1X9VA

Dimeric structure of the c-terminal domain of vpr
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
45
structure length
45
Chain Sequence
DTWTGVEALIRILQQLLFIHFRIGCRHSRIGIIQQRRTRNGASKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords VPR protein
publication title The C-terminal domain of the HIV-1 regulatory protein Vpr adopts an antiparallel dimeric structure in solution via its leucine-zipper-like domain
pubmed doi rcsb
total genus 8
structure length 45
sequence length 45
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.90 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1x9vA00
1X9VA 1VPCA
chains in the Genus database with same CATH superfamily
3KHUA 3FXEA 2BCCD 5CCHD 3L72E 1FOSE 2WITA 1SQBD 2PAJA 1SQVJ 4IFDK 1FBMA 2D2CD 2CK3H 3GF7A 3BCCD 2N1TD 3RBZA 1VL2A 2JO1A 1L0ND 1P84D 2ZT9D 4I6MC 3VP8A 2Q3IA 3V2PA 2K1AA 1OW8A 2C0XA 1NO4A 3FX0A 3TSIA 4XFJA 3P7KA 3CCRP 1LTJA 2Z5IA 3A2AA 1GL2A 1NTKG 5B66H 3GW6A 4K3AA 1KB9E 1N7SB 2YIUB 1NVOA 3BATA 2ZJSE 4RKUJ 1N73B 2W8ZA 2W6JH 1FDOA 5CBNA 2WPQA 4DJGA 1NKNA 1LJ2A 2KOGA 1URQA 2C9NY 4ASVA 3H1KJ 3A0BH 1H0TB 5AVYB 3AE4C 4U7JA 3RL0g 4W7YA 1T8ZA 1N8RQ 1MZ9A 3B4SA 2W6BA 1GDTA 1A02F 4NPDA 1L0LK 4GKGA 1FZGA 2WMMA 1N7SC 1SLQA 3L74D 5APVA 4GODA 3B71A 2PFXA 3V2QA 3F5HA 1S72P 3V2RA 3PLNA 3EWKA 2V7QJ 1NTMK 2GUVA 2FYUG 3PH0A 4M3LA 1LP1B 1QGKB 1KFNA 5KLVJ 3CCMP 1YQ4C 4C7NA 1LT1A 2FBWC 1S3JA 4IFFA 5AW0B 3RK3B 1BDCA 4UB8H 2H88C 2QRXA 5H2FH 1IC2A 2ZVNB 3EFFK 1R5LA 3E7KA 5KAFE 1M90Q 1CI6B 2E74C 2M3BA 3H1IE 5APXA 1VQ8P 1RHZB 3MGNA 2BCCG 4OH8B 3WU2E 2E43A 2K9JA 1IZNB 1SQBG 3L4FA 1KILA 2ZXEB 2YO2A 3P32A 1EZVG 1DEEG 3BCCG 1YBKA 2B87B 3ZDMA 1L0NG 5GTHE 4I7ZB 3RK2B 2WPSA 3AE6C 3U1CA 1R5SA 2NPSA 1ZLLA 1SQQK 1SQXJ 3ABVC 3PRJA 2KSJA 2OYOA 2KB7P 1NTZG 3M0DA 1IK7A 5KAIE 5AVWB 3Q5PA 2OYHB 2JWDA 5CCGC 1YITP 3HE4B 5M1BA 1FS0E 4WBAA 3CWBJ 4PV1D 1J1EC 5AW3B 3H1LJ 4WB4A 1SFCB 3H1JE 2WVRA 2QJKC 1AJYA 3H1KD 3K5BA 3CXHE 1Q82Q 1J1DC 3TGUJ 2Q1KA 4ASWA 4H13B 2QJYB 4A7PA 2PP6A 1Y8AA 2N9YB 4I7ZC 3RK2C 5AW7B 1JMBA 3P8CD 3L75J 4W80A 3CLQA 3I5CA 1KYOE 2OTKE 2PGDA 1VF5D 5KKZC 3U59A 3S9OA 2OYHC 1H8AA 5KJ7D 4UB6E 1JY2P 1M8OB 2M5AA 1KFMA 4DZOA 2WPRA 3FGAD 2OGUA 3H32B 5BVZA 4PD4E 5GTIH 5KLIC 3KZIE 5KLVD 1EXIA 1JY3O 1ZOYC 4H13C 4IL6X 5BU5A 3M9BA 2Q5UA 2QJYC 2WT7A 1J2JB 2DW3A 1LT9A 1T2KD 3G6EP 3TNUB 1HUCA 1PGPA 3NFQA 2P67A 3MUDC 1RF1A 4WY4B 1NTMJ 1PP9E 3AEGC 1FAVA 2O01N 3RL0B 2XNDH 3CX5H 4ZKUA 2XV5A 1X0TA 2YKPA 2B88A 4D6TD 1SVFA 1Z56A 2BEZF 3PP5A 2MJZA 2R5DA 4WWIA 4BXLA 3CI9A 4RESB 1NU1K 1Q7YQ 1RF0A 2RN0A 3AEBC 4Z1MH 1SQXD 1E79H 2WQYC 2OTJP 1Y47A 2E75B 1K04A 3RGUA 1JY3N 3B5NB 1NTKE 2IFMA 5CJ4A 3T97A 1IFDA 3VP9A 3CC2P 4WY4C 1KV4A 3AE1C 1LWUA 1KQLA 3FWLA 3OW2O 2FYNB 1HVVA 1L4AD 3CWBD 1ZRTE 5APUA 3GHGA 2AEFA 3H1LD 1N2DC 3H1KG 5APTA 3G71P 2WWWA 3HE5A 1GMJA 1SQQJ 2OARA 2M8RA 2WSCJ 3M91A 3HD7C 1PV3A 1MV8A 1AVYA 2IBZD 4DCKA 2Q6QA 2R3CA 3PJSK 5E79E 3L72J 3D71A 2Z4EA 3NTNA 3L71E 1OMIA 3L75D 1K05A 1AV1A 3LIDA 1JO5A 2E75C 1M1JB 2D2CB 3B5NC 3NMDA 5B5EH 5AVXB 2E76D 2N1TB 3IR9A 2GUSA 2ZT9B 3MP7B 4N78D 2FYNC 2WZ7A 2SPZA 5DJTB 4PJ0E 1JB0J 1PL5A 2FYUE 2FYZA 3EQ2A 3HD7A 3HTKA 1NAYA 4H44D 2IZ1A 1BE3E 3E1RA 4HB1A 1S2EA 3OAKA 2I1KA 5CCHC 1NH4A 2KNCB 1VQ6P 4KT0J 4U3FE 1QX8A 3CC4P 2L91A 2N9BA 1RE4C 1G2CA 1PGOA 2QIWA 1IFPA 1NTMD 2N1TC 4D6TE 1VQ5P 1WT6A 2KIKA 2XU6A 2BCCE 2V7QH 2NZ2A 5BU8B 2ZT9C 2E5TA 1BGYJ 1Q90D 2RH0A 1SQBE 3H1HJ 5AVVB 4LC1A 5CHXA 2AXCA 2KSEA 3SFDC 3OJAB 1EZVE 5AW2B 3PTZA 1H88A 3BCCE 3A0HE 2FY8A 2ZAEB 1S5LE 1HWTC 2C0WA 1VPCA 1L0NE 2QM7A 3NXSA 5DJUB 2KXPB 1YI2P 1P84E 2WSEJ 3SSUA 1SQXG 4L74A 2IYPA 5CJ0A 2FXOA 3QWOC 1KB9I 4BRYB 2A45I 2OYIA 1NTZE 1L2PA 2YMKA 2ZYGA 2JP3A 1DX7A 3HUSA 2HYNA 1Q86Q 2Y9YA 1NU1J 3CX5I 3H1LG 3L70G 1BCCJ 3F89A 1FZFA 1ZR2A 1OXZA 3H1IJ 1FZCA 3W68A 2IX7C 2ZVOB 1FDMA 1EDKA 2B9BA 2IBZG 4EYYQ 4OGQD 3Q3DA 1OX3A 1NTKK 1NJIQ 4Y99B 4RJTA 4JQ0D 1GL2D 4KJMA 1M56D 2JKVA 2AEJA 2O01J 1MUUA 3VN0A 2KK7A 3O6QB 1SQPD 3L74E 1QEXA 2FXPA 2W6AA 1A02J 1URQD 2GM4A 4NPEA 1EDJA 1BSHA 3L71G 4CPGA 5AW5B 1FC2C 5TJHA 2KYVA 1KB9D 5TISH 3RBXA 2CPBA 3TDKA 2HODB 2B89A 2M0BA 2I8DA 2YIUC 2GA1A 5AW6B 3V6IA 1N73C 5CBOA 4PV1B 2E5YA 1QVFO 3CX5D 2KLUA 2YXQB 4GOEA 2QA4P 1S9KE 2FFDB 2P10A 1AFOA 1BE3G 1RQVA 1X9VA 4YPCA 2FYUK 1M57D 1W5CE 1N7LA 1BSNA 1LTGC 2HPCB 1BGYD 4IL6E 4U3FG 1EDLA 2Z5HA 3H1HD 1S5LX 1VF5B 3PHLA 2XDJA 3A5TA 1N7SA 4IOIH 1HTLC 4D6TG 1WMKA 5C39A 2C9LY 1MKMA 2HLOA 2KZIA 5EFWB 3JCUE 1OWAA 2Y0EA 3A7OA 2JEEA 1SQVD 1UIIA 1H0TA 1JY2O 2FFDC 3L36A 1SQBK 1HGVA 2G8YA 3VTPC 2Q9IA 2W83C 1KILD 3CXHI 1NU1D 3RK3C 1BCCD 1L0NK 4GOFA 2LKMA 3H1KE 1PP9J 1JNMA 1RE3C 2J59M 1LNQA 2WT7B 2KP8A 2NPSD 3V4QA 2VRSA 1LT9B 1NTZK 4AUWA 3H25A 4GDOA 3KXDA 2QG4A 1ZR4A 1KYOI 1QLED 3RK3E 3MZWB 3G3ZA 4NPFX 3C8VA 2AXTH 2E74D 1SQPG 1LP1A 2Q7CA 2W27A 1CSBA 2R5BA 4ZNCA 1VQ7P 3CD6P 3CC7P 3II6A 4PD4I 4KHXA 1OIPA 1NTKJ 4LLHA 2JWAA 2WSCH 1T2KC 1JY2N 4I1LA 1DEBA 1USDA 5KLVE 5APSA 3L74G 4YXDC 3LW5J 3L73J 3JSVC 1HGZA 1CI6A 5CCGA 4H0LD 1YYCA 4I2LC 3P8MC 1FZAA 1L4AB 2QVAA 3A3YB 1RH5B 3CXHD 3V5BA 1U7MA 1SFCC 1K8AQ 1YJNP 1K9MQ 1L0LJ 1VQNP 2B87A 3GHGB 1GZLA 5AW4B 2KS1B 1KB9H 1BGYG 2A45H 1YQ3C 4XA4A 1OW7A 3AECC 2KUBA 2XKMA 3BRVB 5AVSB 2E76B 3VMYA 3Q2YA 5B66E 1EXJA 2OYHA 1NGMB 3CCJP 3HE4A 1L4AC 1SQXE 3KQGA 2RKLA 1SQVG 1ZP0C 1K73Q 3GG2A 1SFCA 3IAOA 1JOCA 2YO3A 3CPWO 4H44B 1Q81Q 3A0BE 2QE7H 5L8RJ 1JCDA 1CZQA 1D7MA 1DD4A 3CWBE 3I56P 4ZKPA 1M1KQ 3H1LE 3L70E 4HJGH 5AVZB 3QH9A 2HFED 2BEQD 1PP9D 3MUDA 3IF4A 4GT1A 2WSEH 2IBZE 2BCCJ 1IFIA 3RL0C 1FJKA 3OA7A 2J5UA 2Y0CA 1SQBJ 4R4MA 1Y9BA 1PPJD 3L75E 1KD1Q 3BCCJ 3H32A 1VQKP 4JYBA 2P58A 3TK1A 3TGUD 1KN7A 1N86A 1JY3P 5KAFH 4N78E 2IPPA 1XTCC 1NTZJ 1JTHB 3D70A 3WU2H 3TNUA 4UB8E 3JCUH 1LTBC 2PRRA 5H2FE 3M06A 1CW5A 1S4XA 3L73D 4WY4A 1KTMA 2KI7B 1ZRTD 4EIJA 3O8ZA 5AVUB 4HH2A 2O01H 5GTHH 4JBZA 2H43A 5KLVG 3HUSB 4JYCA 2WTYA 2OQQA 4OGQB 1L0LD 5KAIH 1LTJB 1GL2B 2G3AA 2KLVA 4AYCA 1FDIA 1EZVI 1X22A 3HD7D 3B5NA 3AEAC 4YTPC 2K9YA 1M1JC 1P84I 2D2CC 3LIEA 3AEEC 3CXHH 1SS1A 1URQB 4GIFA 4WVZA 3GF3A 2H8PD 5AVRB 2QSIA 4TLFA 3SFEC 1VQ4P 1HBWA 4N3YB 1R8EA 2FKWB 3CCSP 1LTAC 1KYOH 2A06D 3D6YA 5APWA 3L37A 1T3UA 3M9QA 2O1JA 5CCHA 2O1KA 4UB6H 2P1JA 1RE4A 1KORA 1OFCX 1M1JA 1SQXK 1IJDB 2N1TA 4PD4H 2AEMA 3SWKA 2JDIH 4B86A 3CWBG 2Y0DA 1URQC 3KZIH 2RMZA 1PPJG 2Q3EA 4N6JA 5AVQB 3USSA 1EZVD 1RQUA 2FXMA 1SQQD 4JPZB 3TGUG 4C7NB 4R4LA 1OZHA 1SQPE 1GK4A 2M3EA 3VMAA 1NHLA 5GTIE 2NRGA 1OVUA 3S4RA 3L72D 3L75G 2R44A 2KNCA 4BWNA 1NTZD 4LGDE 1MFZA 2J58A 3VMXA 1DH3A 3L73G 2K9JB 2ZYDA 1KILB 1IFJA 3CX5E 2WSFH 4ZMDA 3S1KA 1KMIZ 1YHQP 2IZ0A 2V4HA 1L0LG 3AEFC 1U57A 2NPSB 1VQLP 2I1JA 3AE9C 3CCUP 2YXRB 4Y99C 3H1JJ 1BGYE 1ZXGA 3H1HE 2E74B 3LW5H 3MIWA 4BRYA 4IFMA 1JEKA 3CMAP 1NTMG 3CL3D 2WPVB 3V4WA 1PGQA 3M0AA 1KILC 3WUVA 1H89A 3AE8C 5E79H 4EOTA 1SQVE 1G1IA 1VQMP 3Q1MA 3SWFA 3WMM0 4RO0A 2A06G 4H0LB 3I55P 2NPSC 4XE5B 3UIAA 1KILE 1N73A 1NU1E 4PV1C 1BCCE 1S9KD 3G9RA 3M0DC 1VQ9P 1N7SD 4QMAA 1QVGO 2LXBA 1SP4A 3TF5A 3KYQA 1GU4A 1M7LA 2E42A 3O6QA 2M5AB 1J1EB 2IFNA 1PZQA 4PJ0H 3B8EB 5B5EE 1NWQA 2QJKB 4HKZH 1DD3A 1W2EA 1J1DB 3R4YA 5CMZA 1KQFB 2YKOA 1FZBA 2P7JA 4EI2A 1VQOP 2OTLP 1SQQG 1IFMA 1GW4A 4DOJA 1HF9A 3H1ID 4L75A 1VF5C 2HODA 2XNXA 2HR3A 1AQ5A 3WUTA 3L72G 2R3SA 4H0LC 5KJ7C 4TT3H 1X8YA 1GTWA 5KKZB 3P8CE 1FZEA 1DIPA 1EQ7A 1PIXA 2JR8A 1YJ9P 1RF1B 4W7ZA 3IN6A 2WSFJ 1NAFA 2FFDA 3H6PA 1YJWP 1AVOA 3VOPA 1UIXA 3L70J 1SQPK 3A0HH 1WRGA 3HRNA 3CCLP 4MN4C 1S5LH 2HPCA 2JJLA 5KLIB 2A45G 1P84H 1GD2E 1RE3A 1ZMEC 1NOHA 5AW8B 2H89C 4O9BA 3RK3D 3IFMA 5KJ7A 1LT9C 3H1JD 3T97B 1VQPP 1RF1C 4DT0A 3Q5SA 1GW3A 1OVVA 5CCGD 3FWNA 1LWUB 3E1IA 1RY3A 4L73A 3BASA 3Q5RA 1FE6A 3L71J 3MD0A 2ITAA 3MHVA 1HJBA 3HE5B 1IK9A 1KYOD 1HH0A 1IFNA 4YXWH 1KZUB 3H1HG 2WSSH 3JC22 3BVHA 1TU3F 2ZXXA 2W90A 1RF0C 3RK2D 1QL1A 2Y9ZA 2YKQA 4C7RA 3FXDA 1LTSC 3M9HA 3AE5C 1ZN5A 4Y28J 4PD4D 1OVRA 3MTUE 1KC8Q 3N4XA 2FYUJ 2CPSA 3V2NA 2HG5D 2IBZI 2YMYA 1BE3J 2QM8A 5AW1B 1LWUC 2IDBA 2XZRA 3C1LA 2POHA 4JF7A 1SQVK 2MKVA 1NKZB 4HYTB 1PGJA 3GHGC 2P2UA 1NU1G 4U3FJ 3AE2C 1SFCD 1BCCG 3WUUA 1PPJE 1E5WA 3H1IG 3HD7B 3HTKB 3VMZA 4H13D 1FU1A 2R32A 4D6TJ 3TGUE 1LGHB 3ITKA 2E76C 1AQTA 3SWYA 1ZV8A 3EFGA 5TISE 3TYYA 1YTZI 1G1JA 1L4AA 1G2CB 1EDIA 1XTGB 1YIJP 1KQSO 2QEXP 1T6AA 1JCCA 1JMMA 2H7HA 3CMEP 1L0NJ 1KQGB 4IL6H 2QJPB 3L73E 3KPEA 3CCEP 1VDFA 4H44C 1JUNA 1JM0A 2KS1A 3L70D 5K5GB 1USEA 3GMAA 1ZW0A 3W67A 3N7NA 1NTKD 4OVNF 1PFIA 2LXCB 3C9IA 1NYHA 3D6ZA 4AQRD 2LR2A 1L0LE 2UWJE 1U7JA 3GLMA 2K88A 3L35A 2YNYA 3CCVP 5AVTB 3H1JG 2OYIB 1FOSF 1OW6A 5AW9B 2KZJA 1AA0A 1SQPJ 4WY4D 3VYIA 3RL0D 3KDPB 3G4SP 2O3JA 1NTME 1MFTA 2QJPC 1LTTC 5KTBA 3L71D 4K35A 5KLVK 1FZCB 1EC5A 2BASA 1W2BO 1QL2A 3L74J 1T3JA 3AEDC 1LTIC 1HJ0A 5APYA 2ZFCA 3U1AA 2A06E 1GU5A 3BRTB 1FJPA 2L5GB 3AE3C 1BDDA 2E75D 2OYIC 3B5ND 2FYUD 1S1CX 1Q2NA 4OWFA 4EDFA 1BE3D 2AXTE 4L76A 1YTZT 2IYOA 3HUSC 1X79B 4OGQC 3CCQP 4U3FD 1GK6A 1LTJC 1GL2C 2K37A 1FZCC 2ZYAA 3R2PA 1PP9G 1JTHA 1IO4A 1SQQE 4C46A 2K3RA 5APQA 3AE7C
chains in the Genus database with same CATH topology
1CI6A 1H89A 5APTA 5CCGA 2WWWA 3HE5A 1YYCA 4EOTA 2OARA 5CCHD 1G1IA 2M8RA 4I2LC 3P8MC 1FZAA 1L4AB 1FOSE 3A3YB 3M91A 3SWFA 3HD7C 1MV8A 2WITA 3WMM0 2PAJA 3V5BA 4IFDK 2R3CA 1FBMA 2NPSC 4XE5B 1SFCC 2Z4EA 3UIAA 3NTNA 2N1TD 1N73A 3LIDA 1S9KD 3M0DC 3GHGB 1GZLA 4I6MC 5AW4B 3VP8A 1N7SD 1JO5A 3NMDA 1M1JB 2Q3IA 3B5NC 3V2PA 5AVXB 2C0XA 1NO4A 2A45H 3TSIA 2N1TB 1SP4A 3KYQA 1GU4A 3P7KA 3IR9A 1M7LA 2E42A 1LTJA 2Z5IA 3A2AA 1GL2A 1J1EB 2GUSA 2IFNA 4XA4A 3B8EB 3BRVB 2XKMA 1N7SB 4N78D 2WZ7A 1NWQA 5AVSB 3VMYA 1W2EA 1J1DB 5CMZA 2YKOA 1FZBA 3BATA 2P7JA 1N73B 2OYHA 2WPQA 1IFMA 1NKNA 1GW4A 4DOJA 3HE4A 2FYZA 3EQ2A 2KOGA 3HD7A 1URQA 3HTKA 1L4AC 2C9NY 3KQGA 2HODA 2XNXA 1AQ5A 1SFCA 3OAKA 5AVYB 1JOCA 2YO3A 2I1KA 5KJ7C 5CCHC 1NH4A 1X8YA 1GTWA 3P8CE 4W7YA 1T8ZA 1FZEA 1EQ7A 1KILC 1JCDA 1RF1B 2N9BA 4W7ZA 1RE4C 1G2CA 1CZQA 1MZ9A 1NAFA 2FFDA 2W6BA 1GDTA 4ZKPA 1A02F 2N1TC 1WT6A 1L0LK 3H6PA 5AVZB 4GKGA 2XU6A 2HFED 3VOPA 1FZGA 5BU8B 3MUDA 1N7SC 4GT1A 1SLQA 2WSEH 1SQPK 1WRGA 3HRNA 5APVA 2HPCA 1IFIA 5AVVB 2JJLA 4LC1A 5CHXA 3RL0C 1FJKA 2A45G 3OA7A 3V2QA 3OJAB 3V2RA 5AW2B 1GD2E 1H88A 1RE3A 1NOHA 1NTMK 2GUVA 2C0WA 1VPCA 2QM7A 3NXSA 1HWTC 4M3LA 5AW8B 4O9BA 3H32A 3RK3D 3IFMA 1KFNA 5KJ7A 1LT9C 4JYBA 5CJ0A 3TK1A 1N86A 4C7NA 2A45I 1JY3P 2OYIA 4IFFA 5AW0B 1RF1C 3RK3B 1GW3A 4N78E 5CCGD 2IPPA 1LWUB 1XTCC 3E1IA 1IC2A 1JTHB 1RY3A 3BASA 1DX7A 3TNUA 3HUSA 2HYNA 1CI6B 2M3BA 3MD0A 1LTBC 1HJBA 3M06A 3HE5B 5APXA 1CW5A 1IK9A 1HH0A 4WY4A 1IFNA 1KZUB 1FZFA 3MGNA 4OH8B 5APSA 1OXZA 1ZR2A 1FZCA 2E43A 3BVHA 2IX7C 4EIJA 1FDMA 3O8ZA 5AVUB 4HH2A 1RF0C 3L4FA 2O01H 3RK2D 1KILA 1QL1A 2ZXEB 2YO2A 1NTKK 2YKQA 3P32A 4Y99B 2H43A 4C7RA 1GL2D 1LTSC 3M9HA 1ZN5A 3HUSB 4JYCA 2WTYA 3MTUE 3RK2B 2WPSA 3N4XA 2CPSA 3U1CA 3V2NA 1MUUA 2HG5D 1ZLLA 2NPSA 3VN0A 1SQQK 1LTJB 1GL2B 2YMYA 2KSJA 2KLVA 2QM8A 2KB7P 5AW1B 4AYCA 1LWUC 2W6AA 2XZRA 4JF7A 2POHA 1A02J 1SQVK 3M0DA 3HD7D 1URQD 2GM4A 1NKZB 3B5NA 3GHGC 4HYTB 5AVWB 2P2UA 5AW5B 2KYVA 1M1JC 3LIEA 2OYHB 1SFCD 5CCGC 1E5WA 3HE4B 4WBAA 3HD7B 1URQB 3HTKB 4GIFA 3VMZA 1J1EC 2CPBA 5AW3B 2H8PD 1FU1A 2HODB 5AVRB 2R32A 4WB4A 1LGHB 1SFCB 3SWYA 1ZV8A 1J1DC 3EFGA 1HBWA 4N3YB 5AW6B 3TYYA 1N73C 2FKWB 1YTZI 1G1JA 1LTAC 1L4AA 1G2CB 1XTGB 2PP6A 3RK2C 1S9KE 5AW7B 1JCCA 5APWA 3L37A 2FFDB 1JMMA 3P8CD 2H7HA 1T3UA 3M9QA 2O1JA 4W80A 5CCHA 1AFOA 3CLQA 3I5CA 1X9VA 3KPEA 2O1KA 2FYUK 1VDFA 2P1JA 1RE4A 1JUNA 1N7LA 3U59A 1LTGC 2HPCB 1M1JA 1SQXK 1IJDB 3N7NA 2Z5HA 2N1TA 1H8AA 2OYHC 5KJ7D 1JY2P 2XDJA 4B86A 1KFMA 1PFIA 3A5TA 1URQC 1N7SA 1HTLC 2WPRA 3C9IA 4DZOA 2C9LY 3H32B 5BVZA 4AQRD 4N6JA 5AVQB 2HLOA 2FXMA 3L35A 2YNYA 5AVTB 4C7NB 1JY3O 1OWAA 2OYIB 1FOSF 5BU5A 1GK4A 2Q5UA 3A7OA 3M9BA 5AW9B 1NHLA 2JEEA 2WT7A 1J2JB 4WY4D 1JY2O 3VYIA 2FFDC 3RL0D 1LT9A 1T2KD 3L36A 3KDPB 1SQBK 1HGVA 3TNUB 3VTPC 1HUCA 3NFQA 4LGDE 2Q9IA 1LTTC 5KTBA 1MFZA 2P67A 2J58A 3VMXA 1KILD 1RF1A 4WY4B 1FAVA 3RL0B 5KLVK 1DH3A 3RK3C 1FZCB 1L0NK 2BASA 2LKMA 1QL2A 4ZKUA 1JNMA 1RE3C 1KILB 2XV5A 2J59M 1IFJA 1T3JA 1LTIC 2WT7B 2KP8A 2WSFH 2NPSD 3V4QA 2VRSA 2YKPA 1LT9B 5APYA 1NTZK 4AUWA 1SVFA 2ZFCA 1Z56A 3U1AA 3PP5A 2MJZA 1ZR4A 1GU5A 3BRTB 2R5DA 1FJPA 2L5GB 3CI9A 3G3ZA 4RESB 1NU1K 1RF0A 2OYIC 3B5ND 2NPSB 2I1JA 4Y99C 2Q7CA 2W27A 1CSBA 2R5BA 1YTZT 1JY3N 3B5NB 3HUSC 1X79B 2IFMA 3LW5H 3MIWA 3II6A 5CJ4A 4IFMA 4KHXA 3T97A 1IFDA 3VP9A 3CL3D 4WY4C 1GK6A 1LTJC 1GL2C 4LLHA 2WSCH 1T2KC 1JY2N 1LWUA 1FZCC 1KQLA 4I1LA 1DEBA 3V4WA 3R2PA 1HVVA 1L4AD 1JTHA 1IO4A 5APUA 3GHGA 4C46A 5APQA 3M0AA 1N2DC 1HGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X9V A;  1VPC A; 
#chains in the Genus database with same CATH topology
 3KHU A;  3FXE A;  2BCC D;  5CCH D;  3L72 E;  1FOS E;  2WIT A;  1SQB D;  2PAJ A;  1SQV J;  4IFD K;  1FBM A;  2D2C D;  2CK3 H;  3GF7 A;  3BCC D;  2N1T D;  3RBZ A;  1VL2 A;  2JO1 A;  1L0N D;  1P84 D;  2ZT9 D;  4I6M C;  3VP8 A;  2Q3I A;  3V2P A;  2K1A A;  1OW8 A;  2C0X A;  1NO4 A;  3FX0 A;  3TSI A;  4XFJ A;  3P7K A;  3CCR P;  1LTJ A;  2Z5I A;  3A2A A;  1GL2 A;  1NTK G;  5B66 H;  3GW6 A;  4K3A A;  1KB9 E;  1N7S B;  2YIU B;  1NVO A;  3BAT A;  2ZJS E;  4RKU J;  1N73 B;  2W8Z A;  2W6J H;  1FDO A;  5CBN A;  2WPQ A;  4DJG A;  1NKN A;  1LJ2 A;  2KOG A;  1URQ A;  2C9N Y;  4ASV A;  3H1K J;  3A0B H;  1H0T B;  5AVY B;  3AE4 C;  4U7J A;  3RL0 g;  4W7Y A;  1T8Z A;  1N8R Q;  1MZ9 A;  3B4S A;  2W6B A;  1GDT A;  1A02 F;  4NPD A;  1L0L K;  4GKG A;  1FZG A;  2WMM A;  1N7S C;  1SLQ A;  3L74 D;  5APV A;  4GOD A;  3B71 A;  2PFX A;  3V2Q A;  3F5H A;  1S72 P;  3V2R A;  3PLN A;  3EWK A;  2V7Q J;  1NTM K;  2GUV A;  2FYU G;  3PH0 A;  4M3L A;  1LP1 B;  1QGK B;  1KFN A;  5KLV J;  3CCM P;  1YQ4 C;  4C7N A;  1LT1 A;  2FBW C;  1S3J A;  4IFF A;  5AW0 B;  3RK3 B;  1BDC A;  4UB8 H;  2H88 C;  2QRX A;  5H2F H;  1IC2 A;  2ZVN B;  3EFF K;  1R5L A;  3E7K A;  5KAF E;  1M90 Q;  1CI6 B;  2E74 C;  2M3B A;  3H1I E;  5APX A;  1VQ8 P;  1RHZ B;  3MGN A;  2BCC G;  4OH8 B;  3WU2 E;  2E43 A;  2K9J A;  1IZN B;  1SQB G;  3L4F A;  1KIL A;  2ZXE B;  2YO2 A;  3P32 A;  1EZV G;  1DEE G;  3BCC G;  1YBK A;  2B87 B;  3ZDM A;  1L0N G;  5GTH E;  4I7Z B;  3RK2 B;  2WPS A;  3AE6 C;  3U1C A;  1R5S A;  2NPS A;  1ZLL A;  1SQQ K;  1SQX J;  3ABV C;  3PRJ A;  2KSJ A;  2OYO A;  2KB7 P;  1NTZ G;  3M0D A;  1IK7 A;  5KAI E;  5AVW B;  3Q5P A;  2OYH B;  2JWD A;  5CCG C;  1YIT P;  3HE4 B;  5M1B A;  1FS0 E;  4WBA A;  3CWB J;  4PV1 D;  1J1E C;  5AW3 B;  3H1L J;  4WB4 A;  1SFC B;  3H1J E;  2WVR A;  2QJK C;  1AJY A;  3H1K D;  3K5B A;  3CXH E;  1Q82 Q;  1J1D C;  3TGU J;  2Q1K A;  4ASW A;  4H13 B;  2QJY B;  4A7P A;  2PP6 A;  1Y8A A;  2N9Y B;  4I7Z C;  3RK2 C;  5AW7 B;  1JMB A;  3P8C D;  3L75 J;  4W80 A;  3CLQ A;  3I5C A;  1KYO E;  2OTK E;  2PGD A;  1VF5 D;  5KKZ C;  3U59 A;  3S9O A;  2OYH C;  1H8A A;  5KJ7 D;  4UB6 E;  1JY2 P;  1M8O B;  2M5A A;  1KFM A;  4DZO A;  2WPR A;  3FGA D;  2OGU A;  3H32 B;  5BVZ A;  4PD4 E;  5GTI H;  5KLI C;  3KZI E;  5KLV D;  1EXI A;  1JY3 O;  1ZOY C;  4H13 C;  4IL6 X;  5BU5 A;  3M9B A;  2Q5U A;  2QJY C;  2WT7 A;  1J2J B;  2DW3 A;  1LT9 A;  1T2K D;  3G6E P;  3TNU B;  1HUC A;  1PGP A;  3NFQ A;  2P67 A;  3MUD C;  1RF1 A;  4WY4 B;  1NTM J;  1PP9 E;  3AEG C;  1FAV A;  2O01 N;  3RL0 B;  2XND H;  3CX5 H;  4ZKU A;  2XV5 A;  1X0T A;  2YKP A;  2B88 A;  4D6T D;  1SVF A;  1Z56 A;  2BEZ F;  3PP5 A;  2MJZ A;  2R5D A;  4WWI A;  4BXL A;  3CI9 A;  4RES B;  1NU1 K;  1Q7Y Q;  1RF0 A;  2RN0 A;  3AEB C;  4Z1M H;  1SQX D;  1E79 H;  2WQY C;  2OTJ P;  1Y47 A;  2E75 B;  1K04 A;  3RGU A;  1JY3 N;  3B5N B;  1NTK E;  2IFM A;  5CJ4 A;  3T97 A;  1IFD A;  3VP9 A;  3CC2 P;  4WY4 C;  1KV4 A;  3AE1 C;  1LWU A;  1KQL A;  3FWL A;  3OW2 O;  2FYN B;  1HVV A;  1L4A D;  3CWB D;  1ZRT E;  5APU A;  3GHG A;  2AEF A;  3H1L D;  1N2D C;  3H1K G;  5APT A;  3G71 P;  2WWW A;  3HE5 A;  1GMJ A;  1SQQ J;  2OAR A;  2M8R A;  2WSC J;  3M91 A;  3HD7 C;  1PV3 A;  1MV8 A;  1AVY A;  2IBZ D;  4DCK A;  2Q6Q A;  2R3C A;  3PJS K;  5E79 E;  3L72 J;  3D71 A;  2Z4E A;  3NTN A;  3L71 E;  1OMI A;  3L75 D;  1K05 A;  1AV1 A;  3LID A;  1JO5 A;  2E75 C;  1M1J B;  2D2C B;  3B5N C;  3NMD A;  5B5E H;  5AVX B;  2E76 D;  2N1T B;  3IR9 A;  2GUS A;  2ZT9 B;  3MP7 B;  4N78 D;  2FYN C;  2WZ7 A;  2SPZ A;  5DJT B;  4PJ0 E;  1JB0 J;  1PL5 A;  2FYU E;  2FYZ A;  3EQ2 A;  3HD7 A;  3HTK A;  1NAY A;  4H44 D;  2IZ1 A;  1BE3 E;  3E1R A;  4HB1 A;  1S2E A;  3OAK A;  2I1K A;  5CCH C;  1NH4 A;  2KNC B;  1VQ6 P;  4KT0 J;  4U3F E;  1QX8 A;  3CC4 P;  2L91 A;  2N9B A;  1RE4 C;  1G2C A;  1PGO A;  2QIW A;  1IFP A;  1NTM D;  2N1T C;  4D6T E;  1VQ5 P;  1WT6 A;  2KIK A;  2XU6 A;  2BCC E;  2V7Q H;  2NZ2 A;  5BU8 B;  2ZT9 C;  2E5T A;  1BGY J;  1Q90 D;  2RH0 A;  1SQB E;  3H1H J;  5AVV B;  4LC1 A;  5CHX A;  2AXC A;  2KSE A;  3SFD C;  3OJA B;  1EZV E;  5AW2 B;  3PTZ A;  1H88 A;  3BCC E;  3A0H E;  2FY8 A;  2ZAE B;  1S5L E;  1HWT C;  2C0W A;  1VPC A;  1L0N E;  2QM7 A;  3NXS A;  5DJU B;  2KXP B;  1YI2 P;  1P84 E;  2WSE J;  3SSU A;  1SQX G;  4L74 A;  2IYP A;  5CJ0 A;  2FXO A;  3QWO C;  1KB9 I;  4BRY B;  2A45 I;  2OYI A;  1NTZ E;  1L2P A;  2YMK A;  2ZYG A;  2JP3 A;  1DX7 A;  3HUS A;  2HYN A;  1Q86 Q;  2Y9Y A;  1NU1 J;  3CX5 I;  3H1L G;  3L70 G;  1BCC J;  3F89 A;  1FZF A;  1ZR2 A;  1OXZ A;  3H1I J;  1FZC A;  3W68 A;  2IX7 C;  2ZVO B;  1FDM A;  1EDK A;  2B9B A;  2IBZ G;  4EYY Q;  4OGQ D;  3Q3D A;  1OX3 A;  1NTK K;  1NJI Q;  4Y99 B;  4RJT A;  4JQ0 D;  1GL2 D;  4KJM A;  1M56 D;  2JKV A;  2AEJ A;  2O01 J;  1MUU A;  3VN0 A;  2KK7 A;  3O6Q B;  1SQP D;  3L74 E;  1QEX A;  2FXP A;  2W6A A;  1A02 J;  1URQ D;  2GM4 A;  4NPE A;  1EDJ A;  1BSH A;  3L71 G;  4CPG A;  5AW5 B;  1FC2 C;  5TJH A;  2KYV A;  1KB9 D;  5TIS H;  3RBX A;  2CPB A;  3TDK A;  2HOD B;  2B89 A;  2M0B A;  2I8D A;  2YIU C;  2GA1 A;  5AW6 B;  3V6I A;  1N73 C;  5CBO A;  4PV1 B;  2E5Y A;  1QVF O;  3CX5 D;  2KLU A;  2YXQ B;  4GOE A;  2QA4 P;  1S9K E;  2FFD B;  2P10 A;  1AFO A;  1BE3 G;  1RQV A;  1X9V A;  4YPC A;  2FYU K;  1M57 D;  1W5C E;  1N7L A;  1BSN A;  1LTG C;  2HPC B;  1BGY D;  4IL6 E;  4U3F G;  1EDL A;  2Z5H A;  3H1H D;  1S5L X;  1VF5 B;  3PHL A;  2XDJ A;  3A5T A;  1N7S A;  4IOI H;  1HTL C;  4D6T G;  1WMK A;  5C39 A;  2C9L Y;  1MKM A;  2HLO A;  2KZI A;  5EFW B;  3JCU E;  1OWA A;  2Y0E A;  3A7O A;  2JEE A;  1SQV D;  1UII A;  1H0T A;  1JY2 O;  2FFD C;  3L36 A;  1SQB K;  1HGV A;  2G8Y A;  3VTP C;  2Q9I A;  2W83 C;  1KIL D;  3CXH I;  1NU1 D;  3RK3 C;  1BCC D;  1L0N K;  4GOF A;  2LKM A;  3H1K E;  1PP9 J;  1JNM A;  1RE3 C;  2J59 M;  1LNQ A;  2WT7 B;  2KP8 A;  2NPS D;  3V4Q A;  2VRS A;  1LT9 B;  1NTZ K;  4AUW A;  3H25 A;  4GDO A;  3KXD A;  2QG4 A;  1ZR4 A;  1KYO I;  1QLE D;  3RK3 E;  3MZW B;  3G3Z A;  4NPF X;  3C8V A;  2AXT H;  2E74 D;  1SQP G;  1LP1 A;  2Q7C A;  2W27 A;  1CSB A;  2R5B A;  4ZNC A;  1VQ7 P;  3CD6 P;  3CC7 P;  3II6 A;  4PD4 I;  4KHX A;  1OIP A;  1NTK J;  4LLH A;  2JWA A;  2WSC H;  1T2K C;  1JY2 N;  4I1L A;  1DEB A;  1USD A;  5KLV E;  5APS A;  3L74 G;  4YXD C;  3LW5 J;  3L73 J;  3JSV C;  1HGZ A;  1CI6 A;  5CCG A;  4H0L D;  1YYC A;  4I2L C;  3P8M C;  1FZA A;  1L4A B;  2QVA A;  3A3Y B;  1RH5 B;  3CXH D;  3V5B A;  1U7M A;  1SFC C;  1K8A Q;  1YJN P;  1K9M Q;  1L0L J;  1VQN P;  2B87 A;  3GHG B;  1GZL A;  5AW4 B;  2KS1 B;  1KB9 H;  1BGY G;  2A45 H;  1YQ3 C;  4XA4 A;  1OW7 A;  3AEC C;  2KUB A;  2XKM A;  3BRV B;  5AVS B;  2E76 B;  3VMY A;  3Q2Y A;  5B66 E;  1EXJ A;  2OYH A;  1NGM B;  3CCJ P;  3HE4 A;  1L4A C;  1SQX E;  3KQG A;  2RKL A;  1SQV G;  1ZP0 C;  1K73 Q;  3GG2 A;  1SFC A;  3IAO A;  1JOC A;  2YO3 A;  3CPW O;  4H44 B;  1Q81 Q;  3A0B E;  2QE7 H;  5L8R J;  1JCD A;  1CZQ A;  1D7M A;  1DD4 A;  3CWB E;  3I56 P;  4ZKP A;  1M1K Q;  3H1L E;  3L70 E;  4HJG H;  5AVZ B;  3QH9 A;  2HFE D;  2BEQ D;  1PP9 D;  3MUD A;  3IF4 A;  4GT1 A;  2WSE H;  2IBZ E;  2BCC J;  1IFI A;  3RL0 C;  1FJK A;  3OA7 A;  2J5U A;  2Y0C A;  1SQB J;  4R4M A;  1Y9B A;  1PPJ D;  3L75 E;  1KD1 Q;  3BCC J;  3H32 A;  1VQK P;  4JYB A;  2P58 A;  3TK1 A;  3TGU D;  1KN7 A;  1N86 A;  1JY3 P;  5KAF H;  4N78 E;  2IPP A;  1XTC C;  1NTZ J;  1JTH B;  3D70 A;  3WU2 H;  3TNU A;  4UB8 E;  3JCU H;  1LTB C;  2PRR A;  5H2F E;  3M06 A;  1CW5 A;  1S4X A;  3L73 D;  4WY4 A;  1KTM A;  2KI7 B;  1ZRT D;  4EIJ A;  3O8Z A;  5AVU B;  4HH2 A;  2O01 H;  5GTH H;  4JBZ A;  2H43 A;  5KLV G;  3HUS B;  4JYC A;  2WTY A;  2OQQ A;  4OGQ B;  1L0L D;  5KAI H;  1LTJ B;  1GL2 B;  2G3A A;  2KLV A;  4AYC A;  1FDI A;  1EZV I;  1X22 A;  3HD7 D;  3B5N A;  3AEA C;  4YTP C;  2K9Y A;  1M1J C;  1P84 I;  2D2C C;  3LIE A;  3AEE C;  3CXH H;  1SS1 A;  1URQ B;  4GIF A;  4WVZ A;  3GF3 A;  2H8P D;  5AVR B;  2QSI A;  4TLF A;  3SFE C;  1VQ4 P;  1HBW A;  4N3Y B;  1R8E A;  2FKW B;  3CCS P;  1LTA C;  1KYO H;  2A06 D;  3D6Y A;  5APW A;  3L37 A;  1T3U A;  3M9Q A;  2O1J A;  5CCH A;  2O1K A;  4UB6 H;  2P1J A;  1RE4 A;  1KOR A;  1OFC X;  1M1J A;  1SQX K;  1IJD B;  2N1T A;  4PD4 H;  2AEM A;  3SWK A;  2JDI H;  4B86 A;  3CWB G;  2Y0D A;  1URQ C;  3KZI H;  2RMZ A;  1PPJ G;  2Q3E A;  4N6J A;  5AVQ B;  3USS A;  1EZV D;  1RQU A;  2FXM A;  1SQQ D;  4JPZ B;  3TGU G;  4C7N B;  4R4L A;  1OZH A;  1SQP E;  1GK4 A;  2M3E A;  3VMA A;  1NHL A;  5GTI E;  2NRG A;  1OVU A;  3S4R A;  3L72 D;  3L75 G;  2R44 A;  2KNC A;  4BWN A;  1NTZ D;  4LGD E;  1MFZ A;  2J58 A;  3VMX A;  1DH3 A;  3L73 G;  2K9J B;  2ZYD A;  1KIL B;  1IFJ A;  3CX5 E;  2WSF H;  4ZMD A;  3S1K A;  1KMI Z;  1YHQ P;  2IZ0 A;  2V4H A;  1L0L G;  3AEF C;  1U57 A;  2NPS B;  1VQL P;  2I1J A;  3AE9 C;  3CCU P;  2YXR B;  4Y99 C;  3H1J J;  1BGY E;  1ZXG A;  3H1H E;  2E74 B;  3LW5 H;  3MIW A;  4BRY A;  4IFM A;  1JEK A;  3CMA P;  1NTM G;  3CL3 D;  2WPV B;  3V4W A;  1PGQ A;  3M0A A;  1KIL C;  3WUV A;  1H89 A;  3AE8 C;  5E79 H;  4EOT A;  1SQV E;  1G1I A;  1VQM P;  3Q1M A;  3SWF A;  3WMM 0;  4RO0 A;  2A06 G;  4H0L B;  3I55 P;  2NPS C;  4XE5 B;  3UIA A;  1KIL E;  1N73 A;  1NU1 E;  4PV1 C;  1BCC E;  1S9K D;  3G9R A;  3M0D C;  1VQ9 P;  1N7S D;  4QMA A;  1QVG O;  2LXB A;  1SP4 A;  3TF5 A;  3KYQ A;  1GU4 A;  1M7L A;  2E42 A;  3O6Q A;  2M5A B;  1J1E B;  2IFN A;  1PZQ A;  4PJ0 H;  3B8E B;  5B5E E;  1NWQ A;  2QJK B;  4HKZ H;  1DD3 A;  1W2E A;  1J1D B;  3R4Y A;  5CMZ A;  1KQF B;  2YKO A;  1FZB A;  2P7J A;  4EI2 A;  1VQO P;  2OTL P;  1SQQ G;  1IFM A;  1GW4 A;  4DOJ A;  1HF9 A;  3H1I D;  4L75 A;  1VF5 C;  2HOD A;  2XNX A;  2HR3 A;  1AQ5 A;  3WUT A;  3L72 G;  2R3S A;  4H0L C;  5KJ7 C;  4TT3 H;  1X8Y A;  1GTW A;  5KKZ B;  3P8C E;  1FZE A;  1DIP A;  1EQ7 A;  1PIX A;  2JR8 A;  1YJ9 P;  1RF1 B;  4W7Z A;  3IN6 A;  2WSF J;  1NAF A;  2FFD A;  3H6P A;  1YJW P;  1AVO A;  3VOP A;  1UIX A;  3L70 J;  1SQP K;  3A0H H;  1WRG A;  3HRN A;  3CCL P;  4MN4 C;  1S5L H;  2HPC A;  2JJL A;  5KLI B;  2A45 G;  1P84 H;  1GD2 E;  1RE3 A;  1ZME C;  1NOH A;  5AW8 B;  2H89 C;  4O9B A;  3RK3 D;  3IFM A;  5KJ7 A;  1LT9 C;  3H1J D;  3T97 B;  1VQP P;  1RF1 C;  4DT0 A;  3Q5S A;  1GW3 A;  1OVV A;  5CCG D;  3FWN A;  1LWU B;  3E1I A;  1RY3 A;  4L73 A;  3BAS A;  3Q5R A;  1FE6 A;  3L71 J;  3MD0 A;  2ITA A;  3MHV A;  1HJB A;  3HE5 B;  1IK9 A;  1KYO D;  1HH0 A;  1IFN A;  4YXW H;  1KZU B;  3H1H G;  2WSS H;  3JC2 2;  3BVH A;  1TU3 F;  2ZXX A;  2W90 A;  1RF0 C;  3RK2 D;  1QL1 A;  2Y9Z A;  2YKQ A;  4C7R A;  3FXD A;  1LTS C;  3M9H A;  3AE5 C;  1ZN5 A;  4Y28 J;  4PD4 D;  1OVR A;  3MTU E;  1KC8 Q;  3N4X A;  2FYU J;  2CPS A;  3V2N A;  2HG5 D;  2IBZ I;  2YMY A;  1BE3 J;  2QM8 A;  5AW1 B;  1LWU C;  2IDB A;  2XZR A;  3C1L A;  2POH A;  4JF7 A;  1SQV K;  2MKV A;  1NKZ B;  4HYT B;  1PGJ A;  3GHG C;  2P2U A;  1NU1 G;  4U3F J;  3AE2 C;  1SFC D;  1BCC G;  3WUU A;  1PPJ E;  1E5W A;  3H1I G;  3HD7 B;  3HTK B;  3VMZ A;  4H13 D;  1FU1 A;  2R32 A;  4D6T J;  3TGU E;  1LGH B;  3ITK A;  2E76 C;  1AQT A;  3SWY A;  1ZV8 A;  3EFG A;  5TIS E;  3TYY A;  1YTZ I;  1G1J A;  1L4A A;  1G2C B;  1EDI A;  1XTG B;  1YIJ P;  1KQS O;  2QEX P;  1T6A A;  1JCC A;  1JMM A;  2H7H A;  3CME P;  1L0N J;  1KQG B;  4IL6 H;  2QJP B;  3L73 E;  3KPE A;  3CCE P;  1VDF A;  4H44 C;  1JUN A;  1JM0 A;  2KS1 A;  3L70 D;  5K5G B;  1USE A;  3GMA A;  1ZW0 A;  3W67 A;  3N7N A;  1NTK D;  4OVN F;  1PFI A;  2LXC B;  3C9I A;  1NYH A;  3D6Z A;  4AQR D;  2LR2 A;  1L0L E;  2UWJ E;  1U7J A;  3GLM A;  2K88 A;  3L35 A;  2YNY A;  3CCV P;  5AVT B;  3H1J G;  2OYI B;  1FOS F;  1OW6 A;  5AW9 B;  2KZJ A;  1AA0 A;  1SQP J;  4WY4 D;  3VYI A;  3RL0 D;  3KDP B;  3G4S P;  2O3J A;  1NTM E;  1MFT A;  2QJP C;  1LTT C;  5KTB A;  3L71 D;  4K35 A;  5KLV K;  1FZC B;  1EC5 A;  2BAS A;  1W2B O;  1QL2 A;  3L74 J;  1T3J A;  3AED C;  1LTI C;  1HJ0 A;  5APY A;  2ZFC A;  3U1A A;  2A06 E;  1GU5 A;  3BRT B;  1FJP A;  2L5G B;  3AE3 C;  1BDD A;  2E75 D;  2OYI C;  3B5N D;  2FYU D;  1S1C X;  1Q2N A;  4OWF A;  4EDF A;  1BE3 D;  2AXT E;  4L76 A;  1YTZ T;  2IYO A;  3HUS C;  1X79 B;  4OGQ C;  3CCQ P;  4U3F D;  1GK6 A;  1LTJ C;  1GL2 C;  2K37 A;  1FZC C;  2ZYA A;  3R2P A;  1PP9 G;  1JTH A;  1IO4 A;  1SQQ E;  4C46 A;  2K3R A;  5APQ A;  3AE7 C; 
#chains in the Genus database with same CATH homology
 1CI6 A;  1H89 A;  5APT A;  5CCG A;  2WWW A;  3HE5 A;  1YYC A;  4EOT A;  2OAR A;  5CCH D;  1G1I A;  2M8R A;  4I2L C;  3P8M C;  1FZA A;  1L4A B;  1FOS E;  3A3Y B;  3M91 A;  3SWF A;  3HD7 C;  1MV8 A;  2WIT A;  3WMM 0;  2PAJ A;  3V5B A;  4IFD K;  2R3C A;  1FBM A;  2NPS C;  4XE5 B;  1SFC C;  2Z4E A;  3UIA A;  3NTN A;  2N1T D;  1N73 A;  3LID A;  1S9K D;  3M0D C;  3GHG B;  1GZL A;  4I6M C;  5AW4 B;  3VP8 A;  1N7S D;  1JO5 A;  3NMD A;  1M1J B;  2Q3I A;  3B5N C;  3V2P A;  5AVX B;  2C0X A;  1NO4 A;  2A45 H;  3TSI A;  2N1T B;  1SP4 A;  3KYQ A;  1GU4 A;  3P7K A;  3IR9 A;  1M7L A;  2E42 A;  1LTJ A;  2Z5I A;  3A2A A;  1GL2 A;  1J1E B;  2GUS A;  2IFN A;  4XA4 A;  3B8E B;  3BRV B;  2XKM A;  1N7S B;  4N78 D;  2WZ7 A;  1NWQ A;  5AVS B;  3VMY A;  1W2E A;  1J1D B;  5CMZ A;  2YKO A;  1FZB A;  3BAT A;  2P7J A;  1N73 B;  2OYH A;  2WPQ A;  1IFM A;  1NKN A;  1GW4 A;  4DOJ A;  3HE4 A;  2FYZ A;  3EQ2 A;  2KOG A;  3HD7 A;  1URQ A;  3HTK A;  1L4A C;  2C9N Y;  3KQG A;  2HOD A;  2XNX A;  1AQ5 A;  1SFC A;  3OAK A;  5AVY B;  1JOC A;  2YO3 A;  2I1K A;  5KJ7 C;  5CCH C;  1NH4 A;  1X8Y A;  1GTW A;  3P8C E;  4W7Y A;  1T8Z A;  1FZE A;  1EQ7 A;  1KIL C;  1JCD A;  1RF1 B;  2N9B A;  4W7Z A;  1RE4 C;  1G2C A;  1CZQ A;  1MZ9 A;  1NAF A;  2FFD A;  2W6B A;  1GDT A;  4ZKP A;  1A02 F;  2N1T C;  1WT6 A;  1L0L K;  3H6P A;  5AVZ B;  4GKG A;  2XU6 A;  2HFE D;  3VOP A;  1FZG A;  5BU8 B;  3MUD A;  1N7S C;  4GT1 A;  1SLQ A;  2WSE H;  1SQP K;  1WRG A;  3HRN A;  5APV A;  2HPC A;  1IFI A;  5AVV B;  2JJL A;  4LC1 A;  5CHX A;  3RL0 C;  1FJK A;  2A45 G;  3OA7 A;  3V2Q A;  3OJA B;  3V2R A;  5AW2 B;  1GD2 E;  1H88 A;  1RE3 A;  1NOH A;  1NTM K;  2GUV A;  2C0W A;  1VPC A;  2QM7 A;  3NXS A;  1HWT C;  4M3L A;  5AW8 B;  4O9B A;  3H32 A;  3RK3 D;  3IFM A;  1KFN A;  5KJ7 A;  1LT9 C;  4JYB A;  5CJ0 A;  3TK1 A;  1N86 A;  4C7N A;  2A45 I;  1JY3 P;  2OYI A;  4IFF A;  5AW0 B;  1RF1 C;  3RK3 B;  1GW3 A;  4N78 E;  5CCG D;  2IPP A;  1LWU B;  1XTC C;  3E1I A;  1IC2 A;  1JTH B;  1RY3 A;  3BAS A;  1DX7 A;  3TNU A;  3HUS A;  2HYN A;  1CI6 B;  2M3B A;  3MD0 A;  1LTB C;  1HJB A;  3M06 A;  3HE5 B;  5APX A;  1CW5 A;  1IK9 A;  1HH0 A;  4WY4 A;  1IFN A;  1KZU B;  1FZF A;  3MGN A;  4OH8 B;  5APS A;  1OXZ A;  1ZR2 A;  1FZC A;  2E43 A;  3BVH A;  2IX7 C;  4EIJ A;  1FDM A;  3O8Z A;  5AVU B;  4HH2 A;  1RF0 C;  3L4F A;  2O01 H;  3RK2 D;  1KIL A;  1QL1 A;  2ZXE B;  2YO2 A;  1NTK K;  2YKQ A;  3P32 A;  4Y99 B;  2H43 A;  4C7R A;  1GL2 D;  1LTS C;  3M9H A;  1ZN5 A;  3HUS B;  4JYC A;  2WTY A;  3MTU E;  3RK2 B;  2WPS A;  3N4X A;  2CPS A;  3U1C A;  3V2N A;  1MUU A;  2HG5 D;  1ZLL A;  2NPS A;  3VN0 A;  1SQQ K;  1LTJ B;  1GL2 B;  2YMY A;  2KSJ A;  2KLV A;  2QM8 A;  2KB7 P;  5AW1 B;  4AYC A;  1LWU C;  2W6A A;  2XZR A;  4JF7 A;  2POH A;  1A02 J;  1SQV K;  3M0D A;  3HD7 D;  1URQ D;  2GM4 A;  1NKZ B;  3B5N A;  3GHG C;  4HYT B;  5AVW B;  2P2U A;  5AW5 B;  2KYV A;  1M1J C;  3LIE A;  2OYH B;  1SFC D;  5CCG C;  1E5W A;  3HE4 B;  4WBA A;  3HD7 B;  1URQ B;  3HTK B;  4GIF A;  3VMZ A;  1J1E C;  2CPB A;  5AW3 B;  2H8P D;  1FU1 A;  2HOD B;  5AVR B;  2R32 A;  4WB4 A;  1LGH B;  1SFC B;  3SWY A;  1ZV8 A;  1J1D C;  3EFG A;  1HBW A;  4N3Y B;  5AW6 B;  3TYY A;  1N73 C;  2FKW B;  1YTZ I;  1G1J A;  1LTA C;  1L4A A;  1G2C B;  1XTG B;  2PP6 A;  3RK2 C;  1S9K E;  5AW7 B;  1JCC A;  5APW A;  3L37 A;  2FFD B;  1JMM A;  3P8C D;  2H7H A;  1T3U A;  3M9Q A;  2O1J A;  4W80 A;  5CCH A;  1AFO A;  3CLQ A;  3I5C A;  1X9V A;  3KPE A;  2O1K A;  2FYU K;  1VDF A;  2P1J A;  1RE4 A;  1JUN A;  1N7L A;  3U59 A;  1LTG C;  2HPC B;  1M1J A;  1SQX K;  1IJD B;  3N7N A;  2Z5H A;  2N1T A;  1H8A A;  2OYH C;  5KJ7 D;  1JY2 P;  2XDJ A;  4B86 A;  1KFM A;  1PFI A;  3A5T A;  1URQ C;  1N7S A;  1HTL C;  2WPR A;  3C9I A;  4DZO A;  2C9L Y;  3H32 B;  5BVZ A;  4AQR D;  4N6J A;  5AVQ B;  2HLO A;  2FXM A;  3L35 A;  2YNY A;  5AVT B;  4C7N B;  1JY3 O;  1OWA A;  2OYI B;  1FOS F;  5BU5 A;  1GK4 A;  2Q5U A;  3A7O A;  3M9B A;  5AW9 B;  1NHL A;  2JEE A;  2WT7 A;  1J2J B;  4WY4 D;  1JY2 O;  3VYI A;  2FFD C;  3RL0 D;  1LT9 A;  1T2K D;  3L36 A;  3KDP B;  1SQB K;  1HGV A;  3TNU B;  3VTP C;  1HUC A;  3NFQ A;  4LGD E;  2Q9I A;  1LTT C;  5KTB A;  1MFZ A;  2P67 A;  2J58 A;  3VMX A;  1KIL D;  1RF1 A;  4WY4 B;  1FAV A;  3RL0 B;  5KLV K;  1DH3 A;  3RK3 C;  1FZC B;  1L0N K;  2BAS A;  2LKM A;  1QL2 A;  4ZKU A;  1JNM A;  1RE3 C;  1KIL B;  2XV5 A;  2J59 M;  1IFJ A;  1T3J A;  1LTI C;  2WT7 B;  2KP8 A;  2WSF H;  2NPS D;  3V4Q A;  2VRS A;  2YKP A;  1LT9 B;  5APY A;  1NTZ K;  4AUW A;  1SVF A;  2ZFC A;  1Z56 A;  3U1A A;  3PP5 A;  2MJZ A;  1ZR4 A;  1GU5 A;  3BRT B;  2R5D A;  1FJP A;  2L5G B;  3CI9 A;  3G3Z A;  4RES B;  1NU1 K;  1RF0 A;  2OYI C;  3B5N D;  2NPS B;  2I1J A;  4Y99 C;  2Q7C A;  2W27 A;  1CSB A;  2R5B A;  1YTZ T;  1JY3 N;  3B5N B;  3HUS C;  1X79 B;  2IFM A;  3LW5 H;  3MIW A;  3II6 A;  5CJ4 A;  4IFM A;  4KHX A;  3T97 A;  1IFD A;  3VP9 A;  3CL3 D;  4WY4 C;  1GK6 A;  1LTJ C;  1GL2 C;  4LLH A;  2WSC H;  1T2K C;  1JY2 N;  1LWU A;  1FZC C;  1KQL A;  4I1L A;  1DEB A;  3V4W A;  3R2P A;  1HVV A;  1L4A D;  1JTH A;  1IO4 A;  5APU A;  3GHG A;  4C46 A;  5APQ A;  3M0A A;  1N2D C;  1HGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...