP K;  4BXL A;  2B87 A;  4WWI A;  5B66 H;  2R44 A;  3LW5 H;  2J59 M;  2PGD A;  1LWU B;  2XU6 A;  2FYN B;  4HH2 A;  1S5L X;  3P32 A;  4HKZ H;  3P8C D;  2WPQ A;  2O1J A;  4WBA A;  2HFE D;  1RHZ B;  3RK3 C;  3H1I D;  3L73 J;  2FYU D;  5GTH E;  3SFE C;  3FWN A;  1AJY A;  1KFM A;  1YTZ I;  4KT0 J;  3L75 E;  2KNC A;  2CPS A;  1J1D B;  1JMM A;  3M9Q A;  2M3B A;  2RKL A;  2CPB A;  1R5S A;  4D6T G;  1LT9 C;  3CI9 A;  5KLV G;  1LTS C;  3A0H E;  2V4H A;  1SFC D;  2WWW A;  1KD1 Q;  3CD6 P;  3TSI A;  1HF9 A;  3AEB C;  1WMK A;  2KS1 A;  3AEC C;  3WU2 E;  2P10 A;  3B71 A;  4WVZ A;  2ZT9 D;  1VDF A;  1M8O B;  2P2U A;  2ZYA A;  1FS0 E;  3BAS A;  2KXP B;  1BCC G;  3CLQ A;  2R32 A;  2B88 A;  3BRT B;  5AVU B;  1SFC B;  5AVT B;  1FJK A;  3UIA A;  1SQX G;  1N7S C;  3PP5 A;  3RL0 B;  2GM4 A;  1T8Z A;  3GHG B;  5AW3 B;  1JB0 J;  1KYO D;  2D2C C;  3HTK B;  3V2R A;  4RKU J;  3L71 J;  4IFM A;  2ZT9 B;  2FXO A;  3H1K J;  1NU1 E;  3CX5 H;  3SWK A;  3HUS B;  4WB4 A;  1LT1 A;  1ZP0 C;  1DH3 A;  5TIS E;  1JO5 A;  4H0L D;  1AQ5 A;  4O9B A;  1KIL C;  5KTB A;  1PZQ A;  1YBK A;  5CCG D;  1GU4 A;  2WPS A;  3WMM 0;  5BU5 A;  3V4Q A;  1NU1 K;  2XZR A;  5KLI B;  2OTJ P;  1BSN A;  2JJL A;  2OGU A;  1NGM B;  4EOT A;  1N2D C;  4L75 A;  4OH8 B;  2QE7 H;  2FFD C;  2Z4E A;  2M8R A;  2KIK A;  4ZKP A;  1PL5 A;  4R4L A;  1L0L J;  1FDO A;  4AQR D;  4H0L B;  1AA0 A;  1NAY A;  2IBZ G;  1ZLL A;  3RL0 g;  2HG5 D;  5BVZ A;  4LGD E;  2IBZ I;  2HYN A;  1GK4 A;  1NTK D;  1SQP D;  3PH0 A;  2B9B A;  1H0T B;  3PHL A;  1CI6 A;  1PIX A;  2NPS D;  1SQV E;  1NTM G;  2V7Q J;  3AE1 C;  1K05 A;  1GL2 C;  4YXD C;  5GTI E;  3IF4 A;  1SQV K;  1OW6 A;  2WSC J;  2N9B A;  1AFO A;  2JP3 A;  3U59 A;  1GW3 A;  2K37 A;  3CCR P;  1IZN B;  3SWY A;  2NPS B;  1URQ C;  2YIU B;  2JKV A;  2WMM A;  1GDT A;  1K73 Q;  1N73 A;  3F5H A;  2WQY C;  1NVO A;  5AW9 B;  5APX A;  4JBZ A;  1YIJ P;  5KJ7 C;  3A0B H;  2QJK C;  1KYO I;  3D6Y A;  1MV8 A;  4RJT A;  3II6 A;  2K9Y A;  1BCC J;  1Y47 A;  3H1H G;  1BSH A;  3PLN A;  1BGY D;  1LTJ B;  1EDL A;  3Q5P A;  3NMD A;  1HTL C;  1W5C E;  3K5B A;  1LP1 B;  1FZE A;  5M1B A;  1UII A;  4IOI H;  4LC1 A;  1HH0 A;  3IN6 A;  3PRJ A;  4I1L A;  3KQG A;  4ZNC A;  3I56 P;  3H1J J;  1RF1 A;  3GF3 A;  1EDI A;  3MZW B;  1USD A;  4PD4 H;  3NXS A;  2Q5U A;  2QEX P; 
#chains in the Genus database with same CATH homology
 2FFD B;  3R2P A;  1T2K C;  1GL2 A;  1N86 A;  2WIT A;  3B5N A;  1GL2 D;  1LWU C;  1MUU A;  1L4A A;  3B5N D;  2R5D A;  2Q3I A;  1FZC C;  1L4A D;  2WTY A;  3HD7 A;  2LKM A;  1NO4 A;  3TYY A;  2GUS A;  3HD7 D;  1XTG B;  5CMZ A;  1NTZ K;  4WY4 A;  1H88 A;  5CCH C;  1NTM K;  4I6M C;  2NPS A;  4WY4 D;  2R3C A;  2W6B A;  5KLV K;  1H8A A;  5APQ A;  1IFD A;  1RF1 B;  2N1T C;  4N78 E;  4M3L A;  3P8M C;  5AVX B;  5AW0 B;  2POH A;  1M1J A;  2KLV A;  3M9B A;  1GL2 B;  3B5N C;  1DX7 A;  5APV A;  3A7O A;  3B5N B;  1NKN A;  4ZKU A;  1J1D C;  1L4A C;  1FBM A;  1L4A B;  1HBW A;  2OYH A;  2H8P D;  5APY A;  1L0N K;  3VMY A;  5KJ7 A;  1IJD B;  1SLQ A;  2C0W A;  2GUV A;  3HD7 B;  5KJ7 D;  2QM7 A;  2FYZ A;  2YKP A;  2PAJ A;  4WY4 B;  1GD2 E;  2XKM A;  5AW7 B;  1FDM A;  2H7H A;  1LTJ A;  4C46 A;  3BRV B;  3BVH A;  1ZN5 A;  2C9L Y;  3HE5 A;  3M9H A;  3VTP C;  1SQX K;  3L4F A;  3N7N A;  1SVF A;  2W6A A;  3RL0 D;  1M1J C;  2A45 G;  4HYT B;  1M1J B;  3LIE A;  3SWF A;  3V2N A;  3MTU E;  3VN0 A;  2P1J A;  2OYI A;  1RF0 C;  2A45 I;  3MGN A;  3G3Z A;  1FU1 A;  4W80 A;  2OYH B;  1FZA A;  2Z5I A;  1LTG C;  1NOH A;  2J58 A;  3HE4 A;  2I1K A;  1EQ7 A;  1LTT C;  1RE4 C;  3OAK A;  3OJA B;  3P8C E;  2W27 A;  5BU8 B;  3OA7 A;  1M7L A;  1FOS F;  4XA4 A;  3A3Y B;  3O8Z A;  1SFC C;  1YYC A;  2HOD A;  4I2L C;  4LLH A;  1JY2 O;  4GIF A;  3HE5 B;  3P7K A;  1LWU A;  1GU5 A;  4DZO A;  2YNY A;  3RL0 C;  1JNM A;  1FZC A;  3U1A A;  2YMY A;  3GHG C;  1YTZ T;  1X79 B;  4C7N A;  3H32 A;  4JYB A;  5APT A;  1JY3 N;  5CCH A;  2FYU K;  3T97 A;  1KZU B;  2JEE A;  2OYI B;  3HUS C;  2C0X A;  5CCH D;  3VP9 A;  1L0L K;  4RES B;  3M0D C;  4DOJ A;  5CJ0 A;  3L37 A;  2N1T A;  3HE4 B;  2I1J A;  2YO2 A;  1NAF A;  1HVV A;  1SQP K;  2HOD B;  3KDP B;  3KYQ A;  3LW5 H;  2J59 M;  2WT7 A;  1LWU B;  2XU6 A;  1NHL A;  3HRN A;  1SP4 A;  4HH2 A;  1FZC B;  3P32 A;  3P8C D;  2WPQ A;  2O1J A;  2ZXE B;  3L36 A;  1OXZ A;  4WBA A;  1NWQ A;  4C7N B;  2HFE D;  3H32 B;  2P67 A;  3M0A A;  3RK3 C;  3RK2 C;  3MUD A;  1IFJ A;  2XNX A;  1IO4 A;  2P7J A;  1LGH B;  5AVW B;  2N1T B;  5CCG C;  3VYI A;  4GT1 A;  1KFM A;  2WSE H;  5APS A;  1YTZ I;  2YO3 A;  2HLO A;  3VMZ A;  2A45 H;  2CPS A;  1J1D B;  1RF0 A;  1G2C A;  2WT7 B;  1JMM A;  1X8Y A;  3M9Q A;  1PFI A;  1J1E C;  1Z56 A;  2M3B A;  2IFM A;  2CPB A;  4N6J A;  2E42 A;  5APW A;  3NFQ A;  1RE4 A;  3VMX A;  1LT9 C;  3CI9 A;  1T3J A;  3IR9 A;  1SFC A;  1LTS C;  5CJ4 A;  4N3Y B;  2WWW A;  1SFC D;  1HGZ A;  4Y99 C;  3TSI A;  3MD0 A;  1QL1 A;  3L35 A;  1ZR4 A;  1IFI A;  1NH4 A;  3GHG A;  1N7L A;  3HTK A;  3H6P A;  3V4W A;  4AYC A;  2KOG A;  1G2C B;  3HUS A;  1S9K E;  1FJP A;  1VDF A;  1HJB A;  2P2U A;  4N78 D;  3M0D A;  3BAS A;  5AW1 B;  2KB7 P;  1RY3 A;  1KFN A;  3CLQ A;  5AW8 B;  2R32 A;  1LTB C;  3BAT A;  3BRT B;  3NTN A;  1SFC B;  5AVU B;  5AVT B;  1FJK A;  3UIA A;  3M06 A;  4EIJ A;  1A02 F;  1JOC A;  1JCD A;  3KPE A;  1N7S C;  3PP5 A;  3RL0 B;  3IFM A;  3I5C A;  2GM4 A;  3M91 A;  5AVZ B;  1T8Z A;  3GHG B;  1RE3 C;  2IX7 C;  5AW3 B;  3HTK B;  3V2R A;  4IFM A;  1JY3 O;  3V2P A;  1HWT C;  4B86 A;  1JY3 P;  3HUS B;  3RK3 D;  4WB4 A;  1G1J A;  3RK2 D;  3V5B A;  1DH3 A;  1JO5 A;  4O9B A;  5CCG A;  1CW5 A;  1N73 C;  1KIL C;  1VPC A;  5KTB A;  5CHX A;  5CCG D;  1GU4 A;  4GKG A;  2YKQ A;  2YKO A;  1NTK K;  1IFM A;  2WPS A;  3WMM 0;  5BU5 A;  3V4Q A;  1HUC A;  1NU1 K;  2XZR A;  3VP8 A;  2JJL A;  2MJZ A;  2PP6 A;  1FZB A;  2HPC A;  1A02 J;  1IC2 A;  3LID A;  2WSC H;  2XV5 A;  4EOT A;  1LT9 A;  1IFN A;  1N2D C;  4OH8 B;  3EQ2 A;  1FZG A;  2FFD C;  2Z4E A;  2M8R A;  2WZ7 A;  4ZKP A;  3RK3 B;  3RK2 B;  1IK9 A;  2FKW B;  5AVV B;  1SQB K;  4AQR D;  5AVQ B;  2Z5H A;  1ZLL A;  2VRS A;  4JYC A;  2Q7C A;  2O1K A;  2HG5 D;  5BVZ A;  4LGD E;  2QM8 A;  5AVR B;  3MIW A;  4IFF A;  1HGV A;  2HYN A;  5AW4 B;  1MZ9 A;  1G1I A;  1GK4 A;  2L5G B;  3A2A A;  1OWA A;  2ZFC A;  1CI6 A;  2WPR A;  4IFD K;  2HPC B;  1NKZ B;  1RF1 C;  1J1E B;  1URQ A;  2NPS D;  1LTI C;  1W2E A;  1URQ D;  2O01 H;  1JCC A;  1LT9 B;  5AW5 B;  1GL2 C;  2BAS A;  1WRG A;  1SQV K;  4Y99 B;  1N7S A;  3HD7 C;  2N9B A;  1LTA C;  1AFO A;  1N7S D;  3U59 A;  1RE3 A;  3C9I A;  2IFN A;  4AUW A;  4WY4 C;  1MFZ A;  1GW3 A;  3VOP A;  4JF7 A;  2NPS C;  3SWY A;  1CI6 B;  2NPS B;  1URQ C;  1T3U A;  3TK1 A;  5APU A;  1CZQ A;  1URQ B;  1GDT A;  1FZF A;  1GZL A;  4W7Z A;  4W7Y A;  1N73 A;  1KIL A;  1FAV A;  3N4X A;  2H43 A;  1J2J B;  3B8E B;  3EFG A;  1KIL D;  3V2Q A;  1GTW A;  5AW9 B;  1DEB A;  2FXM A;  3TNU A;  5APX A;  5AW2 B;  2WSF H;  2OYH C;  1FOS E;  1JUN A;  5KJ7 C;  5AVY B;  1N7S B;  2KYV A;  1GK6 A;  1ZV8 A;  1MV8 A;  4KHX A;  3II6 A;  1X9V A;  1JTH A;  2FFD A;  1H89 A;  2OAR A;  1CSB A;  1LTJ C;  1WT6 A;  1LTJ B;  1JY2 N;  1T2K D;  1JY2 P;  2E43 A;  2KP8 A;  1KQL A;  2XDJ A;  3NMD A;  5AVS B;  3E1I A;  1SQQ K;  1E5W A;  1GW4 A;  1HTL C;  2R5B A;  1KIL B;  2Q9I A;  1N73 B;  1FZE A;  2IPP A;  4LC1 A;  1ZR2 A;  1HH0 A;  2OYI C;  4I1L A;  1XTC C;  3KQG A;  1S9K D;  5AW6 B;  3TNU B;  3A5T A;  3U1C A;  2KSJ A;  1RF1 A;  2C9N Y;  4C7R A;  4XE5 B;  2N1T D;  3NXS A;  1QL2 A;  2Q5U A;  1JTH B;  3CL3 D;  1AQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...