2A45G

Crystal structure of the complex between thrombin and the central "e" region of fibrin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
48
structure length
48
Chain Sequence
b'SACKDSDWPFCSDEDWNYKCPSGCRMKGLIDEVNQDFTNRINKLKNSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thrombin light chain
publication title Structural basis for sequential cleavage of fibrinopeptides upon fibrin assembly.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 10
structure length 48
sequence length 48
chains with identical sequence J
ec nomenclature
pdb deposition date 2005-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2a45G00
1JY2P 2OYIB 1JY3O 1LTJA 1RE4C 1LT9B 2OYHB 1FZEA 1RF0A 1RF1C 2FFDA 3E1IA 2Q9IA 2A45I 3GHGA 1N73C 1LTJC 1LWUB 3H32A 2HODA 1JY2N 1T3UA 2XNXA 1FZGA 1FZCB 1LT9A 1M1JB 1RF0C 3HUSB 2OYIA 2OYHA 2FFDC 3GHGC 1RF1B 1JY3P 1FZAA 3H32B 1FZFA 2A45H 1LWUA 1JY2O 1LT9C 2HLOA 1W2EA 2Z4EA 2HPCB 1RE3A 1FZCA 2OYIC 2OYHC 1M1JA 3BVHA 3HUSA 1N73B 1LTJB 2H43A 1LWUC 1RE4A 2A45G 1JY3N 1N73A 2FFDB 1RF1A 1RE3C 1FZCC 1FZBA 1N86A 3GHGB 2HPCA 1M1JC 3HUSC 2HODB
chains in the Genus database with same CATH superfamily
1YQ4C 1MZ9A 3L35A 2CPBA 2KZIA 4H13C 1M57D 1SQQE 3MGNA 4U3FD 1SFCA 3C1LA 1IFPA 5C39A 5AW5B 4DOJA 3SWYA 3B71A 4OVNF 3I55P 4HKZH 2KI7B 2QA4P 1W2EA 1N7SA 3VMYA 3IFMA 4WB4A 2ZVOB 1KILE 1GZLA 3CCUP 1RF1C 1XTGB 1R5SA 3RL0B 2WMMA 1VQ6P 2Q7CA 2P10A 2RKLA 1NTKG 1GU5A 4Y99C 3A7OA 1J1DB 4EOTA 3TDKA 2C0XA 1M1KQ 2PGDA 1JCCA 1VPCA 1IK9A 1N86A 2IBZD 2KUBA 1ZOYC 1EDIA 3AE3C 3GHGA 3HE5B 3AE7C 3H1LD 1EQ7A 3KXDA 4L74A 1L0NG 1KYOE 1NTMJ 1JB0J 4GDOA 1CW5A 1IO4A 2QJYB 1FU1A 2OYIB 5KKZC 1LNQA 1LTJC 1BE3E 1AV1A 1LWUA 1JY2O 2QJKB 2Q3IA 5B5EE 1ZMEC 2FY8A 4KJMA 4ZNCA 2C9NY 2AEMA 3L75J 3CCLP 2W27A 1LTAC 1SQXD 3G9RA 1K8AQ 3BATA 1SFCD 2LXCB 1NH4A 3BRTB 1IC2A 3W67A 1PFIA 3SWKA 1J2JB 1PIXA 3W68A 2NZ2A 1EDLA 1N7SD 4QMAA 3H25A 3MUDC 1KILC 1BGYD 2NPSC 3PHLA 2XNXA 4HB1A 2SPZA 1Y9BA 1NVOA 4PD4D 1Q2NA 1S9KD 2JWDA 1S1CX 3H6PA 5APUA 2I1KA 1A02J 2WWWA 3TK1A 3L71D 1JNMA 2E5TA 1DD3A 2Z5HA 3A0HH 2JJLA 3B5NA 2B87B 1GL2B 4YTPC 2QM7A 1H88A 2POHA 1GK6A 3K5BA 4BRYA 1SQVJ 1JTHA 2ZT9C 4IFMA 1PGQA 4KT0J 1WT6A 2ZYGA 2OTLP 2H89C 1X9VA 3Q5PA 3A0BE 1EZVI 3H1JD 4ZKUA 2XDJA 1AQTA 2ZYDA 1SQQG 3NTNA 1VQKP 1JY3N 4YPCA 4C7NA 1M1JC 1VQ9P 2YXRB 4DCKA 4JYCA 3MZWB 2H8PD 2AXCA 2K9YA 1GD2E 3Q1MA 3CCEP 1AQ5A 2IFMA 2YKQA 3GMAA 3H1KG 1QVFO 1DEEG 1Y8AA 4PV1D 3BRVB 3L73G 3F5HA 2KSJA 3D71A 2B9BA 4GIFA 2OYOA 3SWFA 3CCQP 4OGQB 1LTGC 3GG2A 1S9KE 2Z4EA 3IF4A 1YTZT 3I5CA 4WY4B 1MUUA 1NTZK 2P2UA 1XTCC 3RK2D 2W6AA 4IL6E 3L72D 1QLED 3KZIE 1PV3A 2GUSA 1JUNA 1KYOH 1T3UA 1FZGA 1YJ9P 1K05A 3V5BA 2A45H 3B5ND 4K3AA 4N78D 2KYVA 5KAFH 3H1HJ 1EC5A 5AW0B 1U7MA 2WSEH 4I7ZB 3CWBJ 4ASWA 5AVWB 3H1JE 2E76B 3PP5A 3CC7P 4RKUJ 2KNCB 2K3RA 4NPEA 5B5EH 3KYQA 4U3FG 2Z5IA 3D70A 2N1TC 2D2CD 3CL3D 2E5YA 1LTJA 2NRGA 1M7LA 1SQBJ 1SFCC 1FZCB 2OYHA 3S1KA 2W8ZA 4TLFA 1UIIA 1NTZE 4H13D 5AW2B 2QIWA 3HUSA 1AVOA 3L70J 1N7SC 4M3LA 1YIJP 1PGOA 1CSBA 1G1JA 4DZOA 1QGKB 2YMYA 1JEKA 4ZKPA 2IBZG 4EI2A 2AXTH 2BCCJ 3MIWA 4XA4A 1ZV8A 3H1LG 1BCCD 4WBAA 1OZHA 2WSCJ 2KOGA 3AE2C 2H7HA 1RE4A 4XFJA 1NU1E 3MTUE 2FYUJ 1ZR2A 3A0BH 3B8EB 3BCCJ 3P8CD 3V2QA 3S9OA 3H1IE 3CCSP 3TGUJ 3SFDC 1M8OB 3P32A 4RJTA 1FZFA 2JO1A 2OTJP 1WRGA 2KP8A 1ZRTD 1VDFA 1TU3F 1H0TB 3EQ2A 1YJWP 5AVSB 1KORA 3VYIA 3RK3B 2MJZA 2C9LY 1RY3A 1S2EA 4LC1A 1FAVA 3G4SP 1LTTC 2YIUB 1N73B 3WUTA 4PV1C 3M9QA 2E42A 1R5LA 1FDMA 2FYNC 3P8MC 4NPFX 1CZQA 3V6IA 2KLVA 4IL6H 2A06D 1FC2C 2HG5D 3KZIH 3L71G 4OH8B 4RO0A 3RK2C 1NTMK 1FJPA 1OXZA 1JY3O 1KFNA 1LT9B 4JF7A 2Q1KA 4WWIA 1NTKJ 4YXDC 1RF1B 3B5NC 2Q5UA 2IYOA 3FWNA 5CJ0A 2V7QJ 1KD1Q 3L36A 1HUCA 2HPCA 1OX3A 1NKNA 1ZLLA 3H1JG 3V4WA 5AW3B 1GTWA 3VOPA 4IFFA 2ITAA 3D6YA 1VF5C 1PP9J 3A0HE 3TF5A 3VMAA 3HE4A 1QX8A 1L0NJ 1ZR4A 2R5BA 1KYOD 5KLIC 1LP1B 2HODB 2AEJA 1T2KD 1GW3A 1T3JA 3FXDA 2KSEA 2E75B 3JC22 2IX7C 1BE3D 1P84E 1SQPJ 2OQQA 2N1TA 1OW7A 1KB9I 1NTME 4ASVA 4C7RA 1G2CB 1RF0A 2WSFJ 3V2NA 1OW6A 4GT1A 2A06E 2WT7B 1Q82Q 3U1CA 3JCUH 2KIKA 3L72G 5GTHH 3Q3DA 2KK7A 2P7JA 3M0AA 1AFOA 3M91A 1YQ3C 5TJHA 2NPSB 3A5TA 5AW1B 3CC2P 2QSIA 4D6TD 1U7JA 3GF7A 4AUWA 1JY2P 5AW6B 2IFNA 4ZMDA 5CBNA 2MKVA 2JKVA 3AE1C 1VQ7P 3F89A 1ZW0A 2G3AA 2FXMA 2DW3A 3FX0A 5KAFE 1YI2P 2IZ1A 2Q9IA 1Y47A 5KLVJ 1LT1A 3AEGC 2VRSA 2J58A 1SP4A 4HH2A 1YHQP 1OMIA 2OYHC 2H43A 1S3JA 3H1HD 2N1TD 1KYOI 2ZXEB 3HUSC 2YO3A 2QJPB 1LGHB 2LR2A 1HJ0A 1GK4A 2A45I 1M1JB 2JWAA 5APTA 1EXJA 1DX7A 1IZNB 1BDCA 1BCCG 3H1KJ 3FWLA 2WQYC 3L73J 4IL6X 3AE9C 3WU2E 1X8YA 1CI6B 1HGZA 2PAJA 3AE6C 1Q81Q 2M5AA 3Q5SA 4D6TE 3FXEA 1GU4A 2KXPB 1X22A 2AXTE 1SVFA 1RE4C 1L4AA 3PH0A 3CCJP 1URQA 1LJ2A 1SQBK 1OIPA 2WTYA 1JCDA 2KS1B 4EIJA 2HR3A 3T97B 4O9BA 3HRNA 1T2KC 2Y9ZA 2IBZI 3O6QB 4NPDA 1P84H 3M9BA 3H32A 2Q3EA 3SFEC 4L75A 2R44A 1VQNP 3H1HE 2E76D 4I2LC 5AVQB 4U3FJ 4HJGH 3VP9A 5TISH 2XU6A 2FKWB 4JPZB 5L8RJ 3CWBE 3HD7A 4TT3H 2Y0DA 2QJKC 3RBXA 1OWAA 3NMDA 3BCCD 3IAOA 1E5WA 2A06G 5BVZA 2HLOA 1SFCB 3AECC 1NTZD 1N8RQ 2YMKA 1N73A 1SQBE 2BEZF 2FYUK 3P7KA 1N7SB 1X79B 1S5LE 2QM8A 3A3YB 1HBWA 1PPJE 2IYPA 1HWTC 3GF3A 2O01J 3L70E 3MD0A 2FFDB 1EDKA 4H44B 2YKPA 2K9JA 1H89A 3H1LJ 3G6EP 3KQGA 3C8VA 1LT9A 1L4AD 1YYCA 1URQD 2BCCE 4JQ0D 2M3BA 1VQPP 3HTKA 1KMIZ 4PD4I 2A45G 2JEEA 3GHGB 2YKOA 1NU1D 1L0LJ 1W2BO 1BE3G 5CCHA 4PJ0E 3H1ID 4DJGA 1VF5D 3NFQA 5EFWB 1IFNA 2FYUE 3WUVA 1SQXJ 1NAFA 3BCCE 2E43A 1NU1K 4H0LD 3L74J 1LWUB 2K1AA 3TGUE 1RF0C 3HD7D 4Z1MH 2FXPA 1GW4A 1HVVA 1BSNA 5CMZA 1NTKK 4L76A 4U7JA 3D6ZA 1BGYJ 2E74D 2PFXA 3AE4C 1EXIA 3WU2H 5BU8B 3OJAB 1JO5A 4PV1B 2B88A 2K37A 5AW8B 1QEXA 4D6TG 3USSA 1QL2A 1NHLA 2AEFA 3Q5RA 3CCMP 3CX5E 2N9YB 2WT7A 1L0NK 3L71J 3PLNA 2RH0A 3ITKA 3JCUE 2O1KA 2Y0EA 5GTHE 3RGUA 1PL5A 2W83C 2IPPA 1KV4A 3II6A 5APYA 3U59A 1VQMP 1IFDA 2H88C 2R32A 4WVZA 1SQPK 3CD6P 2WPQA 3B5NB 3H1JJ 1OVRA 4Y28J 3AEEC 4W7ZA 2QG4A 1JY2N 1FE6A 1NTKE 4L73A 4BRYB 4JBZA 4GOEA 3H1HG 1JTHB 3HE5A 5CCHD 2E76C 5CBOA 2L5GB 2W6BA 5B66E 2D2CB 4UB8H 1LTBC 2RN0A 5KLIB 4GODA 3KHUA 2FBWC 3RK3E 2OYIA 1ZP0C 3R4YA 1PP9E 4C7NB 1L0NE 1P84D 1K73Q 1NTMD 2E75D 1FZCC 5DJTB 4H13B 1KFMA 1S5LH 5APXA 3OW2O 1K04A 2IZ0A 1KC8Q 5KLVD 2OGUA 1SQPE 3WUUA 4OWFA 2XZRA 4R4MA 4MN4C 5M1BA 3NXSA 1A02F 1FS0E 3L72J 2M3EA 3CPWO 3L75D 4EYYQ 1L4AC 3AEDC 5KLVK 2BCCG 1URQC 3IN6A 3RL0D 2WPSA 1FZBA 4Y99B 2HYNA 3RBZA 3CXHE 2WSCH 1IFJA 3ABVC 1KN7A 2O3JA 4PJ0H 3JSVC 3CCVP 1NJIQ 3TNUB 1MFZA 1FDOA 3KDPB 2B87A 3L4FA 1KQSO 4I6MC 1G1IA 5H2FE 1GL2A 1MKMA 1HF9A 3BCCG 5BU5A 2I8DA 4AYCA 1T6AA 2XNDH 1IK7A 3GLMA 4H0LC 3TGUG 4I1LA 3HD7C 1HGVA 3AE5C 1NTZG 3O6QA 3G3ZA 1X0TA 5KKZB 5K5GB 3EWKA 1IFIA 1LTJB 3QH9A 1D7MA 2E74C 1VQLP 4XE5B 1SQVD 1KQGB 2OYHB 1IFMA 5KLVE 3Q2YA 5TISE 2YIUC 1N73C 3BASA 2PP6A 3HUSB 1SLQA 1UIXA 1ZXGA 3CX5H 3V2PA 3N4XA 4KHXA 5AW4B 1RE3C 2WPVB 1P84I 1BCCJ 5KAIH 3L75E 3V4QA 1USEA 1SQVK 5APVA 2K88A 2R3SA 1KILB 1LT9C 1RQVA 1Z56A 1NU1G 3H1KE 5KJ7A 2JP3A 4WY4A 2B89A 3MP7B 2FFDA 5APQA 3M9HA 2PRRA 3L73E 3H1IG 1J1EC 2V7QH 1JMMA 2ZAEB 5CCHC 3A2AA 3VP8A 2ZYAA 5B66H 2ZXXA 1JMBA 3CCRP 1GL2D 2CK3H 1YITP 1FZEA 1EZVD 4HYTB 5GTIH 1PP9G 2ZT9B 2V4HA 3R2PA 1LTIC 3BVHA 1GDTA 2KNCA 2E75C 1SQQJ 1SQVE 5CCGA 2J5UA 1RHZB 2QVAA 3E1IA 1QL1A 1L0LD 1S72P 3CWBD 1SQPG 1Q7YQ 3GW6A 3PTZA 1NO4A 1N7LA 4RESB 1FZCA 1FOSE 4U3FE 1S5LX 3CC4P 1K9MQ 1NWQA 4N3YB 2WSFH 2R3CA 3EFGA 2KLUA 3PRJA 2BEQD 1L0LK 1SQBD 3L74D 2R5DA 4R4LA 1JM0A 1HTLC 2XV5A 3CXHH 1PPJD 3RL0C 3M0DA 1YBKA 2FXOA 1KZUB 1KQFB 3L70D 4OGQD 1J1DC 5KTBA 5KJ7D 1NKZB 1SQXK 2Y0CA 1R8EA 4WY4D 2M0BA 3ZDMA 2L91A 4H44D 5H2FH 1DEBA 2HPCB 4IFDK 2IBZE 3AEAC 2BCCD 4YXWH 2LXBA 5E79E 1KB9H 1EZVE 2JR8A 4JYBA 3LW5J 1M56D 3H1LE 1DIPA 2WSEJ 3HE4B 1BE3J 1OVUA 1VQOP 4K35A 1NTMG 2JDIH 1M90Q 1NYHA 2QJYC 2OYIC 5AVXB 2GUVA 5AVZB 2YXQB 5KLVG 1L0LE 1L2PA 3IR9A 1H0TA 2FYUD 2N1TB 5CCGD 1SS1A 3TGUD 4UB8E 2QJPC 1NGMB 3E1RA 3MHVA 3WMM0 3L75G 1SQXE 5CJ4A 3LIDA 1FDIA 3E7KA 3L74E 3AE8C 5DJUB 1N2DC 3EFFK 1RE3A 4D6TJ 1VQ5P 3B4SA 1BGYE 3CX5D 3S4RA 2QE7H 2ZJSE 2P67A 2YO2A 1HJBA 4PD4E 2ZFCA 3SSUA 2QRXA 2WSSH 3L37A 1RF1A 2IDBA 3L71E 1GL2C 1H8AA 4LLHA 1OVVA 1HH0A 2I1JA 4AQRD 3TNUA 1NTKD 3AEBC 1KQLA 3LW5H 4W7YA 1SQVG 2OTKE 1Q90D 5APSA 4UB6E 3UIAA 1IJDB 2HFED 1LP1A 5AW9B 2HODA 5AVVB 2KZJA 1U57A 3RK3D 1PP9D 3PJSK 3I56P 3M06A 1OW8A 1L0ND 2LKMA 1USDA 4N6JA 1G2CA 1T8ZA 4BWNA 2UWJE 1QVGO 1AVYA 1BSHA 2FYNB 1SQPD 3VN0A 1Q86Q 2G8YA 1NOHA 4OGQC 1GMJA 2OARA 5AVTB 1E79H 5KJ7C 2M5AB 5KAIE 4WY4C 4GKGA 3RK2B 1RH5B 2FFDC 4H44C 4B86A 2O01H 1NAYA 3QWOC 1YTZI 2WPRA 5E79H 2YNYA 2P58A 1L4AB 3MUDA 1EZVG 3L72E 4IOIH 1KILA 1URQB 3VMZA 3G71P 2NPSA 2CPSA 3CX5I 1BDDA 3CXHD 2M8RA 4N78E 5AVYB 3GHGC 1PGJA 3OA7A 3U1AA 4I7ZC 4C46A 1DD4A 2WITA 1LTSC 3O8ZA 1L0LG 3CWBG 3H32B 2N9BA 1VF5B 3VMXA 2BASA 2Q6QA 5CCGC 1VQ8P 2FYZA 3CMEP 3CLQA 1KB9D 1AJYA 1JY3P 3TSIA 1NTZJ 4H0LB 5GTIE 4EDFA 3HD7B 1LWUC 1SQXG 2WVRA 1SQBG 3L74G 1OFCX 3CI9A 2O01N 1VL2A 2Y9YA 2W90A 3TYYA 2E74B 1PPJG 1ZN5A 1FZAA 4W80A 1M1JA 3L70G 3V2RA 4BXLA 1BGYG 2WZ7A 3RL0g 2W6JH 1SQQD 3M0DC 5AVUB 1VQ4P 2P1JA 4PD4H 2QEXP 3N7NA 1PZQA 3AEFC 4A7PA 1FBMA 1JOCA 2K9JB 5APWA 1CI6A 2GA1A 1NU1J 1BCCE 4GOFA 2C0WA 5CHXA 3OAKA 3H1KD 1SQQK 1DH3A 1KILD 2NPSD 3H1IJ 3HTKB 2GM4A 3L73D 3C9IA 1FOSF 4UB6H 1S4XA 2XKMA 5AVRB 1J1EB 2FYUG 3FGAD 3P8CE 1W5CE 1MFTA 2KS1A 4CPGA 3T97A 2J59M 3CMAP 1KB9E 1FJKA 1RQUA 2KB7P 1KTMA 1PGPA 3CXHI 3KPEA 1ZRTE 4LGDE 3RK3C 5AW7B 4DT0A 3VTPC 2O1JA 2D2CC 1WMKA 2RMZA 2ZVNB 1EDJA 3LIEA 1AA0A 1MV8A 2ZT9D 1YJNP
chains in the Genus database with same CATH topology
1MZ9A 3B8EB 3P8CD 1H89A 3L35A 3V2QA 2CPBA 3KQGA 1L0LK 1LT9A 2R5DA 1L4AD 3P32A 1YYCA 1HTLC 1URQD 1FZFA 1WRGA 2XV5A 2KP8A 2M3BA 1VDFA 3HTKA 3RL0C 3EQ2A 3M0DA 3MGNA 2A45G 2JEEA 5AVSB 3GHGB 3VYIA 3RK3B 1KZUB 1SFCA 2MJZA 2YKOA 1J1DC 5KTBA 5AW5B 2C9LY 5KJ7D 4DOJA 1NKZB 1RY3A 1SQXK 2R3CA 3SWYA 5CCHA 4WY4D 4LC1A 1FAVA 1DEBA 2HPCB 4IFDK 1W2EA 1N7SA 3NFQA 3VMYA 1LTTC 1N73B 1IFNA 3M9QA 3IFMA 4WB4A 2E42A 1GZLA 4JYBA 1NAFA 1FDMA 1RF1C 3P8MC 1XTGB 2E43A 3RL0B 1NU1K 1LWUB 3HE4B 2Q7CA 1CZQA 1RF0C 1GU5A 3HD7D 4Y99C 1GW4A 3A7OA 1J1DB 4EOTA 1HVVA 2OYIC 2C0XA 2KLVA 5CMZA 1NTKK 1JCCA 1VPCA 5AVXB 2GUVA 2HG5D 4OH8B 1IK9A 3RK2C 1N86A 5AVZB 1NTMK 1FJPA 1OXZA 1JY3O 3IR9A 1KFNA 1LT9B 5BU8B 3GHGA 2N1TB 3OJAB 5CCGD 1JO5A 3HE5B 4JF7A 5AW8B 1EQ7A 1RF1B 3B5NC 2Q5UA 1QL2A 1NHLA 5CJ0A 3WMM0 3L36A 1HUCA 2WT7A 1CW5A 2HPCA 1NKNA 1ZLLA 1L0NK 3V4WA 5CJ4A 1IO4A 1FU1A 2OYIB 2O1KA 3LIDA 5AW3B 1GTWA 3VOPA 1LTJC 4IFFA 1N2DC 2IPPA 3II6A 5APYA 1LWUA 1JY2O 3U59A 3HE4A 1RE3A 1IFDA 2Q3IA 2R32A 1ZR4A 2R5BA 1SQPK 2C9NY 2WPQA 2HODB 3B5NB 1T2KD 1GW3A 2W27A 1T3JA 1LTAC 3BATA 4W7ZA 1SFCD 1NH4A 1JY2N 2IX7C 2P67A 2YO2A 3BRTB 1HJBA 1IC2A 1PFIA 2ZFCA 1J2JB 2N1TA 1JTHB 3HE5A 5CCHD 4C7RA 3L37A 1G2CB 1RF1A 1N7SD 1GL2C 1H8AA 1RF0A 1KILC 2L5GB 2W6BA 4LLHA 1LTBC 2NPSC 1HH0A 2XNXA 3V2NA 2OYIA 4GT1A 4C7NB 2I1JA 4AQRD 2WT7B 3TNUA 3LW5H 1KQLA 3U1CA 4W7YA 1S9KD 5APSA 1FZCC 2P7JA 3M0AA 3H6PA 5APUA 3UIAA 1KFMA 2I1KA 1A02J 1IJDB 2WWWA 3TK1A 1AFOA 2HFED 3M91A 5APXA 1JNMA 5AW9B 2Z5HA 2JJLA 2HODA 3B5NA 1GL2B 5AVVB 2QM7A 2XZRA 3RK3D 1H88A 2POHA 2NPSB 1GK6A 3A5TA 3NXSA 5AW1B 3M06A 1A02F 1JTHA 4IFMA 4AUWA 2LKMA 1JY2P 1WT6A 4N6JA 1G2CA 5AW6B 1T8ZA 2IFNA 1X9VA 4ZKUA 1L4AC 5KLVK 2XDJA 1URQC 2FXMA 3RL0D 2WPSA 3NTNA 1JY3N 3VN0A 4C7NA 1FZBA 4Y99B 1M1JC 2HYNA 1NOHA 2WSCH 2OARA 5AVTB 4JYCA 5KJ7C 2Q9IA 1IFJA 2H8PD 3RK2B 4WY4C 4GKGA 2FFDC 3TNUB 1MFZA 4B86A 2VRSA 2O01H 2J58A 1SP4A 4HH2A 1GD2E 1YTZI 2WPRA 3KDPB 2YNYA 1AQ5A 2OYHC 2IFMA 3L4FA 2YKQA 4I6MC 1G1IA 2H43A 1GL2A 1L4AB 3MUDA 2N1TD 1KILA 1URQB 2ZXEB 3HUSC 3VMZA 5BU5A 2NPSA 3BRVB 4AYCA 2YO3A 2CPSA 1LGHB 2KSJA 1GK4A 2A45I 2M8RA 4I1LA 4GIFA 1M1JB 4N78E 3HD7C 5AVYB 3SWFA 3GHGC 1HGVA 3OA7A 3U1AA 3G3ZA 1LTGC 5APTA 1DX7A 1S9KE 2Z4EA 4C46A 2WITA 1YTZT 3I5CA 1IFIA 1LTJB 4WY4B 1LTSC 3O8ZA 1MUUA 1NTZK 2P2UA 1XTCC 3RK2D 3H32B 2N9BA 2W6AA 4XE5B 3VMXA 2BASA 2OYHB 1IFMA 2GUSA 1JUNA 5CCGC 1N73C 2FYZA 3BASA 1T3UA 1FZGA 2PP6A 3HUSB 1SLQA 3CLQA 1X8YA 1CI6B 1HGZA 1JY3P 2PAJA 3V5BA 3TSIA 2A45H 3B5ND 4N78D 3V2PA 2KYVA 3N4XA 1GU4A 3HD7B 1LWUC 4KHXA 5AW4B 1RE3C 5AW0B 2WSEH 1SVFA 3V4QA 1RE4C 1L4AA 3PP5A 5AVWB 3CI9A 1SQVK 5APVA 1URQA 3TYYA 1SQBK 1ZN5A 1FZAA 2WTYA 1JCDA 1KILB 1LT9C 1Z56A 3KYQA 4W80A 4EIJA 1M1JA 2Z5IA 2N1TC 3V2RA 3CL3D 2WZ7A 4O9BA 5KJ7A 3HRNA 1T2KC 3M0DC 5AVUB 1LTJA 4WY4A 2P1JA 2FFDA 5APQA 1M7LA 3M9HA 1SFCC 3M9BA 3H32A 3N7NA 1FZCB 2OYHA 1J1EC 1JMMA 1FBMA 5CCHC 1JOCA 5AW2B 3A2AA 4I2LC 5APWA 3HUSA 5AVQB 3VP8A 1CI6A 3VP9A 1N7SC 2XU6A 2FKWB 2C0WA 4M3LA 5CHXA 3OAKA 1GL2D 1FZEA 3HD7A 1SQQK 1DH3A 1CSBA 1KILD 1OWAA 4HYTB 3NMDA 1G1JA 1E5WA 2NPSD 4DZOA 3HTKB 2GM4A 2YMYA 3R2PA 3C9IA 1FOSF 5BVZA 4ZKPA 2HLOA 1SFCB 2XKMA 1LTIC 3BVHA 1GDTA 5AVRB 1J1EB 3MIWA 3P8CE 4XA4A 5CCGA 1N73A 1ZV8A 3T97A 2J59M 3E1IA 1QL1A 4WBAA 2FYUK 3P7KA 1FJKA 2KB7P 1N7SB 1X79B 2KOGA 3KPEA 2QM8A 4LGDE 3A3YB 1HBWA 1NO4A 1N7LA 4RESB 3RK3C 5AW7B 3VTPC 1HWTC 1FZCA 1FOSE 2O1JA 2H7HA 1RE4A 3MD0A 3LIEA 3MTUE 2FFDB 1NWQA 1MV8A 4N3YB 2WSFH 3EFGA 2YKPA 1ZR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY2 P;  2OYI B;  1JY3 O;  1LTJ A;  1RE4 C;  1LT9 B;  2OYH B;  1FZE A;  1RF0 A;  1RF1 C;  2FFD A;  3E1I A;  2Q9I A;  2A45 I;  3GHG A;  1N73 C;  1LTJ C;  1LWU B;  3H32 A;  2HOD A;  1JY2 N;  1T3U A;  2XNX A;  1FZG A;  1FZC B;  1LT9 A;  1M1J B;  1RF0 C;  3HUS B;  2OYI A;  2OYH A;  2FFD C;  3GHG C;  1RF1 B;  1JY3 P;  1FZA A;  3H32 B;  1FZF A;  2A45 H;  1LWU A;  1JY2 O;  1LT9 C;  2HLO A;  1W2E A;  2Z4E A;  2HPC B;  1RE3 A;  1FZC A;  2OYI C;  2OYH C;  1M1J A;  3BVH A;  3HUS A;  1N73 B;  1LTJ B;  2H43 A;  1LWU C;  1RE4 A;  2A45 G;  1JY3 N;  1N73 A;  2FFD B;  1RF1 A;  1RE3 C;  1FZC C;  1FZB A;  1N86 A;  3GHG B;  2HPC A;  1M1J C;  3HUS C;  2HOD B; 
#chains in the Genus database with same CATH topology
 1YQ4 C;  1MZ9 A;  3L35 A;  2CPB A;  2KZI A;  4H13 C;  1M57 D;  1SQQ E;  3MGN A;  4U3F D;  1SFC A;  3C1L A;  1IFP A;  5C39 A;  5AW5 B;  4DOJ A;  3SWY A;  3B71 A;  4OVN F;  3I55 P;  4HKZ H;  2KI7 B;  2QA4 P;  1W2E A;  1N7S A;  3VMY A;  3IFM A;  4WB4 A;  2ZVO B;  1KIL E;  1GZL A;  3CCU P;  1RF1 C;  1XTG B;  1R5S A;  3RL0 B;  2WMM A;  1VQ6 P;  2Q7C A;  2P10 A;  2RKL A;  1NTK G;  1GU5 A;  4Y99 C;  3A7O A;  1J1D B;  4EOT A;  3TDK A;  2C0X A;  1M1K Q;  2PGD A;  1JCC A;  1VPC A;  1IK9 A;  1N86 A;  2IBZ D;  2KUB A;  1ZOY C;  1EDI A;  3AE3 C;  3GHG A;  3HE5 B;  3AE7 C;  3H1L D;  1EQ7 A;  3KXD A;  4L74 A;  1L0N G;  1KYO E;  1NTM J;  1JB0 J;  4GDO A;  1CW5 A;  1IO4 A;  2QJY B;  1FU1 A;  2OYI B;  5KKZ C;  1LNQ A;  1LTJ C;  1BE3 E;  1AV1 A;  1LWU A;  1JY2 O;  2QJK B;  2Q3I A;  5B5E E;  1ZME C;  2FY8 A;  4KJM A;  4ZNC A;  2C9N Y;  2AEM A;  3L75 J;  3CCL P;  2W27 A;  1LTA C;  1SQX D;  3G9R A;  1K8A Q;  3BAT A;  1SFC D;  2LXC B;  1NH4 A;  3BRT B;  1IC2 A;  3W67 A;  1PFI A;  3SWK A;  1J2J B;  1PIX A;  3W68 A;  2NZ2 A;  1EDL A;  1N7S D;  4QMA A;  3H25 A;  3MUD C;  1KIL C;  1BGY D;  2NPS C;  3PHL A;  2XNX A;  4HB1 A;  2SPZ A;  1Y9B A;  1NVO A;  4PD4 D;  1Q2N A;  1S9K D;  2JWD A;  1S1C X;  3H6P A;  5APU A;  2I1K A;  1A02 J;  2WWW A;  3TK1 A;  3L71 D;  1JNM A;  2E5T A;  1DD3 A;  2Z5H A;  3A0H H;  2JJL A;  3B5N A;  2B87 B;  1GL2 B;  4YTP C;  2QM7 A;  1H88 A;  2POH A;  1GK6 A;  3K5B A;  4BRY A;  1SQV J;  1JTH A;  2ZT9 C;  4IFM A;  1PGQ A;  4KT0 J;  1WT6 A;  2ZYG A;  2OTL P;  2H89 C;  1X9V A;  3Q5P A;  3A0B E;  1EZV I;  3H1J D;  4ZKU A;  2XDJ A;  1AQT A;  2ZYD A;  1SQQ G;  3NTN A;  1VQK P;  1JY3 N;  4YPC A;  4C7N A;  1M1J C;  1VQ9 P;  2YXR B;  4DCK A;  4JYC A;  3MZW B;  2H8P D;  2AXC A;  2K9Y A;  1GD2 E;  3Q1M A;  3CCE P;  1AQ5 A;  2IFM A;  2YKQ A;  3GMA A;  3H1K G;  1QVF O;  1DEE G;  1Y8A A;  4PV1 D;  3BRV B;  3L73 G;  3F5H A;  2KSJ A;  3D71 A;  2B9B A;  4GIF A;  2OYO A;  3SWF A;  3CCQ P;  4OGQ B;  1LTG C;  3GG2 A;  1S9K E;  2Z4E A;  3IF4 A;  1YTZ T;  3I5C A;  4WY4 B;  1MUU A;  1NTZ K;  2P2U A;  1XTC C;  3RK2 D;  2W6A A;  4IL6 E;  3L72 D;  1QLE D;  3KZI E;  1PV3 A;  2GUS A;  1JUN A;  1KYO H;  1T3U A;  1FZG A;  1YJ9 P;  1K05 A;  3V5B A;  2A45 H;  3B5N D;  4K3A A;  4N78 D;  2KYV A;  5KAF H;  3H1H J;  1EC5 A;  5AW0 B;  1U7M A;  2WSE H;  4I7Z B;  3CWB J;  4ASW A;  5AVW B;  3H1J E;  2E76 B;  3PP5 A;  3CC7 P;  4RKU J;  2KNC B;  2K3R A;  4NPE A;  5B5E H;  3KYQ A;  4U3F G;  2Z5I A;  3D70 A;  2N1T C;  2D2C D;  3CL3 D;  2E5Y A;  1LTJ A;  2NRG A;  1M7L A;  1SQB J;  1SFC C;  1FZC B;  2OYH A;  3S1K A;  2W8Z A;  4TLF A;  1UII A;  1NTZ E;  4H13 D;  5AW2 B;  2QIW A;  3HUS A;  1AVO A;  3L70 J;  1N7S C;  4M3L A;  1YIJ P;  1PGO A;  1CSB A;  1G1J A;  4DZO A;  1QGK B;  2YMY A;  1JEK A;  4ZKP A;  2IBZ G;  4EI2 A;  2AXT H;  2BCC J;  3MIW A;  4XA4 A;  1ZV8 A;  3H1L G;  1BCC D;  4WBA A;  1OZH A;  2WSC J;  2KOG A;  3AE2 C;  2H7H A;  1RE4 A;  4XFJ A;  1NU1 E;  3MTU E;  2FYU J;  1ZR2 A;  3A0B H;  3B8E B;  3BCC J;  3P8C D;  3V2Q A;  3S9O A;  3H1I E;  3CCS P;  3TGU J;  3SFD C;  1M8O B;  3P32 A;  4RJT A;  1FZF A;  2JO1 A;  2OTJ P;  1WRG A;  2KP8 A;  1ZRT D;  1VDF A;  1TU3 F;  1H0T B;  3EQ2 A;  1YJW P;  5AVS B;  1KOR A;  3VYI A;  3RK3 B;  2MJZ A;  2C9L Y;  1RY3 A;  1S2E A;  4LC1 A;  1FAV A;  3G4S P;  1LTT C;  2YIU B;  1N73 B;  3WUT A;  4PV1 C;  3M9Q A;  2E42 A;  1R5L A;  1FDM A;  2FYN C;  3P8M C;  4NPF X;  1CZQ A;  3V6I A;  2KLV A;  4IL6 H;  2A06 D;  1FC2 C;  2HG5 D;  3KZI H;  3L71 G;  4OH8 B;  4RO0 A;  3RK2 C;  1NTM K;  1FJP A;  1OXZ A;  1JY3 O;  1KFN A;  1LT9 B;  4JF7 A;  2Q1K A;  4WWI A;  1NTK J;  4YXD C;  1RF1 B;  3B5N C;  2Q5U A;  2IYO A;  3FWN A;  5CJ0 A;  2V7Q J;  1KD1 Q;  3L36 A;  1HUC A;  2HPC A;  1OX3 A;  1NKN A;  1ZLL A;  3H1J G;  3V4W A;  5AW3 B;  1GTW A;  3VOP A;  4IFF A;  2ITA A;  3D6Y A;  1VF5 C;  1PP9 J;  3A0H E;  3TF5 A;  3VMA A;  3HE4 A;  1QX8 A;  1L0N J;  1ZR4 A;  2R5B A;  1KYO D;  5KLI C;  1LP1 B;  2HOD B;  2AEJ A;  1T2K D;  1GW3 A;  1T3J A;  3FXD A;  2KSE A;  2E75 B;  3JC2 2;  2IX7 C;  1BE3 D;  1P84 E;  1SQP J;  2OQQ A;  2N1T A;  1OW7 A;  1KB9 I;  1NTM E;  4ASV A;  4C7R A;  1G2C B;  1RF0 A;  2WSF J;  3V2N A;  1OW6 A;  4GT1 A;  2A06 E;  2WT7 B;  1Q82 Q;  3U1C A;  3JCU H;  2KIK A;  3L72 G;  5GTH H;  3Q3D A;  2KK7 A;  2P7J A;  3M0A A;  1AFO A;  3M91 A;  1YQ3 C;  5TJH A;  2NPS B;  3A5T A;  5AW1 B;  3CC2 P;  2QSI A;  4D6T D;  1U7J A;  3GF7 A;  4AUW A;  1JY2 P;  5AW6 B;  2IFN A;  4ZMD A;  5CBN A;  2MKV A;  2JKV A;  3AE1 C;  1VQ7 P;  3F89 A;  1ZW0 A;  2G3A A;  2FXM A;  2DW3 A;  3FX0 A;  5KAF E;  1YI2 P;  2IZ1 A;  2Q9I A;  1Y47 A;  5KLV J;  1LT1 A;  3AEG C;  2VRS A;  2J58 A;  1SP4 A;  4HH2 A;  1YHQ P;  1OMI A;  2OYH C;  2H43 A;  1S3J A;  3H1H D;  2N1T D;  1KYO I;  2ZXE B;  3HUS C;  2YO3 A;  2QJP B;  1LGH B;  2LR2 A;  1HJ0 A;  1GK4 A;  2A45 I;  1M1J B;  2JWA A;  5APT A;  1EXJ A;  1DX7 A;  1IZN B;  1BDC A;  1BCC G;  3H1K J;  3FWL A;  2WQY C;  3L73 J;  4IL6 X;  3AE9 C;  3WU2 E;  1X8Y A;  1CI6 B;  1HGZ A;  2PAJ A;  3AE6 C;  1Q81 Q;  2M5A A;  3Q5S A;  4D6T E;  3FXE A;  1GU4 A;  2KXP B;  1X22 A;  2AXT E;  1SVF A;  1RE4 C;  1L4A A;  3PH0 A;  3CCJ P;  1URQ A;  1LJ2 A;  1SQB K;  1OIP A;  2WTY A;  1JCD A;  2KS1 B;  4EIJ A;  2HR3 A;  3T97 B;  4O9B A;  3HRN A;  1T2K C;  2Y9Z A;  2IBZ I;  3O6Q B;  4NPD A;  1P84 H;  3M9B A;  3H32 A;  2Q3E A;  3SFE C;  4L75 A;  2R44 A;  1VQN P;  3H1H E;  2E76 D;  4I2L C;  5AVQ B;  4U3F J;  4HJG H;  3VP9 A;  5TIS H;  2XU6 A;  2FKW B;  4JPZ B;  5L8R J;  3CWB E;  3HD7 A;  4TT3 H;  2Y0D A;  2QJK C;  3RBX A;  1OWA A;  3NMD A;  3BCC D;  3IAO A;  1E5W A;  2A06 G;  5BVZ A;  2HLO A;  1SFC B;  3AEC C;  1NTZ D;  1N8R Q;  2YMK A;  1N73 A;  1SQB E;  2BEZ F;  2FYU K;  3P7K A;  1N7S B;  1X79 B;  1S5L E;  2QM8 A;  3A3Y B;  1HBW A;  1PPJ E;  2IYP A;  1HWT C;  3GF3 A;  2O01 J;  3L70 E;  3MD0 A;  2FFD B;  1EDK A;  4H44 B;  2YKP A;  2K9J A;  1H89 A;  3H1L J;  3G6E P;  3KQG A;  3C8V A;  1LT9 A;  1L4A D;  1YYC A;  1URQ D;  2BCC E;  4JQ0 D;  2M3B A;  1VQP P;  3HTK A;  1KMI Z;  4PD4 I;  2A45 G;  2JEE A;  3GHG B;  2YKO A;  1NU1 D;  1L0L J;  1W2B O;  1BE3 G;  5CCH A;  4PJ0 E;  3H1I D;  4DJG A;  1VF5 D;  3NFQ A;  5EFW B;  1IFN A;  2FYU E;  3WUV A;  1SQX J;  1NAF A;  3BCC E;  2E43 A;  1NU1 K;  4H0L D;  3L74 J;  1LWU B;  2K1A A;  3TGU E;  1RF0 C;  3HD7 D;  4Z1M H;  2FXP A;  1GW4 A;  1HVV A;  1BSN A;  5CMZ A;  1NTK K;  4L76 A;  4U7J A;  3D6Z A;  1BGY J;  2E74 D;  2PFX A;  3AE4 C;  1EXI A;  3WU2 H;  5BU8 B;  3OJA B;  1JO5 A;  4PV1 B;  2B88 A;  2K37 A;  5AW8 B;  1QEX A;  4D6T G;  3USS A;  1QL2 A;  1NHL A;  2AEF A;  3Q5R A;  3CCM P;  3CX5 E;  2N9Y B;  2WT7 A;  1L0N K;  3L71 J;  3PLN A;  2RH0 A;  3ITK A;  3JCU E;  2O1K A;  2Y0E A;  5GTH E;  3RGU A;  1PL5 A;  2W83 C;  2IPP A;  1KV4 A;  3II6 A;  5APY A;  3U59 A;  1VQM P;  1IFD A;  2H88 C;  2R32 A;  4WVZ A;  1SQP K;  3CD6 P;  2WPQ A;  3B5N B;  3H1J J;  1OVR A;  4Y28 J;  3AEE C;  4W7Z A;  2QG4 A;  1JY2 N;  1FE6 A;  1NTK E;  4L73 A;  4BRY B;  4JBZ A;  4GOE A;  3H1H G;  1JTH B;  3HE5 A;  5CCH D;  2E76 C;  5CBO A;  2L5G B;  2W6B A;  5B66 E;  2D2C B;  4UB8 H;  1LTB C;  2RN0 A;  5KLI B;  4GOD A;  3KHU A;  2FBW C;  3RK3 E;  2OYI A;  1ZP0 C;  3R4Y A;  1PP9 E;  4C7N B;  1L0N E;  1P84 D;  1K73 Q;  1NTM D;  2E75 D;  1FZC C;  5DJT B;  4H13 B;  1KFM A;  1S5L H;  5APX A;  3OW2 O;  1K04 A;  2IZ0 A;  1KC8 Q;  5KLV D;  2OGU A;  1SQP E;  3WUU A;  4OWF A;  2XZR A;  4R4M A;  4MN4 C;  5M1B A;  3NXS A;  1A02 F;  1FS0 E;  3L72 J;  2M3E A;  3CPW O;  3L75 D;  4EYY Q;  1L4A C;  3AED C;  5KLV K;  2BCC G;  1URQ C;  3IN6 A;  3RL0 D;  2WPS A;  1FZB A;  4Y99 B;  2HYN A;  3RBZ A;  3CXH E;  2WSC H;  1IFJ A;  3ABV C;  1KN7 A;  2O3J A;  4PJ0 H;  3JSV C;  3CCV P;  1NJI Q;  3TNU B;  1MFZ A;  1FDO A;  3KDP B;  2B87 A;  3L4F A;  1KQS O;  4I6M C;  1G1I A;  5H2F E;  1GL2 A;  1MKM A;  1HF9 A;  3BCC G;  5BU5 A;  2I8D A;  4AYC A;  1T6A A;  2XND H;  1IK7 A;  3GLM A;  4H0L C;  3TGU G;  4I1L A;  3HD7 C;  1HGV A;  3AE5 C;  1NTZ G;  3O6Q A;  3G3Z A;  1X0T A;  5KKZ B;  5K5G B;  3EWK A;  1IFI A;  1LTJ B;  3QH9 A;  1D7M A;  2E74 C;  1VQL P;  4XE5 B;  1SQV D;  1KQG B;  2OYH B;  1IFM A;  5KLV E;  3Q2Y A;  5TIS E;  2YIU C;  1N73 C;  3BAS A;  2PP6 A;  3HUS B;  1SLQ A;  1UIX A;  1ZXG A;  3CX5 H;  3V2P A;  3N4X A;  4KHX A;  5AW4 B;  1RE3 C;  2WPV B;  1P84 I;  1BCC J;  5KAI H;  3L75 E;  3V4Q A;  1USE A;  1SQV K;  5APV A;  2K88 A;  2R3S A;  1KIL B;  1LT9 C;  1RQV A;  1Z56 A;  1NU1 G;  3H1K E;  5KJ7 A;  2JP3 A;  4WY4 A;  2B89 A;  3MP7 B;  2FFD A;  5APQ A;  3M9H A;  2PRR A;  3L73 E;  3H1I G;  1J1E C;  2V7Q H;  1JMM A;  2ZAE B;  5CCH C;  3A2A A;  3VP8 A;  2ZYA A;  5B66 H;  2ZXX A;  1JMB A;  3CCR P;  1GL2 D;  2CK3 H;  1YIT P;  1FZE A;  1EZV D;  4HYT B;  5GTI H;  1PP9 G;  2ZT9 B;  2V4H A;  3R2P A;  1LTI C;  3BVH A;  1GDT A;  2KNC A;  2E75 C;  1SQQ J;  1SQV E;  5CCG A;  2J5U A;  1RHZ B;  2QVA A;  3E1I A;  1QL1 A;  1L0L D;  1S72 P;  3CWB D;  1SQP G;  1Q7Y Q;  3GW6 A;  3PTZ A;  1NO4 A;  1N7L A;  4RES B;  1FZC A;  1FOS E;  4U3F E;  1S5L X;  3CC4 P;  1K9M Q;  1NWQ A;  4N3Y B;  2WSF H;  2R3C A;  3EFG A;  2KLU A;  3PRJ A;  2BEQ D;  1L0L K;  1SQB D;  3L74 D;  2R5D A;  4R4L A;  1JM0 A;  1HTL C;  2XV5 A;  3CXH H;  1PPJ D;  3RL0 C;  3M0D A;  1YBK A;  2FXO A;  1KZU B;  1KQF B;  3L70 D;  4OGQ D;  1J1D C;  5KTB A;  5KJ7 D;  1NKZ B;  1SQX K;  2Y0C A;  1R8E A;  4WY4 D;  2M0B A;  3ZDM A;  2L91 A;  4H44 D;  5H2F H;  1DEB A;  2HPC B;  4IFD K;  2IBZ E;  3AEA C;  2BCC D;  4YXW H;  2LXB A;  5E79 E;  1KB9 H;  1EZV E;  2JR8 A;  4JYB A;  3LW5 J;  1M56 D;  3H1L E;  1DIP A;  2WSE J;  3HE4 B;  1BE3 J;  1OVU A;  1VQO P;  4K35 A;  1NTM G;  2JDI H;  1M90 Q;  1NYH A;  2QJY C;  2OYI C;  5AVX B;  2GUV A;  5AVZ B;  2YXQ B;  5KLV G;  1L0L E;  1L2P A;  3IR9 A;  1H0T A;  2FYU D;  2N1T B;  5CCG D;  1SS1 A;  3TGU D;  4UB8 E;  2QJP C;  1NGM B;  3E1R A;  3MHV A;  3WMM 0;  3L75 G;  1SQX E;  5CJ4 A;  3LID A;  1FDI A;  3E7K A;  3L74 E;  3AE8 C;  5DJU B;  1N2D C;  3EFF K;  1RE3 A;  4D6T J;  1VQ5 P;  3B4S A;  1BGY E;  3CX5 D;  3S4R A;  2QE7 H;  2ZJS E;  2P67 A;  2YO2 A;  1HJB A;  4PD4 E;  2ZFC A;  3SSU A;  2QRX A;  2WSS H;  3L37 A;  1RF1 A;  2IDB A;  3L71 E;  1GL2 C;  1H8A A;  4LLH A;  1OVV A;  1HH0 A;  2I1J A;  4AQR D;  3TNU A;  1NTK D;  3AEB C;  1KQL A;  3LW5 H;  4W7Y A;  1SQV G;  2OTK E;  1Q90 D;  5APS A;  4UB6 E;  3UIA A;  1IJD B;  2HFE D;  1LP1 A;  5AW9 B;  2HOD A;  5AVV B;  2KZJ A;  1U57 A;  3RK3 D;  1PP9 D;  3PJS K;  3I56 P;  3M06 A;  1OW8 A;  1L0N D;  2LKM A;  1USD A;  4N6J A;  1G2C A;  1T8Z A;  4BWN A;  2UWJ E;  1QVG O;  1AVY A;  1BSH A;  2FYN B;  1SQP D;  3VN0 A;  1Q86 Q;  2G8Y A;  1NOH A;  4OGQ C;  1GMJ A;  2OAR A;  5AVT B;  1E79 H;  5KJ7 C;  2M5A B;  5KAI E;  4WY4 C;  4GKG A;  3RK2 B;  1RH5 B;  2FFD C;  4H44 C;  4B86 A;  2O01 H;  1NAY A;  3QWO C;  1YTZ I;  2WPR A;  5E79 H;  2YNY A;  2P58 A;  1L4A B;  3MUD A;  1EZV G;  3L72 E;  4IOI H;  1KIL A;  1URQ B;  3VMZ A;  3G71 P;  2NPS A;  2CPS A;  3CX5 I;  1BDD A;  3CXH D;  2M8R A;  4N78 E;  5AVY B;  3GHG C;  1PGJ A;  3OA7 A;  3U1A A;  4I7Z C;  4C46 A;  1DD4 A;  2WIT A;  1LTS C;  3O8Z A;  1L0L G;  3CWB G;  3H32 B;  2N9B A;  1VF5 B;  3VMX A;  2BAS A;  2Q6Q A;  5CCG C;  1VQ8 P;  2FYZ A;  3CME P;  3CLQ A;  1KB9 D;  1AJY A;  1JY3 P;  3TSI A;  1NTZ J;  4H0L B;  5GTI E;  4EDF A;  3HD7 B;  1LWU C;  1SQX G;  2WVR A;  1SQB G;  3L74 G;  1OFC X;  3CI9 A;  2O01 N;  1VL2 A;  2Y9Y A;  2W90 A;  3TYY A;  2E74 B;  1PPJ G;  1ZN5 A;  1FZA A;  4W80 A;  1M1J A;  3L70 G;  3V2R A;  4BXL A;  1BGY G;  2WZ7 A;  3RL0 g;  2W6J H;  1SQQ D;  3M0D C;  5AVU B;  1VQ4 P;  2P1J A;  4PD4 H;  2QEX P;  3N7N A;  1PZQ A;  3AEF C;  4A7P A;  1FBM A;  1JOC A;  2K9J B;  5APW A;  1CI6 A;  2GA1 A;  1NU1 J;  1BCC E;  4GOF A;  2C0W A;  5CHX A;  3OAK A;  3H1K D;  1SQQ K;  1DH3 A;  1KIL D;  2NPS D;  3H1I J;  3HTK B;  2GM4 A;  3L73 D;  3C9I A;  1FOS F;  4UB6 H;  1S4X A;  2XKM A;  5AVR B;  1J1E B;  2FYU G;  3FGA D;  3P8C E;  1W5C E;  1MFT A;  2KS1 A;  4CPG A;  3T97 A;  2J59 M;  3CMA P;  1KB9 E;  1FJK A;  1RQU A;  2KB7 P;  1KTM A;  1PGP A;  3CXH I;  3KPE A;  1ZRT E;  4LGD E;  3RK3 C;  5AW7 B;  4DT0 A;  3VTP C;  2O1J A;  2D2C C;  1WMK A;  2RMZ A;  2ZVN B;  1EDJ A;  3LIE A;  1AA0 A;  1MV8 A;  2ZT9 D;  1YJN P; 
#chains in the Genus database with same CATH homology
 1MZ9 A;  3B8E B;  3P8C D;  1H89 A;  3L35 A;  3V2Q A;  2CPB A;  3KQG A;  1L0L K;  1LT9 A;  2R5D A;  1L4A D;  3P32 A;  1YYC A;  1HTL C;  1URQ D;  1FZF A;  1WRG A;  2XV5 A;  2KP8 A;  2M3B A;  1VDF A;  3HTK A;  3RL0 C;  3EQ2 A;  3M0D A;  3MGN A;  2A45 G;  2JEE A;  5AVS B;  3GHG B;  3VYI A;  3RK3 B;  1KZU B;  1SFC A;  2MJZ A;  2YKO A;  1J1D C;  5KTB A;  5AW5 B;  2C9L Y;  5KJ7 D;  4DOJ A;  1NKZ B;  1RY3 A;  1SQX K;  2R3C A;  3SWY A;  5CCH A;  4WY4 D;  4LC1 A;  1FAV A;  1DEB A;  2HPC B;  4IFD K;  1W2E A;  1N7S A;  3NFQ A;  3VMY A;  1LTT C;  1N73 B;  1IFN A;  3M9Q A;  3IFM A;  4WB4 A;  2E42 A;  1GZL A;  4JYB A;  1NAF A;  1FDM A;  1RF1 C;  3P8M C;  1XTG B;  2E43 A;  3RL0 B;  1NU1 K;  1LWU B;  3HE4 B;  2Q7C A;  1CZQ A;  1RF0 C;  1GU5 A;  3HD7 D;  4Y99 C;  1GW4 A;  3A7O A;  1J1D B;  4EOT A;  1HVV A;  2OYI C;  2C0X A;  2KLV A;  5CMZ A;  1NTK K;  1JCC A;  1VPC A;  5AVX B;  2GUV A;  2HG5 D;  4OH8 B;  1IK9 A;  3RK2 C;  1N86 A;  5AVZ B;  1NTM K;  1FJP A;  1OXZ A;  1JY3 O;  3IR9 A;  1KFN A;  1LT9 B;  5BU8 B;  3GHG A;  2N1T B;  3OJA B;  5CCG D;  1JO5 A;  3HE5 B;  4JF7 A;  5AW8 B;  1EQ7 A;  1RF1 B;  3B5N C;  2Q5U A;  1QL2 A;  1NHL A;  5CJ0 A;  3WMM 0;  3L36 A;  1HUC A;  2WT7 A;  1CW5 A;  2HPC A;  1NKN A;  1ZLL A;  1L0N K;  3V4W A;  5CJ4 A;  1IO4 A;  1FU1 A;  2OYI B;  2O1K A;  3LID A;  5AW3 B;  1GTW A;  3VOP A;  1LTJ C;  4IFF A;  1N2D C;  2IPP A;  3II6 A;  5APY A;  1LWU A;  1JY2 O;  3U59 A;  3HE4 A;  1RE3 A;  1IFD A;  2Q3I A;  2R32 A;  1ZR4 A;  2R5B A;  1SQP K;  2C9N Y;  2WPQ A;  2HOD B;  3B5N B;  1T2K D;  1GW3 A;  2W27 A;  1T3J A;  1LTA C;  3BAT A;  4W7Z A;  1SFC D;  1NH4 A;  1JY2 N;  2IX7 C;  2P67 A;  2YO2 A;  3BRT B;  1HJB A;  1IC2 A;  1PFI A;  2ZFC A;  1J2J B;  2N1T A;  1JTH B;  3HE5 A;  5CCH D;  4C7R A;  3L37 A;  1G2C B;  1RF1 A;  1N7S D;  1GL2 C;  1H8A A;  1RF0 A;  1KIL C;  2L5G B;  2W6B A;  4LLH A;  1LTB C;  2NPS C;  1HH0 A;  2XNX A;  3V2N A;  2OYI A;  4GT1 A;  4C7N B;  2I1J A;  4AQR D;  2WT7 B;  3TNU A;  3LW5 H;  1KQL A;  3U1C A;  4W7Y A;  1S9K D;  5APS A;  1FZC C;  2P7J A;  3M0A A;  3H6P A;  5APU A;  3UIA A;  1KFM A;  2I1K A;  1A02 J;  1IJD B;  2WWW A;  3TK1 A;  1AFO A;  2HFE D;  3M91 A;  5APX A;  1JNM A;  5AW9 B;  2Z5H A;  2JJL A;  2HOD A;  3B5N A;  1GL2 B;  5AVV B;  2QM7 A;  2XZR A;  3RK3 D;  1H88 A;  2POH A;  2NPS B;  1GK6 A;  3A5T A;  3NXS A;  5AW1 B;  3M06 A;  1A02 F;  1JTH A;  4IFM A;  4AUW A;  2LKM A;  1JY2 P;  1WT6 A;  4N6J A;  1G2C A;  5AW6 B;  1T8Z A;  2IFN A;  1X9V A;  4ZKU A;  1L4A C;  5KLV K;  2XDJ A;  1URQ C;  2FXM A;  3RL0 D;  2WPS A;  3NTN A;  1JY3 N;  3VN0 A;  4C7N A;  1FZB A;  4Y99 B;  1M1J C;  2HYN A;  1NOH A;  2WSC H;  2OAR A;  5AVT B;  4JYC A;  5KJ7 C;  2Q9I A;  1IFJ A;  2H8P D;  3RK2 B;  4WY4 C;  4GKG A;  2FFD C;  3TNU B;  1MFZ A;  4B86 A;  2VRS A;  2O01 H;  2J58 A;  1SP4 A;  4HH2 A;  1GD2 E;  1YTZ I;  2WPR A;  3KDP B;  2YNY A;  1AQ5 A;  2OYH C;  2IFM A;  3L4F A;  2YKQ A;  4I6M C;  1G1I A;  2H43 A;  1GL2 A;  1L4A B;  3MUD A;  2N1T D;  1KIL A;  1URQ B;  2ZXE B;  3HUS C;  3VMZ A;  5BU5 A;  2NPS A;  3BRV B;  4AYC A;  2YO3 A;  2CPS A;  1LGH B;  2KSJ A;  1GK4 A;  2A45 I;  2M8R A;  4I1L A;  4GIF A;  1M1J B;  4N78 E;  3HD7 C;  5AVY B;  3SWF A;  3GHG C;  1HGV A;  3OA7 A;  3U1A A;  3G3Z A;  1LTG C;  5APT A;  1DX7 A;  1S9K E;  2Z4E A;  4C46 A;  2WIT A;  1YTZ T;  3I5C A;  1IFI A;  1LTJ B;  4WY4 B;  1LTS C;  3O8Z A;  1MUU A;  1NTZ K;  2P2U A;  1XTC C;  3RK2 D;  3H32 B;  2N9B A;  2W6A A;  4XE5 B;  3VMX A;  2BAS A;  2OYH B;  1IFM A;  2GUS A;  1JUN A;  5CCG C;  1N73 C;  2FYZ A;  3BAS A;  1T3U A;  1FZG A;  2PP6 A;  3HUS B;  1SLQ A;  3CLQ A;  1X8Y A;  1CI6 B;  1HGZ A;  1JY3 P;  2PAJ A;  3V5B A;  3TSI A;  2A45 H;  3B5N D;  4N78 D;  3V2P A;  2KYV A;  3N4X A;  1GU4 A;  3HD7 B;  1LWU C;  4KHX A;  5AW4 B;  1RE3 C;  5AW0 B;  2WSE H;  1SVF A;  3V4Q A;  1RE4 C;  1L4A A;  3PP5 A;  5AVW B;  3CI9 A;  1SQV K;  5APV A;  1URQ A;  3TYY A;  1SQB K;  1ZN5 A;  1FZA A;  2WTY A;  1JCD A;  1KIL B;  1LT9 C;  1Z56 A;  3KYQ A;  4W80 A;  4EIJ A;  1M1J A;  2Z5I A;  2N1T C;  3V2R A;  3CL3 D;  2WZ7 A;  4O9B A;  5KJ7 A;  3HRN A;  1T2K C;  3M0D C;  5AVU B;  1LTJ A;  4WY4 A;  2P1J A;  2FFD A;  5APQ A;  1M7L A;  3M9H A;  1SFC C;  3M9B A;  3H32 A;  3N7N A;  1FZC B;  2OYH A;  1J1E C;  1JMM A;  1FBM A;  5CCH C;  1JOC A;  5AW2 B;  3A2A A;  4I2L C;  5APW A;  3HUS A;  5AVQ B;  3VP8 A;  1CI6 A;  3VP9 A;  1N7S C;  2XU6 A;  2FKW B;  2C0W A;  4M3L A;  5CHX A;  3OAK A;  1GL2 D;  1FZE A;  3HD7 A;  1SQQ K;  1DH3 A;  1CSB A;  1KIL D;  1OWA A;  4HYT B;  3NMD A;  1G1J A;  1E5W A;  2NPS D;  4DZO A;  3HTK B;  2GM4 A;  2YMY A;  3R2P A;  3C9I A;  1FOS F;  5BVZ A;  4ZKP A;  2HLO A;  1SFC B;  2XKM A;  1LTI C;  3BVH A;  1GDT A;  5AVR B;  1J1E B;  3MIW A;  3P8C E;  4XA4 A;  5CCG A;  1N73 A;  1ZV8 A;  3T97 A;  2J59 M;  3E1I A;  1QL1 A;  4WBA A;  2FYU K;  3P7K A;  1FJK A;  2KB7 P;  1N7S B;  1X79 B;  2KOG A;  3KPE A;  2QM8 A;  4LGD E;  3A3Y B;  1HBW A;  1NO4 A;  1N7L A;  4RES B;  3RK3 C;  5AW7 B;  3VTP C;  1HWT C;  1FZC A;  1FOS E;  2O1J A;  2H7H A;  1RE4 A;  3MD0 A;  3LIE A;  3MTU E;  2FFD B;  1NWQ A;  1MV8 A;  4N3Y B;  2WSF H;  3EFG A;  2YKP A;  1ZR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...