3HUSA

Crystal structure of recombinant gamma n308k fibrinogen fragment d with the peptide ligand gly-pro-arg-pro-amide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
61
structure length
61
Chain Sequence
VQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Impaired protofibril formation in fibrinogen gammaN308K is due to altered D:D and "A:a" interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 16
structure length 61
sequence length 61
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3husA00
2A45I 2OYHA 2OYHC 1N73C 1FZCA 2FFDA 2A45H 2A45G 1FZGA 1LTJB 3H32A 1RF0A 2HPCA 2HODB 1FZBA 1N73B 1LWUB 1LT9B 1FZCB 3GHGB 1FZFA 1JY3O 1RF1B 1T3UA 1M1JA 2FFDC 1LTJC 2Q9IA 1N86A 1W2EA 3HUSC 2OYIB 2HLOA 1LWUC 1LT9C 1RE3C 1RE4A 2HODA 3GHGC 1RF1A 1JY2O 2H43A 1RF1C 1LT9A 1JY3N 1LWUA 1RE3A 2FFDB 1JY2P 3H32B 1LTJA 1FZAA 2XNXA 3HUSB 3BVHA 2OYIA 1M1JC 2OYIC 3E1IA 2OYHB 1JY2N 2Z4EA 1RF0C 3GHGA 1RE4C 1JY3P 1N73A 1M1JB 3HUSA 2HPCB 1FZCC 1FZEA
chains in the Genus database with same CATH superfamily
3AE1C 1XTGB 1GMJA 1NTMJ 2XZRA 1GU5A 1S5LH 2ZJSE 5AVSB 3H1JE 5AW8B 1AVYA 1FZBA 5BU5A 1IFNA 1LWUB 1N73B 5E79H 5APYA 1SQPK 3F5HA 3KDPB 1SQQG 1GL2D 1ZN5A 2QJYB 3CXHH 1RH5B 2WPQA 4OVNF 5GTHE 1GL2A 2KUBA 2Q1KA 3CWBG 1NAFA 1NYHA 3L70D 3B5ND 5AW4B 3CPWO 2OYIB 2FYUD 1KILD 1LT9A 1Q90D 1KORA 2JJLA 3ITKA 4KHXA 4K35A 1CSBA 2KLUA 1KZUB 3PTZA 3BVHA 4GOFA 1Y47A 5KLVK 1VQ6P 1U7JA 2KK7A 1D7MA 3NMDA 2E5TA 3L75J 4PV1B 1M8OB 3TNUB 3HE4B 5AW6B 3PHLA 4D6TE 3O6QB 2Z4EA 1Y9BA 3CL3D 3U1AA 3OA7A 2VRSA 4H44B 2P10A 3KXDA 3W68A 2N9BA 2YO2A 2N1TD 1M56D 1HJ0A 1L0LE 4WY4C 1KQGB 5APQA 1QEXA 3TSIA 2R3CA 1N7SA 1IFJA 3V2QA 2B9BA 1LP1B 4BXLA 1VF5C 2W83C 2IBZD 2KSJA 3L73G 1NU1G 5DJTB 4Z1MH 4EOTA 1LT1A 1P84H 2WSEJ 4HH2A 5C39A 5H2FE 1IK7A 2KS1B 3H1LE 2ZT9C 3L73E 3NXSA 3G71P 1FZFA 3O8ZA 1L0LK 2IDBA 2QIWA 2V7QJ 3TF5A 1VQ5P 3RK3C 1KYOD 2O01N 3GF3A 2WPRA 2RKLA 2IZ1A 2GUVA 3HRNA 1YIJP 3Q2YA 4L73A 4DOJA 3VYIA 4WVZA 3L37A 3M0AA 3RBXA 5KJ7D 1KB9I 4UB8H 1IFPA 2LXCB 3AE8C 4GOEA 4LLHA 4AUWA 1FAVA 3TGUG 3AEBC 2Y0DA 4KT0J 1PFIA 3HTKB 3CCSP 2OQQA 1J1EC 2QM7A 1NTMG 1DD3A 4C46A 3SWFA 3CCLP 2KNCA 2AEJA 2AXCA 3HD7C 1IFDA 3BASA 1IFIA 1FOSF 1NAYA 1NO4A 2KYVA 3GF7A 3SWYA 1RF1B 1SQQJ 1HGVA 3VMXA 2Q3IA 3AEDC 3HE5A 4XFJA 3B5NC 1S2EA 5GTIH 1YTZT 2W8ZA 1AFOA 1IK9A 1K04A 2BASA 2FFDB 2CK3H 2K37A 3AE3C 3E7KA 2WTYA 2BCCD 2R44A 5BVZA 3FGAD 1K05A 2AEFA 1NTZK 1N7SC 5TISE 3OAKA 1FDMA 3L74E 2QM8A 1LJ2A 1PP9G 1OVUA 3NFQA 2E42A 4JPZB 1SQPD 1Z56A 1OW7A 3CX5D 4BRYB 2NPSC 1S5LX 3RK2D 3ABVC 2C0WA 2RN0A 3SFEC 2Y9YA 3B71A 3CXHD 4UB8E 3CCUP 1URQD 1Q2NA 1R5LA 1SP4A 1CI6A 1JY3O 1KILE 1NU1J 2QE7H 3L73J 3H1ID 1EZVD 3MUDC 2QJKC 1LTJC 3P8MC 5APWA 1N86A 5AVWB 3TDKA 5B5EE 1LT9C 1PL5A 2KOGA 1N8RQ 1L0ND 1BE3E 2N1TA 1EC5A 1ZW0A 4U3FD 2O01H 4N3YB 3H25A 3MZWB 1S72P 2C0XA 3M0DC 3M06A 1S5LE 1URQA 3AE5C 3LIEA 3RL0C 1EDKA 2WSFH 5CCHC 1BSHA 1L0NK 2FYNC 2IZ0A 2D2CC 2GA1A 2G8YA 2KZIA 1USEA 3L72G 3L75E 3MD0A 4L74A 2MKVA 1WT6A 3TGUJ 5AW0B 1GDTA 5APUA 1QLED 4DZOA 4A7PA 1SFCB 1KYOI 2FKWB 2LKMA 1VL2A 2A06D 1JUNA 3P7KA 1U7MA 3CMEP 4NPFX 3AE7C 2O1JA 4C7NB 3U59A 3H1HG 3I56P 2IX7C 1L4AD 2WZ7A 2AXTE 3L36A 5K5GB 2Q9IA 1EXIA 2WMMA 3AEEC 3H1HE 1URQB 2E75D 5B5EH 3M91A 2HODA 4U3FG 2B89A 3RL0g 2HG5D 3T97A 2PGDA 3M9QA 1K8AQ 2PP6A 1GL2C 2ZAEB 1JY2P 1GZLA 1NU1D 1PIXA 1NTME 1LTJA 3H32B 5KLVD 5M1BA 1SQVJ 3L70E 1ZR2A 3MUDA 4Y99B 1SQQE 1NTZE 2QEXP 1R8EA 1SQVE 1Q81Q 1GW4A 5AVZB 1FC2C 3GLMA 5KAFE 1NJIQ 1OVVA 2ZFCA 1PPJD 2NPSA 3P8CD 3PLNA 4ASVA 1BCCE 1PP9J 4I7ZB 3H32A 4ZMDA 2YNYA 4GT1A 2YXRB 2Y0EA 4BRYA 4D6TD 1SQQK 1JMMA 1RF0A 2E76B 2HODB 4EDFA 3VOPA 4N78E 1S3JA 5KLIC 3RK3B 1H8AA 2JEEA 5KTBA 2LR2A 4XA4A 2FBWC 4TLFA 2BCCG 1X22A 2FY8A 4C7NA 3AEFC 4HJGH 1JB0J 2XNDH 2MJZA 1T8ZA 3KZIH 1JY3N 2BEZF 1JCCA 1SFCA 2JO1A 2O01J 3RK2B 1VQOP 2KSEA 2HFED 1EDJA 2FYUJ 1ZRTD 3E1RA 2W6JH 3FXEA 3HE5B 3KYQA 1S1CX 3KQGA 1IZNB 2L91A 3FWLA 2WSFJ 3V2PA 3SFDC 5B66E 3L74G 2HR3A 2IYOA 4NPEA 3FX0A 5APVA 3II6A 1L2PA 3BCCJ 4L75A 3L72J 3CCJP 1QVFO 5CCGC 1YI2P 1OWAA 2H43A 1T2KC 1M1KQ 1FZCC 1AQ5A 1A02F 3H1IG 5AW5B 4PV1C 1NTKD 1ZLLA 4IFFA 2N1TB 2JWAA 1EDLA 1ZR4A 1HGZA 3VMYA 1G1JA 1FJKA 3MTUE 4I2LC 3G4SP 5AVXB 3AE9C 2FYUE 3H1HJ 3LIDA 3WU2E 2YIUC 4H0LD 1CI6B 4GKGA 2YMKA 3WU2H 1BE3G 1X79B 1XTCC 4U7JA 5AW9B 1P84E 4U3FJ 3VMZA 3CMAP 3GHGC 2P7JA 2Z5IA 1Y8AA 4HB1A 3WUVA 3K5BA 1M90Q 1HJBA 1AV1A 2IBZG 5CMZA 2D2CD 1Q7YQ 2O1KA 1KILB 1KILA 4I1LA 2KI7B 3AE4C 1SQVG 3GW6A 1ZMEC 1M1JC 3RL0D 3Q5RA 2KS1A 1SQBJ 1VQMP 1SQVK 1DIPA 3EWKA 4PV1D 3P32A 1J1DC 1SQXK 2QJPB 5CCGD 2E74D 1J2JB 2IBZE 2Z5HA 3H1KD 3L71G 1N2DC 2FFDA 3R2PA 2PAJA 3PH0A 3F89A 1VQ4P 1MKMA 1LTJB 1JM0A 2J5UA 3JCUE 4JQ0D 3IAOA 5CCHD 2Q3EA 5AVUB 3M9HA 3T97B 4JF7A 1BGYE 1SQPE 2IFMA 1QGKB 1YQ4C 3HE4A 5L8RJ 1A02J 1OW8A 1JCDA 1U57A 1NU1E 2BCCJ 3CWBE 3JC22 4ASWA 3HUSC 2WSCH 2R5BA 5CCGA 1RE4A 1YJWP 4I6MC 2ZYAA 2IBZI 1QVGO 4O9BA 2WVRA 3AE6C 1RE3A 1MZ9A 3V4QA 2O3JA 2FYNB 1NTZG 1MV8A 2KZJA 2WWWA 5TJHA 2JDIH 2YXQB 2J58A 2FYUG 2KIKA 4XE5B 3TK1A 2OYIA 3PRJA 5KJ7A 4UB6H 1LNQA 1VQ8P 2JP3A 3L74J 4TT3H 1OFCX 4R4MA 4W80A 2M3BA 3BCCG 5DJUB 3FWNA 4EIJA 1H89A 1DEBA 1N73A 2K9YA 1YBKA 3H1IJ 5AW1B 2CPSA 1PP9E 3MIWA 2E74B 2P58A 1S9KE 4UB6E 1AJYA 4HYTB 1GTWA 4OWFA 2WITA 2I8DA 3BRVB 5CJ4A 1EZVI 5GTHH 3L4FA 3N4XA 3ZDMA 2NPSB 1LTTC 2A06E 4QMAA 2GM4A 1BE3J 1P84I 5AW2B 1LP1A 1LWUC 2OTLP 2G3AA 4W7YA 1X0TA 5KKZB 3H1JG 1Q86Q 2E5YA 3V6IA 3AEAC 1SQXE 3RK3E 4L76A 3H1LD 1SS1A 1L0NJ 1MFZA 3L74D 5KJ7C 4H44C 2YKQA 3WUTA 1X9VA 2ZXXA 2YO3A 2XV5A 3HD7D 2K9JA 3CX5E 1SQBG 3EFFK 3O6QA 1NKNA 1W5CE 4H0LB 4R4LA 3TNUA 3CI9A 3HD7B 4IFMA 3I5CA 1PZQA 1JY3P 2DW3A 3C9IA 3H6PA 3L71E 4JYBA 1HTLC 5AVRB 1CZQA 2FXPA 2K1AA 3L71J 2H8PD 2ZT9D 1JEKA 3L72D 2A45H 2A45G 3A2AA 4PD4I 4W7ZA 3V5BA 3VP9A 4OGQB 5AVQB 3KZIE 2ZT9B 3GMAA 1OVRA 2WPVB 2E75B 1QL2A 4WBAA 1USDA 2I1KA 2XU6A 2YMYA 4JYCA 3RGUA 3H1LJ 1OXZA 1NGMB 1L4AB 3U1CA 2Y9ZA 1VQ9P 4WY4D 4AYCA 2KP8A 3LW5H 1JNMA 1OMIA 3IF4A 2A06G 2WSCJ 2ITAA 2AXTH 2B87A 1RF1A 4N78D 1N73C 2POHA 1KFNA 1DD4A 5H2FH 2FXMA 2R5DA 1NTZJ 5CCHA 2K88A 2KXPB 4HKZH 1URQC 2XNXA 2GUSA 3H1KJ 1IC2A 3M0DA 1N7LA 1VF5D 4YTPC 4DT0A 3H1KE 4DJGA 1YITP 4H13D 4PD4E 1BDDA 3D70A 2M5AA 1L0LD 2N1TC 1S4XA 3BRTB 1G1IA 1SQBE 2OTKE 3GHGA 3NTNA 3R4YA 1RE4C 1NTMK 2W6AA 4EI2A 4Y99C 5BU8B 1VDFA 1BGYD 3GG2A 3B8EB 3VN0A 2H89C 2QJKB 1RY3A 1SFCD 2WPSA 1SQPG 2P1JA 2WSSH 3L73D 3CLQA 4NPDA 2HPCA 1YJNP 3MP7B 4D6TG 5KAFH 1HBWA 1GK4A 1AQTA 3V4WA 5GTIE 2YKPA 3Q5SA 2PFXA 1KILC 3EFGA 1IFMA 1LTSC 1EZVG 1NTZD 1H0TA 3G6EP 4M3LA 3CXHI 5KLIB 1RF1C 3H1JJ 3CCQP 1PV3A 1T3JA 1EZVE 1N7SB 3CC2P 1VQNP 4PJ0H 2W6BA 1L0NG 1GW3A 3AECC 1BGYJ 1HF9A 3V2NA 3CC7P 1JOCA 5TISH 1KB9H 1MFTA 1L0NE 3BCCE 1VQ7P 1SFCC 2OTJP 1AVOA 1BCCJ 2W27A 2P67A 1FZEA 4H13B 3EQ2A 1NOHA 2W90A 1PGOA 3A5TA 3VP8A 1OX3A 2OYHC 4MN4C 1FZGA 1CW5A 2QJYC 1JO5A 3L70J 2KNCB 1FOSE 2I1JA 2C9NY 1SQXG 1ZP0C 1LT9B 3S9OA 2JKVA 1IJDB 1FU1A 1NH4A 3HTKA 1R5SA 2OGUA 1GL2B 1JTHA 2OYOA 2M8RA 3H1LG 3W67A 1NTKG 3RK3D 3CCMP 3CCVP 3LW5J 1PGPA 2YKOA 1YYCA 2WT7A 1AA0A 3RL0B 1WRGA 2AEMA 1DH3A 1FDIA 1LWUA 4YPCA 1G2CA 4OGQD 2D2CB 1VQKP 2SPZA 3JSVC 5AVYB 3H1KG 3B5NB 3L71D 4PJ0E 1RHZB 3V2RA 1KQSO 2CPBA 3G3ZA 3CC4P 2L5GB 2NRGA 5EFWB 4WY4B 1YQ3C 5CHXA 3RBZA 2E76C 3H1JD 1JMBA 3TGUE 1VPCA 2E74C 2ZVOB 1SQBK 3CXHE 1UIIA 1E79H 1SQVD 2A45I 4WB4A 4GODA 4Y28J 1FBMA 1Q82Q 1FE6A 1VQPP 1SQPJ 3MHVA 4B86A 2ZXEB 3Q1MA 1HVVA 1P84D 2QVAA 4D6TJ 2RMZA 1KYOH 2KB7P 3TGUD 2J59M 4WWIA 2B88A 4WY4A 5KKZC 3C1LA 1GD2E 3D6ZA 2FXOA 2Q6QA 2Q7CA 3A0HH 1RE3C 1MUUA 3S4RA 2IYPA 1JY2O 1NTKK 2ZYDA 1T6AA 2OARA 4H0LC 1KD1Q 4N6JA 2QRXA 4ZNCA 1OW6A 1YHQP 1FZCA 2WT7B 3HUSB 1KB9E 1BGYG 5CBOA 1L0LG 4AQRD 2Y0CA 1ZXGA 1QX8A 4I7ZC 1YTZI 3M9BA 4LGDE 1DX7A 1JTHB 1SVFA 2BEQD 2XKMA 1BCCG 4LC1A 3WUUA 1H88A 4OGQC 1K73Q 4IL6H 5KAIH 3HUSA 2OYHA 1X8YA 1S9KD 5KAIE 3A7OA 2Q5UA 2YIUB 3CCEP 1NHLA 3CWBD 3L70G 4IOIH 1QL1A 3H1HD 1K9MQ 1IO4A 1SQXJ 5APXA 3FXDA 1TU3F 4YXWH 4JBZA 1T3UA 1M1JA 1NTKE 3PJSK 1OZHA 4RKUJ 1M7LA 5AW7B 3RK2C 2NPSD 1NTKJ 3QH9A 1NTMD 2FFDC 4EYYQ 1W2EA 2HLOA 1VF5B 1SQQD 5KLVG 4YXDC 3QWOC 3A0HE 3OJAB 3H1IE 1ZV8A 1PPJE 1RQUA 3P8CE 1H0TB 5E79E 2IPPA 1BCCD 2C9LY 3OW2O 1PPJG 2E43A 1PP9D 2ZYGA 4IFDK 1M57D 3IFMA 5CBNA 3CX5H 1DEEG 3A0BH 3B5NA 1LTAC 5AVVB 2HPCB 3IR9A 4IL6X 4C7RA 2H7HA 1G2CB 1WMKA 2QSIA 3AE2C 4KJMA 3CX5I 4PD4D 1PGJA 2WQYC 1SQBD 3KHUA 4RJTA 2OYIC 3IN6A 1HWTC 3SWKA 1LGHB 4GDOA 2M0BA 3GHGB 4RESB 1FZCB 1KMIZ 1KQLA 2M5AB 1J1EB 1FJPA 2IFNA 2JWDA 1NVOA 5AVTB 1ZRTE 2BCCE 3CWBJ 1NWQA 3TYYA 2E75C 3SSUA 3PP5A 3CCRP 1L4AC 3USSA 1RQVA 3BATA 1J1DB 1FZAA 2B87B 2XDJA 3D6YA 4H13C 3Q3DA 1L0LJ 1HUCA 2P2UA 2QJPC 2ZVNB 3E1IA 2OYHB 1YJ9P 1JY2N 1L4AA 1KFMA 1KYOE 2H88C 3L72E 2NZ2A 3L75G 5APSA 5AW3B 5KLVE 1GK6A 3Q5PA 1FS0E 2R32A 1W2BO 4PD4H 4CPGA 1EDIA 2JR8A 1T2KD 2RH0A 4GIFA 1SLQA 2M3EA 3BCCD 3S1KA 2E76D 2UWJE 3G9RA 3VMAA 3WMM0 1FDOA 3MGNA 2HYNA 3N7NA 2PRRA 5APTA 3A3YB 1EXJA 3B4SA 2V4HA 3L35A 3D71A 1GU4A 3JCUH 1KC8Q 3HD7A 1ZOYC 2K3RA 2LXBA 1KQFB 4RO0A 1BE3D 1VQLP 1HH0A 1KTMA 2K9JB 2WSEH 4U3FE 5CJ0A 4K3AA 1KB9D 1NU1K 1PGQA 5KLVJ 2V7QH 2QG4A 3KPEA 2FYUK 3AEGC 3UIAA 3VTPC 3CD6P 2R3SA 4DCKA 1N7SD 2KLVA 1LTBC 1NKZB 1EQ7A 3L75D 4BWNA 2N9YB 5B66H 1LTGC 4OH8B 3C8VA 4ZKPA 4H44D 4IL6E 1KN7A 1OIPA 2FYZA 1KV4A 1SQXD 3A0BE 1E5WA 1LTIC 1RF0C 4ZKUA 1BDCA 1BSNA 3I55P 1M1JB 1UIXA 2QA4P
chains in the Genus database with same CATH topology
1XTGB 2XZRA 5AW8B 1FZBA 5BU5A 1IFNA 1LWUB 1N73B 5APYA 1SQPK 3KDPB 1ZN5A 1GL2D 2WPQA 1GL2A 5AW4B 2OYIB 1NAFA 3B5ND 1KILD 1LT9A 2JJLA 4KHXA 1CSBA 1KZUB 3BVHA 5KLVK 3NMDA 3TNUB 3HE4B 5AW6B 2Z4EA 3CL3D 3U1AA 3OA7A 2VRSA 2N9BA 2YO2A 2N1TD 4WY4C 5APQA 3V2QA 3V4QA 3TSIA 2R3CA 1N7SA 1IFJA 2KSJA 4EOTA 4HH2A 4IFDK 3NXSA 3O8ZA 1L0LK 3RK3C 2WPRA 3HRNA 2GUVA 4DOJA 3VYIA 3L37A 3M0AA 5KJ7D 4AUWA 4LLHA 1FAVA 1PFIA 3HTKB 2QM7A 1J1EC 4C46A 3SWFA 3HD7C 1IFDA 3BASA 1IFIA 1FOSF 1NO4A 2KYVA 3SWYA 1RF1B 3VMXA 2Q3IA 3HE5A 3B5NC 1YTZT 1IK9A 2BASA 2FFDB 2WTYA 5BVZA 1NTZK 1N7SC 3OAKA 1FDMA 2QM8A 3NFQA 1Z56A 2NPSC 3RK2D 2C0WA 1SP4A 1URQD 1CI6A 1FZFA 1JY3O 5APWA 1LTJC 3P8MC 1N86A 5AVWB 1LT9C 2KOGA 2N1TA 2O01H 4N3YB 2C0XA 3M0DC 3M06A 1URQA 3LIEA 3RL0C 2WSFH 5CCHC 1L0NK 1GU5A 3MD0A 1WT6A 5AW0B 5APUA 4DZOA 1SFCB 2FKWB 2LKMA 1JUNA 3P7KA 2O1JA 4C7NB 3U59A 2IX7C 1L4AD 2WZ7A 3L36A 2Q9IA 1URQB 3M91A 2HODA 2HG5D 3T97A 3M9QA 2PP6A 1GL2C 1JY2P 1GZLA 3H32B 1LTJA 1ZR2A 3MUDA 4Y99B 1GW4A 5AVZB 2ZFCA 2NPSA 3P8CD 3H32A 2YNYA 4GT1A 1SQQK 1JMMA 1RF0A 2HODB 3VOPA 4N78E 3RK3B 1H8AA 2JEEA 5KTBA 4XA4A 4C7NA 2MJZA 1T8ZA 1JY3N 1JCCA 1SFCA 3RK2B 2HFED 5AVSB 3KYQA 2OYIC 3HE5B 3V2PA 3KQGA 5APVA 3II6A 5CCGC 1OWAA 2H43A 1T2KC 1FZCC 1AQ5A 1A02F 5AW5B 1ZLLA 4IFFA 2N1TB 1ZR4A 1HGZA 3VMYA 1G1JA 1FJKA 3MTUE 4I2LC 5AVXB 3LIDA 1CI6B 4GKGA 1X79B 1XTCC 5AW9B 3VMZA 3GHGC 2P7JA 2Z5IA 1HJBA 5CMZA 2O1KA 1KILB 1KILA 4I1LA 1M1JC 3RL0D 1SQVK 3P32A 1J1DC 1SQXK 5CCGD 1AFOA 1J2JB 2Z5HA 2FFDA 1N2DC 3R2PA 2PAJA 1LTJB 5CCHD 5AVUB 3M9HA 4JF7A 2IFMA 3HE4A 1A02J 1JCDA 3HUSC 2WSCH 2R5BA 5CCGA 1RE4A 4I6MC 4O9BA 1RE3A 1MZ9A 2WWWA 1MV8A 2J58A 4XE5B 3TK1A 2OYIA 5KJ7A 4W80A 2M3BA 4EIJA 1H89A 1DEBA 1N73A 5AW1B 2CPSA 3MIWA 4HYTB 1GTWA 2WITA 3BRVB 5CJ4A 3L4FA 3N4XA 2NPSB 1LTTC 2GM4A 5AW2B 1LWUC 4W7YA 1MFZA 5KJ7C 2YKQA 1X9VA 2YO3A 2XV5A 3HD7D 1S9KE 3TNUA 1NKNA 3CI9A 3HD7B 4IFMA 3I5CA 1JY3P 4JYBA 3C9IA 3H6PA 1HTLC 5AVRB 1CZQA 2H8PD 4W7ZA 2A45H 2A45G 3A2AA 3VP9A 3V5BA 5AVQB 1QL2A 4WBAA 2YMYA 2I1KA 2XU6A 4JYCA 1OXZA 1L4AB 3U1CA 4WY4D 4AYCA 2KP8A 3LW5H 1JNMA 1N73C 1RF1A 4N78D 2POHA 1KFNA 2FXMA 2R5DA 5CCHA 1URQC 2XNXA 2GUSA 3M0DA 1IC2A 1N7LA 2N1TC 3BRTB 1G1IA 3GHGA 3NTNA 1RE4C 1NTMK 2W6AA 4Y99C 5BU8B 1VDFA 3B8EB 3VN0A 1RY3A 1SFCD 2WPSA 2P1JA 2HPCA 1HWTC 3CLQA 1HBWA 1GK4A 3V4WA 2YKPA 1KILC 3EFGA 1IFMA 1LTSC 4M3LA 1RF1C 1T3JA 1N7SB 2W6BA 1GW3A 3V2NA 1JOCA 1SFCC 2W27A 2P67A 1FZEA 3EQ2A 1NOHA 3A5TA 2OYHC 3VP8A 1CW5A 1FZGA 1JO5A 1FOSE 2I1JA 2C9NY 1LT9B 3HTKA 1IJDB 1FU1A 1NH4A 1GDTA 1GL2B 1JTHA 2E42A 2M8RA 3RK3D 2YKOA 1YYCA 2WT7A 3RL0B 1WRGA 1DH3A 1LWUA 1G2CA 5AVYB 3V2RA 3B5NB 2CPBA 3G3ZA 2L5GB 4WY4B 5CHXA 1VPCA 1SQBK 4WB4A 2A45I 1FBMA 4B86A 2ZXEB 1HVVA 2KB7P 2J59M 4WY4A 1GD2E 2Q7CA 1RE3C 1MUUA 1JY2O 1NTKK 2OARA 4N6JA 2WT7B 3HUSB 1DX7A 4AQRD 4LGDE 1YTZI 3M9BA 1JTHB 1SVFA 2XKMA 4LC1A 1H88A 3HUSA 2OYHA 1X8YA 1S9KD 3A7OA 2Q5UA 1NHLA 1IO4A 1QL1A 5APXA 1T3UA 1M1JA 2H7HA 3RK2C 1M7LA 5AW7B 2FFDC 2NPSD 1W2EA 2HLOA 3OJAB 1ZV8A 3P8CE 2IPPA 2C9LY 2E43A 3IFMA 3B5NA 1LTAC 5AVVB 2HPCB 3IR9A 4C7RA 1G2CB 1LGHB 1FZCB 3GHGB 4RESB 1KQLA 1J1EB 1FJPA 2IFNA 5AVTB 3TYYA 3PP5A 1L4AC 3BATA 1J1DB 1FZAA 2XDJA 2P2UA 1HUCA 3E1IA 2OYHB 1JY2N 1L4AA 1KFMA 1NWQA 5APSA 5AW3B 1GK6A 2R32A 1T2KD 4GIFA 1SLQA 1FZCA 3WMM0 3MGNA 2HYNA 3N7NA 5APTA 3A3YB 3L35A 1GU4A 3HD7A 1HH0A 2WSEH 5CJ0A 1NU1K 3KPEA 2FYUK 3UIAA 3VTPC 1N7SD 2KLVA 1LTBC 1NKZB 1EQ7A 1LTGC 4OH8B 4ZKPA 2FYZA 1E5WA 1LTIC 1RF0C 4ZKUA 1M1JB 1HGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A45 I;  2OYH A;  2OYH C;  1N73 C;  1FZC A;  2FFD A;  2A45 H;  2A45 G;  1FZG A;  1LTJ B;  3H32 A;  1RF0 A;  2HPC A;  2HOD B;  1FZB A;  1N73 B;  1LWU B;  1LT9 B;  1FZC B;  3GHG B;  1FZF A;  1JY3 O;  1RF1 B;  1T3U A;  1M1J A;  2FFD C;  1LTJ C;  2Q9I A;  1N86 A;  1W2E A;  3HUS C;  2OYI B;  2HLO A;  1LWU C;  1LT9 C;  1RE3 C;  1RE4 A;  2HOD A;  3GHG C;  1RF1 A;  1JY2 O;  2H43 A;  1RF1 C;  1LT9 A;  1JY3 N;  1LWU A;  1RE3 A;  2FFD B;  1JY2 P;  3H32 B;  1LTJ A;  1FZA A;  2XNX A;  3HUS B;  3BVH A;  2OYI A;  1M1J C;  2OYI C;  3E1I A;  2OYH B;  1JY2 N;  2Z4E A;  1RF0 C;  3GHG A;  1RE4 C;  1JY3 P;  1N73 A;  1M1J B;  3HUS A;  2HPC B;  1FZC C;  1FZE A; 
#chains in the Genus database with same CATH topology
 3AE1 C;  1XTG B;  1GMJ A;  1NTM J;  2XZR A;  1GU5 A;  1S5L H;  2ZJS E;  5AVS B;  3H1J E;  5AW8 B;  1AVY A;  1FZB A;  5BU5 A;  1IFN A;  1LWU B;  1N73 B;  5E79 H;  5APY A;  1SQP K;  3F5H A;  3KDP B;  1SQQ G;  1GL2 D;  1ZN5 A;  2QJY B;  3CXH H;  1RH5 B;  2WPQ A;  4OVN F;  5GTH E;  1GL2 A;  2KUB A;  2Q1K A;  3CWB G;  1NAF A;  1NYH A;  3L70 D;  3B5N D;  5AW4 B;  3CPW O;  2OYI B;  2FYU D;  1KIL D;  1LT9 A;  1Q90 D;  1KOR A;  2JJL A;  3ITK A;  4KHX A;  4K35 A;  1CSB A;  2KLU A;  1KZU B;  3PTZ A;  3BVH A;  4GOF A;  1Y47 A;  5KLV K;  1VQ6 P;  1U7J A;  2KK7 A;  1D7M A;  3NMD A;  2E5T A;  3L75 J;  4PV1 B;  1M8O B;  3TNU B;  3HE4 B;  5AW6 B;  3PHL A;  4D6T E;  3O6Q B;  2Z4E A;  1Y9B A;  3CL3 D;  3U1A A;  3OA7 A;  2VRS A;  4H44 B;  2P10 A;  3KXD A;  3W68 A;  2N9B A;  2YO2 A;  2N1T D;  1M56 D;  1HJ0 A;  1L0L E;  4WY4 C;  1KQG B;  5APQ A;  1QEX A;  3TSI A;  2R3C A;  1N7S A;  1IFJ A;  3V2Q A;  2B9B A;  1LP1 B;  4BXL A;  1VF5 C;  2W83 C;  2IBZ D;  2KSJ A;  3L73 G;  1NU1 G;  5DJT B;  4Z1M H;  4EOT A;  1LT1 A;  1P84 H;  2WSE J;  4HH2 A;  5C39 A;  5H2F E;  1IK7 A;  2KS1 B;  3H1L E;  2ZT9 C;  3L73 E;  3NXS A;  3G71 P;  1FZF A;  3O8Z A;  1L0L K;  2IDB A;  2QIW A;  2V7Q J;  3TF5 A;  1VQ5 P;  3RK3 C;  1KYO D;  2O01 N;  3GF3 A;  2WPR A;  2RKL A;  2IZ1 A;  2GUV A;  3HRN A;  1YIJ P;  3Q2Y A;  4L73 A;  4DOJ A;  3VYI A;  4WVZ A;  3L37 A;  3M0A A;  3RBX A;  5KJ7 D;  1KB9 I;  4UB8 H;  1IFP A;  2LXC B;  3AE8 C;  4GOE A;  4LLH A;  4AUW A;  1FAV A;  3TGU G;  3AEB C;  2Y0D A;  4KT0 J;  1PFI A;  3HTK B;  3CCS P;  2OQQ A;  1J1E C;  2QM7 A;  1NTM G;  1DD3 A;  4C46 A;  3SWF A;  3CCL P;  2KNC A;  2AEJ A;  2AXC A;  3HD7 C;  1IFD A;  3BAS A;  1IFI A;  1FOS F;  1NAY A;  1NO4 A;  2KYV A;  3GF7 A;  3SWY A;  1RF1 B;  1SQQ J;  1HGV A;  3VMX A;  2Q3I A;  3AED C;  3HE5 A;  4XFJ A;  3B5N C;  1S2E A;  5GTI H;  1YTZ T;  2W8Z A;  1AFO A;  1IK9 A;  1K04 A;  2BAS A;  2FFD B;  2CK3 H;  2K37 A;  3AE3 C;  3E7K A;  2WTY A;  2BCC D;  2R44 A;  5BVZ A;  3FGA D;  1K05 A;  2AEF A;  1NTZ K;  1N7S C;  5TIS E;  3OAK A;  1FDM A;  3L74 E;  2QM8 A;  1LJ2 A;  1PP9 G;  1OVU A;  3NFQ A;  2E42 A;  4JPZ B;  1SQP D;  1Z56 A;  1OW7 A;  3CX5 D;  4BRY B;  2NPS C;  1S5L X;  3RK2 D;  3ABV C;  2C0W A;  2RN0 A;  3SFE C;  2Y9Y A;  3B71 A;  3CXH D;  4UB8 E;  3CCU P;  1URQ D;  1Q2N A;  1R5L A;  1SP4 A;  1CI6 A;  1JY3 O;  1KIL E;  1NU1 J;  2QE7 H;  3L73 J;  3H1I D;  1EZV D;  3MUD C;  2QJK C;  1LTJ C;  3P8M C;  5APW A;  1N86 A;  5AVW B;  3TDK A;  5B5E E;  1LT9 C;  1PL5 A;  2KOG A;  1N8R Q;  1L0N D;  1BE3 E;  2N1T A;  1EC5 A;  1ZW0 A;  4U3F D;  2O01 H;  4N3Y B;  3H25 A;  3MZW B;  1S72 P;  2C0X A;  3M0D C;  3M06 A;  1S5L E;  1URQ A;  3AE5 C;  3LIE A;  3RL0 C;  1EDK A;  2WSF H;  5CCH C;  1BSH A;  1L0N K;  2FYN C;  2IZ0 A;  2D2C C;  2GA1 A;  2G8Y A;  2KZI A;  1USE A;  3L72 G;  3L75 E;  3MD0 A;  4L74 A;  2MKV A;  1WT6 A;  3TGU J;  5AW0 B;  1GDT A;  5APU A;  1QLE D;  4DZO A;  4A7P A;  1SFC B;  1KYO I;  2FKW B;  2LKM A;  1VL2 A;  2A06 D;  1JUN A;  3P7K A;  1U7M A;  3CME P;  4NPF X;  3AE7 C;  2O1J A;  4C7N B;  3U59 A;  3H1H G;  3I56 P;  2IX7 C;  1L4A D;  2WZ7 A;  2AXT E;  3L36 A;  5K5G B;  2Q9I A;  1EXI A;  2WMM A;  3AEE C;  3H1H E;  1URQ B;  2E75 D;  5B5E H;  3M91 A;  2HOD A;  4U3F G;  2B89 A;  3RL0 g;  2HG5 D;  3T97 A;  2PGD A;  3M9Q A;  1K8A Q;  2PP6 A;  1GL2 C;  2ZAE B;  1JY2 P;  1GZL A;  1NU1 D;  1PIX A;  1NTM E;  1LTJ A;  3H32 B;  5KLV D;  5M1B A;  1SQV J;  3L70 E;  1ZR2 A;  3MUD A;  4Y99 B;  1SQQ E;  1NTZ E;  2QEX P;  1R8E A;  1SQV E;  1Q81 Q;  1GW4 A;  5AVZ B;  1FC2 C;  3GLM A;  5KAF E;  1NJI Q;  1OVV A;  2ZFC A;  1PPJ D;  2NPS A;  3P8C D;  3PLN A;  4ASV A;  1BCC E;  1PP9 J;  4I7Z B;  3H32 A;  4ZMD A;  2YNY A;  4GT1 A;  2YXR B;  2Y0E A;  4BRY A;  4D6T D;  1SQQ K;  1JMM A;  1RF0 A;  2E76 B;  2HOD B;  4EDF A;  3VOP A;  4N78 E;  1S3J A;  5KLI C;  3RK3 B;  1H8A A;  2JEE A;  5KTB A;  2LR2 A;  4XA4 A;  2FBW C;  4TLF A;  2BCC G;  1X22 A;  2FY8 A;  4C7N A;  3AEF C;  4HJG H;  1JB0 J;  2XND H;  2MJZ A;  1T8Z A;  3KZI H;  1JY3 N;  2BEZ F;  1JCC A;  1SFC A;  2JO1 A;  2O01 J;  3RK2 B;  1VQO P;  2KSE A;  2HFE D;  1EDJ A;  2FYU J;  1ZRT D;  3E1R A;  2W6J H;  3FXE A;  3HE5 B;  3KYQ A;  1S1C X;  3KQG A;  1IZN B;  2L91 A;  3FWL A;  2WSF J;  3V2P A;  3SFD C;  5B66 E;  3L74 G;  2HR3 A;  2IYO A;  4NPE A;  3FX0 A;  5APV A;  3II6 A;  1L2P A;  3BCC J;  4L75 A;  3L72 J;  3CCJ P;  1QVF O;  5CCG C;  1YI2 P;  1OWA A;  2H43 A;  1T2K C;  1M1K Q;  1FZC C;  1AQ5 A;  1A02 F;  3H1I G;  5AW5 B;  4PV1 C;  1NTK D;  1ZLL A;  4IFF A;  2N1T B;  2JWA A;  1EDL A;  1ZR4 A;  1HGZ A;  3VMY A;  1G1J A;  1FJK A;  3MTU E;  4I2L C;  3G4S P;  5AVX B;  3AE9 C;  2FYU E;  3H1H J;  3LID A;  3WU2 E;  2YIU C;  4H0L D;  1CI6 B;  4GKG A;  2YMK A;  3WU2 H;  1BE3 G;  1X79 B;  1XTC C;  4U7J A;  5AW9 B;  1P84 E;  4U3F J;  3VMZ A;  3CMA P;  3GHG C;  2P7J A;  2Z5I A;  1Y8A A;  4HB1 A;  3WUV A;  3K5B A;  1M90 Q;  1HJB A;  1AV1 A;  2IBZ G;  5CMZ A;  2D2C D;  1Q7Y Q;  2O1K A;  1KIL B;  1KIL A;  4I1L A;  2KI7 B;  3AE4 C;  1SQV G;  3GW6 A;  1ZME C;  1M1J C;  3RL0 D;  3Q5R A;  2KS1 A;  1SQB J;  1VQM P;  1SQV K;  1DIP A;  3EWK A;  4PV1 D;  3P32 A;  1J1D C;  1SQX K;  2QJP B;  5CCG D;  2E74 D;  1J2J B;  2IBZ E;  2Z5H A;  3H1K D;  3L71 G;  1N2D C;  2FFD A;  3R2P A;  2PAJ A;  3PH0 A;  3F89 A;  1VQ4 P;  1MKM A;  1LTJ B;  1JM0 A;  2J5U A;  3JCU E;  4JQ0 D;  3IAO A;  5CCH D;  2Q3E A;  5AVU B;  3M9H A;  3T97 B;  4JF7 A;  1BGY E;  1SQP E;  2IFM A;  1QGK B;  1YQ4 C;  3HE4 A;  5L8R J;  1A02 J;  1OW8 A;  1JCD A;  1U57 A;  1NU1 E;  2BCC J;  3CWB E;  3JC2 2;  4ASW A;  3HUS C;  2WSC H;  2R5B A;  5CCG A;  1RE4 A;  1YJW P;  4I6M C;  2ZYA A;  2IBZ I;  1QVG O;  4O9B A;  2WVR A;  3AE6 C;  1RE3 A;  1MZ9 A;  3V4Q A;  2O3J A;  2FYN B;  1NTZ G;  1MV8 A;  2KZJ A;  2WWW A;  5TJH A;  2JDI H;  2YXQ B;  2J58 A;  2FYU G;  2KIK A;  4XE5 B;  3TK1 A;  2OYI A;  3PRJ A;  5KJ7 A;  4UB6 H;  1LNQ A;  1VQ8 P;  2JP3 A;  3L74 J;  4TT3 H;  1OFC X;  4R4M A;  4W80 A;  2M3B A;  3BCC G;  5DJU B;  3FWN A;  4EIJ A;  1H89 A;  1DEB A;  1N73 A;  2K9Y A;  1YBK A;  3H1I J;  5AW1 B;  2CPS A;  1PP9 E;  3MIW A;  2E74 B;  2P58 A;  1S9K E;  4UB6 E;  1AJY A;  4HYT B;  1GTW A;  4OWF A;  2WIT A;  2I8D A;  3BRV B;  5CJ4 A;  1EZV I;  5GTH H;  3L4F A;  3N4X A;  3ZDM A;  2NPS B;  1LTT C;  2A06 E;  4QMA A;  2GM4 A;  1BE3 J;  1P84 I;  5AW2 B;  1LP1 A;  1LWU C;  2OTL P;  2G3A A;  4W7Y A;  1X0T A;  5KKZ B;  3H1J G;  1Q86 Q;  2E5Y A;  3V6I A;  3AEA C;  1SQX E;  3RK3 E;  4L76 A;  3H1L D;  1SS1 A;  1L0N J;  1MFZ A;  3L74 D;  5KJ7 C;  4H44 C;  2YKQ A;  3WUT A;  1X9V A;  2ZXX A;  2YO3 A;  2XV5 A;  3HD7 D;  2K9J A;  3CX5 E;  1SQB G;  3EFF K;  3O6Q A;  1NKN A;  1W5C E;  4H0L B;  4R4L A;  3TNU A;  3CI9 A;  3HD7 B;  4IFM A;  3I5C A;  1PZQ A;  1JY3 P;  2DW3 A;  3C9I A;  3H6P A;  3L71 E;  4JYB A;  1HTL C;  5AVR B;  1CZQ A;  2FXP A;  2K1A A;  3L71 J;  2H8P D;  2ZT9 D;  1JEK A;  3L72 D;  2A45 H;  2A45 G;  3A2A A;  4PD4 I;  4W7Z A;  3V5B A;  3VP9 A;  4OGQ B;  5AVQ B;  3KZI E;  2ZT9 B;  3GMA A;  1OVR A;  2WPV B;  2E75 B;  1QL2 A;  4WBA A;  1USD A;  2I1K A;  2XU6 A;  2YMY A;  4JYC A;  3RGU A;  3H1L J;  1OXZ A;  1NGM B;  1L4A B;  3U1C A;  2Y9Z A;  1VQ9 P;  4WY4 D;  4AYC A;  2KP8 A;  3LW5 H;  1JNM A;  1OMI A;  3IF4 A;  2A06 G;  2WSC J;  2ITA A;  2AXT H;  2B87 A;  1RF1 A;  4N78 D;  1N73 C;  2POH A;  1KFN A;  1DD4 A;  5H2F H;  2FXM A;  2R5D A;  1NTZ J;  5CCH A;  2K88 A;  2KXP B;  4HKZ H;  1URQ C;  2XNX A;  2GUS A;  3H1K J;  1IC2 A;  3M0D A;  1N7L A;  1VF5 D;  4YTP C;  4DT0 A;  3H1K E;  4DJG A;  1YIT P;  4H13 D;  4PD4 E;  1BDD A;  3D70 A;  2M5A A;  1L0L D;  2N1T C;  1S4X A;  3BRT B;  1G1I A;  1SQB E;  2OTK E;  3GHG A;  3NTN A;  3R4Y A;  1RE4 C;  1NTM K;  2W6A A;  4EI2 A;  4Y99 C;  5BU8 B;  1VDF A;  1BGY D;  3GG2 A;  3B8E B;  3VN0 A;  2H89 C;  2QJK B;  1RY3 A;  1SFC D;  2WPS A;  1SQP G;  2P1J A;  2WSS H;  3L73 D;  3CLQ A;  4NPD A;  2HPC A;  1YJN P;  3MP7 B;  4D6T G;  5KAF H;  1HBW A;  1GK4 A;  1AQT A;  3V4W A;  5GTI E;  2YKP A;  3Q5S A;  2PFX A;  1KIL C;  3EFG A;  1IFM A;  1LTS C;  1EZV G;  1NTZ D;  1H0T A;  3G6E P;  4M3L A;  3CXH I;  5KLI B;  1RF1 C;  3H1J J;  3CCQ P;  1PV3 A;  1T3J A;  1EZV E;  1N7S B;  3CC2 P;  1VQN P;  4PJ0 H;  2W6B A;  1L0N G;  1GW3 A;  3AEC C;  1BGY J;  1HF9 A;  3V2N A;  3CC7 P;  1JOC A;  5TIS H;  1KB9 H;  1MFT A;  1L0N E;  3BCC E;  1VQ7 P;  1SFC C;  2OTJ P;  1AVO A;  1BCC J;  2W27 A;  2P67 A;  1FZE A;  4H13 B;  3EQ2 A;  1NOH A;  2W90 A;  1PGO A;  3A5T A;  3VP8 A;  1OX3 A;  2OYH C;  4MN4 C;  1FZG A;  1CW5 A;  2QJY C;  1JO5 A;  3L70 J;  2KNC B;  1FOS E;  2I1J A;  2C9N Y;  1SQX G;  1ZP0 C;  1LT9 B;  3S9O A;  2JKV A;  1IJD B;  1FU1 A;  1NH4 A;  3HTK A;  1R5S A;  2OGU A;  1GL2 B;  1JTH A;  2OYO A;  2M8R A;  3H1L G;  3W67 A;  1NTK G;  3RK3 D;  3CCM P;  3CCV P;  3LW5 J;  1PGP A;  2YKO A;  1YYC A;  2WT7 A;  1AA0 A;  3RL0 B;  1WRG A;  2AEM A;  1DH3 A;  1FDI A;  1LWU A;  4YPC A;  1G2C A;  4OGQ D;  2D2C B;  1VQK P;  2SPZ A;  3JSV C;  5AVY B;  3H1K G;  3B5N B;  3L71 D;  4PJ0 E;  1RHZ B;  3V2R A;  1KQS O;  2CPB A;  3G3Z A;  3CC4 P;  2L5G B;  2NRG A;  5EFW B;  4WY4 B;  1YQ3 C;  5CHX A;  3RBZ A;  2E76 C;  3H1J D;  1JMB A;  3TGU E;  1VPC A;  2E74 C;  2ZVO B;  1SQB K;  3CXH E;  1UII A;  1E79 H;  1SQV D;  2A45 I;  4WB4 A;  4GOD A;  4Y28 J;  1FBM A;  1Q82 Q;  1FE6 A;  1VQP P;  1SQP J;  3MHV A;  4B86 A;  2ZXE B;  3Q1M A;  1HVV A;  1P84 D;  2QVA A;  4D6T J;  2RMZ A;  1KYO H;  2KB7 P;  3TGU D;  2J59 M;  4WWI A;  2B88 A;  4WY4 A;  5KKZ C;  3C1L A;  1GD2 E;  3D6Z A;  2FXO A;  2Q6Q A;  2Q7C A;  3A0H H;  1RE3 C;  1MUU A;  3S4R A;  2IYP A;  1JY2 O;  1NTK K;  2ZYD A;  1T6A A;  2OAR A;  4H0L C;  1KD1 Q;  4N6J A;  2QRX A;  4ZNC A;  1OW6 A;  1YHQ P;  1FZC A;  2WT7 B;  3HUS B;  1KB9 E;  1BGY G;  5CBO A;  1L0L G;  4AQR D;  2Y0C A;  1ZXG A;  1QX8 A;  4I7Z C;  1YTZ I;  3M9B A;  4LGD E;  1DX7 A;  1JTH B;  1SVF A;  2BEQ D;  2XKM A;  1BCC G;  4LC1 A;  3WUU A;  1H88 A;  4OGQ C;  1K73 Q;  4IL6 H;  5KAI H;  3HUS A;  2OYH A;  1X8Y A;  1S9K D;  5KAI E;  3A7O A;  2Q5U A;  2YIU B;  3CCE P;  1NHL A;  3CWB D;  3L70 G;  4IOI H;  1QL1 A;  3H1H D;  1K9M Q;  1IO4 A;  1SQX J;  5APX A;  3FXD A;  1TU3 F;  4YXW H;  4JBZ A;  1T3U A;  1M1J A;  1NTK E;  3PJS K;  1OZH A;  4RKU J;  1M7L A;  5AW7 B;  3RK2 C;  2NPS D;  1NTK J;  3QH9 A;  1NTM D;  2FFD C;  4EYY Q;  1W2E A;  2HLO A;  1VF5 B;  1SQQ D;  5KLV G;  4YXD C;  3QWO C;  3A0H E;  3OJA B;  3H1I E;  1ZV8 A;  1PPJ E;  1RQU A;  3P8C E;  1H0T B;  5E79 E;  2IPP A;  1BCC D;  2C9L Y;  3OW2 O;  1PPJ G;  2E43 A;  1PP9 D;  2ZYG A;  4IFD K;  1M57 D;  3IFM A;  5CBN A;  3CX5 H;  1DEE G;  3A0B H;  3B5N A;  1LTA C;  5AVV B;  2HPC B;  3IR9 A;  4IL6 X;  4C7R A;  2H7H A;  1G2C B;  1WMK A;  2QSI A;  3AE2 C;  4KJM A;  3CX5 I;  4PD4 D;  1PGJ A;  2WQY C;  1SQB D;  3KHU A;  4RJT A;  2OYI C;  3IN6 A;  1HWT C;  3SWK A;  1LGH B;  4GDO A;  2M0B A;  3GHG B;  4RES B;  1FZC B;  1KMI Z;  1KQL A;  2M5A B;  1J1E B;  1FJP A;  2IFN A;  2JWD A;  1NVO A;  5AVT B;  1ZRT E;  2BCC E;  3CWB J;  1NWQ A;  3TYY A;  2E75 C;  3SSU A;  3PP5 A;  3CCR P;  1L4A C;  3USS A;  1RQV A;  3BAT A;  1J1D B;  1FZA A;  2B87 B;  2XDJ A;  3D6Y A;  4H13 C;  3Q3D A;  1L0L J;  1HUC A;  2P2U A;  2QJP C;  2ZVN B;  3E1I A;  2OYH B;  1YJ9 P;  1JY2 N;  1L4A A;  1KFM A;  1KYO E;  2H88 C;  3L72 E;  2NZ2 A;  3L75 G;  5APS A;  5AW3 B;  5KLV E;  1GK6 A;  3Q5P A;  1FS0 E;  2R32 A;  1W2B O;  4PD4 H;  4CPG A;  1EDI A;  2JR8 A;  1T2K D;  2RH0 A;  4GIF A;  1SLQ A;  2M3E A;  3BCC D;  3S1K A;  2E76 D;  2UWJ E;  3G9R A;  3VMA A;  3WMM 0;  1FDO A;  3MGN A;  2HYN A;  3N7N A;  2PRR A;  5APT A;  3A3Y B;  1EXJ A;  3B4S A;  2V4H A;  3L35 A;  3D71 A;  1GU4 A;  3JCU H;  1KC8 Q;  3HD7 A;  1ZOY C;  2K3R A;  2LXB A;  1KQF B;  4RO0 A;  1BE3 D;  1VQL P;  1HH0 A;  1KTM A;  2K9J B;  2WSE H;  4U3F E;  5CJ0 A;  4K3A A;  1KB9 D;  1NU1 K;  1PGQ A;  5KLV J;  2V7Q H;  2QG4 A;  3KPE A;  2FYU K;  3AEG C;  3UIA A;  3VTP C;  3CD6 P;  2R3S A;  4DCK A;  1N7S D;  2KLV A;  1LTB C;  1NKZ B;  1EQ7 A;  3L75 D;  4BWN A;  2N9Y B;  5B66 H;  1LTG C;  4OH8 B;  3C8V A;  4ZKP A;  4H44 D;  4IL6 E;  1KN7 A;  1OIP A;  2FYZ A;  1KV4 A;  1SQX D;  3A0B E;  1E5W A;  1LTI C;  1RF0 C;  4ZKU A;  1BDC A;  1BSN A;  3I55 P;  1M1J B;  1UIX A;  2QA4 P; 
#chains in the Genus database with same CATH homology
 1XTG B;  2XZR A;  5AW8 B;  1FZB A;  5BU5 A;  1IFN A;  1LWU B;  1N73 B;  5APY A;  1SQP K;  3KDP B;  1ZN5 A;  1GL2 D;  2WPQ A;  1GL2 A;  5AW4 B;  2OYI B;  1NAF A;  3B5N D;  1KIL D;  1LT9 A;  2JJL A;  4KHX A;  1CSB A;  1KZU B;  3BVH A;  5KLV K;  3NMD A;  3TNU B;  3HE4 B;  5AW6 B;  2Z4E A;  3CL3 D;  3U1A A;  3OA7 A;  2VRS A;  2N9B A;  2YO2 A;  2N1T D;  4WY4 C;  5APQ A;  3V2Q A;  3V4Q A;  3TSI A;  2R3C A;  1N7S A;  1IFJ A;  2KSJ A;  4EOT A;  4HH2 A;  4IFD K;  3NXS A;  3O8Z A;  1L0L K;  3RK3 C;  2WPR A;  3HRN A;  2GUV A;  4DOJ A;  3VYI A;  3L37 A;  3M0A A;  5KJ7 D;  4AUW A;  4LLH A;  1FAV A;  1PFI A;  3HTK B;  2QM7 A;  1J1E C;  4C46 A;  3SWF A;  3HD7 C;  1IFD A;  3BAS A;  1IFI A;  1FOS F;  1NO4 A;  2KYV A;  3SWY A;  1RF1 B;  3VMX A;  2Q3I A;  3HE5 A;  3B5N C;  1YTZ T;  1IK9 A;  2BAS A;  2FFD B;  2WTY A;  5BVZ A;  1NTZ K;  1N7S C;  3OAK A;  1FDM A;  2QM8 A;  3NFQ A;  1Z56 A;  2NPS C;  3RK2 D;  2C0W A;  1SP4 A;  1URQ D;  1CI6 A;  1FZF A;  1JY3 O;  5APW A;  1LTJ C;  3P8M C;  1N86 A;  5AVW B;  1LT9 C;  2KOG A;  2N1T A;  2O01 H;  4N3Y B;  2C0X A;  3M0D C;  3M06 A;  1URQ A;  3LIE A;  3RL0 C;  2WSF H;  5CCH C;  1L0N K;  1GU5 A;  3MD0 A;  1WT6 A;  5AW0 B;  5APU A;  4DZO A;  1SFC B;  2FKW B;  2LKM A;  1JUN A;  3P7K A;  2O1J A;  4C7N B;  3U59 A;  2IX7 C;  1L4A D;  2WZ7 A;  3L36 A;  2Q9I A;  1URQ B;  3M91 A;  2HOD A;  2HG5 D;  3T97 A;  3M9Q A;  2PP6 A;  1GL2 C;  1JY2 P;  1GZL A;  3H32 B;  1LTJ A;  1ZR2 A;  3MUD A;  4Y99 B;  1GW4 A;  5AVZ B;  2ZFC A;  2NPS A;  3P8C D;  3H32 A;  2YNY A;  4GT1 A;  1SQQ K;  1JMM A;  1RF0 A;  2HOD B;  3VOP A;  4N78 E;  3RK3 B;  1H8A A;  2JEE A;  5KTB A;  4XA4 A;  4C7N A;  2MJZ A;  1T8Z A;  1JY3 N;  1JCC A;  1SFC A;  3RK2 B;  2HFE D;  5AVS B;  3KYQ A;  2OYI C;  3HE5 B;  3V2P A;  3KQG A;  5APV A;  3II6 A;  5CCG C;  1OWA A;  2H43 A;  1T2K C;  1FZC C;  1AQ5 A;  1A02 F;  5AW5 B;  1ZLL A;  4IFF A;  2N1T B;  1ZR4 A;  1HGZ A;  3VMY A;  1G1J A;  1FJK A;  3MTU E;  4I2L C;  5AVX B;  3LID A;  1CI6 B;  4GKG A;  1X79 B;  1XTC C;  5AW9 B;  3VMZ A;  3GHG C;  2P7J A;  2Z5I A;  1HJB A;  5CMZ A;  2O1K A;  1KIL B;  1KIL A;  4I1L A;  1M1J C;  3RL0 D;  1SQV K;  3P32 A;  1J1D C;  1SQX K;  5CCG D;  1AFO A;  1J2J B;  2Z5H A;  2FFD A;  1N2D C;  3R2P A;  2PAJ A;  1LTJ B;  5CCH D;  5AVU B;  3M9H A;  4JF7 A;  2IFM A;  3HE4 A;  1A02 J;  1JCD A;  3HUS C;  2WSC H;  2R5B A;  5CCG A;  1RE4 A;  4I6M C;  4O9B A;  1RE3 A;  1MZ9 A;  2WWW A;  1MV8 A;  2J58 A;  4XE5 B;  3TK1 A;  2OYI A;  5KJ7 A;  4W80 A;  2M3B A;  4EIJ A;  1H89 A;  1DEB A;  1N73 A;  5AW1 B;  2CPS A;  3MIW A;  4HYT B;  1GTW A;  2WIT A;  3BRV B;  5CJ4 A;  3L4F A;  3N4X A;  2NPS B;  1LTT C;  2GM4 A;  5AW2 B;  1LWU C;  4W7Y A;  1MFZ A;  5KJ7 C;  2YKQ A;  1X9V A;  2YO3 A;  2XV5 A;  3HD7 D;  1S9K E;  3TNU A;  1NKN A;  3CI9 A;  3HD7 B;  4IFM A;  3I5C A;  1JY3 P;  4JYB A;  3C9I A;  3H6P A;  1HTL C;  5AVR B;  1CZQ A;  2H8P D;  4W7Z A;  2A45 H;  2A45 G;  3A2A A;  3VP9 A;  3V5B A;  5AVQ B;  1QL2 A;  4WBA A;  2YMY A;  2I1K A;  2XU6 A;  4JYC A;  1OXZ A;  1L4A B;  3U1C A;  4WY4 D;  4AYC A;  2KP8 A;  3LW5 H;  1JNM A;  1N73 C;  1RF1 A;  4N78 D;  2POH A;  1KFN A;  2FXM A;  2R5D A;  5CCH A;  1URQ C;  2XNX A;  2GUS A;  3M0D A;  1IC2 A;  1N7L A;  2N1T C;  3BRT B;  1G1I A;  3GHG A;  3NTN A;  1RE4 C;  1NTM K;  2W6A A;  4Y99 C;  5BU8 B;  1VDF A;  3B8E B;  3VN0 A;  1RY3 A;  1SFC D;  2WPS A;  2P1J A;  2HPC A;  1HWT C;  3CLQ A;  1HBW A;  1GK4 A;  3V4W A;  2YKP A;  1KIL C;  3EFG A;  1IFM A;  1LTS C;  4M3L A;  1RF1 C;  1T3J A;  1N7S B;  2W6B A;  1GW3 A;  3V2N A;  1JOC A;  1SFC C;  2W27 A;  2P67 A;  1FZE A;  3EQ2 A;  1NOH A;  3A5T A;  2OYH C;  3VP8 A;  1CW5 A;  1FZG A;  1JO5 A;  1FOS E;  2I1J A;  2C9N Y;  1LT9 B;  3HTK A;  1IJD B;  1FU1 A;  1NH4 A;  1GDT A;  1GL2 B;  1JTH A;  2E42 A;  2M8R A;  3RK3 D;  2YKO A;  1YYC A;  2WT7 A;  3RL0 B;  1WRG A;  1DH3 A;  1LWU A;  1G2C A;  5AVY B;  3V2R A;  3B5N B;  2CPB A;  3G3Z A;  2L5G B;  4WY4 B;  5CHX A;  1VPC A;  1SQB K;  4WB4 A;  2A45 I;  1FBM A;  4B86 A;  2ZXE B;  1HVV A;  2KB7 P;  2J59 M;  4WY4 A;  1GD2 E;  2Q7C A;  1RE3 C;  1MUU A;  1JY2 O;  1NTK K;  2OAR A;  4N6J A;  2WT7 B;  3HUS B;  1DX7 A;  4AQR D;  4LGD E;  1YTZ I;  3M9B A;  1JTH B;  1SVF A;  2XKM A;  4LC1 A;  1H88 A;  3HUS A;  2OYH A;  1X8Y A;  1S9K D;  3A7O A;  2Q5U A;  1NHL A;  1IO4 A;  1QL1 A;  5APX A;  1T3U A;  1M1J A;  2H7H A;  3RK2 C;  1M7L A;  5AW7 B;  2FFD C;  2NPS D;  1W2E A;  2HLO A;  3OJA B;  1ZV8 A;  3P8C E;  2IPP A;  2C9L Y;  2E43 A;  3IFM A;  3B5N A;  1LTA C;  5AVV B;  2HPC B;  3IR9 A;  4C7R A;  1G2C B;  1LGH B;  1FZC B;  3GHG B;  4RES B;  1KQL A;  1J1E B;  1FJP A;  2IFN A;  5AVT B;  3TYY A;  3PP5 A;  1L4A C;  3BAT A;  1J1D B;  1FZA A;  2XDJ A;  2P2U A;  1HUC A;  3E1I A;  2OYH B;  1JY2 N;  1L4A A;  1KFM A;  1NWQ A;  5APS A;  5AW3 B;  1GK6 A;  2R32 A;  1T2K D;  4GIF A;  1SLQ A;  1FZC A;  3WMM 0;  3MGN A;  2HYN A;  3N7N A;  5APT A;  3A3Y B;  3L35 A;  1GU4 A;  3HD7 A;  1HH0 A;  2WSE H;  5CJ0 A;  1NU1 K;  3KPE A;  2FYU K;  3UIA A;  3VTP C;  1N7S D;  2KLV A;  1LTB C;  1NKZ B;  1EQ7 A;  1LTG C;  4OH8 B;  4ZKP A;  2FYZ A;  1E5W A;  1LTI C;  1RF0 C;  4ZKU A;  1M1J B;  1HGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...