2A45G

Crystal structure of the complex between thrombin and the central "e" region of fibrin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
48
structure length
48
Chain Sequence
SACKDSDWPFCSDEDWNYKCPSGCRMKGLIDEVNQDFTNRINKLKNSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for sequential cleavage of fibrinopeptides upon fibrin assembly.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Thrombin light chain
total genus 10
structure length 48
sequence length 48
chains with identical sequence J
ec nomenclature
pdb deposition date 2005-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2a45G00
2Z4EA 1LT9A 1JY2O 1M1JC 1N86A 3BVHA 1N73C 1M1JB 1JY2N 1LWUC 1N73B 1LWUB 1LT9C 3E1IA 2Q9IA 1RF1A 2HLOA 2XNXA 3HUSA 1FZBA 1LWUA 1JY2P 2H43A 2HODB 3GHGC 2OYIA 2OYHA 1JY3N 1T3UA 3HUSC 2FFDA 1M1JA 1RE4C 1RF0C 1N73A 1RE3A 2HPCA 3H32B 2A45G 2OYIC 1LTJA 2FFDC 2HPCB 1RF1C 1RE3C 1LTJB 1FZEA 2A45I 2A45H 3H32A 1LTJC 2FFDB 1FZCC 1FZCB 2OYHC 2OYIB 2HODA 1RF0A 1RE4A 2OYHB 1RF1B 3HUSB 1W2EA 1FZCA 1FZAA 1LT9B 1FZGA 1JY3O 1FZFA 3GHGA 3GHGB 1JY3P
chains in the Genus database with same CATH superfamily
1KILB 1IZNB 1W5CE 1KB9I 2FYNC 2WPQA 5AVVB 5AVRB 4HKZH 1PPJE 5KAIE 2B87A 1KYOD 3H1LE 4GIFA 1IK7A 2WSSH 2AXCA 3N4XA 2P10A 1S9KD 2YO3A 4H13D 3I55P 1E5WA 2IZ1A 5GTIH 1HUCA 1IFJA 1H0TB 1SFCC 2PGDA 3A0BE 1L0LJ 2JDIH 3RK3E 1T3JA 1ZOYC 3NFQA 5BU8B 1Q2NA 5AW9B 3L36A 5BVZA 1WT6A 2WITA 2Z5HA 2YIUC 3FXEA 2ZXXA 4OVNF 3AEGC 3CX5E 2OYHC 4H13C 4RESB 1JMMA 2QM7A 2WZ7A 1QGKB 2XV5A 1PPJD 3M9BA 5EFWB 1OZHA 2E75D 3TSIA 4A7PA 2OYHB 2AEJA 2G3AA 3SWKA 3KZIH 1SQPE 2M8RA 2XZRA 4RKUJ 2B89A 1S2EA 1ZRTD 4WBAA 1JM0A 1GL2B 1FAVA 1U7MA 2IPPA 3S9OA 3U59A 2IBZD 1PP9G 2E76B 3L73E 1FBMA 2E75B 4LLHA 2Z4EA 1FDIA 2W90A 3HTKB 3IR9A 4Y99B 4RJTA 3II6A 3V2QA 2ZVNB 3HUSA 1NTZK 3M06A 3AEDC 2JEEA 2M3BA 1NJIQ 3JSVC 1L0LE 2O1KA 5DJTB 1EZVI 2IBZI 1PPJG 1PL5A 1DEBA 1HGVA 1JCCA 1OW6A 2R44A 3AE4C 3BCCG 4BRYB 4DOJA 3AE3C 3R4YA 1U57A 2K9JA 3S1KA 1LTIC 2KSJA 3TGUD 1P84E 3B5NB 1SQXG 1J1DC 2Q7CA 5AVQB 2H88C 3MD0A 4I6MC 4L74A 1NAFA 5B66H 2WSFJ 2B87B 3OA7A 1EZVD 3V2NA 2AEMA 2M0BA 3B5NA 4PV1B 1ZR2A 1OW7A 5K5GB 1JY3O 1SQBE 3V4WA 3P32A 1FZFA 3GHGB 4WY4A 1JCDA 1KFNA 1KB9H 1FOSE 4OWFA 3CXHE 3HD7B 5KLIB 3Q3DA 2NPSA 2YO2A 3FWNA 3BRVB 4N6JA 5APVA 5AW1B 1K04A 1DX7A 1EDIA 1L0NK 1LWUA 1RQVA 3HD7A 1EDKA 2QJPB 3ZDMA 1EQ7A 1L0LD 2XNDH 2K37A 3N7NA 4NPEA 4WY4B 2YKPA 1L4AC 3A3YB 3CCMP 1NTMJ 4B86A 3A0HH 2E5YA 1LGHB 1L0LG 1S5LX 2QJKC 3CXHD 1T2KD 4OGQB 4YTPC 4M3LA 2LKMA 3C1LA 2OTJP 2WSEJ 3L72E 3VYIA 2OYIB 2N1TB 2M5AA 2FXMA 2RN0A 1YBKA 1BCCE 2IBZG 1NU1J 2C0WA 5AVSB 1UIXA 1W2EA 3RK2D 2QJKB 3AE5C 1SQBD 3BATA 3RBXA 2KI7B 3F5HA 1LT1A 3H1IE 3RL0C 3TK1A 1YITP 1FC2C 2POHA 2ZXEB 4KT0J 1BGYE 1X22A 5H2FE 1NTKK 2E76C 1M1JC 1S72P 4WB4A 2YXQB 1KQLA 1LJ2A 4HB1A 2KP8A 1OIPA 5BU5A 5AW3B 2N1TA 3L71G 3B71A 2QEXP 1SQPK 1TU3F 3RL0B 1EXIA 2L91A 1PP9E 3L73G 2QE7H 4H13B 3SWFA 4IL6H 2W27A 2YIUB 4JYBA 3H32A 4W7ZA 1M57D 1HJBA 2YKQA 2W6JH 4WVZA 1J1DB 3VP9A 4OGQC 5GTHE 3IFMA 1SQXJ 3CC7P 1KFMA 4XE5B 3B8EB 5CHXA 1PIXA 3L72G 2BEQD 4WY4C 1CSBA 3GHGA 1ZV8A 4D6TD 4EYYQ 3PHLA 1M90Q 2K1AA 1SS1A 5C39A 1JY2O 3FX0A 5B5EH 2N9YB 4GDOA 1JB0J 1LWUC 2Y0CA 3P7KA 3D71A 3TF5A 1DD4A 3B5ND 1H89A 1LT9C 1H0TA 2GA1A 1NOHA 3LW5H 4C7NA 3A5TA 3P8CE 1BSHA 2AXTE 1BGYJ 1KYOE 3BASA 3H1LD 5AW0B 4ZKPA 1G1IA 2I1JA 1J1EB 1KILA 3H1IJ 1LTAC 1S5LE 3PH0A 3WUTA 1A02J 2AEFA 1SQBK 2A45G 1ZRTE 4PD4E 2R5DA 2FFDC 2WPVB 2R5BA 1IK9A 1PZQA 2OQQA 2KS1B 1FZCB 4HH2A 4D6TG 1VQKP 3CX5D 3H1ID 3AE7C 4UB8E 3V2RA 3KZIE 4D6TE 3H1KG 3O6QA 5KKZC 1R5SA 2FXOA 3RK2B 3T97B 1LP1B 1EZVG 4Z1MH 1ZLLA 1M1KQ 1SFCB 3CD6P 1URQD 1N73C 4H44B 3LIDA 4RO0A 3AE8C 2ITAA 3GF3A 1DEEG 3Q1MA 4Y99C 3AEBC 1OVRA 2V4HA 1J2JB 2BASA 3H6PA 3G3ZA 1JY2P 1NTMD 4W80A 4U3FD 5E79H 3CCUP 1JY3N 3L75J 2R3SA 1S1CX 3MP7B 1MFZA 2Y0EA 2H89C 4I1LA 2D2CD 1NTZG 2IFNA 2HYNA 1IFIA 3FXDA 3PJSK 1WRGA 5AW2B 5AW6B 5KAFE 3TNUA 2MKVA 3W68A 3VN0A 1X0TA 4DCKA 4YXDC 2WT7A 2A45I 1T8ZA 3V5BA 1LTJC 5APXA 3CCJP 1P84H 2O01N 1RHZB 4I7ZC 4DJGA 1IFNA 4JF7A 2O1JA 1PGOA 1SQPG 2YXRB 3MHVA 3VMAA 1A02F 4IOIH 2YKOA 1L4AD 3VMZA 2ZYDA 1VQ6P 1G2CB 2I1KA 1T6AA 3HE4A 3AE2C 2CPBA 4WWIA 3CC4P 2B88A 2BCCJ 4PJ0E 3OW2O 1VQMP 2YNYA 3Q5PA 3CCVP 2PP6A 1FOSF 3G71P 1LT9A 2QA4P 1JOCA 3MTUE 5AW8B 5KJ7D 5KLVJ 2HR3A 1GK4A 2E74D 4IFFA 1LWUB 1BE3E 1NTKD 2FYNB 3WU2H 5TISH 3L72D 1SQVE 1IC2A 1KILC 2NPSB 2P2UA 1LTGC 4N78D 1NKNA 3RK3B 2C9NY 1VPCA 2J58A 2NRGA 3RL0D 2FFDA 3P8MC 3SFDC 2C9LY 2WQYC 1SQVG 3M9QA 2KXPB 2WPSA 3L74D 3MZWB 5TJHA 1KMIZ 2MJZA 5KLVD 5KAIH 4HJGH 2FKWB 3H1IG 1EC5A 2QM8A 1RE3C 3PP5A 1AV1A 3H1KD 1OFCX 2ZT9B 1KILD 3CWBJ 2OTKE 2QJYB 1USDA 2RMZA 4N3YB 2Q5UA 4AQRD 3Q5RA 1GU5A 4L75A 2WTYA 2QG4A 5CJ0A 4D6TJ 1FU1A 1ZN5A 2W83C 4XFJA 1CW5A 1FJPA 4PV1D 1L2PA 4YPCA 1RH5B 4EI2A 2RKLA 1QVGO 1BCCJ 2Q3IA 3CCSP 2H7HA 1N86A 1FJKA 1SQBG 1HTLC 3BVHA 1DH3A 1SQVD 4EIJA 4U3FE 2Y9ZA 1YJNP 1JNMA 3RL0g 2P7JA 1P84D 1FDMA 5B66E 4KHXA 1ZW0A 1NAYA 2H8PD 1JEKA 2IYOA 1NH4A 3EFFK 1CI6A 3M91A 1NTME 1OXZA 3QH9A 1M1JA 3PTZA 2NPSD 1GL2A 2IBZE 3WUVA 1ZP0C 1LTJA 3H1LG 3L75G 3VOPA 2B9BA 2K9YA 3EQ2A 4OH8B 3VP8A 1NTMG 4L73A 3KPEA 1FZEA 2A45H 2N1TC 3L73D 1UIIA 1URQB 4CPGA 1P84I 4EOTA 1VQ7P 1MKMA 3IAOA 1OVUA 2V7QJ 1K8AQ 1KD1Q 5GTHH 3AEFC 5AVYB 1VQNP 4Y28J 2Q6QA 4NPFX 1N7SD 3JCUH 2O3JA 1Y9BA 5KAFH 1PGPA 1LTSC 5AVUB 1USEA 3L71E 4JYCA 4UB6E 1OMIA 1JY3P 2KNCA 4GOEA 4PD4D 5CCHA 3A7OA 1SQQE 2BCCG 2FYUK 2WSCJ 3TGUG 2KOGA 1M1JB 1G1JA 2HG5D 2ZT9D 4H0LB 2DW3A 3CX5I 2IZ0A 4GOFA 3L74G 3L75D 1AVYA 1NTKJ 3H1JD 2KUBA 4R4LA 2IYPA 2E43A 1NYHA 3GHGC 2YMYA 5CBNA 2O01J 2J59M 2KIKA 1VQPP 2GUSA 1KC8Q 3AEEC 3H1JG 1RE3A 3RK3D 3F89A 4U3FG 4GODA 2QJYC 1MUUA 4KJMA 3CCQP 4ASVA 3AE6C 3H1JE 4L76A 1NTZD 4O9BA 3GF7A 4XA4A 2HODA 5CCGA 1SQVK 3C8VA 1ZR4A 1RF1B 3KYQA 3L75E 1SLQA 1OW8A 4GT1A 3KDPB 1HGZA 3RK3C 1N7SB 1PGQA 1VDFA 2XKMA 1SQPD 3H1HD 3CMAP 1W2BO 2FYZA 3D70A 1SQQG 5APWA 3S4RA 1OX3A 1QL1A 3L70E 4IL6E 2KNCB 5KLIC 3L72J 3FWLA 4JQ0D 1DIPA 2W6AA 1GW4A 1QL2A 3HE5B 1BCCG 1BE3J 1VF5B 3ITKA 1RF1A 2QSIA 4H0LC 2HODB 1JO5A 2JO1A 1GL2C 1VQ9P 1T3UA 2BCCE 1N73A 3KXDA 1BGYG 4JBZA 5APSA 3PRJA 3M0DA 2WSFH 2KK7A 1BE3D 1NTKE 1LTJB 2KYVA 2Q3EA 1BGYD 1S3JA 1ZXGA 3H1LJ 3VMXA 5B5EE 4AUWA 1XTCC 2CPSA 3OAKA 2QVAA 1GL2D 1QVFO 1SFCD 1NWQA 2KLUA 5GTIE 2OTLP 3FGAD 1EDJA 4LGDE 4I2LC 1BCCD 3NXSA 3A0BH 1EZVE 5CCHC 1JTHA 1FZGA 1IO4A 5M1BA 1AQ5A 4IFDK 3RGUA 3H1KE 2Z5IA 3TNUB 5APYA 1KB9E 2KB7P 2WSCH 2IDBA 4QMAA 1K73Q 1N73B 1JY2N 1Q90D 1NHLA 2E75C 3AEAC 2WVRA 3CX5H 4OGQD 3WU2E 3UIAA 1YYCA 1LNQA 2XNXA 3LIEA 1GW3A 1FZBA 2D2CB 2LXBA 5AVWB 5CCHD 1QEXA 1GDTA 1MZ9A 1URQA 4UB8H 1N2DC 1M56D 2KSEA 2W6BA 1KORA 1RE4C 1RF0C 2HPCA 4I7ZB 1SQXD 3VTPC 1JTHB 3GG2A 1JMBA 1Y47A 3HD7D 1NTZJ 1FZCC 4U3FJ 3E1RA 3O6QB 2FY8A 4C46A 1X8YA 1S4XA 2I8DA 2IFMA 3CCRP 1YI2P 3BRTB 3L70J 2JJLA 3OJAB 1IFMA 5AW7B 1XTGB 3MGNA 5KTBA 2AXTH 3GLMA 1KYOH 1DD3A 2ZJSE 1SP4A 4K35A 2A06G 1Q7YQ 2QRXA 3U1CA 1SQPJ 1YTZT 2WWWA 4ZKUA 4TLFA 3TDKA 2KZIA 2P58A 2PAJA 2NZ2A 4K3AA 2N1TD 2A06E 2PFXA 3TGUE 1LTBC 1NU1K 1KZUB 1FDOA 3L70D 2ZYAA 1VL2A 1M7LA 3AECC 3H1HG 2FYUD 1N7SC 2HLOA 5KLVG 3D6YA 2K3RA 2BCCD 1BE3G 4U7JA 1NKZB 1AJYA 1QLED 3WMM0 2Q1KA 4EDFA 5APUA 1MFTA 1AA0A 4PJ0H 2K9JB 2QIWA 2HPCB 2Y9YA 1SQVJ 2LR2A 2HFED 2Y0DA 1HF9A 4H44D 5CBOA 3EWKA 1WMKA 1J1EC 1AQTA 1U7JA 2KLVA 3CWBG 5E79E 3W67A 1R5LA 3NTNA 1VQOP 1YJ9P 3HUSB 1YQ3C 2JR8A 1PP9J 1N8RQ 1T2KC 1GMJA 1RY3A 3CWBD 3HTKA 1SFCA 1L0NJ 2D2CC 3CI9A 1D7MA 3B4SA 3T97A 2JWAA 3CXHI 2XDJA 3L71D 2OGUA 3R2PA 1KTMA 2J5UA 1YQ4C 1CI6B 1X79B 1SQBJ 3MIWA 5AVXB 3QWOC 1M8OB 4YXWH 1EXJA 3TGUJ 1PP9D 2OYHA 3IN6A 3BCCE 3G6EP 1IFDA 3K5BA 3RK2C 1FE6A 1AVOA 4PD4H 2KS1A 5AVTB 2WT7B 3H1HE 5KKZB 5KJ7C 4DT0A 3L37A 3SFEC 1NU1E 2ZFCA 3RBZA 2YMKA 2JP3A 3CLQA 2FBWC 2E76D 2SPZA 5AW5B 2M3EA 3V4QA 4C7RA 1MV8A 1NTZE 1KYOI 3I56P 1HH0A 4LC1A 3KHUA 3AE1C 3C9IA 3L70G 1GD2E 1Q86Q 4NPDA 1K9MQ 1PV3A 1E79H 1NO4A 2XU6A 5CCGC 3V6IA 1JUNA 2RH0A 2P67A 1BSNA 2PRRA 2A06D 3CWBE 2GUVA 4ZNCA 1KV4A 1VF5C 3P8CD 1VQ5P 3E7KA 1R8EA 4GKGA 4AYCA 3Q2YA 2ZAEB 1GTWA 1K05A 3H1HJ 3L74J 4PV1C 5DJUB 3M0AA 1NTKG 4WY4D 1PFIA 1VQLP 3CMEP 5CCGD 3V2PA 2OYIC 3H32B 2FYUG 1VQ4P 1LTTC 1SQXK 1VF5D 3H1JJ 1RF1C 1H88A 1X9VA 3B5NC 3LW5J 5KLVE 2VRSA 2N9BA 1KQFB 1NU1G 3SSUA 3G4SP 1G2CA 1SQQD 2IX7C 3HE4B 3KQGA 1AFOA 4C7NB 1L0NE 1KN7A 2WMMA 2WPRA 3GW6A 3TYYA 1H8AA 3M0DC 2NPSC 3M9HA 1FS0E 1S5LH 3HD7C 4MN4C 1SQXE 2ZVOB 2BEZF 4BWNA 1L4AA 1SQQJ 3CXHH 2OARA 1QX8A 2E5TA 2OYOA 1L0NG 3MUDC 3L71J 1Q81Q 1OWAA 2Q9IA 3H25A 2H43A 2W8ZA 1GK6A 2JKVA 1EDLA 3CCEP 1SVFA 1N7LA 2ZYGA 3L73J 1BDDA 5AVZB 1VQ8P 2L5GB 3I5CA 3VMYA 5KJ7A 1IFPA 3L74E 1Z56A 4BXLA 3A0HE 4PD4I 3Q5SA 4UB6H 3L4FA 4ZMDA 3CL3D 2UWJE 1LP1A 4IFMA 1NVOA 4IL6X 4JPZB 3L35A 1SQQK 2FYUE 2GM4A 5CMZA 1KQGB 1ZMEC 1URQC 4HYTB 2K88A 5CJ4A 1NGMB 3AE9C 2P1JA 1YIJP 1KILE 1RF0A 1RE4A 2C0XA 2KZJA 2ZT9C 3HRNA 5AW4B 3CCLP 1HBWA 3NMDA 1NTMK 1L0ND 1GU4A 1FZCA 1FZAA 3G9RA 1BDCA 3WUUA 1GZLA 1YTZI 3PLNA 1L4AB 4H44C 5H2FH 2G8YA 3A2AA 4TT3H 3CC2P 3D6ZA 2QJPC 5KLVK 4DZOA 4R4MA 4N78E 2R32A 3IF4A 2WSEH 4W7YA 1HJ0A 3E1IA 1CZQA 1OVVA 2M5AB 3GMAA 1HVVA 3HE5A 3JC22 1HWTC 2OYIA 5L8RJ 5APTA 4ASWA 2O01H 3BCCJ 1Q82Q 3HUSC 5APQA 2CK3H 1RQUA 3CPWO 1PGJA 2R3CA 1N7SA 2E74C 1YHQP 2FYUJ 2LXCB 3ABVC 4BRYA 2FFDB 2E74B 5TISE 4H0LD 1KB9D 3EFGA 3BCCD 3SWYA 1KQSO 3H1KJ 3JCUE 1IJDB 1S9KE 1Y8AA 2E42A 1L0LK 1LT9B 3O8ZA 1NU1D 2FXPA 3U1AA 1YJWP 2V7QH 2JWDA 3MUDA 3USSA
chains in the Genus database with same CATH topology
1KILB 2WPQA 5AVVB 5AVRB 4GIFA 3N4XA 1S9KD 2YO3A 1E5WA 1HUCA 1IFJA 1SFCC 1T3JA 5BU8B 3NFQA 5AW9B 3L36A 5BVZA 1WT6A 2WITA 2Z5HA 2OYHC 4RESB 5BU5A 1JMMA 2QM7A 2WZ7A 2XV5A 3M9BA 3TSIA 2OYHB 2M8RA 2XZRA 4WBAA 1GL2B 1FAVA 2IPPA 3U59A 4LLHA 1FBMA 2Z4EA 3HTKB 3IR9A 4Y99B 3II6A 3V2QA 3HUSA 1NTZK 3M06A 2JEEA 2M3BA 2O1KA 1FOSE 1DEBA 1HGVA 1JCCA 4DOJA 1LTIC 2KSJA 3B5NB 1J1DC 2Q7CA 5AVQB 4I6MC 3MD0A 1NAFA 3OA7A 3V2NA 3B5NA 1JY3O 3V4WA 1FZFA 3P32A 3GHGB 4WY4A 1JCDA 1KFNA 3HD7B 2NPSA 2YO2A 4N6JA 3BRVB 5APVA 5AW1B 1DX7A 1L0NK 1LWUA 3HD7A 1EQ7A 4WY4B 3N7NA 2YKPA 1L4AC 3A3YB 4B86A 1LGHB 1T2KD 4M3LA 2LKMA 3VYIA 2OYIB 2N1TB 2FXMA 2C0WA 5AVSB 1W2EA 3RK2D 3BATA 3TK1A 3RL0C 2POHA 2ZXEB 1NTKK 1M1JC 4WB4A 1KQLA 2KP8A 5AW3B 2N1TA 1SQPK 3RL0B 3SWFA 2W27A 4JYBA 3H32A 4W7ZA 1HJBA 2YKQA 1J1DB 3VP9A 3IFMA 1KFMA 4XE5B 3B8EB 5CHXA 4WY4C 1CSBA 3GHGA 1ZV8A 1JY2O 1LWUC 3P7KA 3B5ND 1H89A 1LT9C 1NOHA 3LW5H 4C7NA 3A5TA 3P8CE 3BASA 5AW0B 4ZKPA 1G1IA 2I1JA 1J1EB 1KILA 1LTAC 1A02J 1SQBK 2A45G 2R5DA 2FFDC 2R5BA 1IK9A 1FZCB 4HH2A 3V2RA 3RK2B 1ZLLA 1SFCB 1URQD 1N73C 3LIDA 4Y99C 3H6PA 1J2JB 2BASA 3G3ZA 1JY2P 4W80A 1JY3N 1MFZA 4I1LA 5AW6B 2IFNA 2HYNA 1IFIA 3TNUA 1WRGA 5AW2B 2WT7A 3VN0A 2A45I 1T8ZA 3V5BA 1LTJC 5APXA 1IFNA 4JF7A 2O1JA 1A02F 2YKOA 1L4AD 3VMZA 1G2CB 2I1KA 3HE4A 2CPBA 2YNYA 2PP6A 1FOSF 1LT9A 3MTUE 1JOCA 5AW8B 5KJ7D 1GK4A 4IFFA 1LWUB 1IC2A 1KILC 2P2UA 2NPSB 1LTGC 4N78D 1NKNA 3RK3B 2C9NY 1VPCA 2J58A 3RL0D 2FFDA 3P8MC 2C9LY 3M9QA 2WPSA 2MJZA 2FKWB 2QM8A 3PP5A 1RE3C 1KILD 4N3YB 1ZR2A 4AQRD 2Q5UA 1GU5A 2WTYA 5CJ0A 1FU1A 1ZN5A 1CW5A 1FJPA 2Q3IA 2H7HA 1N86A 1FJKA 3BVHA 1HTLC 1DH3A 4EIJA 1JNMA 2P7JA 1FDMA 4KHXA 2H8PD 1NH4A 3M91A 1CI6A 1OXZA 1M1JA 2NPSD 1GL2A 1LTJA 3VOPA 3VP8A 3EQ2A 4OH8B 3KPEA 1FZEA 2A45H 2N1TC 1URQB 4EOTA 5AVYB 1N7SD 1LTSC 5AVUB 4JYCA 5CCHA 1JY3P 3A7OA 2FYUK 2KOGA 1M1JB 1G1JA 2HG5D 2E43A 3GHGC 2YMYA 2J59M 2GUSA 1RE3A 3RK3D 1MUUA 4XA4A 4O9BA 2HODA 5CCGA 1SQVK 1ZR4A 1RF1B 3KYQA 1SLQA 4GT1A 3KDPB 1HGZA 3RK3C 1N7SB 1VDFA 2XKMA 2FYZA 5APWA 1QL1A 2W6AA 1GW4A 1QL2A 3HE5B 1RF1A 2HODB 1JO5A 1GL2C 1T3UA 1N73A 5APSA 3M0DA 2WSFH 1LTJB 2KYVA 3VMXA 4AUWA 1XTCC 2CPSA 3OAKA 1GL2D 1SFCD 1NWQA 4LGDE 4I2LC 3NXSA 5CCHC 1JTHA 1FZGA 1IO4A 1AQ5A 4IFDK 2Z5IA 3TNUB 5APYA 2KB7P 2WSCH 1N73B 1JY2N 1NHLA 3UIAA 1YYCA 3LIEA 2XNXA 1GW3A 1FZBA 5AVWB 5CCHD 1GDTA 1MZ9A 1URQA 1N2DC 2W6BA 1RE4C 1RF0C 2HPCA 3VTPC 1JTHB 3HD7D 1FZCC 4C46A 1X8YA 2IFMA 3BRTB 3OJAB 2JJLA 5KTBA 1IFMA 5AW7B 1XTGB 3MGNA 1GU4A 1SP4A 3U1CA 1YTZT 2WWWA 4ZKUA 2PAJA 2N1TD 1LTBC 1NU1K 1KZUB 1M7LA 1N7SC 2HLOA 1NKZB 3WMM0 5APUA 2HPCB 2HFED 1J1EC 2KLVA 3NTNA 3HUSB 1T2KC 1RY3A 3HTKA 1SFCA 3CI9A 3T97A 2XDJA 3R2PA 5AVXB 1CI6B 1X79B 3MIWA 2OYHA 1IFDA 3RK2C 2WT7B 5AVTB 5KJ7C 3L37A 2ZFCA 3CLQA 5AW5B 3V4QA 4C7RA 1MV8A 1HH0A 4LC1A 3C9IA 1GD2E 1NO4A 2XU6A 5CCGC 1JUNA 2P67A 2GUVA 3P8CD 4GKGA 4AYCA 1GTWA 1PFIA 3M0AA 4WY4D 5CCGD 3V2PA 2OYIC 3H32B 1LTTC 1SQXK 1RF1C 1H88A 1X9VA 3B5NC 2VRSA 2N9BA 1G2CA 2IX7C 3HE4B 3KQGA 1AFOA 4C7NB 2WPRA 3TYYA 1H8AA 3M0DC 2NPSC 3M9HA 3HD7C 1L4AA 2OARA 1OWAA 2Q9IA 2H43A 1GK6A 1SVFA 1N7LA 5AVZB 2L5GB 3I5CA 3VMYA 5KJ7A 1Z56A 3L4FA 3CL3D 4IFMA 3L35A 1SQQK 2GM4A 5CMZA 1URQC 4HYTB 5CJ4A 2P1JA 1RF0A 1RE4A 2C0XA 5AW4B 3HRNA 1HBWA 3NMDA 1NTMK 1FZCA 1FZAA 1GZLA 1YTZI 1L4AB 3A2AA 5KLVK 4DZOA 4N78E 2R32A 2WSEH 4W7YA 3E1IA 1CZQA 1HVVA 3HE5A 1HWTC 2OYIA 5APTA 2O01H 3HUSC 5APQA 2R3CA 1N7SA 2FFDB 3EFGA 3SWYA 1IJDB 1S9KE 2E42A 1L0LK 1LT9B 3O8ZA 3U1AA 3MUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z4E A;  1LT9 A;  1JY2 O;  1M1J C;  1N86 A;  3BVH A;  1N73 C;  1M1J B;  1JY2 N;  1LWU C;  1N73 B;  1LWU B;  1LT9 C;  3E1I A;  2Q9I A;  1RF1 A;  2HLO A;  2XNX A;  3HUS A;  1FZB A;  1LWU A;  1JY2 P;  2H43 A;  2HOD B;  3GHG C;  2OYI A;  2OYH A;  1JY3 N;  1T3U A;  3HUS C;  2FFD A;  1M1J A;  1RE4 C;  1RF0 C;  1N73 A;  1RE3 A;  2HPC A;  3H32 B;  2A45 G;  2OYI C;  1LTJ A;  2FFD C;  2HPC B;  1RF1 C;  1RE3 C;  1LTJ B;  1FZE A;  2A45 I;  2A45 H;  3H32 A;  1LTJ C;  2FFD B;  1FZC C;  1FZC B;  2OYH C;  2OYI B;  2HOD A;  1RF0 A;  1RE4 A;  2OYH B;  1RF1 B;  3HUS B;  1W2E A;  1FZC A;  1FZA A;  1LT9 B;  1FZG A;  1JY3 O;  1FZF A;  3GHG A;  3GHG B;  1JY3 P; 
#chains in the Genus database with same CATH topology
 1KIL B;  1IZN B;  1W5C E;  1KB9 I;  2FYN C;  2WPQ A;  5AVV B;  5AVR B;  4HKZ H;  1PPJ E;  5KAI E;  2B87 A;  1KYO D;  3H1L E;  4GIF A;  1IK7 A;  2WSS H;  2AXC A;  3N4X A;  2P10 A;  1S9K D;  2YO3 A;  4H13 D;  3I55 P;  1E5W A;  2IZ1 A;  5GTI H;  1HUC A;  1IFJ A;  1H0T B;  1SFC C;  2PGD A;  3A0B E;  1L0L J;  2JDI H;  3RK3 E;  1T3J A;  1ZOY C;  3NFQ A;  5BU8 B;  1Q2N A;  5AW9 B;  3L36 A;  5BVZ A;  1WT6 A;  2WIT A;  2Z5H A;  2YIU C;  3FXE A;  2ZXX A;  4OVN F;  3AEG C;  3CX5 E;  2OYH C;  4H13 C;  4RES B;  1JMM A;  2QM7 A;  2WZ7 A;  1QGK B;  2XV5 A;  1PPJ D;  3M9B A;  5EFW B;  1OZH A;  2E75 D;  3TSI A;  4A7P A;  2OYH B;  2AEJ A;  2G3A A;  3SWK A;  3KZI H;  1SQP E;  2M8R A;  2XZR A;  4RKU J;  2B89 A;  1S2E A;  1ZRT D;  4WBA A;  1JM0 A;  1GL2 B;  1FAV A;  1U7M A;  2IPP A;  3S9O A;  3U59 A;  2IBZ D;  1PP9 G;  2E76 B;  3L73 E;  1FBM A;  2E75 B;  4LLH A;  2Z4E A;  1FDI A;  2W90 A;  3HTK B;  3IR9 A;  4Y99 B;  4RJT A;  3II6 A;  3V2Q A;  2ZVN B;  3HUS A;  1NTZ K;  3M06 A;  3AED C;  2JEE A;  2M3B A;  1NJI Q;  3JSV C;  1L0L E;  2O1K A;  5DJT B;  1EZV I;  2IBZ I;  1PPJ G;  1PL5 A;  1DEB A;  1HGV A;  1JCC A;  1OW6 A;  2R44 A;  3AE4 C;  3BCC G;  4BRY B;  4DOJ A;  3AE3 C;  3R4Y A;  1U57 A;  2K9J A;  3S1K A;  1LTI C;  2KSJ A;  3TGU D;  1P84 E;  3B5N B;  1SQX G;  1J1D C;  2Q7C A;  5AVQ B;  2H88 C;  3MD0 A;  4I6M C;  4L74 A;  1NAF A;  5B66 H;  2WSF J;  2B87 B;  3OA7 A;  1EZV D;  3V2N A;  2AEM A;  2M0B A;  3B5N A;  4PV1 B;  1ZR2 A;  1OW7 A;  5K5G B;  1JY3 O;  1SQB E;  3V4W A;  3P32 A;  1FZF A;  3GHG B;  4WY4 A;  1JCD A;  1KFN A;  1KB9 H;  1FOS E;  4OWF A;  3CXH E;  3HD7 B;  5KLI B;  3Q3D A;  2NPS A;  2YO2 A;  3FWN A;  3BRV B;  4N6J A;  5APV A;  5AW1 B;  1K04 A;  1DX7 A;  1EDI A;  1L0N K;  1LWU A;  1RQV A;  3HD7 A;  1EDK A;  2QJP B;  3ZDM A;  1EQ7 A;  1L0L D;  2XND H;  2K37 A;  3N7N A;  4NPE A;  4WY4 B;  2YKP A;  1L4A C;  3A3Y B;  3CCM P;  1NTM J;  4B86 A;  3A0H H;  2E5Y A;  1LGH B;  1L0L G;  1S5L X;  2QJK C;  3CXH D;  1T2K D;  4OGQ B;  4YTP C;  4M3L A;  2LKM A;  3C1L A;  2OTJ P;  2WSE J;  3L72 E;  3VYI A;  2OYI B;  2N1T B;  2M5A A;  2FXM A;  2RN0 A;  1YBK A;  1BCC E;  2IBZ G;  1NU1 J;  2C0W A;  5AVS B;  1UIX A;  1W2E A;  3RK2 D;  2QJK B;  3AE5 C;  1SQB D;  3BAT A;  3RBX A;  2KI7 B;  3F5H A;  1LT1 A;  3H1I E;  3RL0 C;  3TK1 A;  1YIT P;  1FC2 C;  2POH A;  2ZXE B;  4KT0 J;  1BGY E;  1X22 A;  5H2F E;  1NTK K;  2E76 C;  1M1J C;  1S72 P;  4WB4 A;  2YXQ B;  1KQL A;  1LJ2 A;  4HB1 A;  2KP8 A;  1OIP A;  5BU5 A;  5AW3 B;  2N1T A;  3L71 G;  3B71 A;  2QEX P;  1SQP K;  1TU3 F;  3RL0 B;  1EXI A;  2L91 A;  1PP9 E;  3L73 G;  2QE7 H;  4H13 B;  3SWF A;  4IL6 H;  2W27 A;  2YIU B;  4JYB A;  3H32 A;  4W7Z A;  1M57 D;  1HJB A;  2YKQ A;  2W6J H;  4WVZ A;  1J1D B;  3VP9 A;  4OGQ C;  5GTH E;  3IFM A;  1SQX J;  3CC7 P;  1KFM A;  4XE5 B;  3B8E B;  5CHX A;  1PIX A;  3L72 G;  2BEQ D;  4WY4 C;  1CSB A;  3GHG A;  1ZV8 A;  4D6T D;  4EYY Q;  3PHL A;  1M90 Q;  2K1A A;  1SS1 A;  5C39 A;  1JY2 O;  3FX0 A;  5B5E H;  2N9Y B;  4GDO A;  1JB0 J;  1LWU C;  2Y0C A;  3P7K A;  3D71 A;  3TF5 A;  1DD4 A;  3B5N D;  1H89 A;  1LT9 C;  1H0T A;  2GA1 A;  1NOH A;  3LW5 H;  4C7N A;  3A5T A;  3P8C E;  1BSH A;  2AXT E;  1BGY J;  1KYO E;  3BAS A;  3H1L D;  5AW0 B;  4ZKP A;  1G1I A;  2I1J A;  1J1E B;  1KIL A;  3H1I J;  1LTA C;  1S5L E;  3PH0 A;  3WUT A;  1A02 J;  2AEF A;  1SQB K;  2A45 G;  1ZRT E;  4PD4 E;  2R5D A;  2FFD C;  2WPV B;  2R5B A;  1IK9 A;  1PZQ A;  2OQQ A;  2KS1 B;  1FZC B;  4HH2 A;  4D6T G;  1VQK P;  3CX5 D;  3H1I D;  3AE7 C;  4UB8 E;  3V2R A;  3KZI E;  4D6T E;  3H1K G;  3O6Q A;  5KKZ C;  1R5S A;  2FXO A;  3RK2 B;  3T97 B;  1LP1 B;  1EZV G;  4Z1M H;  1ZLL A;  1M1K Q;  1SFC B;  3CD6 P;  1URQ D;  1N73 C;  4H44 B;  3LID A;  4RO0 A;  3AE8 C;  2ITA A;  3GF3 A;  1DEE G;  3Q1M A;  4Y99 C;  3AEB C;  1OVR A;  2V4H A;  1J2J B;  2BAS A;  3H6P A;  3G3Z A;  1JY2 P;  1NTM D;  4W80 A;  4U3F D;  5E79 H;  3CCU P;  1JY3 N;  3L75 J;  2R3S A;  1S1C X;  3MP7 B;  1MFZ A;  2Y0E A;  2H89 C;  4I1L A;  2D2C D;  1NTZ G;  2IFN A;  2HYN A;  1IFI A;  3FXD A;  3PJS K;  1WRG A;  5AW2 B;  5AW6 B;  5KAF E;  3TNU A;  2MKV A;  3W68 A;  3VN0 A;  1X0T A;  4DCK A;  4YXD C;  2WT7 A;  2A45 I;  1T8Z A;  3V5B A;  1LTJ C;  5APX A;  3CCJ P;  1P84 H;  2O01 N;  1RHZ B;  4I7Z C;  4DJG A;  1IFN A;  4JF7 A;  2O1J A;  1PGO A;  1SQP G;  2YXR B;  3MHV A;  3VMA A;  1A02 F;  4IOI H;  2YKO A;  1L4A D;  3VMZ A;  2ZYD A;  1VQ6 P;  1G2C B;  2I1K A;  1T6A A;  3HE4 A;  3AE2 C;  2CPB A;  4WWI A;  3CC4 P;  2B88 A;  2BCC J;  4PJ0 E;  3OW2 O;  1VQM P;  2YNY A;  3Q5P A;  3CCV P;  2PP6 A;  1FOS F;  3G71 P;  1LT9 A;  2QA4 P;  1JOC A;  3MTU E;  5AW8 B;  5KJ7 D;  5KLV J;  2HR3 A;  1GK4 A;  2E74 D;  4IFF A;  1LWU B;  1BE3 E;  1NTK D;  2FYN B;  3WU2 H;  5TIS H;  3L72 D;  1SQV E;  1IC2 A;  1KIL C;  2NPS B;  2P2U A;  1LTG C;  4N78 D;  1NKN A;  3RK3 B;  2C9N Y;  1VPC A;  2J58 A;  2NRG A;  3RL0 D;  2FFD A;  3P8M C;  3SFD C;  2C9L Y;  2WQY C;  1SQV G;  3M9Q A;  2KXP B;  2WPS A;  3L74 D;  3MZW B;  5TJH A;  1KMI Z;  2MJZ A;  5KLV D;  5KAI H;  4HJG H;  2FKW B;  3H1I G;  1EC5 A;  2QM8 A;  1RE3 C;  3PP5 A;  1AV1 A;  3H1K D;  1OFC X;  2ZT9 B;  1KIL D;  3CWB J;  2OTK E;  2QJY B;  1USD A;  2RMZ A;  4N3Y B;  2Q5U A;  4AQR D;  3Q5R A;  1GU5 A;  4L75 A;  2WTY A;  2QG4 A;  5CJ0 A;  4D6T J;  1FU1 A;  1ZN5 A;  2W83 C;  4XFJ A;  1CW5 A;  1FJP A;  4PV1 D;  1L2P A;  4YPC A;  1RH5 B;  4EI2 A;  2RKL A;  1QVG O;  1BCC J;  2Q3I A;  3CCS P;  2H7H A;  1N86 A;  1FJK A;  1SQB G;  1HTL C;  3BVH A;  1DH3 A;  1SQV D;  4EIJ A;  4U3F E;  2Y9Z A;  1YJN P;  1JNM A;  3RL0 g;  2P7J A;  1P84 D;  1FDM A;  5B66 E;  4KHX A;  1ZW0 A;  1NAY A;  2H8P D;  1JEK A;  2IYO A;  1NH4 A;  3EFF K;  1CI6 A;  3M91 A;  1NTM E;  1OXZ A;  3QH9 A;  1M1J A;  3PTZ A;  2NPS D;  1GL2 A;  2IBZ E;  3WUV A;  1ZP0 C;  1LTJ A;  3H1L G;  3L75 G;  3VOP A;  2B9B A;  2K9Y A;  3EQ2 A;  4OH8 B;  3VP8 A;  1NTM G;  4L73 A;  3KPE A;  1FZE A;  2A45 H;  2N1T C;  3L73 D;  1UII A;  1URQ B;  4CPG A;  1P84 I;  4EOT A;  1VQ7 P;  1MKM A;  3IAO A;  1OVU A;  2V7Q J;  1K8A Q;  1KD1 Q;  5GTH H;  3AEF C;  5AVY B;  1VQN P;  4Y28 J;  2Q6Q A;  4NPF X;  1N7S D;  3JCU H;  2O3J A;  1Y9B A;  5KAF H;  1PGP A;  1LTS C;  5AVU B;  1USE A;  3L71 E;  4JYC A;  4UB6 E;  1OMI A;  1JY3 P;  2KNC A;  4GOE A;  4PD4 D;  5CCH A;  3A7O A;  1SQQ E;  2BCC G;  2FYU K;  2WSC J;  3TGU G;  2KOG A;  1M1J B;  1G1J A;  2HG5 D;  2ZT9 D;  4H0L B;  2DW3 A;  3CX5 I;  2IZ0 A;  4GOF A;  3L74 G;  3L75 D;  1AVY A;  1NTK J;  3H1J D;  2KUB A;  4R4L A;  2IYP A;  2E43 A;  1NYH A;  3GHG C;  2YMY A;  5CBN A;  2O01 J;  2J59 M;  2KIK A;  1VQP P;  2GUS A;  1KC8 Q;  3AEE C;  3H1J G;  1RE3 A;  3RK3 D;  3F89 A;  4U3F G;  4GOD A;  2QJY C;  1MUU A;  4KJM A;  3CCQ P;  4ASV A;  3AE6 C;  3H1J E;  4L76 A;  1NTZ D;  4O9B A;  3GF7 A;  4XA4 A;  2HOD A;  5CCG A;  1SQV K;  3C8V A;  1ZR4 A;  1RF1 B;  3KYQ A;  3L75 E;  1SLQ A;  1OW8 A;  4GT1 A;  3KDP B;  1HGZ A;  3RK3 C;  1N7S B;  1PGQ A;  1VDF A;  2XKM A;  1SQP D;  3H1H D;  3CMA P;  1W2B O;  2FYZ A;  3D70 A;  1SQQ G;  5APW A;  3S4R A;  1OX3 A;  1QL1 A;  3L70 E;  4IL6 E;  2KNC B;  5KLI C;  3L72 J;  3FWL A;  4JQ0 D;  1DIP A;  2W6A A;  1GW4 A;  1QL2 A;  3HE5 B;  1BCC G;  1BE3 J;  1VF5 B;  3ITK A;  1RF1 A;  2QSI A;  4H0L C;  2HOD B;  1JO5 A;  2JO1 A;  1GL2 C;  1VQ9 P;  1T3U A;  2BCC E;  1N73 A;  3KXD A;  1BGY G;  4JBZ A;  5APS A;  3PRJ A;  3M0D A;  2WSF H;  2KK7 A;  1BE3 D;  1NTK E;  1LTJ B;  2KYV A;  2Q3E A;  1BGY D;  1S3J A;  1ZXG A;  3H1L J;  3VMX A;  5B5E E;  4AUW A;  1XTC C;  2CPS A;  3OAK A;  2QVA A;  1GL2 D;  1QVF O;  1SFC D;  1NWQ A;  2KLU A;  5GTI E;  2OTL P;  3FGA D;  1EDJ A;  4LGD E;  4I2L C;  1BCC D;  3NXS A;  3A0B H;  1EZV E;  5CCH C;  1JTH A;  1FZG A;  1IO4 A;  5M1B A;  1AQ5 A;  4IFD K;  3RGU A;  3H1K E;  2Z5I A;  3TNU B;  5APY A;  1KB9 E;  2KB7 P;  2WSC H;  2IDB A;  4QMA A;  1K73 Q;  1N73 B;  1JY2 N;  1Q90 D;  1NHL A;  2E75 C;  3AEA C;  2WVR A;  3CX5 H;  4OGQ D;  3WU2 E;  3UIA A;  1YYC A;  1LNQ A;  2XNX A;  3LIE A;  1GW3 A;  1FZB A;  2D2C B;  2LXB A;  5AVW B;  5CCH D;  1QEX A;  1GDT A;  1MZ9 A;  1URQ A;  4UB8 H;  1N2D C;  1M56 D;  2KSE A;  2W6B A;  1KOR A;  1RE4 C;  1RF0 C;  2HPC A;  4I7Z B;  1SQX D;  3VTP C;  1JTH B;  3GG2 A;  1JMB A;  1Y47 A;  3HD7 D;  1NTZ J;  1FZC C;  4U3F J;  3E1R A;  3O6Q B;  2FY8 A;  4C46 A;  1X8Y A;  1S4X A;  2I8D A;  2IFM A;  3CCR P;  1YI2 P;  3BRT B;  3L70 J;  2JJL A;  3OJA B;  1IFM A;  5AW7 B;  1XTG B;  3MGN A;  5KTB A;  2AXT H;  3GLM A;  1KYO H;  1DD3 A;  2ZJS E;  1SP4 A;  4K35 A;  2A06 G;  1Q7Y Q;  2QRX A;  3U1C A;  1SQP J;  1YTZ T;  2WWW A;  4ZKU A;  4TLF A;  3TDK A;  2KZI A;  2P58 A;  2PAJ A;  2NZ2 A;  4K3A A;  2N1T D;  2A06 E;  2PFX A;  3TGU E;  1LTB C;  1NU1 K;  1KZU B;  1FDO A;  3L70 D;  2ZYA A;  1VL2 A;  1M7L A;  3AEC C;  3H1H G;  2FYU D;  1N7S C;  2HLO A;  5KLV G;  3D6Y A;  2K3R A;  2BCC D;  1BE3 G;  4U7J A;  1NKZ B;  1AJY A;  1QLE D;  3WMM 0;  2Q1K A;  4EDF A;  5APU A;  1MFT A;  1AA0 A;  4PJ0 H;  2K9J B;  2QIW A;  2HPC B;  2Y9Y A;  1SQV J;  2LR2 A;  2HFE D;  2Y0D A;  1HF9 A;  4H44 D;  5CBO A;  3EWK A;  1WMK A;  1J1E C;  1AQT A;  1U7J A;  2KLV A;  3CWB G;  5E79 E;  3W67 A;  1R5L A;  3NTN A;  1VQO P;  1YJ9 P;  3HUS B;  1YQ3 C;  2JR8 A;  1PP9 J;  1N8R Q;  1T2K C;  1GMJ A;  1RY3 A;  3CWB D;  3HTK A;  1SFC A;  1L0N J;  2D2C C;  3CI9 A;  1D7M A;  3B4S A;  3T97 A;  2JWA A;  3CXH I;  2XDJ A;  3L71 D;  2OGU A;  3R2P A;  1KTM A;  2J5U A;  1YQ4 C;  1CI6 B;  1X79 B;  1SQB J;  3MIW A;  5AVX B;  3QWO C;  1M8O B;  4YXW H;  1EXJ A;  3TGU J;  1PP9 D;  2OYH A;  3IN6 A;  3BCC E;  3G6E P;  1IFD A;  3K5B A;  3RK2 C;  1FE6 A;  1AVO A;  4PD4 H;  2KS1 A;  5AVT B;  2WT7 B;  3H1H E;  5KKZ B;  5KJ7 C;  4DT0 A;  3L37 A;  3SFE C;  1NU1 E;  2ZFC A;  3RBZ A;  2YMK A;  2JP3 A;  3CLQ A;  2FBW C;  2E76 D;  2SPZ A;  5AW5 B;  2M3E A;  3V4Q A;  4C7R A;  1MV8 A;  1NTZ E;  1KYO I;  3I56 P;  1HH0 A;  4LC1 A;  3KHU A;  3AE1 C;  3C9I A;  3L70 G;  1GD2 E;  1Q86 Q;  4NPD A;  1K9M Q;  1PV3 A;  1E79 H;  1NO4 A;  2XU6 A;  5CCG C;  3V6I A;  1JUN A;  2RH0 A;  2P67 A;  1BSN A;  2PRR A;  2A06 D;  3CWB E;  2GUV A;  4ZNC A;  1KV4 A;  1VF5 C;  3P8C D;  1VQ5 P;  3E7K A;  1R8E A;  4GKG A;  4AYC A;  3Q2Y A;  2ZAE B;  1GTW A;  1K05 A;  3H1H J;  3L74 J;  4PV1 C;  5DJU B;  3M0A A;  1NTK G;  4WY4 D;  1PFI A;  1VQL P;  3CME P;  5CCG D;  3V2P A;  2OYI C;  3H32 B;  2FYU G;  1VQ4 P;  1LTT C;  1SQX K;  1VF5 D;  3H1J J;  1RF1 C;  1H88 A;  1X9V A;  3B5N C;  3LW5 J;  5KLV E;  2VRS A;  2N9B A;  1KQF B;  1NU1 G;  3SSU A;  3G4S P;  1G2C A;  1SQQ D;  2IX7 C;  3HE4 B;  3KQG A;  1AFO A;  4C7N B;  1L0N E;  1KN7 A;  2WMM A;  2WPR A;  3GW6 A;  3TYY A;  1H8A A;  3M0D C;  2NPS C;  3M9H A;  1FS0 E;  1S5L H;  3HD7 C;  4MN4 C;  1SQX E;  2ZVO B;  2BEZ F;  4BWN A;  1L4A A;  1SQQ J;  3CXH H;  2OAR A;  1QX8 A;  2E5T A;  2OYO A;  1L0N G;  3MUD C;  3L71 J;  1Q81 Q;  1OWA A;  2Q9I A;  3H25 A;  2H43 A;  2W8Z A;  1GK6 A;  2JKV A;  1EDL A;  3CCE P;  1SVF A;  1N7L A;  2ZYG A;  3L73 J;  1BDD A;  5AVZ B;  1VQ8 P;  2L5G B;  3I5C A;  3VMY A;  5KJ7 A;  1IFP A;  3L74 E;  1Z56 A;  4BXL A;  3A0H E;  4PD4 I;  3Q5S A;  4UB6 H;  3L4F A;  4ZMD A;  3CL3 D;  2UWJ E;  1LP1 A;  4IFM A;  1NVO A;  4IL6 X;  4JPZ B;  3L35 A;  1SQQ K;  2FYU E;  2GM4 A;  5CMZ A;  1KQG B;  1ZME C;  1URQ C;  4HYT B;  2K88 A;  5CJ4 A;  1NGM B;  3AE9 C;  2P1J A;  1YIJ P;  1KIL E;  1RF0 A;  1RE4 A;  2C0X A;  2KZJ A;  2ZT9 C;  3HRN A;  5AW4 B;  3CCL P;  1HBW A;  3NMD A;  1NTM K;  1L0N D;  1GU4 A;  1FZC A;  1FZA A;  3G9R A;  1BDC A;  3WUU A;  1GZL A;  1YTZ I;  3PLN A;  1L4A B;  4H44 C;  5H2F H;  2G8Y A;  3A2A A;  4TT3 H;  3CC2 P;  3D6Z A;  2QJP C;  5KLV K;  4DZO A;  4R4M A;  4N78 E;  2R32 A;  3IF4 A;  2WSE H;  4W7Y A;  1HJ0 A;  3E1I A;  1CZQ A;  1OVV A;  2M5A B;  3GMA A;  1HVV A;  3HE5 A;  3JC2 2;  1HWT C;  2OYI A;  5L8R J;  5APT A;  4ASW A;  2O01 H;  3BCC J;  1Q82 Q;  3HUS C;  5APQ A;  2CK3 H;  1RQU A;  3CPW O;  1PGJ A;  2R3C A;  1N7S A;  2E74 C;  1YHQ P;  2FYU J;  2LXC B;  3ABV C;  4BRY A;  2FFD B;  2E74 B;  5TIS E;  4H0L D;  1KB9 D;  3EFG A;  3BCC D;  3SWY A;  1KQS O;  3H1K J;  3JCU E;  1IJD B;  1S9K E;  1Y8A A;  2E42 A;  1L0L K;  1LT9 B;  3O8Z A;  1NU1 D;  2FXP A;  3U1A A;  1YJW P;  2V7Q H;  2JWD A;  3MUD A;  3USS A; 
#chains in the Genus database with same CATH homology
 1KIL B;  2WPQ A;  5AVV B;  5AVR B;  4GIF A;  3N4X A;  1S9K D;  2YO3 A;  1E5W A;  1HUC A;  1IFJ A;  1SFC C;  1T3J A;  5BU8 B;  3NFQ A;  5AW9 B;  3L36 A;  5BVZ A;  1WT6 A;  2WIT A;  2Z5H A;  2OYH C;  4RES B;  5BU5 A;  1JMM A;  2QM7 A;  2WZ7 A;  2XV5 A;  3M9B A;  3TSI A;  2OYH B;  2M8R A;  2XZR A;  4WBA A;  1GL2 B;  1FAV A;  2IPP A;  3U59 A;  4LLH A;  1FBM A;  2Z4E A;  3HTK B;  3IR9 A;  4Y99 B;  3II6 A;  3V2Q A;  3HUS A;  1NTZ K;  3M06 A;  2JEE A;  2M3B A;  2O1K A;  1FOS E;  1DEB A;  1HGV A;  1JCC A;  4DOJ A;  1LTI C;  2KSJ A;  3B5N B;  1J1D C;  2Q7C A;  5AVQ B;  4I6M C;  3MD0 A;  1NAF A;  3OA7 A;  3V2N A;  3B5N A;  1JY3 O;  3V4W A;  1FZF A;  3P32 A;  3GHG B;  4WY4 A;  1JCD A;  1KFN A;  3HD7 B;  2NPS A;  2YO2 A;  4N6J A;  3BRV B;  5APV A;  5AW1 B;  1DX7 A;  1L0N K;  1LWU A;  3HD7 A;  1EQ7 A;  4WY4 B;  3N7N A;  2YKP A;  1L4A C;  3A3Y B;  4B86 A;  1LGH B;  1T2K D;  4M3L A;  2LKM A;  3VYI A;  2OYI B;  2N1T B;  2FXM A;  2C0W A;  5AVS B;  1W2E A;  3RK2 D;  3BAT A;  3TK1 A;  3RL0 C;  2POH A;  2ZXE B;  1NTK K;  1M1J C;  4WB4 A;  1KQL A;  2KP8 A;  5AW3 B;  2N1T A;  1SQP K;  3RL0 B;  3SWF A;  2W27 A;  4JYB A;  3H32 A;  4W7Z A;  1HJB A;  2YKQ A;  1J1D B;  3VP9 A;  3IFM A;  1KFM A;  4XE5 B;  3B8E B;  5CHX A;  4WY4 C;  1CSB A;  3GHG A;  1ZV8 A;  1JY2 O;  1LWU C;  3P7K A;  3B5N D;  1H89 A;  1LT9 C;  1NOH A;  3LW5 H;  4C7N A;  3A5T A;  3P8C E;  3BAS A;  5AW0 B;  4ZKP A;  1G1I A;  2I1J A;  1J1E B;  1KIL A;  1LTA C;  1A02 J;  1SQB K;  2A45 G;  2R5D A;  2FFD C;  2R5B A;  1IK9 A;  1FZC B;  4HH2 A;  3V2R A;  3RK2 B;  1ZLL A;  1SFC B;  1URQ D;  1N73 C;  3LID A;  4Y99 C;  3H6P A;  1J2J B;  2BAS A;  3G3Z A;  1JY2 P;  4W80 A;  1JY3 N;  1MFZ A;  4I1L A;  5AW6 B;  2IFN A;  2HYN A;  1IFI A;  3TNU A;  1WRG A;  5AW2 B;  2WT7 A;  3VN0 A;  2A45 I;  1T8Z A;  3V5B A;  1LTJ C;  5APX A;  1IFN A;  4JF7 A;  2O1J A;  1A02 F;  2YKO A;  1L4A D;  3VMZ A;  1G2C B;  2I1K A;  3HE4 A;  2CPB A;  2YNY A;  2PP6 A;  1FOS F;  1LT9 A;  3MTU E;  1JOC A;  5AW8 B;  5KJ7 D;  1GK4 A;  4IFF A;  1LWU B;  1IC2 A;  1KIL C;  2P2U A;  2NPS B;  1LTG C;  4N78 D;  1NKN A;  3RK3 B;  2C9N Y;  1VPC A;  2J58 A;  3RL0 D;  2FFD A;  3P8M C;  2C9L Y;  3M9Q A;  2WPS A;  2MJZ A;  2FKW B;  2QM8 A;  3PP5 A;  1RE3 C;  1KIL D;  4N3Y B;  1ZR2 A;  4AQR D;  2Q5U A;  1GU5 A;  2WTY A;  5CJ0 A;  1FU1 A;  1ZN5 A;  1CW5 A;  1FJP A;  2Q3I A;  2H7H A;  1N86 A;  1FJK A;  3BVH A;  1HTL C;  1DH3 A;  4EIJ A;  1JNM A;  2P7J A;  1FDM A;  4KHX A;  2H8P D;  1NH4 A;  3M91 A;  1CI6 A;  1OXZ A;  1M1J A;  2NPS D;  1GL2 A;  1LTJ A;  3VOP A;  3VP8 A;  3EQ2 A;  4OH8 B;  3KPE A;  1FZE A;  2A45 H;  2N1T C;  1URQ B;  4EOT A;  5AVY B;  1N7S D;  1LTS C;  5AVU B;  4JYC A;  5CCH A;  1JY3 P;  3A7O A;  2FYU K;  2KOG A;  1M1J B;  1G1J A;  2HG5 D;  2E43 A;  3GHG C;  2YMY A;  2J59 M;  2GUS A;  1RE3 A;  3RK3 D;  1MUU A;  4XA4 A;  4O9B A;  2HOD A;  5CCG A;  1SQV K;  1ZR4 A;  1RF1 B;  3KYQ A;  1SLQ A;  4GT1 A;  3KDP B;  1HGZ A;  3RK3 C;  1N7S B;  1VDF A;  2XKM A;  2FYZ A;  5APW A;  1QL1 A;  2W6A A;  1GW4 A;  1QL2 A;  3HE5 B;  1RF1 A;  2HOD B;  1JO5 A;  1GL2 C;  1T3U A;  1N73 A;  5APS A;  3M0D A;  2WSF H;  1LTJ B;  2KYV A;  3VMX A;  4AUW A;  1XTC C;  2CPS A;  3OAK A;  1GL2 D;  1SFC D;  1NWQ A;  4LGD E;  4I2L C;  3NXS A;  5CCH C;  1JTH A;  1FZG A;  1IO4 A;  1AQ5 A;  4IFD K;  2Z5I A;  3TNU B;  5APY A;  2KB7 P;  2WSC H;  1N73 B;  1JY2 N;  1NHL A;  3UIA A;  1YYC A;  3LIE A;  2XNX A;  1GW3 A;  1FZB A;  5AVW B;  5CCH D;  1GDT A;  1MZ9 A;  1URQ A;  1N2D C;  2W6B A;  1RE4 C;  1RF0 C;  2HPC A;  3VTP C;  1JTH B;  3HD7 D;  1FZC C;  4C46 A;  1X8Y A;  2IFM A;  3BRT B;  3OJA B;  2JJL A;  5KTB A;  1IFM A;  5AW7 B;  1XTG B;  3MGN A;  1GU4 A;  1SP4 A;  3U1C A;  1YTZ T;  2WWW A;  4ZKU A;  2PAJ A;  2N1T D;  1LTB C;  1NU1 K;  1KZU B;  1M7L A;  1N7S C;  2HLO A;  1NKZ B;  3WMM 0;  5APU A;  2HPC B;  2HFE D;  1J1E C;  2KLV A;  3NTN A;  3HUS B;  1T2K C;  1RY3 A;  3HTK A;  1SFC A;  3CI9 A;  3T97 A;  2XDJ A;  3R2P A;  5AVX B;  1CI6 B;  1X79 B;  3MIW A;  2OYH A;  1IFD A;  3RK2 C;  2WT7 B;  5AVT B;  5KJ7 C;  3L37 A;  2ZFC A;  3CLQ A;  5AW5 B;  3V4Q A;  4C7R A;  1MV8 A;  1HH0 A;  4LC1 A;  3C9I A;  1GD2 E;  1NO4 A;  2XU6 A;  5CCG C;  1JUN A;  2P67 A;  2GUV A;  3P8C D;  4GKG A;  4AYC A;  1GTW A;  1PFI A;  3M0A A;  4WY4 D;  5CCG D;  3V2P A;  2OYI C;  3H32 B;  1LTT C;  1SQX K;  1RF1 C;  1H88 A;  1X9V A;  3B5N C;  2VRS A;  2N9B A;  1G2C A;  2IX7 C;  3HE4 B;  3KQG A;  1AFO A;  4C7N B;  2WPR A;  3TYY A;  1H8A A;  3M0D C;  2NPS C;  3M9H A;  3HD7 C;  1L4A A;  2OAR A;  1OWA A;  2Q9I A;  2H43 A;  1GK6 A;  1SVF A;  1N7L A;  5AVZ B;  2L5G B;  3I5C A;  3VMY A;  5KJ7 A;  1Z56 A;  3L4F A;  3CL3 D;  4IFM A;  3L35 A;  1SQQ K;  2GM4 A;  5CMZ A;  1URQ C;  4HYT B;  5CJ4 A;  2P1J A;  1RF0 A;  1RE4 A;  2C0X A;  5AW4 B;  3HRN A;  1HBW A;  3NMD A;  1NTM K;  1FZC A;  1FZA A;  1GZL A;  1YTZ I;  1L4A B;  3A2A A;  5KLV K;  4DZO A;  4N78 E;  2R32 A;  2WSE H;  4W7Y A;  3E1I A;  1CZQ A;  1HVV A;  3HE5 A;  1HWT C;  2OYI A;  5APT A;  2O01 H;  3HUS C;  5APQ A;  2R3C A;  1N7S A;  2FFD B;  3EFG A;  3SWY A;  1IJD B;  1S9K E;  2E42 A;  1L0L K;  1LT9 B;  3O8Z A;  3U1A A;  3MUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...