2A45G

Crystal structure of the complex between thrombin and the central "e" region of fibrin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
48
structure length
48
Chain Sequence
SACKDSDWPFCSDEDWNYKCPSGCRMKGLIDEVNQDFTNRINKLKNSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for sequential cleavage of fibrinopeptides upon fibrin assembly.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Thrombin light chain
total genus 10
structure length 48
sequence length 48
chains with identical sequence J
ec nomenclature
pdb deposition date 2005-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2a45G00
1FZBA 1N73C 1M1JA 1RE4C 2Z4EA 3GHGA 1RE3C 1LWUC 2HODA 1JY3O 1RF1A 3HUSC 2HODB 2HPCA 2OYIB 2HLOA 1FZCC 3E1IA 1JY2O 1FZEA 1LTJB 1RE4A 1M1JB 3GHGB 1LTJA 3H32B 1RE3A 2OYHA 3BVHA 2FFDC 1T3UA 2H43A 1LWUB 1LT9A 3HUSA 1FZAA 2HPCB 1JY2N 1RF1B 1FZGA 1N86A 1N73B 2Q9IA 2A45I 1FZFA 1LTJC 1W2EA 2OYHC 2FFDB 2FFDA 1RF0C 2XNXA 3HUSB 1LT9C 1FZCB 2OYIC 1N73A 3H32A 1M1JC 1JY3P 2A45G 3GHGC 2OYHB 1LWUA 1JY2P 1JY3N 1RF0A 1RF1C 1LT9B 2A45H 2OYIA 1FZCA
chains in the Genus database with same CATH superfamily
3M9BA 1YJWP 1RE4C 1S4XA 5B66H 2O1JA 1RE3C 3B5NA 1PFIA 3V2PA 4D6TJ 1H88A 5AVVB 3ABVC 2AEFA 4IL6H 1GU5A 1L0LJ 1LTSC 1H0TA 1GZLA 4D6TG 1FZEA 4D6TD 1SQPE 2WVRA 3G6EP 1PPJD 3BVHA 1SQVE 2NPSD 3FWLA 3L71J 3NTNA 1LT9A 1VQ7P 3AECC 3CCLP 1IZNB 4MN4C 3CCMP 1KYOE 4IFMA 2BCCD 2N9BA 2OYHC 4LGDE 4Y99C 1IFJA 5APTA 2OYHB 2ZYGA 3M06A 3M9QA 1QX8A 5AVXB 1KB9E 1QVGO 1J2JB 3VP8A 4C7RA 4RESB 3HTKB 1GW4A 3WU2H 2KUBA 2YKQA 3KYQA 2GA1A 1AV1A 4WBAA 3GF3A 2YIUB 1BGYG 1BCCD 2PFXA 5KTBA 1RQUA 1L0LE 3F89A 4PD4I 3VMXA 3AE9C 2R5BA 3RL0B 3ZDMA 1LTJA 3BRTB 3MGNA 2XV5A 2IBZD 4H0LD 4H0LC 3N4XA 5AVWB 3SWFA 2O01N 3CXHE 1JY2N 2ZJSE 3CWBJ 1N86A 3L73G 2QJKB 1ZRTD 4UB6H 2XNDH 1KV4A 2FFDA 1TU3F 1NKNA 3G4SP 1XTGB 3AEGC 1KTMA 4GOEA 1SFCC 3CD6P 2I8DA 2CK3H 1MV8A 1SQBJ 2J5UA 2ZT9B 2K1AA 3OJAB 2YIUC 2B87B 4IOIH 3L72G 1YITP 2KSEA 2QA4P 3TF5A 4K3AA 2M5AB 2AXTE 3H6PA 4RJTA 5B5EE 1LT9B 1MFTA 2XDJA 4H13D 5AVQB 1KMIZ 1L0NG 1X9VA 3BASA 3S9OA 2N1TB 1Q86Q 2E75B 4HJGH 5EFWB 1Q81Q 2P7JA 1N73C 2Q5UA 1GW3A 2WT7A 1EDIA 3C9IA 4YXWH 1K9MQ 3CCVP 1KZUB 1M56D 2IBZI 3BCCE 2CPSA 1M7LA 3VOPA 2KNCB 4GDOA 1R5LA 2WSCH 3AE5C 3Q5RA 1LTJB 1S5LH 1NTMD 2W83C 3H1KD 1VQ5P 2M5AA 1YJNP 2VRSA 1N7SB 1EDLA 3CX5H 3KZIH 1QVFO 3MUDA 3L73J 1FZGA 2LR2A 1GL2D 3WUUA 1FU1A 1OVRA 3CWBE 2KZJA 5BVZA 2I1KA 2E43A 1HTLC 1U7JA 3F5HA 1NOHA 1VQKP 4WVZA 5BU5A 1VQPP 1NHLA 5KJ7A 1LT9C 1ZXGA 3A7OA 5GTIH 3VMAA 3H1JJ 3L70E 2POHA 4EIJA 1FDOA 3CX5I 1VQ6P 1JOCA 2FYUE 1OXZA 3L72J 1NVOA 3RK2B 3CPWO 2LKMA 3SWYA 1NTZE 2OTLP 2N9YB 1L0NJ 2O1KA 4OVNF 4DOJA 3D71A 3H25A 1VF5B 4AUWA 2FXMA 5GTIE 2QJPB 4WY4D 1QGKB 2K3RA 1JY3O 1HGZA 4KT0J 3Q2YA 2HLOA 3AEAC 2ZT9C 3LIDA 3MHVA 4HB1A 4HYTB 4I7ZC 3GHGB 4C7NA 1Y9BA 1JM0A 2JEEA 3AE3C 5CCHC 3CCQP 3M0DC 1NU1D 1L4AA 1K04A 1OMIA 4R4MA 1NTKK 1W2BO 1LTAC 1PZQA 1RY3A 4AYCA 1JCCA 2O01J 1JCDA 3O8ZA 4OGQC 1BE3E 3N7NA 4BRYB 3RK2C 1P84I 3CCRP 3HD7D 5TISH 1FS0E 1QL1A 2ZXEB 5KJ7D 5KLVG 2HG5D 2Q3IA 1BCCJ 1BDDA 4GODA 5AW2B 1WMKA 2QSIA 1SQVD 1PIXA 2QE7H 3KHUA 3AE2C 4GIFA 4GOFA 4BWNA 1RQVA 1KN7A 2HFED 1NTZJ 1PGJA 3L35A 3L71D 4W7ZA 3RL0D 1Q7YQ 5APUA 2YKPA 5M1BA 2PP6A 3H1JE 1S1CX 2B87A 1G2CB 1NTKD 2WPQA 1WT6A 2R3SA 2QG4A 3A0HH 2PRRA 3AE7C 3WMM0 1SQXD 1YI2P 1KB9D 3LW5J 4JYCA 5B66E 4EI2A 1P84E 2HPCB 1J1DC 2QJYB 3QH9A 5APXA 2A45I 4JBZA 3RL0C 3W67A 5CBNA 3NXSA 3CCUP 1BGYJ 1J1EB 1EZVE 1FDMA 3OW2O 5KLVE 4H0LB 1OIPA 4N6JA 4DT0A 1L0LD 1GU4A 1KQSO 1BSHA 3A0BE 4L76A 1N7SA 4TT3H 4C46A 5KJ7C 1FOSE 1SFCD 3L75D 1MFZA 4WY4B 1YQ3C 1SQVK 1EC5A 1LTGC 2G8YA 3AE6C 1PP9D 2IX7C 3PRJA 1KQFB 1YBKA 1IFPA 1LTTC 4JPZB 1LTBC 1BDCA 1HBWA 2WT7B 2FYZA 3IAOA 3HD7C 2H7HA 2N1TA 4PD4H 1SQBE 1SQXK 4OGQD 1JY2O 3CX5E 4CPGA 1IK9A 5CCGC 3SWKA 1DEEG 2KZIA 2FFDC 2P1JA 1SQPD 2WMMA 4GKGA 1KILD 2H43A 1USEA 1FE6A 1VQ4P 1SFCA 2W6JH 2OTKE 1KC8Q 3AE4C 1R5SA 1FJPA 3E1RA 1AJYA 2ZT9D 1GL2B 1HVVA 3JC22 4DJGA 5AVYB 1L4AC 2WSEH 1K8AQ 3A3YB 1Y8AA 2NPSB 2KSJA 2NRGA 4KJMA 2E76C 3H32A 3P8CD 3C1LA 2RH0A 1HH0A 1PL5A 4UB6E 3S1KA 1KFNA 3I55P 3JCUH 4PV1D 1EDJA 3CMAP 2ZYDA 5E79E 2KYVA 2V4HA 3PH0A 1J1DB 1FBMA 1OFCX 1AVYA 2NPSA 2YO3A 2K9JA 4RO0A 1UIIA 2E75D 3U1AA 3CCEP 1AQTA 2R3CA 2JP3A 4Y99B 1NTMK 1FC2C 2HODB 2IYPA 3U59A 3BCCG 3H1LJ 3MUDC 1FOSF 5AW5B 1JMMA 1OW7A 2FYNC 4KHXA 5E79H 1VQLP 3L70D 1T3UA 1XTCC 2YO2A 1CI6B 1S3JA 1YQ4C 3HUSA 4TLFA 2I1JA 4ASVA 1AVOA 5H2FE 3CWBG 2R5DA 2JDIH 4I7ZB 1ZMEC 2P67A 3B5NB 1U7MA 2OYOA 3L70G 5AW9B 5CJ4A 4AQRD 3CXHI 1ZP0C 1DEBA 1UIXA 3HE5B 1OVVA 4IL6X 3P7KA 1YHQP 1M1JC 4XE5B 2E42A 3EWKA 2E74B 2KB7P 1Q2NA 1U57A 1IK7A 2W6AA 1DH3A 1L4AD 1M8OB 2JR8A 3I5CA 2Q6QA 2E76D 5APVA 3TNUB 1HJBA 2IBZG 1N7SC 2JWDA 1NAYA 2KS1B 1BE3D 1BCCE 2Y0DA 1OW6A 3M0DA 3D6ZA 3CC4P 2E74D 3RK3E 1KB9I 2KXPB 3O6QA 5TISE 5KLVJ 1S9KD 1BGYE 2JKVA 1CW5A 1BCCG 2B9BA 3FXDA 1T6AA 3L74D 3HD7A 1SVFA 3B8EB 2IPPA 1FZAA 4PV1B 4U3FD 4L75A 2NZ2A 2N1TC 3CXHD 3TGUG 2PAJA 1N73B 4O9BA 3TSIA 3WUVA 5CBOA 5CCGA 1SQPG 1SP4A 3S4RA 1T2KC 3L71E 5H2FH 1KYOI 1IFNA 1NO4A 2BEZF 2Q1KA 2R44A 3H1HD 2FKWB 2KP8A 1NTZG 2ZVOB 2C0XA 3V6IA 2OYIA 3L75G 4DZOA 1M1KQ 3ITKA 1SQQD 3R4YA 4I6MC 3TK1A 2BEQD 4A7PA 4RKUJ 1VQ9P 3L4FA 4UB8E 1R8EA 1PGQA 1W5CE 3VMYA 3A5TA 5AW8B 3IF4A 1OZHA 2NPSC 2JO1A 2E76B 2QM7A 3CCSP 1ZLLA 2D2CB 2E5YA 2AXCA 2H89C 3WUTA 1S2EA 3SFDC 1ZW0A 4IFDK 2YMYA 2E5TA 1NU1E 1PGPA 3FX0A 1YYCA 4I2LC 4ASWA 2FXOA 1G1JA 4ZMDA 5K5GB 1LGHB 2WSCJ 3IFMA 3Q5SA 5KLIB 1AFOA 1SQPJ 3H1IJ 1URQC 2KLVA 1IFIA 1Y47A 1EZVI 5DJUB 1KILB 5AW1B 1VQ8P 1M90Q 2KK7A 3B5ND 3D70A 3K5BA 1E5WA 1L0NK 2ZYAA 2FYUD 1L0NE 2P10A 2IBZE 2KI7B 3G9RA 4JYBA 3VMZA 4Y28J 1OWAA 4OWFA 2KOGA 1RHZB 3RK3B 1M1JA 2D2CC 3CXHH 4M3LA 3G71P 2H88C 1NTZK 3IR9A 1S9KE 3PP5A 1IFDA 2H8PD 2HODA 3L36A 2OYIB 1YTZI 2WQYC 1SQBG 3BRVB 1G1IA 1LT1A 5CCHD 5AVTB 1M1JB 3FWNA 3GW6A 5GTHE 1J1EC 3P8CE 1URQB 1IC2A 1NTKE 4H44B 1BE3G 1SQPK 3L73E 4U7JA 3RBXA 5AW3B 2JWAA 2KNCA 3CC7P 2M3BA 3VP9A 3RBZA 2FYNB 3MP7B 1P84H 1RF0C 1KILA 1LTIC 3AEFC 3PLNA 1FZCB 2IDBA 1FAVA 2FYUK 2QVAA 3BCCD 2OTJP 3P8MC 1SQQG 5APSA 3GHGC 2A45G 3E7KA 3T97A 2YMKA 1S72P 3VTPC 1S5LE 2Z4EA 1ZRTE 4WWIA 1DIPA 3TGUJ 3H1IG 1OX3A 1PP9E 3TNUA 2M3EA 3WU2E 3HUSC 1CZQA 2OGUA 5TJHA 3H1LD 1X22A 3B4SA 2WWWA 3H1JG 1BSNA 1LP1B 3P32A 4N3YB 2B88A 4D6TE 1GL2C 2A06E 2AXTH 1PPJE 3L37A 2C9LY 1LNQA 1VF5C 1LWUB 2J59M 3TGUD 3OAKA 5CJ0A 2V7QJ 3CLQA 1KYOD 1ZN5A 1KILE 3EQ2A 4L73A 5APYA 1KORA 5APWA 4YPCA 1LP1A 2BCCE 2FYUJ 3L72E 1FZFA 1HGVA 1X79B 3H1KG 3II6A 5KAFE 1NTMG 3L74J 4JF7A 3VN0A 2FBWC 4H13C 2FYUG 3Q1MA 1JTHB 2V7QH 2W90A 1VQOP 5CMZA 1NKZB 3AE1C 1NTME 3H1ID 4LLHA 5KAIH 1BE3J 3B71A 3KZIE 3PTZA 4OGQB 3Q5PA 1URQA 2YXRB 1USDA 2LXBA 2WPSA 3TYYA 2A45H 4N78E 2QJKC 4C7NB 1HF9A 3PJSK 5KAFH 3CI9A 4Z1MH 5AW7B 1NWQA 4BRYA 3HE5A 4XFJA 3RGUA 1SFCB 1E79H 1SQBK 1L0LG 2FY8A 2XZRA 5KAIE 3RK2D 4WY4A 1D7MA 1T2KD 3H1LG 1S5LX 2R32A 3E1IA 4NPFX 1ZV8A 1L2PA 2N1TD 2W6BA 1MUUA 2WPRA 1H89A 1EZVG 2WZ7A 1H0TB 5AW0B 4BXLA 3KDPB 3L75J 1Q90D 2Q7CA 2Q9IA 3I56P 1W2EA 2E74C 2XU6A 5AW6B 1SQQE 2MJZA 3L70J 2WTYA 3SFEC 1GMJA 3HD7B 1N7SD 1JMBA 2JJLA 1SS1A 3IN6A 2CPBA 1NH4A 4EYYQ 2OYIC 1GDTA 1L0LK 1JY3P 2K88A 3KPEA 2W27A 1RF0A 1JY3N 4ZKUA 2Y9YA 2KS1A 3M91A 2YNYA 4H44C 1Z56A 4YXDC 2QEXP 4GT1A 1GD2E 1FZBA 4QMAA 5KKZB 2W8ZA 3GHGA 4PD4E 1WRGA 3NMDA 1NTKJ 4PJ0H 4H13B 1HJ0A 2HYNA 2K37A 2HPCA 5KLVD 3M0AA 1AQ5A 3HE4A 1FZCC 1RH5B 1VF5D 3T97B 1RE4A 2IYOA 3RK3C 2K9JB 3AEEC 3RK3D 1RE3A 1NU1K 2ZFCA 2BCCG 1SQQJ 1N7LA 1KQGB 1RF1A 4LC1A 2AEMA 1VL2A 3JSVC 3VYIA 1FZCA 2C9NY 3PHLA 4JQ0D 3GG2A 3C8VA 2G3AA 1HUCA 1ZR4A 2E75C 1JNMA 1KFMA 1SQXJ 3MD0A 4IL6E 1PGOA 2YXQB 2FFDB 2YKOA 3RL0g 2DW3A 1M57D 2IFNA 1DD4A 2UWJE 2Z5IA 3H1HJ 4H44D 3JCUE 4HKZH 4R4LA 2J58A 2L5GB 3A0HE 5L8RJ 3AEDC 3R2PA 3D6YA 3H1HE 3FXEA 1DD3A 1PP9G 3MZWB 2LXCB 1LWUA 3CCJP 4W7YA 3USSA 1JEKA 2FXPA 4PV1C 4EDFA 1NTZD 1QL2A 4IFFA 2Q3EA 1YJ9P 4YTPC 1NU1J 1SQVJ 4ZKPA 5KLVK 1GTWA 1EZVD 1SQQK 1CI6A 3GMAA 1IJDB 1KB9H 2AEJA 2BASA 5AVSB 5KLIC 3H32B 4DCKA 4NPDA 5CCGD 1VQNP 3L74E 3CC2P 4HH2A 1KILC 3CL3D 1FJKA 4U3FG 4U3FE 5AVUB 3HE4B 3V4WA 1MKMA 3G3ZA 5KKZC 1YIJP 1G2CA 2OARA 5B5EH 1K73Q 3O6QB 1NTKG 1OVUA 1X8YA 1EQ7A 1JB0J 1LTJC 2A06G 2O01H 4U3FJ 1KYOH 2P58A 2IZ1A 4L74A 5AW4B 2RN0A 3BCCJ 2M8RA 3H1HG 1SLQA 1FDIA 3Q3DA 1N2DC 2O3JA 3FGAD 3L71G 5DJTB 4B86A 2OQQA 1OW8A 3B5NC 3W68A 3V2NA 3GF7A 1L0ND 1URQD 2QJYC 2WITA 3KXDA 4W80A 3UIAA 1IO4A 3V2QA 1DX7A 1GL2A 1NYHA 1K05A 1QEXA 2WPVB 4WB4A 1A02F 1NTMJ 3L72D 3L74G 1X0TA 2GUSA 3KQGA 3LW5H 2ZAEB 2ZVNB 3NFQA 2ITAA 3M9HA 3H1JD 2KIKA 2QIWA 1HWTC 3HRNA 2OYHA 3AE8C 1N8RQ 3QWOC 1YTZT 2L91A 1L4AB 1ZOYC 1VPCA 2GUVA 2WSFJ 2IFMA 4XA4A 2SPZA 5GTHH 1NU1G 1P84D 1T8ZA 2MKVA 1RF1B 3L73D 5BU8B 3U1CA 1JUNA 4N78D 1VDFA 3LIEA 1ZR2A 3TDKA 2WSFH 2XKMA 1EXIA 3H1KE 3MTUE 1VQMP 1BGYD 1PV3A 3A2AA 1QLED 3MIWA 3L75E 1NAFA 3EFGA 2RMZA 3CWBD 1JTHA 4PJ0E 3SSUA 1GK6A 2QRXA 1A02J 5APQA 1LWUC 4EOTA 1SQXG 4I1LA 2PGDA 1KD1Q 2GM4A 4ZNCA 1SQBD 1EXJA 3CX5D 3H1LE 2Z5HA 1EDKA 1SQXE 2Y0CA 4K35A 2K9YA 2A06D 1NGMB 1AA0A 2WSEJ 3GLMA 1PP9J 5AVZB 3V4QA 1JO5A 2RKLA 3TGUE 2ZXXA 4WY4C 1MZ9A 4OH8B 3V5BA 3OA7A 2KLUA 3CMEP 2WSSH 5CCHA 1PPJG 1GK4A 5C39A 1H8AA 5CHXA 1SQVG 2XNXA 3H1KJ 3HUSB 4PD4D 3EFFK 3A0BH 2Y0EA 3V2RA 3HTKA 2C0WA 2Y9ZA 1Q82Q 1LJ2A 2D2CD 4UB8H 1N73A 2B89A 2HR3A 1KQLA 1CSBA 2M0BA 2BCCJ 2QJPC 1JY2P 2IZ0A 3H1IE 4NPEA 2P2UA 1IFMA 2QM8A 1NJIQ 1T3JA 1RF1C 3BATA 3AEBC 5AVRB
chains in the Genus database with same CATH topology
3M9BA 1RE4C 2O1JA 1RE3C 3B5NA 1PFIA 1H88A 5AVVB 1GU5A 1LTSC 1GZLA 1FZEA 3BVHA 2NPSD 3NTNA 1LT9A 4IFMA 2N9BA 2OYHC 4LGDE 4Y99C 1IFJA 5APTA 3M06A 3M9QA 5AVXB 1J2JB 4C7RA 4RESB 3HTKB 1GW4A 2YKQA 3KYQA 4WBAA 5KTBA 3VMXA 2R5BA 3RL0B 1LTJA 3BRTB 3MGNA 2XV5A 5AVWB 3N4XA 3SWFA 1JY2N 1N86A 2FFDA 1NKNA 1XTGB 1SFCC 3OJAB 4WY4A 1MV8A 3H6PA 1LT9B 2XDJA 5AVQB 1X9VA 3BASA 2N1TB 1N73C 2P7JA 2Q5UA 1GW3A 2WT7A 3C9IA 1RF1A 1KZUB 1S9KE 1FDMA 2CPSA 1M7LA 3VOPA 2WSCH 1LTJB 2VRSA 1N7SB 3MUDA 1FZGA 2E43A 1GL2D 1FU1A 5BVZA 2I1KA 1HTLC 1NOHA 5BU5A 1NHLA 5KJ7A 1LT9C 3A7OA 2POHA 4EIJA 1JOCA 1OXZA 3RK2B 2LKMA 3SWYA 2O1KA 4DOJA 4AUWA 2FXMA 4WY4D 1JY3O 1HGZA 2HLOA 4C7NA 3LIDA 4HYTB 3GHGB 2JEEA 5CCHC 3M0DC 1L4AA 1NTKK 1LTAC 1RY3A 4AYCA 1JCCA 1JCDA 3O8ZA 3N7NA 3RK2C 3HD7D 1QL1A 2ZXEB 5KJ7D 2HG5D 2Q3IA 5AW2B 4GIFA 2HFED 3L35A 3RL0D 4W7ZA 5APUA 2YKPA 2PP6A 1G2CB 2WPQA 1WT6A 3WMM0 4JYCA 2HPCB 1J1DC 5APXA 2A45I 3RL0C 3NXSA 1J1EB 4N6JA 1GU4A 1N7SA 1FOSE 4C46A 5KJ7C 1SFCD 1MFZA 4WY4B 1SQVK 1LTGC 2IX7C 1HBWA 1LTTC 1LTBC 2WT7B 2FYZA 3HD7C 2H7HA 2N1TA 1SQXK 1JY2O 1IK9A 5CCGC 2FFDC 2P1JA 2H43A 4GKGA 1KILD 1SFCA 1FJPA 1GL2B 1HVVA 5AVYB 1L4AC 2WSEH 3A3YB 2NPSB 2KSJA 3H32A 3P8CD 1HH0A 1KFNA 2KYVA 1J1DB 1FBMA 2NPSA 2YO3A 3U1AA 2R3CA 4Y99B 1NTMK 2HODB 3U59A 5AW5B 1JMMA 4KHXA 1T3UA 1XTCC 2YO2A 1CI6B 3HUSA 2I1JA 2R5DA 2P67A 3B5NB 5AW9B 4AQRD 3HE5B 1DEBA 3P7KA 2E42A 1M1JC 4XE5B 2KB7P 1DH3A 2W6AA 1L4AD 3I5CA 5APVA 3TNUB 1HJBA 1N7SC 3M0DA 1S9KD 1CW5A 3HD7A 1SVFA 3B8EB 2IPPA 1FZAA 2N1TC 1N73B 2PAJA 4O9BA 3TSIA 5CCGA 1SP4A 1T2KC 1IFNA 1NO4A 2FKWB 2KP8A 2C0XA 2OYIA 4DZOA 4I6MC 3TK1A 3L4FA 3VMYA 3A5TA 5AW8B 2NPSC 2QM7A 1ZLLA 4IFDK 2YMYA 1YYCA 4I2LC 2GM4A 1G1JA 1LGHB 3IFMA 1AFOA 1URQC 2KLVA 1IFIA 1KILB 5AW1B 3B5ND 1E5WA 1L0NK 4JYBA 3VMZA 1OWAA 2KOGA 3RK3B 1M1JA 4M3LA 1NTZK 3IR9A 3PP5A 1IFDA 2H8PD 2HODA 3L36A 2OYIB 1YTZI 3BRVB 1G1IA 5CCHD 5AVTB 1M1JB 1J1EC 3P8CE 1URQB 1IC2A 1SQPK 5AW3B 2M3BA 3VP9A 1RF0C 1KILA 1LTIC 1FZCB 1FAVA 2FYUK 3P8MC 5APSA 3T97A 3GHGC 2A45G 3VTPC 2Z4EA 3TNUA 3HUSC 1CZQA 3P32A 4N3YB 2WWWA 1GL2C 3L37A 2C9LY 1LWUB 2J59M 3OAKA 5CJ0A 5AW0B 3CLQA 1ZN5A 3EQ2A 5APYA 5APWA 1FZFA 1HGVA 1X79B 3II6A 4JF7A 3VN0A 1JTHB 5CMZA 1NKZB 4LLHA 1URQA 2WPSA 3TYYA 4C7NB 2A45H 4N78E 3CI9A 5AW7B 1NWQA 3HE5A 1SFCB 1SQBK 2XZRA 3RK2D 1T2KD 2R32A 3E1IA 1ZV8A 2N1TD 2WPRA 2W6BA 1MUUA 1H89A 2WZ7A 3KDPB 2Q7CA 2Q9IA 1W2EA 2XU6A 5AW6B 2MJZA 3HD7B 1N7SD 2JJLA 2OYIC 1GDTA 2CPBA 1NH4A 1L0LK 1JY3P 3KPEA 2W27A 1RF0A 1JY3N 4ZKUA 3M91A 2YNYA 1Z56A 4GT1A 1GD2E 1FZBA 3GHGA 1WRGA 3NMDA 2HYNA 2HPCA 3M0AA 1AQ5A 3HE4A 1FZCC 1RE4A 3RK3C 3RK3D 1RE3A 1NU1K 2ZFCA 1N7LA 4LC1A 3VYIA 1FZCA 2C9NY 1HUCA 1ZR4A 1JNMA 1KFMA 3MD0A 2FFDB 2YKOA 3V2PA 5CJ4A 2IFNA 2WTYA 1FOSF 2Z5IA 2J58A 2L5GB 3R2PA 1LWUA 4W7YA 1QL2A 4IFFA 4ZKPA 5KLVK 1GTWA 1SQQK 1CI6A 1IJDB 2BASA 5AVSB 3H32B 5CCGD 4HH2A 1KILC 3CL3D 1FJKA 5AVUB 3HE4B 3V4WA 3G3ZA 1G2CA 2OARA 1X8YA 1EQ7A 1LTJC 2O01H 5AW4B 2M8RA 1SLQA 1N2DC 4B86A 3B5NC 3V2NA 1URQD 2WITA 4W80A 3UIAA 1DX7A 1IO4A 3V2QA 1GL2A 4WB4A 1A02F 2GUSA 3KQGA 3LW5H 3NFQA 3M9HA 1HWTC 3HRNA 2OYHA 1YTZT 1L4AB 1VPCA 2GUVA 4XA4A 2IFMA 1RF1B 1T8ZA 5BU8B 3U1CA 1JUNA 4N78D 1VDFA 3LIEA 1ZR2A 2WSFH 2XKMA 3MTUE 3A2AA 3MIWA 1NAFA 3EFGA 1JTHA 1A02J 1GK6A 5APQA 1LWUC 4EOTA 4I1LA 2Z5HA 3V4QA 1JO5A 5AVZB 4WY4C 1MZ9A 4OH8B 3V5BA 3OA7A 5CCHA 1H8AA 1GK4A 5CHXA 2XNXA 3HUSB 3V2RA 3HTKA 2C0WA 1N73A 1KQLA 1CSBA 2OYHB 1JY2P 2P2UA 1IFMA 2QM8A 1RF1C 1T3JA 3BATA 3VP8A 5AVRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZB A;  1N73 C;  1M1J A;  1RE4 C;  2Z4E A;  3GHG A;  1RE3 C;  1LWU C;  2HOD A;  1JY3 O;  1RF1 A;  3HUS C;  2HOD B;  2HPC A;  2OYI B;  2HLO A;  1FZC C;  3E1I A;  1JY2 O;  1FZE A;  1LTJ B;  1RE4 A;  1M1J B;  3GHG B;  1LTJ A;  3H32 B;  1RE3 A;  2OYH A;  3BVH A;  2FFD C;  1T3U A;  2H43 A;  1LWU B;  1LT9 A;  3HUS A;  1FZA A;  2HPC B;  1JY2 N;  1RF1 B;  1FZG A;  1N86 A;  1N73 B;  2Q9I A;  2A45 I;  1FZF A;  1LTJ C;  1W2E A;  2OYH C;  2FFD B;  2FFD A;  1RF0 C;  2XNX A;  3HUS B;  1LT9 C;  1FZC B;  2OYI C;  1N73 A;  3H32 A;  1M1J C;  1JY3 P;  2A45 G;  3GHG C;  2OYH B;  1LWU A;  1JY2 P;  1JY3 N;  1RF0 A;  1RF1 C;  1LT9 B;  2A45 H;  2OYI A;  1FZC A; 
#chains in the Genus database with same CATH topology
 3M9B A;  1YJW P;  1RE4 C;  1S4X A;  5B66 H;  2O1J A;  1RE3 C;  3B5N A;  1PFI A;  3V2P A;  4D6T J;  1H88 A;  5AVV B;  3ABV C;  2AEF A;  4IL6 H;  1GU5 A;  1L0L J;  1LTS C;  1H0T A;  1GZL A;  4D6T G;  1FZE A;  4D6T D;  1SQP E;  2WVR A;  3G6E P;  1PPJ D;  3BVH A;  1SQV E;  2NPS D;  3FWL A;  3L71 J;  3NTN A;  1LT9 A;  1VQ7 P;  3AEC C;  3CCL P;  1IZN B;  4MN4 C;  3CCM P;  1KYO E;  4IFM A;  2BCC D;  2N9B A;  2OYH C;  4LGD E;  4Y99 C;  1IFJ A;  5APT A;  2OYH B;  2ZYG A;  3M06 A;  3M9Q A;  1QX8 A;  5AVX B;  1KB9 E;  1QVG O;  1J2J B;  3VP8 A;  4C7R A;  4RES B;  3HTK B;  1GW4 A;  3WU2 H;  2KUB A;  2YKQ A;  3KYQ A;  2GA1 A;  1AV1 A;  4WBA A;  3GF3 A;  2YIU B;  1BGY G;  1BCC D;  2PFX A;  5KTB A;  1RQU A;  1L0L E;  3F89 A;  4PD4 I;  3VMX A;  3AE9 C;  2R5B A;  3RL0 B;  3ZDM A;  1LTJ A;  3BRT B;  3MGN A;  2XV5 A;  2IBZ D;  4H0L D;  4H0L C;  3N4X A;  5AVW B;  3SWF A;  2O01 N;  3CXH E;  1JY2 N;  2ZJS E;  3CWB J;  1N86 A;  3L73 G;  2QJK B;  1ZRT D;  4UB6 H;  2XND H;  1KV4 A;  2FFD A;  1TU3 F;  1NKN A;  3G4S P;  1XTG B;  3AEG C;  1KTM A;  4GOE A;  1SFC C;  3CD6 P;  2I8D A;  2CK3 H;  1MV8 A;  1SQB J;  2J5U A;  2ZT9 B;  2K1A A;  3OJA B;  2YIU C;  2B87 B;  4IOI H;  3L72 G;  1YIT P;  2KSE A;  2QA4 P;  3TF5 A;  4K3A A;  2M5A B;  2AXT E;  3H6P A;  4RJT A;  5B5E E;  1LT9 B;  1MFT A;  2XDJ A;  4H13 D;  5AVQ B;  1KMI Z;  1L0N G;  1X9V A;  3BAS A;  3S9O A;  2N1T B;  1Q86 Q;  2E75 B;  4HJG H;  5EFW B;  1Q81 Q;  2P7J A;  1N73 C;  2Q5U A;  1GW3 A;  2WT7 A;  1EDI A;  3C9I A;  4YXW H;  1K9M Q;  3CCV P;  1KZU B;  1M56 D;  2IBZ I;  3BCC E;  2CPS A;  1M7L A;  3VOP A;  2KNC B;  4GDO A;  1R5L A;  2WSC H;  3AE5 C;  3Q5R A;  1LTJ B;  1S5L H;  1NTM D;  2W83 C;  3H1K D;  1VQ5 P;  2M5A A;  1YJN P;  2VRS A;  1N7S B;  1EDL A;  3CX5 H;  3KZI H;  1QVF O;  3MUD A;  3L73 J;  1FZG A;  2LR2 A;  1GL2 D;  3WUU A;  1FU1 A;  1OVR A;  3CWB E;  2KZJ A;  5BVZ A;  2I1K A;  2E43 A;  1HTL C;  1U7J A;  3F5H A;  1NOH A;  1VQK P;  4WVZ A;  5BU5 A;  1VQP P;  1NHL A;  5KJ7 A;  1LT9 C;  1ZXG A;  3A7O A;  5GTI H;  3VMA A;  3H1J J;  3L70 E;  2POH A;  4EIJ A;  1FDO A;  3CX5 I;  1VQ6 P;  1JOC A;  2FYU E;  1OXZ A;  3L72 J;  1NVO A;  3RK2 B;  3CPW O;  2LKM A;  3SWY A;  1NTZ E;  2OTL P;  2N9Y B;  1L0N J;  2O1K A;  4OVN F;  4DOJ A;  3D71 A;  3H25 A;  1VF5 B;  4AUW A;  2FXM A;  5GTI E;  2QJP B;  4WY4 D;  1QGK B;  2K3R A;  1JY3 O;  1HGZ A;  4KT0 J;  3Q2Y A;  2HLO A;  3AEA C;  2ZT9 C;  3LID A;  3MHV A;  4HB1 A;  4HYT B;  4I7Z C;  3GHG B;  4C7N A;  1Y9B A;  1JM0 A;  2JEE A;  3AE3 C;  5CCH C;  3CCQ P;  3M0D C;  1NU1 D;  1L4A A;  1K04 A;  1OMI A;  4R4M A;  1NTK K;  1W2B O;  1LTA C;  1PZQ A;  1RY3 A;  4AYC A;  1JCC A;  2O01 J;  1JCD A;  3O8Z A;  4OGQ C;  1BE3 E;  3N7N A;  4BRY B;  3RK2 C;  1P84 I;  3CCR P;  3HD7 D;  5TIS H;  1FS0 E;  1QL1 A;  2ZXE B;  5KJ7 D;  5KLV G;  2HG5 D;  2Q3I A;  1BCC J;  1BDD A;  4GOD A;  5AW2 B;  1WMK A;  2QSI A;  1SQV D;  1PIX A;  2QE7 H;  3KHU A;  3AE2 C;  4GIF A;  4GOF A;  4BWN A;  1RQV A;  1KN7 A;  2HFE D;  1NTZ J;  1PGJ A;  3L35 A;  3L71 D;  4W7Z A;  3RL0 D;  1Q7Y Q;  5APU A;  2YKP A;  5M1B A;  2PP6 A;  3H1J E;  1S1C X;  2B87 A;  1G2C B;  1NTK D;  2WPQ A;  1WT6 A;  2R3S A;  2QG4 A;  3A0H H;  2PRR A;  3AE7 C;  3WMM 0;  1SQX D;  1YI2 P;  1KB9 D;  3LW5 J;  4JYC A;  5B66 E;  4EI2 A;  1P84 E;  2HPC B;  1J1D C;  2QJY B;  3QH9 A;  5APX A;  2A45 I;  4JBZ A;  3RL0 C;  3W67 A;  5CBN A;  3NXS A;  3CCU P;  1BGY J;  1J1E B;  1EZV E;  1FDM A;  3OW2 O;  5KLV E;  4H0L B;  1OIP A;  4N6J A;  4DT0 A;  1L0L D;  1GU4 A;  1KQS O;  1BSH A;  3A0B E;  4L76 A;  1N7S A;  4TT3 H;  4C46 A;  5KJ7 C;  1FOS E;  1SFC D;  3L75 D;  1MFZ A;  4WY4 B;  1YQ3 C;  1SQV K;  1EC5 A;  1LTG C;  2G8Y A;  3AE6 C;  1PP9 D;  2IX7 C;  3PRJ A;  1KQF B;  1YBK A;  1IFP A;  1LTT C;  4JPZ B;  1LTB C;  1BDC A;  1HBW A;  2WT7 B;  2FYZ A;  3IAO A;  3HD7 C;  2H7H A;  2N1T A;  4PD4 H;  1SQB E;  1SQX K;  4OGQ D;  1JY2 O;  3CX5 E;  4CPG A;  1IK9 A;  5CCG C;  3SWK A;  1DEE G;  2KZI A;  2FFD C;  2P1J A;  1SQP D;  2WMM A;  4GKG A;  1KIL D;  2H43 A;  1USE A;  1FE6 A;  1VQ4 P;  1SFC A;  2W6J H;  2OTK E;  1KC8 Q;  3AE4 C;  1R5S A;  1FJP A;  3E1R A;  1AJY A;  2ZT9 D;  1GL2 B;  1HVV A;  3JC2 2;  4DJG A;  5AVY B;  1L4A C;  2WSE H;  1K8A Q;  3A3Y B;  1Y8A A;  2NPS B;  2KSJ A;  2NRG A;  4KJM A;  2E76 C;  3H32 A;  3P8C D;  3C1L A;  2RH0 A;  1HH0 A;  1PL5 A;  4UB6 E;  3S1K A;  1KFN A;  3I55 P;  3JCU H;  4PV1 D;  1EDJ A;  3CMA P;  2ZYD A;  5E79 E;  2KYV A;  2V4H A;  3PH0 A;  1J1D B;  1FBM A;  1OFC X;  1AVY A;  2NPS A;  2YO3 A;  2K9J A;  4RO0 A;  1UII A;  2E75 D;  3U1A A;  3CCE P;  1AQT A;  2R3C A;  2JP3 A;  4Y99 B;  1NTM K;  1FC2 C;  2HOD B;  2IYP A;  3U59 A;  3BCC G;  3H1L J;  3MUD C;  1FOS F;  5AW5 B;  1JMM A;  1OW7 A;  2FYN C;  4KHX A;  5E79 H;  1VQL P;  3L70 D;  1T3U A;  1XTC C;  2YO2 A;  1CI6 B;  1S3J A;  1YQ4 C;  3HUS A;  4TLF A;  2I1J A;  4ASV A;  1AVO A;  5H2F E;  3CWB G;  2R5D A;  2JDI H;  4I7Z B;  1ZME C;  2P67 A;  3B5N B;  1U7M A;  2OYO A;  3L70 G;  5AW9 B;  5CJ4 A;  4AQR D;  3CXH I;  1ZP0 C;  1DEB A;  1UIX A;  3HE5 B;  1OVV A;  4IL6 X;  3P7K A;  1YHQ P;  1M1J C;  4XE5 B;  2E42 A;  3EWK A;  2E74 B;  2KB7 P;  1Q2N A;  1U57 A;  1IK7 A;  2W6A A;  1DH3 A;  1L4A D;  1M8O B;  2JR8 A;  3I5C A;  2Q6Q A;  2E76 D;  5APV A;  3TNU B;  1HJB A;  2IBZ G;  1N7S C;  2JWD A;  1NAY A;  2KS1 B;  1BE3 D;  1BCC E;  2Y0D A;  1OW6 A;  3M0D A;  3D6Z A;  3CC4 P;  2E74 D;  3RK3 E;  1KB9 I;  2KXP B;  3O6Q A;  5TIS E;  5KLV J;  1S9K D;  1BGY E;  2JKV A;  1CW5 A;  1BCC G;  2B9B A;  3FXD A;  1T6A A;  3L74 D;  3HD7 A;  1SVF A;  3B8E B;  2IPP A;  1FZA A;  4PV1 B;  4U3F D;  4L75 A;  2NZ2 A;  2N1T C;  3CXH D;  3TGU G;  2PAJ A;  1N73 B;  4O9B A;  3TSI A;  3WUV A;  5CBO A;  5CCG A;  1SQP G;  1SP4 A;  3S4R A;  1T2K C;  3L71 E;  5H2F H;  1KYO I;  1IFN A;  1NO4 A;  2BEZ F;  2Q1K A;  2R44 A;  3H1H D;  2FKW B;  2KP8 A;  1NTZ G;  2ZVO B;  2C0X A;  3V6I A;  2OYI A;  3L75 G;  4DZO A;  1M1K Q;  3ITK A;  1SQQ D;  3R4Y A;  4I6M C;  3TK1 A;  2BEQ D;  4A7P A;  4RKU J;  1VQ9 P;  3L4F A;  4UB8 E;  1R8E A;  1PGQ A;  1W5C E;  3VMY A;  3A5T A;  5AW8 B;  3IF4 A;  1OZH A;  2NPS C;  2JO1 A;  2E76 B;  2QM7 A;  3CCS P;  1ZLL A;  2D2C B;  2E5Y A;  2AXC A;  2H89 C;  3WUT A;  1S2E A;  3SFD C;  1ZW0 A;  4IFD K;  2YMY A;  2E5T A;  1NU1 E;  1PGP A;  3FX0 A;  1YYC A;  4I2L C;  4ASW A;  2FXO A;  1G1J A;  4ZMD A;  5K5G B;  1LGH B;  2WSC J;  3IFM A;  3Q5S A;  5KLI B;  1AFO A;  1SQP J;  3H1I J;  1URQ C;  2KLV A;  1IFI A;  1Y47 A;  1EZV I;  5DJU B;  1KIL B;  5AW1 B;  1VQ8 P;  1M90 Q;  2KK7 A;  3B5N D;  3D70 A;  3K5B A;  1E5W A;  1L0N K;  2ZYA A;  2FYU D;  1L0N E;  2P10 A;  2IBZ E;  2KI7 B;  3G9R A;  4JYB A;  3VMZ A;  4Y28 J;  1OWA A;  4OWF A;  2KOG A;  1RHZ B;  3RK3 B;  1M1J A;  2D2C C;  3CXH H;  4M3L A;  3G71 P;  2H88 C;  1NTZ K;  3IR9 A;  1S9K E;  3PP5 A;  1IFD A;  2H8P D;  2HOD A;  3L36 A;  2OYI B;  1YTZ I;  2WQY C;  1SQB G;  3BRV B;  1G1I A;  1LT1 A;  5CCH D;  5AVT B;  1M1J B;  3FWN A;  3GW6 A;  5GTH E;  1J1E C;  3P8C E;  1URQ B;  1IC2 A;  1NTK E;  4H44 B;  1BE3 G;  1SQP K;  3L73 E;  4U7J A;  3RBX A;  5AW3 B;  2JWA A;  2KNC A;  3CC7 P;  2M3B A;  3VP9 A;  3RBZ A;  2FYN B;  3MP7 B;  1P84 H;  1RF0 C;  1KIL A;  1LTI C;  3AEF C;  3PLN A;  1FZC B;  2IDB A;  1FAV A;  2FYU K;  2QVA A;  3BCC D;  2OTJ P;  3P8M C;  1SQQ G;  5APS A;  3GHG C;  2A45 G;  3E7K A;  3T97 A;  2YMK A;  1S72 P;  3VTP C;  1S5L E;  2Z4E A;  1ZRT E;  4WWI A;  1DIP A;  3TGU J;  3H1I G;  1OX3 A;  1PP9 E;  3TNU A;  2M3E A;  3WU2 E;  3HUS C;  1CZQ A;  2OGU A;  5TJH A;  3H1L D;  1X22 A;  3B4S A;  2WWW A;  3H1J G;  1BSN A;  1LP1 B;  3P32 A;  4N3Y B;  2B88 A;  4D6T E;  1GL2 C;  2A06 E;  2AXT H;  1PPJ E;  3L37 A;  2C9L Y;  1LNQ A;  1VF5 C;  1LWU B;  2J59 M;  3TGU D;  3OAK A;  5CJ0 A;  2V7Q J;  3CLQ A;  1KYO D;  1ZN5 A;  1KIL E;  3EQ2 A;  4L73 A;  5APY A;  1KOR A;  5APW A;  4YPC A;  1LP1 A;  2BCC E;  2FYU J;  3L72 E;  1FZF A;  1HGV A;  1X79 B;  3H1K G;  3II6 A;  5KAF E;  1NTM G;  3L74 J;  4JF7 A;  3VN0 A;  2FBW C;  4H13 C;  2FYU G;  3Q1M A;  1JTH B;  2V7Q H;  2W90 A;  1VQO P;  5CMZ A;  1NKZ B;  3AE1 C;  1NTM E;  3H1I D;  4LLH A;  5KAI H;  1BE3 J;  3B71 A;  3KZI E;  3PTZ A;  4OGQ B;  3Q5P A;  1URQ A;  2YXR B;  1USD A;  2LXB A;  2WPS A;  3TYY A;  2A45 H;  4N78 E;  2QJK C;  4C7N B;  1HF9 A;  3PJS K;  5KAF H;  3CI9 A;  4Z1M H;  5AW7 B;  1NWQ A;  4BRY A;  3HE5 A;  4XFJ A;  3RGU A;  1SFC B;  1E79 H;  1SQB K;  1L0L G;  2FY8 A;  2XZR A;  5KAI E;  3RK2 D;  4WY4 A;  1D7M A;  1T2K D;  3H1L G;  1S5L X;  2R32 A;  3E1I A;  4NPF X;  1ZV8 A;  1L2P A;  2N1T D;  2W6B A;  1MUU A;  2WPR A;  1H89 A;  1EZV G;  2WZ7 A;  1H0T B;  5AW0 B;  4BXL A;  3KDP B;  3L75 J;  1Q90 D;  2Q7C A;  2Q9I A;  3I56 P;  1W2E A;  2E74 C;  2XU6 A;  5AW6 B;  1SQQ E;  2MJZ A;  3L70 J;  2WTY A;  3SFE C;  1GMJ A;  3HD7 B;  1N7S D;  1JMB A;  2JJL A;  1SS1 A;  3IN6 A;  2CPB A;  1NH4 A;  4EYY Q;  2OYI C;  1GDT A;  1L0L K;  1JY3 P;  2K88 A;  3KPE A;  2W27 A;  1RF0 A;  1JY3 N;  4ZKU A;  2Y9Y A;  2KS1 A;  3M91 A;  2YNY A;  4H44 C;  1Z56 A;  4YXD C;  2QEX P;  4GT1 A;  1GD2 E;  1FZB A;  4QMA A;  5KKZ B;  2W8Z A;  3GHG A;  4PD4 E;  1WRG A;  3NMD A;  1NTK J;  4PJ0 H;  4H13 B;  1HJ0 A;  2HYN A;  2K37 A;  2HPC A;  5KLV D;  3M0A A;  1AQ5 A;  3HE4 A;  1FZC C;  1RH5 B;  1VF5 D;  3T97 B;  1RE4 A;  2IYO A;  3RK3 C;  2K9J B;  3AEE C;  3RK3 D;  1RE3 A;  1NU1 K;  2ZFC A;  2BCC G;  1SQQ J;  1N7L A;  1KQG B;  1RF1 A;  4LC1 A;  2AEM A;  1VL2 A;  3JSV C;  3VYI A;  1FZC A;  2C9N Y;  3PHL A;  4JQ0 D;  3GG2 A;  3C8V A;  2G3A A;  1HUC A;  1ZR4 A;  2E75 C;  1JNM A;  1KFM A;  1SQX J;  3MD0 A;  4IL6 E;  1PGO A;  2YXQ B;  2FFD B;  2YKO A;  3RL0 g;  2DW3 A;  1M57 D;  2IFN A;  1DD4 A;  2UWJ E;  2Z5I A;  3H1H J;  4H44 D;  3JCU E;  4HKZ H;  4R4L A;  2J58 A;  2L5G B;  3A0H E;  5L8R J;  3AED C;  3R2P A;  3D6Y A;  3H1H E;  3FXE A;  1DD3 A;  1PP9 G;  3MZW B;  2LXC B;  1LWU A;  3CCJ P;  4W7Y A;  3USS A;  1JEK A;  2FXP A;  4PV1 C;  4EDF A;  1NTZ D;  1QL2 A;  4IFF A;  2Q3E A;  1YJ9 P;  4YTP C;  1NU1 J;  1SQV J;  4ZKP A;  5KLV K;  1GTW A;  1EZV D;  1SQQ K;  1CI6 A;  3GMA A;  1IJD B;  1KB9 H;  2AEJ A;  2BAS A;  5AVS B;  5KLI C;  3H32 B;  4DCK A;  4NPD A;  5CCG D;  1VQN P;  3L74 E;  3CC2 P;  4HH2 A;  1KIL C;  3CL3 D;  1FJK A;  4U3F G;  4U3F E;  5AVU B;  3HE4 B;  3V4W A;  1MKM A;  3G3Z A;  5KKZ C;  1YIJ P;  1G2C A;  2OAR A;  5B5E H;  1K73 Q;  3O6Q B;  1NTK G;  1OVU A;  1X8Y A;  1EQ7 A;  1JB0 J;  1LTJ C;  2A06 G;  2O01 H;  4U3F J;  1KYO H;  2P58 A;  2IZ1 A;  4L74 A;  5AW4 B;  2RN0 A;  3BCC J;  2M8R A;  3H1H G;  1SLQ A;  1FDI A;  3Q3D A;  1N2D C;  2O3J A;  3FGA D;  3L71 G;  5DJT B;  4B86 A;  2OQQ A;  1OW8 A;  3B5N C;  3W68 A;  3V2N A;  3GF7 A;  1L0N D;  1URQ D;  2QJY C;  2WIT A;  3KXD A;  4W80 A;  3UIA A;  1IO4 A;  3V2Q A;  1DX7 A;  1GL2 A;  1NYH A;  1K05 A;  1QEX A;  2WPV B;  4WB4 A;  1A02 F;  1NTM J;  3L72 D;  3L74 G;  1X0T A;  2GUS A;  3KQG A;  3LW5 H;  2ZAE B;  2ZVN B;  3NFQ A;  2ITA A;  3M9H A;  3H1J D;  2KIK A;  2QIW A;  1HWT C;  3HRN A;  2OYH A;  3AE8 C;  1N8R Q;  3QWO C;  1YTZ T;  2L91 A;  1L4A B;  1ZOY C;  1VPC A;  2GUV A;  2WSF J;  2IFM A;  4XA4 A;  2SPZ A;  5GTH H;  1NU1 G;  1P84 D;  1T8Z A;  2MKV A;  1RF1 B;  3L73 D;  5BU8 B;  3U1C A;  1JUN A;  4N78 D;  1VDF A;  3LIE A;  1ZR2 A;  3TDK A;  2WSF H;  2XKM A;  1EXI A;  3H1K E;  3MTU E;  1VQM P;  1BGY D;  1PV3 A;  3A2A A;  1QLE D;  3MIW A;  3L75 E;  1NAF A;  3EFG A;  2RMZ A;  3CWB D;  1JTH A;  4PJ0 E;  3SSU A;  1GK6 A;  2QRX A;  1A02 J;  5APQ A;  1LWU C;  4EOT A;  1SQX G;  4I1L A;  2PGD A;  1KD1 Q;  2GM4 A;  4ZNC A;  1SQB D;  1EXJ A;  3CX5 D;  3H1L E;  2Z5H A;  1EDK A;  1SQX E;  2Y0C A;  4K35 A;  2K9Y A;  2A06 D;  1NGM B;  1AA0 A;  2WSE J;  3GLM A;  1PP9 J;  5AVZ B;  3V4Q A;  1JO5 A;  2RKL A;  3TGU E;  2ZXX A;  4WY4 C;  1MZ9 A;  4OH8 B;  3V5B A;  3OA7 A;  2KLU A;  3CME P;  2WSS H;  5CCH A;  1PPJ G;  1GK4 A;  5C39 A;  1H8A A;  5CHX A;  1SQV G;  2XNX A;  3H1K J;  3HUS B;  4PD4 D;  3EFF K;  3A0B H;  2Y0E A;  3V2R A;  3HTK A;  2C0W A;  2Y9Z A;  1Q82 Q;  1LJ2 A;  2D2C D;  4UB8 H;  1N73 A;  2B89 A;  2HR3 A;  1KQL A;  1CSB A;  2M0B A;  2BCC J;  2QJP C;  1JY2 P;  2IZ0 A;  3H1I E;  4NPE A;  2P2U A;  1IFM A;  2QM8 A;  1NJI Q;  1T3J A;  1RF1 C;  3BAT A;  3AEB C;  5AVR B; 
#chains in the Genus database with same CATH homology
 3M9B A;  1RE4 C;  2O1J A;  1RE3 C;  3B5N A;  1PFI A;  1H88 A;  5AVV B;  1GU5 A;  1LTS C;  1GZL A;  1FZE A;  3BVH A;  2NPS D;  3NTN A;  1LT9 A;  4IFM A;  2N9B A;  2OYH C;  4LGD E;  4Y99 C;  1IFJ A;  5APT A;  3M06 A;  3M9Q A;  5AVX B;  1J2J B;  4C7R A;  4RES B;  3HTK B;  1GW4 A;  2YKQ A;  3KYQ A;  4WBA A;  5KTB A;  3VMX A;  2R5B A;  3RL0 B;  1LTJ A;  3BRT B;  3MGN A;  2XV5 A;  5AVW B;  3N4X A;  3SWF A;  1JY2 N;  1N86 A;  2FFD A;  1NKN A;  1XTG B;  1SFC C;  3OJA B;  4WY4 A;  1MV8 A;  3H6P A;  1LT9 B;  2XDJ A;  5AVQ B;  1X9V A;  3BAS A;  2N1T B;  1N73 C;  2P7J A;  2Q5U A;  1GW3 A;  2WT7 A;  3C9I A;  1RF1 A;  1KZU B;  1S9K E;  1FDM A;  2CPS A;  1M7L A;  3VOP A;  2WSC H;  1LTJ B;  2VRS A;  1N7S B;  3MUD A;  1FZG A;  2E43 A;  1GL2 D;  1FU1 A;  5BVZ A;  2I1K A;  1HTL C;  1NOH A;  5BU5 A;  1NHL A;  5KJ7 A;  1LT9 C;  3A7O A;  2POH A;  4EIJ A;  1JOC A;  1OXZ A;  3RK2 B;  2LKM A;  3SWY A;  2O1K A;  4DOJ A;  4AUW A;  2FXM A;  4WY4 D;  1JY3 O;  1HGZ A;  2HLO A;  4C7N A;  3LID A;  4HYT B;  3GHG B;  2JEE A;  5CCH C;  3M0D C;  1L4A A;  1NTK K;  1LTA C;  1RY3 A;  4AYC A;  1JCC A;  1JCD A;  3O8Z A;  3N7N A;  3RK2 C;  3HD7 D;  1QL1 A;  2ZXE B;  5KJ7 D;  2HG5 D;  2Q3I A;  5AW2 B;  4GIF A;  2HFE D;  3L35 A;  3RL0 D;  4W7Z A;  5APU A;  2YKP A;  2PP6 A;  1G2C B;  2WPQ A;  1WT6 A;  3WMM 0;  4JYC A;  2HPC B;  1J1D C;  5APX A;  2A45 I;  3RL0 C;  3NXS A;  1J1E B;  4N6J A;  1GU4 A;  1N7S A;  1FOS E;  4C46 A;  5KJ7 C;  1SFC D;  1MFZ A;  4WY4 B;  1SQV K;  1LTG C;  2IX7 C;  1HBW A;  1LTT C;  1LTB C;  2WT7 B;  2FYZ A;  3HD7 C;  2H7H A;  2N1T A;  1SQX K;  1JY2 O;  1IK9 A;  5CCG C;  2FFD C;  2P1J A;  2H43 A;  4GKG A;  1KIL D;  1SFC A;  1FJP A;  1GL2 B;  1HVV A;  5AVY B;  1L4A C;  2WSE H;  3A3Y B;  2NPS B;  2KSJ A;  3H32 A;  3P8C D;  1HH0 A;  1KFN A;  2KYV A;  1J1D B;  1FBM A;  2NPS A;  2YO3 A;  3U1A A;  2R3C A;  4Y99 B;  1NTM K;  2HOD B;  3U59 A;  5AW5 B;  1JMM A;  4KHX A;  1T3U A;  1XTC C;  2YO2 A;  1CI6 B;  3HUS A;  2I1J A;  2R5D A;  2P67 A;  3B5N B;  5AW9 B;  4AQR D;  3HE5 B;  1DEB A;  3P7K A;  2E42 A;  1M1J C;  4XE5 B;  2KB7 P;  1DH3 A;  2W6A A;  1L4A D;  3I5C A;  5APV A;  3TNU B;  1HJB A;  1N7S C;  3M0D A;  1S9K D;  1CW5 A;  3HD7 A;  1SVF A;  3B8E B;  2IPP A;  1FZA A;  2N1T C;  1N73 B;  2PAJ A;  4O9B A;  3TSI A;  5CCG A;  1SP4 A;  1T2K C;  1IFN A;  1NO4 A;  2FKW B;  2KP8 A;  2C0X A;  2OYI A;  4DZO A;  4I6M C;  3TK1 A;  3L4F A;  3VMY A;  3A5T A;  5AW8 B;  2NPS C;  2QM7 A;  1ZLL A;  4IFD K;  2YMY A;  1YYC A;  4I2L C;  2GM4 A;  1G1J A;  1LGH B;  3IFM A;  1AFO A;  1URQ C;  2KLV A;  1IFI A;  1KIL B;  5AW1 B;  3B5N D;  1E5W A;  1L0N K;  4JYB A;  3VMZ A;  1OWA A;  2KOG A;  3RK3 B;  1M1J A;  4M3L A;  1NTZ K;  3IR9 A;  3PP5 A;  1IFD A;  2H8P D;  2HOD A;  3L36 A;  2OYI B;  1YTZ I;  3BRV B;  1G1I A;  5CCH D;  5AVT B;  1M1J B;  1J1E C;  3P8C E;  1URQ B;  1IC2 A;  1SQP K;  5AW3 B;  2M3B A;  3VP9 A;  1RF0 C;  1KIL A;  1LTI C;  1FZC B;  1FAV A;  2FYU K;  3P8M C;  5APS A;  3T97 A;  3GHG C;  2A45 G;  3VTP C;  2Z4E A;  3TNU A;  3HUS C;  1CZQ A;  3P32 A;  4N3Y B;  2WWW A;  1GL2 C;  3L37 A;  2C9L Y;  1LWU B;  2J59 M;  3OAK A;  5CJ0 A;  5AW0 B;  3CLQ A;  1ZN5 A;  3EQ2 A;  5APY A;  5APW A;  1FZF A;  1HGV A;  1X79 B;  3II6 A;  4JF7 A;  3VN0 A;  1JTH B;  5CMZ A;  1NKZ B;  4LLH A;  1URQ A;  2WPS A;  3TYY A;  4C7N B;  2A45 H;  4N78 E;  3CI9 A;  5AW7 B;  1NWQ A;  3HE5 A;  1SFC B;  1SQB K;  2XZR A;  3RK2 D;  1T2K D;  2R32 A;  3E1I A;  1ZV8 A;  2N1T D;  2WPR A;  2W6B A;  1MUU A;  1H89 A;  2WZ7 A;  3KDP B;  2Q7C A;  2Q9I A;  1W2E A;  2XU6 A;  5AW6 B;  2MJZ A;  3HD7 B;  1N7S D;  2JJL A;  2OYI C;  1GDT A;  2CPB A;  1NH4 A;  1L0L K;  1JY3 P;  3KPE A;  2W27 A;  1RF0 A;  1JY3 N;  4ZKU A;  3M91 A;  2YNY A;  1Z56 A;  4GT1 A;  1GD2 E;  1FZB A;  3GHG A;  1WRG A;  3NMD A;  2HYN A;  2HPC A;  3M0A A;  1AQ5 A;  3HE4 A;  1FZC C;  1RE4 A;  3RK3 C;  3RK3 D;  1RE3 A;  1NU1 K;  2ZFC A;  1N7L A;  4LC1 A;  3VYI A;  1FZC A;  2C9N Y;  1HUC A;  1ZR4 A;  1JNM A;  1KFM A;  3MD0 A;  2FFD B;  2YKO A;  3V2P A;  5CJ4 A;  2IFN A;  2WTY A;  1FOS F;  2Z5I A;  2J58 A;  2L5G B;  3R2P A;  1LWU A;  4W7Y A;  1QL2 A;  4IFF A;  4ZKP A;  5KLV K;  1GTW A;  1SQQ K;  1CI6 A;  1IJD B;  2BAS A;  5AVS B;  3H32 B;  5CCG D;  4HH2 A;  1KIL C;  3CL3 D;  1FJK A;  5AVU B;  3HE4 B;  3V4W A;  3G3Z A;  1G2C A;  2OAR A;  1X8Y A;  1EQ7 A;  1LTJ C;  2O01 H;  5AW4 B;  2M8R A;  1SLQ A;  1N2D C;  4B86 A;  3B5N C;  3V2N A;  1URQ D;  2WIT A;  4W80 A;  3UIA A;  1DX7 A;  1IO4 A;  3V2Q A;  1GL2 A;  4WB4 A;  1A02 F;  2GUS A;  3KQG A;  3LW5 H;  3NFQ A;  3M9H A;  1HWT C;  3HRN A;  2OYH A;  1YTZ T;  1L4A B;  1VPC A;  2GUV A;  4XA4 A;  2IFM A;  1RF1 B;  1T8Z A;  5BU8 B;  3U1C A;  1JUN A;  4N78 D;  1VDF A;  3LIE A;  1ZR2 A;  2WSF H;  2XKM A;  3MTU E;  3A2A A;  3MIW A;  1NAF A;  3EFG A;  1JTH A;  1A02 J;  1GK6 A;  5APQ A;  1LWU C;  4EOT A;  4I1L A;  2Z5H A;  3V4Q A;  1JO5 A;  5AVZ B;  4WY4 C;  1MZ9 A;  4OH8 B;  3V5B A;  3OA7 A;  5CCH A;  1H8A A;  1GK4 A;  5CHX A;  2XNX A;  3HUS B;  3V2R A;  3HTK A;  2C0W A;  1N73 A;  1KQL A;  1CSB A;  2OYH B;  1JY2 P;  2P2U A;  1IFM A;  2QM8 A;  1RF1 C;  1T3J A;  3BAT A;  3VP8 A;  5AVR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...