2A45G

Crystal structure of the complex between thrombin and the central "e" region of fibrin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
48
structure length
48
Chain Sequence
SACKDSDWPFCSDEDWNYKCPSGCRMKGLIDEVNQDFTNRINKLKNSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thrombin light chain
publication title Structural basis for sequential cleavage of fibrinopeptides upon fibrin assembly.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 10
structure length 48
sequence length 48
chains with identical sequence J
ec nomenclature
pdb deposition date 2005-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2a45G00
1JY3N 1T3UA 1RF0A 1FZGA 2H43A 2HPCB 2FFDA 2FFDB 2Z4EA 1FZBA 1RE4C 1FZEA 1LWUC 3E1IA 3GHGC 1RE3A 3HUSC 2OYIA 2OYIB 1JY2P 1LT9A 1W2EA 3H32A 1N73A 1LT9B 3H32B 1N73B 2XNXA 2HODA 1JY2O 2HODB 2A45G 1RF0C 2OYHA 2FFDC 2OYHB 1M1JA 1FZCA 2OYIC 1M1JB 1RE3C 1FZCB 1RF1A 1JY2N 1RF1B 3BVHA 1LTJA 1LT9C 2A45I 1LTJB 1N73C 2Q9IA 1FZFA 1JY3P 3GHGA 2HLOA 1LWUA 2A45H 3GHGB 3HUSA 1LWUB 1RE4A 1FZCC 1JY3O 1M1JC 1FZAA 3HUSB 2OYHC 1RF1C 1N86A 1LTJC 2HPCA
chains in the Genus database with same CATH superfamily
3E1RA 1JTHB 3TK1A 4ZNCA 1ZN5A 1AQ5A 1BE3D 3WUUA 1WMKA 3L73G 1ZOYC 1OVVA 4H0LC 3BCCE 1PGQA 3NTNA 3H1IG 4NPEA 2H43A 3H32A 1LT9B 1PP9G 1E5WA 3KQGA 5AW4B 2CPBA 1SP4A 1JY3P 3L74J 3NMDA 3CXHI 1VQ9P 3L35A 4HYTB 4Z1MH 4GODA 2PFXA 1K8AQ 2PGDA 2R5DA 5CCGD 3OJAB 2WSSH 5AVWB 1CW5A 5C39A 3Q1MA 1H89A 1ZV8A 2OYHC 2QJPC 1Q81Q 1JY3O 3CPWO 1SQQJ 1XTGB 1KC8Q 1IFJA 3H1HG 3L74D 3HD7A 3HE4A 3G6EP 1L4AC 1R8EA 1URQC 5AVUB 1BDDA 3AEGC 5K5GB 1KILE 1HH0A 4GOEA 2FKWB 3MZWB 1FDMA 5KKZC 2GM4A 2YXRB 4I1LA 5AVXB 1EZVG 3H32B 5AVQB 1SQQD 1NTZE 3L71J 1RF1A 1KZUB 3TGUJ 1SQPD 1IFNA 5KLVG 1GK4A 1JB0J 1YJNP 4DT0A 2W8ZA 3A3YB 1GW3A 1S9KE 4WY4C 1RF0A 2M5AB 3Q2YA 1M8OB 2QJYC 3KYQA 2KS1A 3CCVP 2WSFJ 5CJ4A 3V2PA 1LGHB 2H88C 1JUNA 2ZVOB 1DD3A 3OA7A 3MUDC 4IFMA 2D2CD 1GL2A 3GHGA 1VQLP 2D2CB 3L71D 1YYCA 2Q3EA 2QJKB 5AVZB 2AEFA 2VRSA 3T97A 1H88A 3TGUD 2IBZG 3H6PA 3TF5A 1X0TA 3HD7D 3A0HH 3W67A 2KK7A 3HD7B 1LP1A 2IBZI 3HE4B 2BCCD 3A0BH 3L36A 3VMAA 4B86A 1W5CE 4D6TE 1N8RQ 1ZMEC 2QM7A 3B5NC 5H2FH 1IK7A 3CCEP 1NWQA 1FZAA 1K9MQ 1KB9D 1QVGO 3W68A 1BCCE 2KP8A 4R4MA 2ZT9C 1GD2E 3CX5I 1SQBD 3R4YA 5CHXA 5L8RJ 3L73E 1SQXG 3IN6A 4O9BA 1GMJA 2I8DA 1JY2N 3H1JG 1RF1B 2KOGA 3CC2P 3WU2H 3HTKA 3H1IE 2NZ2A 5AVRB 5B66E 1M7LA 3H1LD 2Y0CA 3KHUA 2FYNB 1VQ7P 1PIXA 1RQVA 4LGDE 1GL2D 1LT9C 1VQ4P 1NTMJ 1GL2B 3GHGB 3H1KG 1KYOH 3CI9A 1KFNA 1SLQA 3SFDC 3T97B 3CXHH 3OW2O 3CWBJ 1QL2A 1MFTA 2ZFCA 1ZRTD 1LP1B 2Q6QA 1IFMA 2FXPA 1IZNB 2XU6A 1G2CA 5CCGC 4PD4D 3SWFA 5CBNA 4QMAA 3H1HE 4YPCA 1NTMG 3PHLA 2Q5UA 1SQQK 3C1LA 3CWBD 1K73Q 1SQPK 1P84H 1YJWP 3HTKB 1NJIQ 3TSIA 3P8MC 1FAVA 1EZVE 1L0NG 4ASWA 5KLVE 2IZ1A 1SQVD 1UIIA 3QH9A 1FZEA 3VP8A 4DOJA 1NO4A 2KSJA 3AE9C 2RMZA 3L75D 2WSEJ 1IFDA 2FYUJ 1OX3A 1KQLA 2AXCA 3N4XA 3A7OA 1G2CB 3G3ZA 3PJSK 2A06G 1KD1Q 2IBZE 3BCCJ 3VMXA 2D2CC 2QJKC 1SQBK 1E79H 1HF9A 2OYIC 2R5BA 3HD7C 3MGNA 3GLMA 3V2NA 2YKPA 3HUSA 2QE7H 4RESB 1S5LE 3IAOA 4DCKA 2KXPB 3CX5E 1T3JA 2JR8A 5AW2B 3GW6A 2E76D 2E76B 2WPQA 3CX5H 3U1CA 1SQXE 3BCCD 1KILA 3H1JE 4EIJA 3Q5RA 5BU5A 3TNUA 1RF1C 3UIAA 3NXSA 3L70G 2AXTH 1NKZB 1EQ7A 1FOSE 1GTWA 1PGPA 3LIEA 2KUBA 1JMBA 2O1KA 1RF0C 2FYNC 2IFMA 1Y8AA 2QSIA 1BSHA 2WWWA 1HVVA 1FZCC 2O01H 4W80A 1CSBA 1M57D 1GL2C 5AVYB 2PRRA 3GHGC 5APWA 3V4WA 1NYHA 1PPJG 1Q90D 2FXMA 4ASVA 2MJZA 3HUSB 1NTZJ 2WT7A 3AEBC 1NAYA 1NTME 1XTCC 2XKMA 1AJYA 1KILD 4Y99B 1KILB 1CI6A 5GTIE 2M0BA 3TNUB 2JWDA 1KFMA 5GTIH 1JTHA 4H13D 1IFPA 3U1AA 1L0NE 5AVSB 1JO5A 4OGQD 4H13B 5AW3B 1NTZD 3AE6C 4OGQB 3KZIH 2H89C 4BRYB 1S9KD 4D6TJ 3SFEC 2NPSA 1NAFA 3V2RA 2E75D 4RKUJ 2E75B 1OZHA 1EDLA 2WT7B 2A06E 3VMZA 2FYUK 3CC4P 2OTLP 4A7PA 4D6TD 1LTTC 3H1IJ 2POHA 3K5BA 2FYZA 1GZLA 3D71A 1SVFA 1CI6B 3RL0g 3P32A 1X22A 2FY8A 2C9LY 1H0TA 1PP9J 1BCCD 3AEEC 3VMYA 2WSCH 3BATA 2FYUE 2O1JA 3L73D 4L74A 3HE5A 2QM8A 1FZFA 4I7ZB 1L2PA 1J2JB 2E76C 3V4QA 1NU1G 3H1ID 4HB1A 3M9QA 4RO0A 1OVRA 3L70E 1JY3N 2NPSD 2ZJSE 4IL6E 3M9BA 2NPSB 2P67A 2HR3A 3IR9A 5DJUB 3S9OA 4IL6H 1JNMA 5KAFH 3H25A 1L0LJ 1HBWA 3H1HJ 1KYOI 1NOHA 3GG2A 1HJ0A 2Q7CA 4H44D 2K1AA 2M5AA 4H44B 2B9BA 1IC2A 1RH5B 1RHZB 4ZMDA 4TT3H 3F89A 4KT0J 3C8VA 1PPJE 2I1KA 1Q82Q 2LR2A 3P7KA 4L73A 2R44A 3AE4C 3C9IA 1H0TB 2K9JA 4N3YB 1L0LG 3H1HD 2OYIA 3HUSC 2ZYAA 5KLVJ 3GF7A 5AW5B 5KJ7A 1NTZK 5APSA 3BRVB 3Q5SA 3HE5B 2W90A 1P84I 2B87A 2WZ7A 4Y99C 3AE5C 1KILC 5APQA 4K35A 3RK3E 3V2QA 1EZVD 2W6BA 4R4LA 3GMAA 1FDIA 1G1JA 3G71P 1KQGB 2J5UA 2YXQB 2PP6A 1VQPP 5KLVD 4H13C 2Q9IA 4NPFX 1LWUA 4OGQC 1S4XA 2BEZF 5KLIB 3FGAD 4PV1D 4KHXA 3AEFC 2JEEA 2QIWA 3M91A 1LT1A 4C46A 3CCUP 4AQRD 2M8RA 1FZCA 2JKVA 1BGYG 1NHLA 2E42A 1AFOA 2YMYA 3A0HE 2E75C 4IOIH 3RGUA 3EWKA 1FS0E 3A0BE 1SQXJ 2IBZD 2K9JB 2N1TA 4JBZA 1N7SA 3H1JJ 2R3CA 3PP5A 2OYIB 4PJ0H 1LTAC 4U3FG 5KJ7D 5GTHH 1KORA 5H2FE 2J58A 2KYVA 1VDFA 3L72G 2B87B 1S3JA 1NGMB 5CBOA 3AE3C 2K3RA 3OAKA 1J1DB 3CCQP 3FWLA 3I55P 1JM0A 3KPEA 1ZP0C 3H1KJ 1ZR4A 1SQXD 3WU2E 3B71A 3H1JD 1VQNP 2CK3H 1RQUA 1TU3F 1LWUB 1NU1E 3LW5H 1J1EB 2WTYA 1DX7A 4I7ZC 3IFMA 1KB9I 3S1KA 2ZXXA 1LTGC 3WUTA 1FZCB 1PP9E 1KYOE 2NPSC 3CXHE 3PRJA 1IK9A 2ITAA 2E5YA 1X79B 2N1TD 3JC22 3H1LG 1N7SD 3V6IA 5APXA 1NTKG 2N1TB 1N7SB 1FZBA 2BASA 1Q2NA 2L5GB 4H44C 1L0NJ 5AW9B 1FOSF 3D70A 3JSVC 1L0LE 3E1IA 1NTMD 1NVOA 1P84E 1A02J 3SSUA 1OW6A 1QVFO 1ZR2A 1PV3A 5KLVK 5CCHA 5CMZA 1YTZI 4XA4A 3ABVC 3FXDA 4PD4I 1SFCA 2XDJA 4L76A 5DJTB 4BWNA 4WBAA 3D6YA 2Y0DA 1YIJP 5TJHA 2IPPA 2P10A 5KLIC 2IZ0A 2WSCJ 2DW3A 5AW8B 2M3BA 1BGYE 2GUVA 2WPVB 2LXBA 1HTLC 1SQVG 2IYOA 1T2KD 4UB6H 1JOCA 2OTKE 1R5LA 1AVYA 3M0DA 4U3FE 1JMMA 4BXLA 3BASA 4IFDK 1AV1A 1SQXK 1YJ9P 3L70J 1K04A 4OWFA 5CCHD 3L72E 4KJMA 1A02F 5AW6B 1LJ2A 5KJ7C 3A2AA 4IFFA 3CCSP 1FZGA 1SFCD 4JYBA 2GA1A 2FYUD 1SFCB 4GIFA 2RH0A 3PH0A 4TLFA 3M0AA 2R32A 1J1DC 2P2UA 4N6JA 1NKNA 3VYIA 2AXTE 4YTPC 3JCUH 2JDIH 3L70D 2FBWC 1T3UA 3U59A 2KNCA 1X8YA 1RE4C 1LWUC 1MUUA 1J1EC 1KB9H 2YNYA 3E7KA 5TISH 1AQTA 1FJKA 1VPCA 1HWTC 2WPRA 3MTUE 4BRYA 3H1KE 3ITKA 2OTJP 3PTZA 3Q3DA 1NTKE 2V7QH 2Q3IA 4XFJA 3TDKA 1NTMK 1IJDB 2N1TC 3CMEP 1N7SC 1PPJD 1RY3A 5APUA 1S2EA 1LTJA 1LTIC 3AE2C 1U7MA 2IDBA 2QRXA 1L0NK 2G8YA 3EQ2A 1X9VA 2IYPA 4ZKUA 4JPZB 2I1JA 2E43A 3RK3D 3Q5PA 2KNCB 1YTZT 3RK3B 3KZIE 1YQ4C 4PD4H 2A45G 4MN4C 1M1JA 1RE3C 1DD4A 1OIPA 2IFNA 3QWOC 2A45I 1ZLLA 1YITP 5B5EH 1SS1A 1QGKB 1EC5A 2Z4EA 1PZQA 4DZOA 2WPSA 1LTJB 2ZYDA 1FBMA 3PLNA 4JF7A 1BSNA 1M1KQ 3LW5J 1JCCA 4U7JA 3WUVA 1NU1J 1USEA 1T2KC 2N9YB 4EI2A 1K05A 3CCMP 3CLQA 3FXEA 1N86A 4LC1A 4EDFA 1YQ3C 3RBZA 2E5TA 5CCHC 1KV4A 2WMMA 2B88A 2QVAA 1DH3A 3F5HA 1PFIA 1M1JB 3M9HA 4LLHA 1SFCC 1VQOP 5M1BA 2AEJA 4I6MC 2HLOA 1NU1D 1OVUA 1VQMP 4W7ZA 1DEBA 1Z56A 1BCCG 1EXIA 3SWKA 1GDTA 3L37A 4UB8H 5KAFE 1BE3G 4WB4A 3P8CE 2WSEH 1PP9D 1KYOD 3CXHD 2QEXP 2KB7P 1OFCX 2OQQA 2YO3A 3VN0A 5AW7B 3G4SP 1M56D 2YKQA 1N73A 1R5SA 2KZIA 2KLVA 4GOFA 2GUSA 3M0DC 1VQ8P 2HFED 1OMIA 5AVTB 2K9YA 2WQYC 1MKMA 1L0LD 4JQ0D 2Y0EA 1EDIA 3WMM0 3MIWA 4AYCA 1P84D 1LTBC 1PGOA 1MZ9A 2WITA 1N2DC 1HJBA 2K37A 2P7JA 2HYNA 3TYYA 1Q7YQ 3RK2D 3II6A 3RK2B 2L91A 2FFDA 1DEEG 2KLUA 1BGYJ 1SQPJ 3L74G 1FE6A 1PL5A 3R2PA 2RKLA 3IF4A 3RK3C 2O3JA 2A45H 2YKOA 4U3FJ 1RE4A 3BRTB 1S5LX 4PV1B 3L72J 1N73B 2XNDH 1EZVI 1SQQG 2E74D 3GF3A 1BGYD 3MP7B 2E74B 1SQPG 1VQKP 1T8ZA 2J59M 2BCCJ 1GK6A 4PJ0E 3MHVA 1M90Q 5GTHE 1LTJC 2OARA 2YO2A 2UWJE 3A5TA 3G9RA 4U3FD 1WRGA 3CCRP 1QL1A 3L72D 5APTA 2LXCB 5AW1B 1U7JA 1EDKA 1Y9BA 1SQBJ 1NU1K 3L71G 3TGUG 2ZYGA 2PAJA 1VL2A 2B89A 1DIPA 2LKMA 2O01J 3CX5D 2FFDB 3LIDA 1LTSC 2O01N 1HGZA 3RL0D 2V7QJ 2BCCG 3RL0B 3I5CA 2JO1A 2H8PD 4WWIA 3H1LJ 1W2BO 1NTKJ 1EXJA 2KSEA 4N78E 1M1JC 5KAIE 1USDA 3NFQA 1RE3A 5KAIH 1QEXA 2W27A 1N7LA 3VP9A 1BE3E 1G1IA 1SQBG 2G3AA 4RJTA 2KI7B 2NRGA 2V4HA 3O6QA 3V5BA 3L4FA 4K3AA 2WVRA 3MD0A 1QLED 1WT6A 3VTPC 1YHQP 3H1KD 1Q86Q 3FX0A 1NTKD 2KS1B 1L0LK 1JY2P 5B66H 1T6AA 1KQFB 4JYCA 4L75A 4HH2A 1AA0A 2C0XA 3I56P 2K88A 1W2EA 1JY2O 1QX8A 3AECC 4Y28J 2Y9YA 2ZAEB 3CCJP 4GKGA 2ZXEB 2CPSA 3AE8C 2XNXA 2XZRA 3EFGA 3FWNA 3L74E 1FU1A 2N9BA 1L0ND 1JCDA 3RK2C 1HGVA 1SQVJ 5KTBA 4C7RA 3CWBG 3O6QB 4OVNF 4GDOA 1OXZA 4YXWH 2YIUB 2QA4P 1EDJA 3L75J 4M3LA 1SQQE 4PV1C 2Q1KA 2W83C 5E79E 1N73C 3USSA 1SQPE 4UB6E 2IX7C 1HUCA 3KXDA 2ZVNB 2E74C 5E79H 4IL6X 3D6ZA 2A06D 2M3EA 3CMAP 4ZKPA 1MFZA 2SPZA 2Y9ZA 3L75G 4EOTA 3L71E 1S72P 3TGUE 2AEMA 1VF5D 1IO4A 3AEDC 1VF5B 3HRNA 1NH4A 3KDPB 2BCCE 2OYHA 2FFDC 4EYYQ 3CL3D 3JCUE 1IFIA 4I2LC 3RL0C 2KIKA 1CZQA 3S4RA 2RN0A 1L4AA 1URQA 4H0LD 2HPCA 5BU8B 1KB9E 2MKVA 2YMKA 2Z5IA 2WSFH 4H0LB 3CD6P 1NTKK 2FYUG 5TISE 1S5LH 1D7MA 1SQBE 3P8CD 3AE7C 3CCLP 3BCCG 4OH8B 2QG4A 1Y47A 2JWAA 3ZDMA 2HG5D 1KN7A 3H1LE 3O8ZA 2JJLA 4WY4A 3EFFK 3N7NA 3SWYA 3AE1C 4WVZA 5BVZA 1JEKA 4C7NA 2XV5A 1PGJA 1KTMA 3MUDA 5CJ0A 1VQ6P 2HODA 2P58A 1ZRTE 1OW7A 1H8AA 2OYHB 1FC2C 2QJPB 2C9NY 1OW8A 2R3SA 2BEQD 1L4AD 2KZJA 1URQD 1L4AB 1URQB 1YBKA 4PD4E 1VQ5P 3VOPA 2HPCB 5AVVB 1LNQA 2FXOA 1ZW0A 3B4SA 3B5NA 5APVA 5KKZB 1FDOA 2H7HA 5B5EE 3CWBE 1KMIZ 1OWAA 2W6AA 2OYOA 4NPDA 4HKZH 1SQVK 3AEAC 1AVOA 2P1JA 4YXDC 1ZXGA 1NTZG 2W6JH 4GT1A 2YIUC 4WY4D 2C0WA 4WY4B 1U57A 2QJYB 4AUWA 3M06A 1SQVE 5AW0B 1MV8A 4C7NB 4XE5B 3B8EB 1UIXA 1LT9A 1KQSO 1FJPA 2HODB 1YI2P 1S1CX 4HJGH 1BCCJ 1BDCA 3L75E 3CC7P 5EFWB 4W7YA 1BE3J 3L73J 4DJGA 1GU5A 2OGUA 1GU4A 3B5ND 5APYA 1GW4A 4D6TG 3B5NB 2JP3A 5CCGA 3BVHA 4CPGA 1VF5C 3RBXA 4N78D 2ZT9D 4UB8E 2ZT9B 2Z5HA
chains in the Genus database with same CATH topology
2OARA 1CSBA 2YO2A 1GL2C 5AVYB 1JTHB 3GHGC 3TK1A 3A5TA 1SFCA 1ZN5A 1AQ5A 2XDJA 5APWA 1WRGA 3V4WA 2FXMA 1QL1A 5APTA 5AW1B 3NTNA 2MJZA 4WBAA 3HUSB 1NU1K 2WT7A 2PAJA 2H43A 2LKMA 2IPPA 2FFDB 3LIDA 1LTSC 3RL0D 1HGZA 3H32A 1LT9B 1XTCC 3RL0B 2XKMA 5AW8B 2M3BA 1E5WA 3I5CA 1KILD 4Y99B 2H8PD 3KQGA 5AW4B 2CPBA 1KILB 1SP4A 1CI6A 1JY3P 2GUVA 4N78E 1HTLC 3NMDA 1M1JC 3TNUB 3NFQA 1KFMA 1T2KD 3L35A 4HYTB 1JOCA 1JTHA 1RE3A 2W27A 3U1AA 1N7LA 3VP9A 3M0DA 5AVSB 1JO5A 1G1IA 5AW3B 1JMMA 2R5DA 5CCGD 3OJAB 3BASA 4IFDK 5AVWB 1CW5A 1SQXK 3V5BA 3L4FA 5CCHD 1A02F 1H89A 5AW6B 1ZV8A 3MD0A 5KJ7C 2OYHC 1WT6A 3A2AA 1JY3O 4IFFA 3VTPC 1S9KD 1FZGA 1XTGB 1SFCD 1IFJA 4JYBA 2NPSA 1L0LK 1NAFA 1JY2P 1SFCB 3HD7A 4GIFA 3V2RA 3HE4A 1L4AC 1URQC 5AVUB 3M0AA 2R32A 1J1DC 4JYCA 2P2UA 4N6JA 1HH0A 2FKWB 4HH2A 1NKNA 3VYIA 1FDMA 2GM4A 2WT7B 1T3UA 3U59A 4I1LA 2C0XA 5AVXB 1X8YA 1RE4C 1LWUC 1MUUA 3VMZA 1W2EA 2FYUK 1J1EC 3H32B 5AVQB 1JY2O 2YNYA 1LTTC 4GKGA 2POHA 2ZXEB 1RF1A 1KZUB 2FYZA 1FJKA 1GZLA 1SVFA 2CPSA 1IFNA 1GK4A 1VPCA 1HWTC 1CI6B 2WPRA 3MTUE 3P32A 3A3YB 1GW3A 2C9LY 2XNXA 1S9KE 4WY4C 1RF0A 2XZRA 3EFGA 2Q3IA 3KYQA 3VMYA 1FU1A 2WSCH 3BATA 2N9BA 1JCDA 1NTMK 2O1JA 3RK2C 5CJ4A 3V2PA 1HGVA 1LGHB 1IJDB 2N1TC 5KTBA 1JUNA 1N7SC 1RY3A 4C7RA 3HE5A 5APUA 2QM8A 1LTJA 3OA7A 1FZFA 4IFMA 1GL2A 3GHGA 1J2JB 1OXZA 3V4QA 3M9QA 1YYCA 1LTIC 5AVZB 2VRSA 1H88A 3T97A 1JY3N 2NPSD 3H6PA 3HD7D 3M9BA 2NPSB 2P67A 4M3LA 3HD7B 1L0NK 3HE4B 3IR9A 3L36A 4B86A 3EQ2A 1JNMA 1X9VA 4ZKUA 1N73C 1HBWA 2QM7A 3B5NC 2IX7C 1HUCA 1NOHA 2I1JA 1NWQA 1FZAA 2E43A 2Q7CA 3RK3D 1IC2A 1YTZT 2KP8A 3RK3B 1GD2E 5CHXA 2A45G 4ZKPA 1M1JA 4O9BA 1RE3C 2IFNA 1JY2N 1RF1B 2I1KA 2KOGA 2A45I 1MFZA 3P7KA 4EOTA 1ZLLA 3HTKA 3C9IA 5AVRB 1M7LA 4N3YB 2Z4EA 1IO4A 2OYIA 3HUSC 3HRNA 1NH4A 3KDPB 5AW5B 5KJ7A 1NTZK 5APSA 2OYHA 2FFDC 3BRVB 3HE5B 4LGDE 4DZOA 2WPSA 1GL2D 1LT9C 1LTJB 3CL3D 4I2LC 1FBMA 1IFIA 3RL0C 1GL2B 1CZQA 3GHGB 2WZ7A 4JF7A 4Y99C 3CI9A 1L4AA 1KFNA 1SLQA 1KILC 1URQA 2HPCA 5BU8B 5APQA 2Z5IA 2WSFH 3V2QA 1QL2A 1NTKK 2W6BA 1JCCA 2ZFCA 1G1JA 3P8CD 1IFMA 1T2KC 4OH8B 2PP6A 2Q9IA 3CLQA 2XU6A 1LWUA 1G2CA 5CCGC 1N86A 4LC1A 2HG5D 4KHXA 3SWFA 5CCHC 2JEEA 3M91A 3O8ZA 4C46A 2JJLA 2Q5UA 1DH3A 4AQRD 2M8RA 1SQQK 1PFIA 1FZCA 1M1JB 3M9HA 4LLHA 1SFCC 1NHLA 4WY4A 3N7NA 3SWYA 2E42A 1SQPK 4I6MC 1AFOA 2HLOA 2YMYA 3HTKB 5BVZA 4W7ZA 1DEBA 2N1TA 1N7SA 1Z56A 3TSIA 4C7NA 3P8MC 2XV5A 2R3CA 1GDTA 3PP5A 2OYIB 1FAVA 1LTAC 3L37A 3MUDA 4WB4A 5KJ7D 5CJ0A 2HODA 1H8AA 3P8CE 2OYHB 2WSEH 2C9NY 2J58A 2KYVA 1VDFA 2KB7P 1L4AD 1URQD 2YO3A 1L4AB 1URQB 3VN0A 3VOPA 5AW7B 5AVVB 2HPCB 3OAKA 1J1DB 1FZEA 2YKQA 3VP8A 1N73A 4DOJA 3KPEA 1NO4A 2KSJA 3B5NA 1ZR4A 5APVA 2H7HA 2KLVA 2GUSA 3M0DC 1IFDA 1OWAA 2W6AA 1LWUB 2HFED 1KQLA 3N4XA 3A7OA 5AVTB 1SQVK 3LW5H 1G2CB 1J1EB 2P1JA 2WTYA 3G3ZA 1DX7A 3IFMA 3VMXA 3WMM0 3MIWA 1LTGC 4AYCA 4GT1A 1SQBK 1LTBC 2OYIC 4WY4D 1FZCB 2R5BA 2NPSC 1MZ9A 2C0WA 3HD7C 2WITA 1N2DC 3MGNA 1HJBA 4WY4B 3V2NA 2P7JA 2HYNA 3TYYA 2YKPA 3HUSA 3RK2D 1IK9A 1X79B 4AUWA 3M06A 4RESB 2N1TD 3II6A 1N7SD 3RK2B 5APXA 2N1TB 2FFDA 5AW0B 1N7SB 1FZBA 1MV8A 4XE5B 4C7NB 1T3JA 3B8EB 5AW2B 1LT9A 3R2PA 1FJPA 2BASA 2HODB 2L5GB 2WPQA 3U1CA 3RK3C 1KILA 4EIJA 2A45H 2YKOA 5BU5A 1RE4A 3BRTB 4W7YA 5AW9B 3TNUA 1FOSF 1RF1C 3UIAA 3NXSA 1GU5A 1NKZB 1EQ7A 1FOSE 3E1IA 1GTWA 1GU4A 3LIEA 3B5ND 5APYA 1N73B 1GW4A 2O1KA 3B5NB 1RF0C 1A02J 5CCGA 3BVHA 1ZR2A 2IFMA 5KLVK 4N78D 2WWWA 5CMZA 1HVVA 1T8ZA 5CCHA 2J59M 1YTZI 1FZCC 4XA4A 1GK6A 2O01H 4W80A 2Z5HA 1LTJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY3 N;  1T3U A;  1RF0 A;  1FZG A;  2H43 A;  2HPC B;  2FFD A;  2FFD B;  2Z4E A;  1FZB A;  1RE4 C;  1FZE A;  1LWU C;  3E1I A;  3GHG C;  1RE3 A;  3HUS C;  2OYI A;  2OYI B;  1JY2 P;  1LT9 A;  1W2E A;  3H32 A;  1N73 A;  1LT9 B;  3H32 B;  1N73 B;  2XNX A;  2HOD A;  1JY2 O;  2HOD B;  2A45 G;  1RF0 C;  2OYH A;  2FFD C;  2OYH B;  1M1J A;  1FZC A;  2OYI C;  1M1J B;  1RE3 C;  1FZC B;  1RF1 A;  1JY2 N;  1RF1 B;  3BVH A;  1LTJ A;  1LT9 C;  2A45 I;  1LTJ B;  1N73 C;  2Q9I A;  1FZF A;  1JY3 P;  3GHG A;  2HLO A;  1LWU A;  2A45 H;  3GHG B;  3HUS A;  1LWU B;  1RE4 A;  1FZC C;  1JY3 O;  1M1J C;  1FZA A;  3HUS B;  2OYH C;  1RF1 C;  1N86 A;  1LTJ C;  2HPC A; 
#chains in the Genus database with same CATH topology
 3E1R A;  1JTH B;  3TK1 A;  4ZNC A;  1ZN5 A;  1AQ5 A;  1BE3 D;  3WUU A;  1WMK A;  3L73 G;  1ZOY C;  1OVV A;  4H0L C;  3BCC E;  1PGQ A;  3NTN A;  3H1I G;  4NPE A;  2H43 A;  3H32 A;  1LT9 B;  1PP9 G;  1E5W A;  3KQG A;  5AW4 B;  2CPB A;  1SP4 A;  1JY3 P;  3L74 J;  3NMD A;  3CXH I;  1VQ9 P;  3L35 A;  4HYT B;  4Z1M H;  4GOD A;  2PFX A;  1K8A Q;  2PGD A;  2R5D A;  5CCG D;  3OJA B;  2WSS H;  5AVW B;  1CW5 A;  5C39 A;  3Q1M A;  1H89 A;  1ZV8 A;  2OYH C;  2QJP C;  1Q81 Q;  1JY3 O;  3CPW O;  1SQQ J;  1XTG B;  1KC8 Q;  1IFJ A;  3H1H G;  3L74 D;  3HD7 A;  3HE4 A;  3G6E P;  1L4A C;  1R8E A;  1URQ C;  5AVU B;  1BDD A;  3AEG C;  5K5G B;  1KIL E;  1HH0 A;  4GOE A;  2FKW B;  3MZW B;  1FDM A;  5KKZ C;  2GM4 A;  2YXR B;  4I1L A;  5AVX B;  1EZV G;  3H32 B;  5AVQ B;  1SQQ D;  1NTZ E;  3L71 J;  1RF1 A;  1KZU B;  3TGU J;  1SQP D;  1IFN A;  5KLV G;  1GK4 A;  1JB0 J;  1YJN P;  4DT0 A;  2W8Z A;  3A3Y B;  1GW3 A;  1S9K E;  4WY4 C;  1RF0 A;  2M5A B;  3Q2Y A;  1M8O B;  2QJY C;  3KYQ A;  2KS1 A;  3CCV P;  2WSF J;  5CJ4 A;  3V2P A;  1LGH B;  2H88 C;  1JUN A;  2ZVO B;  1DD3 A;  3OA7 A;  3MUD C;  4IFM A;  2D2C D;  1GL2 A;  3GHG A;  1VQL P;  2D2C B;  3L71 D;  1YYC A;  2Q3E A;  2QJK B;  5AVZ B;  2AEF A;  2VRS A;  3T97 A;  1H88 A;  3TGU D;  2IBZ G;  3H6P A;  3TF5 A;  1X0T A;  3HD7 D;  3A0H H;  3W67 A;  2KK7 A;  3HD7 B;  1LP1 A;  2IBZ I;  3HE4 B;  2BCC D;  3A0B H;  3L36 A;  3VMA A;  4B86 A;  1W5C E;  4D6T E;  1N8R Q;  1ZME C;  2QM7 A;  3B5N C;  5H2F H;  1IK7 A;  3CCE P;  1NWQ A;  1FZA A;  1K9M Q;  1KB9 D;  1QVG O;  3W68 A;  1BCC E;  2KP8 A;  4R4M A;  2ZT9 C;  1GD2 E;  3CX5 I;  1SQB D;  3R4Y A;  5CHX A;  5L8R J;  3L73 E;  1SQX G;  3IN6 A;  4O9B A;  1GMJ A;  2I8D A;  1JY2 N;  3H1J G;  1RF1 B;  2KOG A;  3CC2 P;  3WU2 H;  3HTK A;  3H1I E;  2NZ2 A;  5AVR B;  5B66 E;  1M7L A;  3H1L D;  2Y0C A;  3KHU A;  2FYN B;  1VQ7 P;  1PIX A;  1RQV A;  4LGD E;  1GL2 D;  1LT9 C;  1VQ4 P;  1NTM J;  1GL2 B;  3GHG B;  3H1K G;  1KYO H;  3CI9 A;  1KFN A;  1SLQ A;  3SFD C;  3T97 B;  3CXH H;  3OW2 O;  3CWB J;  1QL2 A;  1MFT A;  2ZFC A;  1ZRT D;  1LP1 B;  2Q6Q A;  1IFM A;  2FXP A;  1IZN B;  2XU6 A;  1G2C A;  5CCG C;  4PD4 D;  3SWF A;  5CBN A;  4QMA A;  3H1H E;  4YPC A;  1NTM G;  3PHL A;  2Q5U A;  1SQQ K;  3C1L A;  3CWB D;  1K73 Q;  1SQP K;  1P84 H;  1YJW P;  3HTK B;  1NJI Q;  3TSI A;  3P8M C;  1FAV A;  1EZV E;  1L0N G;  4ASW A;  5KLV E;  2IZ1 A;  1SQV D;  1UII A;  3QH9 A;  1FZE A;  3VP8 A;  4DOJ A;  1NO4 A;  2KSJ A;  3AE9 C;  2RMZ A;  3L75 D;  2WSE J;  1IFD A;  2FYU J;  1OX3 A;  1KQL A;  2AXC A;  3N4X A;  3A7O A;  1G2C B;  3G3Z A;  3PJS K;  2A06 G;  1KD1 Q;  2IBZ E;  3BCC J;  3VMX A;  2D2C C;  2QJK C;  1SQB K;  1E79 H;  1HF9 A;  2OYI C;  2R5B A;  3HD7 C;  3MGN A;  3GLM A;  3V2N A;  2YKP A;  3HUS A;  2QE7 H;  4RES B;  1S5L E;  3IAO A;  4DCK A;  2KXP B;  3CX5 E;  1T3J A;  2JR8 A;  5AW2 B;  3GW6 A;  2E76 D;  2E76 B;  2WPQ A;  3CX5 H;  3U1C A;  1SQX E;  3BCC D;  1KIL A;  3H1J E;  4EIJ A;  3Q5R A;  5BU5 A;  3TNU A;  1RF1 C;  3UIA A;  3NXS A;  3L70 G;  2AXT H;  1NKZ B;  1EQ7 A;  1FOS E;  1GTW A;  1PGP A;  3LIE A;  2KUB A;  1JMB A;  2O1K A;  1RF0 C;  2FYN C;  2IFM A;  1Y8A A;  2QSI A;  1BSH A;  2WWW A;  1HVV A;  1FZC C;  2O01 H;  4W80 A;  1CSB A;  1M57 D;  1GL2 C;  5AVY B;  2PRR A;  3GHG C;  5APW A;  3V4W A;  1NYH A;  1PPJ G;  1Q90 D;  2FXM A;  4ASV A;  2MJZ A;  3HUS B;  1NTZ J;  2WT7 A;  3AEB C;  1NAY A;  1NTM E;  1XTC C;  2XKM A;  1AJY A;  1KIL D;  4Y99 B;  1KIL B;  1CI6 A;  5GTI E;  2M0B A;  3TNU B;  2JWD A;  1KFM A;  5GTI H;  1JTH A;  4H13 D;  1IFP A;  3U1A A;  1L0N E;  5AVS B;  1JO5 A;  4OGQ D;  4H13 B;  5AW3 B;  1NTZ D;  3AE6 C;  4OGQ B;  3KZI H;  2H89 C;  4BRY B;  1S9K D;  4D6T J;  3SFE C;  2NPS A;  1NAF A;  3V2R A;  2E75 D;  4RKU J;  2E75 B;  1OZH A;  1EDL A;  2WT7 B;  2A06 E;  3VMZ A;  2FYU K;  3CC4 P;  2OTL P;  4A7P A;  4D6T D;  1LTT C;  3H1I J;  2POH A;  3K5B A;  2FYZ A;  1GZL A;  3D71 A;  1SVF A;  1CI6 B;  3RL0 g;  3P32 A;  1X22 A;  2FY8 A;  2C9L Y;  1H0T A;  1PP9 J;  1BCC D;  3AEE C;  3VMY A;  2WSC H;  3BAT A;  2FYU E;  2O1J A;  3L73 D;  4L74 A;  3HE5 A;  2QM8 A;  1FZF A;  4I7Z B;  1L2P A;  1J2J B;  2E76 C;  3V4Q A;  1NU1 G;  3H1I D;  4HB1 A;  3M9Q A;  4RO0 A;  1OVR A;  3L70 E;  1JY3 N;  2NPS D;  2ZJS E;  4IL6 E;  3M9B A;  2NPS B;  2P67 A;  2HR3 A;  3IR9 A;  5DJU B;  3S9O A;  4IL6 H;  1JNM A;  5KAF H;  3H25 A;  1L0L J;  1HBW A;  3H1H J;  1KYO I;  1NOH A;  3GG2 A;  1HJ0 A;  2Q7C A;  4H44 D;  2K1A A;  2M5A A;  4H44 B;  2B9B A;  1IC2 A;  1RH5 B;  1RHZ B;  4ZMD A;  4TT3 H;  3F89 A;  4KT0 J;  3C8V A;  1PPJ E;  2I1K A;  1Q82 Q;  2LR2 A;  3P7K A;  4L73 A;  2R44 A;  3AE4 C;  3C9I A;  1H0T B;  2K9J A;  4N3Y B;  1L0L G;  3H1H D;  2OYI A;  3HUS C;  2ZYA A;  5KLV J;  3GF7 A;  5AW5 B;  5KJ7 A;  1NTZ K;  5APS A;  3BRV B;  3Q5S A;  3HE5 B;  2W90 A;  1P84 I;  2B87 A;  2WZ7 A;  4Y99 C;  3AE5 C;  1KIL C;  5APQ A;  4K35 A;  3RK3 E;  3V2Q A;  1EZV D;  2W6B A;  4R4L A;  3GMA A;  1FDI A;  1G1J A;  3G71 P;  1KQG B;  2J5U A;  2YXQ B;  2PP6 A;  1VQP P;  5KLV D;  4H13 C;  2Q9I A;  4NPF X;  1LWU A;  4OGQ C;  1S4X A;  2BEZ F;  5KLI B;  3FGA D;  4PV1 D;  4KHX A;  3AEF C;  2JEE A;  2QIW A;  3M91 A;  1LT1 A;  4C46 A;  3CCU P;  4AQR D;  2M8R A;  1FZC A;  2JKV A;  1BGY G;  1NHL A;  2E42 A;  1AFO A;  2YMY A;  3A0H E;  2E75 C;  4IOI H;  3RGU A;  3EWK A;  1FS0 E;  3A0B E;  1SQX J;  2IBZ D;  2K9J B;  2N1T A;  4JBZ A;  1N7S A;  3H1J J;  2R3C A;  3PP5 A;  2OYI B;  4PJ0 H;  1LTA C;  4U3F G;  5KJ7 D;  5GTH H;  1KOR A;  5H2F E;  2J58 A;  2KYV A;  1VDF A;  3L72 G;  2B87 B;  1S3J A;  1NGM B;  5CBO A;  3AE3 C;  2K3R A;  3OAK A;  1J1D B;  3CCQ P;  3FWL A;  3I55 P;  1JM0 A;  3KPE A;  1ZP0 C;  3H1K J;  1ZR4 A;  1SQX D;  3WU2 E;  3B71 A;  3H1J D;  1VQN P;  2CK3 H;  1RQU A;  1TU3 F;  1LWU B;  1NU1 E;  3LW5 H;  1J1E B;  2WTY A;  1DX7 A;  4I7Z C;  3IFM A;  1KB9 I;  3S1K A;  2ZXX A;  1LTG C;  3WUT A;  1FZC B;  1PP9 E;  1KYO E;  2NPS C;  3CXH E;  3PRJ A;  1IK9 A;  2ITA A;  2E5Y A;  1X79 B;  2N1T D;  3JC2 2;  3H1L G;  1N7S D;  3V6I A;  5APX A;  1NTK G;  2N1T B;  1N7S B;  1FZB A;  2BAS A;  1Q2N A;  2L5G B;  4H44 C;  1L0N J;  5AW9 B;  1FOS F;  3D70 A;  3JSV C;  1L0L E;  3E1I A;  1NTM D;  1NVO A;  1P84 E;  1A02 J;  3SSU A;  1OW6 A;  1QVF O;  1ZR2 A;  1PV3 A;  5KLV K;  5CCH A;  5CMZ A;  1YTZ I;  4XA4 A;  3ABV C;  3FXD A;  4PD4 I;  1SFC A;  2XDJ A;  4L76 A;  5DJT B;  4BWN A;  4WBA A;  3D6Y A;  2Y0D A;  1YIJ P;  5TJH A;  2IPP A;  2P10 A;  5KLI C;  2IZ0 A;  2WSC J;  2DW3 A;  5AW8 B;  2M3B A;  1BGY E;  2GUV A;  2WPV B;  2LXB A;  1HTL C;  1SQV G;  2IYO A;  1T2K D;  4UB6 H;  1JOC A;  2OTK E;  1R5L A;  1AVY A;  3M0D A;  4U3F E;  1JMM A;  4BXL A;  3BAS A;  4IFD K;  1AV1 A;  1SQX K;  1YJ9 P;  3L70 J;  1K04 A;  4OWF A;  5CCH D;  3L72 E;  4KJM A;  1A02 F;  5AW6 B;  1LJ2 A;  5KJ7 C;  3A2A A;  4IFF A;  3CCS P;  1FZG A;  1SFC D;  4JYB A;  2GA1 A;  2FYU D;  1SFC B;  4GIF A;  2RH0 A;  3PH0 A;  4TLF A;  3M0A A;  2R32 A;  1J1D C;  2P2U A;  4N6J A;  1NKN A;  3VYI A;  2AXT E;  4YTP C;  3JCU H;  2JDI H;  3L70 D;  2FBW C;  1T3U A;  3U59 A;  2KNC A;  1X8Y A;  1RE4 C;  1LWU C;  1MUU A;  1J1E C;  1KB9 H;  2YNY A;  3E7K A;  5TIS H;  1AQT A;  1FJK A;  1VPC A;  1HWT C;  2WPR A;  3MTU E;  4BRY A;  3H1K E;  3ITK A;  2OTJ P;  3PTZ A;  3Q3D A;  1NTK E;  2V7Q H;  2Q3I A;  4XFJ A;  3TDK A;  1NTM K;  1IJD B;  2N1T C;  3CME P;  1N7S C;  1PPJ D;  1RY3 A;  5APU A;  1S2E A;  1LTJ A;  1LTI C;  3AE2 C;  1U7M A;  2IDB A;  2QRX A;  1L0N K;  2G8Y A;  3EQ2 A;  1X9V A;  2IYP A;  4ZKU A;  4JPZ B;  2I1J A;  2E43 A;  3RK3 D;  3Q5P A;  2KNC B;  1YTZ T;  3RK3 B;  3KZI E;  1YQ4 C;  4PD4 H;  2A45 G;  4MN4 C;  1M1J A;  1RE3 C;  1DD4 A;  1OIP A;  2IFN A;  3QWO C;  2A45 I;  1ZLL A;  1YIT P;  5B5E H;  1SS1 A;  1QGK B;  1EC5 A;  2Z4E A;  1PZQ A;  4DZO A;  2WPS A;  1LTJ B;  2ZYD A;  1FBM A;  3PLN A;  4JF7 A;  1BSN A;  1M1K Q;  3LW5 J;  1JCC A;  4U7J A;  3WUV A;  1NU1 J;  1USE A;  1T2K C;  2N9Y B;  4EI2 A;  1K05 A;  3CCM P;  3CLQ A;  3FXE A;  1N86 A;  4LC1 A;  4EDF A;  1YQ3 C;  3RBZ A;  2E5T A;  5CCH C;  1KV4 A;  2WMM A;  2B88 A;  2QVA A;  1DH3 A;  3F5H A;  1PFI A;  1M1J B;  3M9H A;  4LLH A;  1SFC C;  1VQO P;  5M1B A;  2AEJ A;  4I6M C;  2HLO A;  1NU1 D;  1OVU A;  1VQM P;  4W7Z A;  1DEB A;  1Z56 A;  1BCC G;  1EXI A;  3SWK A;  1GDT A;  3L37 A;  4UB8 H;  5KAF E;  1BE3 G;  4WB4 A;  3P8C E;  2WSE H;  1PP9 D;  1KYO D;  3CXH D;  2QEX P;  2KB7 P;  1OFC X;  2OQQ A;  2YO3 A;  3VN0 A;  5AW7 B;  3G4S P;  1M56 D;  2YKQ A;  1N73 A;  1R5S A;  2KZI A;  2KLV A;  4GOF A;  2GUS A;  3M0D C;  1VQ8 P;  2HFE D;  1OMI A;  5AVT B;  2K9Y A;  2WQY C;  1MKM A;  1L0L D;  4JQ0 D;  2Y0E A;  1EDI A;  3WMM 0;  3MIW A;  4AYC A;  1P84 D;  1LTB C;  1PGO A;  1MZ9 A;  2WIT A;  1N2D C;  1HJB A;  2K37 A;  2P7J A;  2HYN A;  3TYY A;  1Q7Y Q;  3RK2 D;  3II6 A;  3RK2 B;  2L91 A;  2FFD A;  1DEE G;  2KLU A;  1BGY J;  1SQP J;  3L74 G;  1FE6 A;  1PL5 A;  3R2P A;  2RKL A;  3IF4 A;  3RK3 C;  2O3J A;  2A45 H;  2YKO A;  4U3F J;  1RE4 A;  3BRT B;  1S5L X;  4PV1 B;  3L72 J;  1N73 B;  2XND H;  1EZV I;  1SQQ G;  2E74 D;  3GF3 A;  1BGY D;  3MP7 B;  2E74 B;  1SQP G;  1VQK P;  1T8Z A;  2J59 M;  2BCC J;  1GK6 A;  4PJ0 E;  3MHV A;  1M90 Q;  5GTH E;  1LTJ C;  2OAR A;  2YO2 A;  2UWJ E;  3A5T A;  3G9R A;  4U3F D;  1WRG A;  3CCR P;  1QL1 A;  3L72 D;  5APT A;  2LXC B;  5AW1 B;  1U7J A;  1EDK A;  1Y9B A;  1SQB J;  1NU1 K;  3L71 G;  3TGU G;  2ZYG A;  2PAJ A;  1VL2 A;  2B89 A;  1DIP A;  2LKM A;  2O01 J;  3CX5 D;  2FFD B;  3LID A;  1LTS C;  2O01 N;  1HGZ A;  3RL0 D;  2V7Q J;  2BCC G;  3RL0 B;  3I5C A;  2JO1 A;  2H8P D;  4WWI A;  3H1L J;  1W2B O;  1NTK J;  1EXJ A;  2KSE A;  4N78 E;  1M1J C;  5KAI E;  1USD A;  3NFQ A;  1RE3 A;  5KAI H;  1QEX A;  2W27 A;  1N7L A;  3VP9 A;  1BE3 E;  1G1I A;  1SQB G;  2G3A A;  4RJT A;  2KI7 B;  2NRG A;  2V4H A;  3O6Q A;  3V5B A;  3L4F A;  4K3A A;  2WVR A;  3MD0 A;  1QLE D;  1WT6 A;  3VTP C;  1YHQ P;  3H1K D;  1Q86 Q;  3FX0 A;  1NTK D;  2KS1 B;  1L0L K;  1JY2 P;  5B66 H;  1T6A A;  1KQF B;  4JYC A;  4L75 A;  4HH2 A;  1AA0 A;  2C0X A;  3I56 P;  2K88 A;  1W2E A;  1JY2 O;  1QX8 A;  3AEC C;  4Y28 J;  2Y9Y A;  2ZAE B;  3CCJ P;  4GKG A;  2ZXE B;  2CPS A;  3AE8 C;  2XNX A;  2XZR A;  3EFG A;  3FWN A;  3L74 E;  1FU1 A;  2N9B A;  1L0N D;  1JCD A;  3RK2 C;  1HGV A;  1SQV J;  5KTB A;  4C7R A;  3CWB G;  3O6Q B;  4OVN F;  4GDO A;  1OXZ A;  4YXW H;  2YIU B;  2QA4 P;  1EDJ A;  3L75 J;  4M3L A;  1SQQ E;  4PV1 C;  2Q1K A;  2W83 C;  5E79 E;  1N73 C;  3USS A;  1SQP E;  4UB6 E;  2IX7 C;  1HUC A;  3KXD A;  2ZVN B;  2E74 C;  5E79 H;  4IL6 X;  3D6Z A;  2A06 D;  2M3E A;  3CMA P;  4ZKP A;  1MFZ A;  2SPZ A;  2Y9Z A;  3L75 G;  4EOT A;  3L71 E;  1S72 P;  3TGU E;  2AEM A;  1VF5 D;  1IO4 A;  3AED C;  1VF5 B;  3HRN A;  1NH4 A;  3KDP B;  2BCC E;  2OYH A;  2FFD C;  4EYY Q;  3CL3 D;  3JCU E;  1IFI A;  4I2L C;  3RL0 C;  2KIK A;  1CZQ A;  3S4R A;  2RN0 A;  1L4A A;  1URQ A;  4H0L D;  2HPC A;  5BU8 B;  1KB9 E;  2MKV A;  2YMK A;  2Z5I A;  2WSF H;  4H0L B;  3CD6 P;  1NTK K;  2FYU G;  5TIS E;  1S5L H;  1D7M A;  1SQB E;  3P8C D;  3AE7 C;  3CCL P;  3BCC G;  4OH8 B;  2QG4 A;  1Y47 A;  2JWA A;  3ZDM A;  2HG5 D;  1KN7 A;  3H1L E;  3O8Z A;  2JJL A;  4WY4 A;  3EFF K;  3N7N A;  3SWY A;  3AE1 C;  4WVZ A;  5BVZ A;  1JEK A;  4C7N A;  2XV5 A;  1PGJ A;  1KTM A;  3MUD A;  5CJ0 A;  1VQ6 P;  2HOD A;  2P58 A;  1ZRT E;  1OW7 A;  1H8A A;  2OYH B;  1FC2 C;  2QJP B;  2C9N Y;  1OW8 A;  2R3S A;  2BEQ D;  1L4A D;  2KZJ A;  1URQ D;  1L4A B;  1URQ B;  1YBK A;  4PD4 E;  1VQ5 P;  3VOP A;  2HPC B;  5AVV B;  1LNQ A;  2FXO A;  1ZW0 A;  3B4S A;  3B5N A;  5APV A;  5KKZ B;  1FDO A;  2H7H A;  5B5E E;  3CWB E;  1KMI Z;  1OWA A;  2W6A A;  2OYO A;  4NPD A;  4HKZ H;  1SQV K;  3AEA C;  1AVO A;  2P1J A;  4YXD C;  1ZXG A;  1NTZ G;  2W6J H;  4GT1 A;  2YIU C;  4WY4 D;  2C0W A;  4WY4 B;  1U57 A;  2QJY B;  4AUW A;  3M06 A;  1SQV E;  5AW0 B;  1MV8 A;  4C7N B;  4XE5 B;  3B8E B;  1UIX A;  1LT9 A;  1KQS O;  1FJP A;  2HOD B;  1YI2 P;  1S1C X;  4HJG H;  1BCC J;  1BDC A;  3L75 E;  3CC7 P;  5EFW B;  4W7Y A;  1BE3 J;  3L73 J;  4DJG A;  1GU5 A;  2OGU A;  1GU4 A;  3B5N D;  5APY A;  1GW4 A;  4D6T G;  3B5N B;  2JP3 A;  5CCG A;  3BVH A;  4CPG A;  1VF5 C;  3RBX A;  4N78 D;  2ZT9 D;  4UB8 E;  2ZT9 B;  2Z5H A; 
#chains in the Genus database with same CATH homology
 2OAR A;  1CSB A;  2YO2 A;  1GL2 C;  5AVY B;  1JTH B;  3GHG C;  3TK1 A;  3A5T A;  1SFC A;  1ZN5 A;  1AQ5 A;  2XDJ A;  5APW A;  1WRG A;  3V4W A;  2FXM A;  1QL1 A;  5APT A;  5AW1 B;  3NTN A;  2MJZ A;  4WBA A;  3HUS B;  1NU1 K;  2WT7 A;  2PAJ A;  2H43 A;  2LKM A;  2IPP A;  2FFD B;  3LID A;  1LTS C;  3RL0 D;  1HGZ A;  3H32 A;  1LT9 B;  1XTC C;  3RL0 B;  2XKM A;  5AW8 B;  2M3B A;  1E5W A;  3I5C A;  1KIL D;  4Y99 B;  2H8P D;  3KQG A;  5AW4 B;  2CPB A;  1KIL B;  1SP4 A;  1CI6 A;  1JY3 P;  2GUV A;  4N78 E;  1HTL C;  3NMD A;  1M1J C;  3TNU B;  3NFQ A;  1KFM A;  1T2K D;  3L35 A;  4HYT B;  1JOC A;  1JTH A;  1RE3 A;  2W27 A;  3U1A A;  1N7L A;  3VP9 A;  3M0D A;  5AVS B;  1JO5 A;  1G1I A;  5AW3 B;  1JMM A;  2R5D A;  5CCG D;  3OJA B;  3BAS A;  4IFD K;  5AVW B;  1CW5 A;  1SQX K;  3V5B A;  3L4F A;  5CCH D;  1A02 F;  1H89 A;  5AW6 B;  1ZV8 A;  3MD0 A;  5KJ7 C;  2OYH C;  1WT6 A;  3A2A A;  1JY3 O;  4IFF A;  3VTP C;  1S9K D;  1FZG A;  1XTG B;  1SFC D;  1IFJ A;  4JYB A;  2NPS A;  1L0L K;  1NAF A;  1JY2 P;  1SFC B;  3HD7 A;  4GIF A;  3V2R A;  3HE4 A;  1L4A C;  1URQ C;  5AVU B;  3M0A A;  2R32 A;  1J1D C;  4JYC A;  2P2U A;  4N6J A;  1HH0 A;  2FKW B;  4HH2 A;  1NKN A;  3VYI A;  1FDM A;  2GM4 A;  2WT7 B;  1T3U A;  3U59 A;  4I1L A;  2C0X A;  5AVX B;  1X8Y A;  1RE4 C;  1LWU C;  1MUU A;  3VMZ A;  1W2E A;  2FYU K;  1J1E C;  3H32 B;  5AVQ B;  1JY2 O;  2YNY A;  1LTT C;  4GKG A;  2POH A;  2ZXE B;  1RF1 A;  1KZU B;  2FYZ A;  1FJK A;  1GZL A;  1SVF A;  2CPS A;  1IFN A;  1GK4 A;  1VPC A;  1HWT C;  1CI6 B;  2WPR A;  3MTU E;  3P32 A;  3A3Y B;  1GW3 A;  2C9L Y;  2XNX A;  1S9K E;  4WY4 C;  1RF0 A;  2XZR A;  3EFG A;  2Q3I A;  3KYQ A;  3VMY A;  1FU1 A;  2WSC H;  3BAT A;  2N9B A;  1JCD A;  1NTM K;  2O1J A;  3RK2 C;  5CJ4 A;  3V2P A;  1HGV A;  1LGH B;  1IJD B;  2N1T C;  5KTB A;  1JUN A;  1N7S C;  1RY3 A;  4C7R A;  3HE5 A;  5APU A;  2QM8 A;  1LTJ A;  3OA7 A;  1FZF A;  4IFM A;  1GL2 A;  3GHG A;  1J2J B;  1OXZ A;  3V4Q A;  3M9Q A;  1YYC A;  1LTI C;  5AVZ B;  2VRS A;  1H88 A;  3T97 A;  1JY3 N;  2NPS D;  3H6P A;  3HD7 D;  3M9B A;  2NPS B;  2P67 A;  4M3L A;  3HD7 B;  1L0N K;  3HE4 B;  3IR9 A;  3L36 A;  4B86 A;  3EQ2 A;  1JNM A;  1X9V A;  4ZKU A;  1N73 C;  1HBW A;  2QM7 A;  3B5N C;  2IX7 C;  1HUC A;  1NOH A;  2I1J A;  1NWQ A;  1FZA A;  2E43 A;  2Q7C A;  3RK3 D;  1IC2 A;  1YTZ T;  2KP8 A;  3RK3 B;  1GD2 E;  5CHX A;  2A45 G;  4ZKP A;  1M1J A;  4O9B A;  1RE3 C;  2IFN A;  1JY2 N;  1RF1 B;  2I1K A;  2KOG A;  2A45 I;  1MFZ A;  3P7K A;  4EOT A;  1ZLL A;  3HTK A;  3C9I A;  5AVR B;  1M7L A;  4N3Y B;  2Z4E A;  1IO4 A;  2OYI A;  3HUS C;  3HRN A;  1NH4 A;  3KDP B;  5AW5 B;  5KJ7 A;  1NTZ K;  5APS A;  2OYH A;  2FFD C;  3BRV B;  3HE5 B;  4LGD E;  4DZO A;  2WPS A;  1GL2 D;  1LT9 C;  1LTJ B;  3CL3 D;  4I2L C;  1FBM A;  1IFI A;  3RL0 C;  1GL2 B;  1CZQ A;  3GHG B;  2WZ7 A;  4JF7 A;  4Y99 C;  3CI9 A;  1L4A A;  1KFN A;  1SLQ A;  1KIL C;  1URQ A;  2HPC A;  5BU8 B;  5APQ A;  2Z5I A;  2WSF H;  3V2Q A;  1QL2 A;  1NTK K;  2W6B A;  1JCC A;  2ZFC A;  1G1J A;  3P8C D;  1IFM A;  1T2K C;  4OH8 B;  2PP6 A;  2Q9I A;  3CLQ A;  2XU6 A;  1LWU A;  1G2C A;  5CCG C;  1N86 A;  4LC1 A;  2HG5 D;  4KHX A;  3SWF A;  5CCH C;  2JEE A;  3M91 A;  3O8Z A;  4C46 A;  2JJL A;  2Q5U A;  1DH3 A;  4AQR D;  2M8R A;  1SQQ K;  1PFI A;  1FZC A;  1M1J B;  3M9H A;  4LLH A;  1SFC C;  1NHL A;  4WY4 A;  3N7N A;  3SWY A;  2E42 A;  1SQP K;  4I6M C;  1AFO A;  2HLO A;  2YMY A;  3HTK B;  5BVZ A;  4W7Z A;  1DEB A;  2N1T A;  1N7S A;  1Z56 A;  3TSI A;  4C7N A;  3P8M C;  2XV5 A;  2R3C A;  1GDT A;  3PP5 A;  2OYI B;  1FAV A;  1LTA C;  3L37 A;  3MUD A;  4WB4 A;  5KJ7 D;  5CJ0 A;  2HOD A;  1H8A A;  3P8C E;  2OYH B;  2WSE H;  2C9N Y;  2J58 A;  2KYV A;  1VDF A;  2KB7 P;  1L4A D;  1URQ D;  2YO3 A;  1L4A B;  1URQ B;  3VN0 A;  3VOP A;  5AW7 B;  5AVV B;  2HPC B;  3OAK A;  1J1D B;  1FZE A;  2YKQ A;  3VP8 A;  1N73 A;  4DOJ A;  3KPE A;  1NO4 A;  2KSJ A;  3B5N A;  1ZR4 A;  5APV A;  2H7H A;  2KLV A;  2GUS A;  3M0D C;  1IFD A;  1OWA A;  2W6A A;  1LWU B;  2HFE D;  1KQL A;  3N4X A;  3A7O A;  5AVT B;  1SQV K;  3LW5 H;  1G2C B;  1J1E B;  2P1J A;  2WTY A;  3G3Z A;  1DX7 A;  3IFM A;  3VMX A;  3WMM 0;  3MIW A;  1LTG C;  4AYC A;  4GT1 A;  1SQB K;  1LTB C;  2OYI C;  4WY4 D;  1FZC B;  2R5B A;  2NPS C;  1MZ9 A;  2C0W A;  3HD7 C;  2WIT A;  1N2D C;  3MGN A;  1HJB A;  4WY4 B;  3V2N A;  2P7J A;  2HYN A;  3TYY A;  2YKP A;  3HUS A;  3RK2 D;  1IK9 A;  1X79 B;  4AUW A;  3M06 A;  4RES B;  2N1T D;  3II6 A;  1N7S D;  3RK2 B;  5APX A;  2N1T B;  2FFD A;  5AW0 B;  1N7S B;  1FZB A;  1MV8 A;  4XE5 B;  4C7N B;  1T3J A;  3B8E B;  5AW2 B;  1LT9 A;  3R2P A;  1FJP A;  2BAS A;  2HOD B;  2L5G B;  2WPQ A;  3U1C A;  3RK3 C;  1KIL A;  4EIJ A;  2A45 H;  2YKO A;  5BU5 A;  1RE4 A;  3BRT B;  4W7Y A;  5AW9 B;  3TNU A;  1FOS F;  1RF1 C;  3UIA A;  3NXS A;  1GU5 A;  1NKZ B;  1EQ7 A;  1FOS E;  3E1I A;  1GTW A;  1GU4 A;  3LIE A;  3B5N D;  5APY A;  1N73 B;  1GW4 A;  2O1K A;  3B5N B;  1RF0 C;  1A02 J;  5CCG A;  3BVH A;  1ZR2 A;  2IFM A;  5KLV K;  4N78 D;  2WWW A;  5CMZ A;  1HVV A;  1T8Z A;  5CCH A;  2J59 M;  1YTZ I;  1FZC C;  4XA4 A;  1GK6 A;  2O01 H;  4W80 A;  2Z5H A;  1LTJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...