1IFIA

Molecular models and structural comparisons of native and mutant class i filamentous bacteriophages ff (fd, f1, m13), if1 and ike
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
50
structure length
50
Chain Sequence
AEGDDPAKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular models and structural comparisons of native and mutant class I filamentous bacteriophages Ff (fd, f1, M13), If1 and IKe.
pubmed doi rcsb
source organism Enterobacteria phage fd
molecule tags Virus
molecule keywords INOVIRUS
total genus 21
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1994-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ifiA00
2CPBA 1IFJA 1NH4A 2MJZA 1HH0A 1IFDA 2CPSA 1FDMA 2C0WA 1IFIA 1HGZA 1HGVA 2C0XA
chains in the Genus database with same CATH superfamily
4XA4A 1KILA 3L71E 1YBKA 3CL3D 4WVZA 3H1KD 3VN0A 4BWNA 1FZBA 2QRXA 2QEXP 1L0LK 3E1RA 2RN0A 1KILC 3AE9C 1LJ2A 3CXHH 4BXLA 1VQ5P 3L4FA 1NOHA 4YXWH 1NTKD 2FXMA 3HD7A 1L0LD 1M1JA 3A2AA 3H1LD 1FOSE 5KTBA 4JYCA 2Q3IA 1YTZT 2QM7A 2V7QJ 3L36A 3WUUA 4ZNCA 1DEBA 3HUSB 3NXSA 1KYOH 3CXHE 3GLMA 1ZV8A 1GL2C 1P84H 1RE3A 5DJUB 5KKZC 4K35A 2E76B 2J5UA 5AVYB 2E5TA 3TGUE 3HD7D 3B5NB 1GL2B 5CJ4A 5AW8B 4AYCA 1KZUB 2UWJE 1T2KD 2W90A 1H88A 3CC2P 3FXDA 4C7NA 1OX3A 5AW6B 1PIXA 1L0LG 1WT6A 3H1LG 2IYPA 3MUDA 4IFFA 2W6JH 1ZR4A 4KT0J 1ZOYC 3ITKA 2O01H 3JCUH 1WMKA 5C39A 3SSUA 3VYIA 1NJIQ 1EXJA 3V2PA 1QVFO 1JTHB 2WPQA 1JY3P 1SS1A 2WSSH 4LLHA 3CCSP 3CMAP 3Q5RA 3TYYA 1OW6A 1T3UA 2AXTH 1HJBA 4WBAA 1NH4A 2HODB 4D6TD 1SQVG 4YPCA 1YI2P 2C0WA 2K9JA 2KUBA 1KQLA 2KNCA 1S1CX 3AE5C 5AW3B 3Q5PA 3H1HD 1S5LH 1S72P 3H6PA 5KLVK 1CW5A 5GTIH 2P58A 1FE6A 1K05A 3HUSC 1G2CB 2ZYAA 3JCUE 4TT3H 4HYTB 2IZ1A 5E79E 5BU5A 1VQ6P 3G3ZA 4GDOA 1Q2NA 2E74B 2IFNA 3SFEC 2N1TC 5AW7B 2E76D 1N7LA 1URQB 3C8VA 2YNYA 5KAIH 3CXHD 2AXTE 3M9BA 3R2PA 5CMZA 1BDDA 1NAYA 5AVVB 3WU2H 1Y9BA 3AEFC 4OH8B 5E79H 3HE5A 3KPEA 1YJNP 4JYBA 2YKOA 1JM0A 2WWWA 5CCHA 1JCCA 2OYIB 3D70A 1KTMA 2B9BA 3PJSK 3G71P 1YHQP 2BEZF 1S5LE 1KQSO 4B86A 1SQXE 1HH0A 1QX8A 2G8YA 1ZXGA 3F89A 4K3AA 1OZHA 3PP5A 3VP9A 4U3FG 1N73B 4L75A 3VMZA 1SFCC 1SQVE 3CCLP 3AE2C 1M57D 1HGZA 3WU2E 2QJYC 3S4RA 3H1KJ 1SQVJ 4O9BA 1MFTA 3GF3A 4ZKUA 1FU1A 2E43A 3M0DC 1IFDA 1IFMA 1YQ4C 3H1KE 4Y99C 4DJGA 4L76A 1GMJA 3TNUB 3O6QA 1VQMP 1Q82Q 4BRYA 2E74C 4HH2A 2SPZA 5BVZA 1USEA 1J1EC 1CI6A 2A45G 3B8EB 3GF7A 4PD4D 1K8AQ 3L73G 1NTMK 5CCHC 3CCUP 2JP3A 2J58A 3IR9A 3AE6C 1GU4A 2B88A 1EQ7A 2IDBA 3HTKB 2JWDA 2Q5UA 1RF1C 5APWA 1JY3N 1MV8A 3E7KA 1Y8AA 1X22A 1PGPA 4U3FD 3TDKA 2A45H 1IFIA 2Q3EA 3G9RA 4KHXA 4DT0A 1IK9A 3MP7B 2KOGA 1HVVA 1NKNA 2PGDA 2ZAEB 1RF0C 3USSA 2OYHB 5KKZB 2A06E 5CJ0A 2ZYDA 3NFQA 4H0LC 1JY2N 1DEEG 1M7LA 4I6MC 1SQVD 1NTMG 1RY3A 2AEFA 2B89A 5B66E 3FX0A 3L75J 3OW2O 4WY4C 1VQ4P 3ABVC 4W80A 1QL2A 5APSA 2POHA 2Z5IA 1SQBG 1NU1D 2PP6A 3L71G 2I8DA 2Y9YA 1ZR2A 1IFJA 2KYVA 4DOJA 1A02F 4Z1MH 1LTIC 1KFMA 2YIUC 3I56P 2KSEA 3FWNA 2FYUE 2BCCD 1FJPA 1VQ9P 5AW5B 1VF5C 3PLNA 3CD6P 2B87A 1LTJB 3TGUD 1AFOA 3RK2D 3CCJP 4H44C 3W67A 1JNMA 1JO5A 2JDIH 2KS1A 1NU1K 2HYNA 3RGUA 2Y9ZA 1NWQA 1FAVA 4IFDK 4L73A 2KLVA 1LP1A 1N7SC 3L72J 3O8ZA 4OGQB 5GTIE 2HPCB 2HLOA 2H88C 5B66H 1ZRTD 2O3JA 2N9YB 3L74J 3BASA 2ZVOB 4GIFA 2O01N 1BE3D 1AVYA 1FDOA 1NTKE 1RE3C 3M06A 3SWYA 1GL2A 1NTKG 4EI2A 1Q81Q 1FZFA 4D6TJ 2ZT9B 2KB7P 2OTJP 2IFMA 3CMEP 2IBZE 1J2JB 2YXRB 2WSEJ 3GHGB 4GOEA 5KAIE 3RK3B 2OYOA 1L4AD 3FGAD 1KYOI 3HD7C 1NTZJ 5TISE 1T6AA 2QSIA 2V7QH 3L70G 3T97A 4H13C 2IPPA 3VMAA 1RE4A 2GUSA 3EQ2A 2G3AA 4HJGH 4W7ZA 3JC22 4WY4D 2WT7A 1AJYA 4JBZA 1RH5B 2YMYA 4ASVA 2M3EA 3OAKA 1G1IA 5AW4B 1LGHB 1KC8Q 2QVAA 3AEGC 4I2LC 3VP8A 1Z56A 2GM4A 5TISH 1EZVI 1SQQK 1SQPK 1FBMA 3CX5D 3G4SP 2FY8A 2LXCB 3TGUG 3LW5J 5AW2B 2Q7CA 2P2UA 2L5GB 2W8ZA 3WUVA 1N73C 1SQPJ 1JEKA 1SQQJ 5EFWB 5GTHH 5AVWB 1L4AB 3RK2C 1J1DB 3RK3D 1LTAC 2ZFCA 5APXA 4C46A 5BU8B 4ZKPA 2XU6A 2W6AA 1NVOA 2NRGA 4GKGA 2ZT9D 3A0HH 3SWKA 2JKVA 1N73A 5AVZB 1MKMA 1FOSF 2PFXA 3KYQA 4DCKA 4PD4E 3V2NA 1NU1G 1SQBD 3A0BE 3S1KA 3TK1A 1YYCA 2KZJA 3CC7P 2YKQA 2CPBA 3CPWO 3L74G 1RQVA 3L72D 5APQA 5CBOA 1OVVA 2CK3H 3A3YB 4IL6E 1YITP 1H0TB 3L72G 1CZQA 1KB9E 1LTGC 2FYNC 2RMZA 5AW0B 1DD4A 1GTWA 4D6TG 2OYIA 4GODA 5GTHE 1Q7YQ 1EDLA 2FFDB 3HRNA 1GDTA 1FZCB 1SQPE 1SQQE 1SLQA 2P10A 3QWOC 1RHZB 1U7JA 1FC2C 2P67A 3V2RA 3L71D 1FZEA 1IC2A 1KFNA 2XKMA 1NHLA 2PRRA 4AUWA 1PGQA 1SQXD 1HUCA 1KN7A 2NPSB 2H8PD 3CX5H 5H2FH 3RL0C 2M3BA 1NO4A 2HG5D 3BCCJ 2E74D 1L0NE 1MZ9A 2KIKA 5CCGC 1K73Q 2M8RA 1VQNP 3TF5A 2I1JA 4QMAA 2OARA 1QVGO 2FFDC 1L0NJ 2Q9IA 3P8CE 4HB1A 2E75D 4U7JA 1FZCC 2KNCB 3V2QA 2E42A 1N8RQ 3TGUJ 3H1JE 2FBWC 1VPCA 1VQOP 1HWTC 5KLIB 2ZVNB 1LWUB 1XTCC 2E75C 2KSJA 1K9MQ 1W2BO 1ZMEC 1PZQA 5APYA 1M90Q 5CBNA 1AQTA 4WY4A 1EZVE 1OW7A 3CI9A 1SVFA 4JQ0D 3L70D 3B5NC 4ZMDA 4R4LA 3NMDA 2K88A 5KLVE 1D7MA 3MGNA 1EZVD 2IBZG 2XNXA 3CX5I 1BGYG 4PV1D 1YIJP 3RBZA 3KXDA 3VMXA 4EYYQ 3AE1C 2ITAA 4PJ0H 4Y99B 1X8YA 1LT9A 1HTLC 1LTTC 3QH9A 3LW5H 3EWKA 3G6EP 1JY2P 1BGYJ 1IO4A 1KILB 1BSNA 1SQXJ 2Q6QA 2M5AB 2W6BA 4H44D 1GW3A 3BATA 3H1IG 3FWLA 4NPDA 2FYUG 2QJKC 1X0TA 2H89C 1N2DC 1OIPA 1JB0J 3H1IE 3PRJA 3BCCG 2N1TA 1LNQA 1LT9C 2A06G 2ZXEB 4OGQD 3OA7A 1T2KC 1YJWP 1RQUA 3HUSA 1KORA 1QEXA 1IK7A 5AW9B 2R32A 4EIJA 1NTME 2HPCA 1G1JA 2M0BA 2P7JA 2KZIA 3JSVC 2QJPB 1BE3J 4C7RA 3B5NA 2R44A 1PGJA 2IYOA 1KB9D 2PAJA 4C7NB 1BGYE 1N7SD 4XE5B 3S9OA 2D2CB 1P84D 1RF1B 1PP9J 2YO2A 4PV1B 5KLVG 1IZNB 1FDIA 1BCCJ 1PP9E 3IAOA 2P1JA 4DZOA 3M91A 4N6JA 4IFMA 5KAFH 1SQBE 2WTYA 2MJZA 1VQLP 1BCCE 1S4XA 3F5HA 3OJAB 4OWFA 2MKVA 2QIWA 3H1KG 2O1KA 1H89A 5B5EE 1SP4A 1HF9A 1IFNA 1UIXA 3PHLA 3SWFA 3U1CA 2OTLP 3H1JG 4GT1A 2OGUA 3N4XA 3BCCD 3ZDMA 5AVUB 3O6QB 3H1JD 1AQ5A 3L73J 1SFCB 2XZRA 1SFCD 2OTKE 2R5BA 3KHUA 3AE3C 3CWBE 1CI6B 3LIDA 5H2FE 1GZLA 5B5EH 1GU5A 1NTZD 2XV5A 1BDCA 1P84E 1SQXG 2BCCG 3MIWA 2JJLA 3HTKA 3NTNA 2WZ7A 1OMIA 3HD7B 1M1JB 2ZYGA 1BCCD 4UB8H 2RH0A 1NTMD 2BEQD 2OYIC 3H32B 5DJTB 1SQPG 1SQQG 3HE5B 2R5DA 3GG2A 2D2CD 1KV4A 1BE3G 1BGYD 3CCRP 2O01J 1NTMJ 2AEMA 1CSBA 2KP8A 2L91A 3R4YA 4H13D 2C0XA 3B5ND 1BE3E 3BVHA 1L0NG 3IFMA 2Q1KA 2WPVB 3L73E 1H8AA 3L35A 3U1AA 3L71J 2Z4EA 2LR2A 2XNDH 4H44B 1NYHA 1OW8A 3KDPB 2WPRA 1M1KQ 1SQBK 3A7OA 2QJPC 2Y0DA 3RL0g 2YMKA 3H1ID 3D6YA 4N78D 1NAFA 2K37A 4KJMA 4W7YA 3E1IA 3C9IA 4GOFA 3K5BA 3MTUE 2HODA 4PD4I 3AE8C 1R5SA 3TNUA 1KILD 1VL2A 1LWUC 1XTGB 2WPSA 2DW3A 2FYZA 3LIEA 3VMYA 3L70E 1URQD 3I5CA 4IOIH 3H1HJ 1P84I 1NTKJ 1RE4C 4JF7A 4MN4C 2H43A 2GUVA 3AECC 1VQ8P 1T8ZA 1S5LX 2Z5HA 4D6TE 4UB6H 1HGVA 4M3LA 1NTKK 3MD0A 1FS0E 1PPJD 4PV1C 1AV1A 1S9KD 3GHGA 3BRTB 4PD4H 1PPJG 5AVSB 2KXPB 1JY3O 1VQKP 2AXCA 1URQA 2NZ2A 4H0LD 4WWIA 5KLVD 1T3JA 1NTZG 2O1JA 3MZWB 4LGDE 5APUA 4A7PA 2YIUB 2OYHA 3HE4B 1PFIA 3C1LA 3CCVP 1ZP0C 1JMBA 1JMMA 1N7SA 5KJ7C 2YKPA 4RJTA 2LKMA 1YQ3C 1YJ9P 1L0NK 3W68A 2IZ0A 4N78E 3PH0A 1VQ7P 3IN6A 2WSCH 5AVXB 1Y47A 2K9JB 2K3RA 1E79H 1N86A 1DD3A 1R5LA 2QG4A 3B71A 3AEEC 1S3JA 1GW4A 2AEJA 1GK4A 2RKLA 2WMMA 1M56D 1L4AA 2W27A 2E75B 2WITA 3P8CD 4PJ0E 4R4MA 2M5AA 3P8MC 2IX7C 3EFGA 5AW1B 3WMM0 2NPSA 1G2CA 1L0LE 1HJ0A 3CXHI 2QE7H 3FXEA 3H1LE 3L75D 1GL2D 4I1LA 3KZIH 3M9HA 4L74A 1OVRA 1L0LJ 3H1LJ 1LTSC 5KAFE 3WUTA 3I55P 4WB4A 1S2EA 2R3CA 3RK3C 4CPGA 2W83C 3GW6A 1LT1A 2QJKB 2J59M 4RO0A 1VQPP 1LTJC 1M8OB 2HR3A 3GMAA 4BRYB 1LP1B 1Q90D 1DIPA 1RF0A 1SQQD 1SQPD 3A0HE 1HBWA 1SQVK 3L70J 3MHVA 1ZW0A 4OGQC 3L75E 2XDJA 3V4WA 3AE4C 4UB8E 2BASA 1GD2E 4EOTA 1KD1Q 3L37A 4N3YB 2JO1A 1W5CE 5KJ7D 1NTZE 4YTPC 3CCMP 1RF1A 1K04A 1SQXK 2FXPA 4OVNF 3KZIE 3P7KA 3IF4A 4AQRD 4IL6H 3T97B 1JCDA 4U3FE 1KB9H 1ZLLA 1JTHA 3BCCE 1EDJA 2WQYC 2BCCJ 3CX5E 5APVA 3UIAA 4Y28J 2R3SA 3M0AA 5L8RJ 3VOPA 1EC5A 2K1AA 3M0DA 1JY2O 2QM8A 5AVQB 3CCEP 4TLFA 3RBXA 4IL6X 2ZT9C 2ZXXA 3RK3E 3H1HE 3N7NA 4ASWA 1VF5D 1TU3F 1VF5B 1SFCA 1KMIZ 3BRVB 4JPZB 2E76C 3CC4P 1S9KE 1EZVG 2IBZD 1PPJE 1X79B 2H7HA 1J1DC 1WRGA 1JOCA 4RKUJ 2K9YA 1NKZB 1USDA 2D2CC 2B87B 2LXBA 2WVRA 1MFZA 4WY4B 4EDFA 1PV3A 2FKWB 2C9NY 1A02J 2C9LY 1OWAA 3AEBC 1KILE 2FYNB 2NPSC 5TJHA 3RL0B 1PGOA 1FJKA 2KLUA 3AEAC 2N1TD 1L4AC 4NPEA 3RK2B 2WSEH 1J1EB 2KI7B 1L2PA 4H13B 1AA0A 2FFDA 2FYUD 3CCQP 2Y0CA 2NPSD 1FZCA 2KK7A 1YTZI 1ZRTE 3AEDC 1U7MA 2A45I 3CLQA 2YXQB 3II6A 1QLED 3P32A 3A5TA 2V4HA 1OFCX 2ZJSE 1IFPA 1NU1E 4UB6E 2YO3A 5CCGA 1KB9I 1OVUA 2FYUJ 1FZAA 5KLIC 2I1KA 3VTPC 2OYHC 2OQQA 3L73D 3D71A 3H1IJ 4LC1A 1FZGA 1ZN5A 2BCCE 2FYUK 1URQC 2N9BA 1LTJA 1QL1A 1NTZK 2N1TB 4I7ZB 3GHGC 5APTA 5M1BA 5CCHD 3D6ZA 3L72E 2CPSA 1FDMA 2KS1B 4NPFX 3RL0D 2FXOA 3V4QA 2VRSA 3TSIA 3L74E 2QJYB 2QA4P 1EDIA 1UIIA 1IJDB 2JWAA 1KQFB 2JR8A 4YXDC 5K5GB 3Q1MA 3CWBJ 5CHXA 1KYOD 1LWUA 1Q86Q 2WSCJ 5AVTB 3Q5SA 1DH3A 2A06D 3L75G 4HKZH 1BCCG 3MUDC 3U59A 1NU1J 4XFJA 1GK6A 1AVOA 3A0BH 3AE7C 1U57A 4I7ZC 1PP9G 3CWBD 1KQGB 1SQBJ 2GA1A 2HFED 4U3FJ 1QGKB 1LTBC 5KLVJ 1E5WA 3B4SA 3CWBG 3EFFK 4H0LB 1EXIA 3H32A 3H25A 1BSHA 2WSFH 2WT7B 1JUNA 5KJ7A 1H0TA 3H1HG 3HE4A 3KQGA 3V5BA 1N7SB 3M9QA 3V6IA 1MUUA 3Q3DA 1VDFA 5AVRB 1W2EA 1KYOE 1L0ND 2E5YA 1PL5A 2Y0EA 1LT9B 4RESB 2WSFJ 1EDKA 1OXZA 1M1JC 2IBZI 1X9VA 1NGMB 3H1JJ 3PTZA 3SFDC 1R8EA 2JEEA 3Q2YA 5CCGD 1PP9D 3L74D 1DX7A
chains in the Genus database with same CATH topology
4XA4A 1KILA 3VN0A 3CL3D 1FZBA 1L0LK 1KILC 3L4FA 1NOHA 2FXMA 3HD7A 1M1JA 3A2AA 1FOSE 5KTBA 4JYCA 2Q3IA 1YTZT 2QM7A 3L36A 1DEBA 3HUSB 3NXSA 1ZV8A 1GL2C 1RE3A 5AVYB 3HD7D 3B5NB 1GL2B 5CJ4A 5AW8B 4AYCA 1KZUB 1T2KD 1H88A 4C7NA 5AW6B 1WT6A 3MUDA 4IFFA 1ZR4A 2O01H 3VYIA 3V2PA 1JTHB 2WPQA 1JY3P 4LLHA 3TYYA 1T3UA 1HJBA 4WBAA 1NH4A 2HODB 2C0WA 1KQLA 5AW3B 3H6PA 5KLVK 3HUSC 1G2CB 5BU5A 4HYTB 3G3ZA 2IFNA 2N1TC 5AW7B 1N7LA 1URQB 2YNYA 3M9BA 5CMZA 5AVVB 3R2PA 4OH8B 3HE5A 3KPEA 2YKOA 2WWWA 2OYIB 5CCHA 1JCCA 4B86A 1HH0A 3PP5A 3VP9A 3VMZA 1SFCC 1HGZA 4O9BA 4ZKUA 1FU1A 2E43A 3M0DC 1IFDA 1IFMA 4Y99C 3TNUB 4HH2A 5BVZA 1J1EC 1CI6A 2A45G 3B8EB 1JO5A 1NTMK 5CCHC 1GU4A 3IR9A 2J58A 1EQ7A 3HTKB 2Q5UA 1RF1C 5APWA 1JY3N 1MV8A 2A45H 1IFIA 4KHXA 1IK9A 2KOGA 1HVVA 1NKNA 2OYHB 1RF0C 5CJ0A 3NFQA 1JY2N 1M7LA 4I6MC 1RY3A 4WY4C 4W80A 1QL2A 5APSA 2Z5IA 2POHA 2PP6A 1ZR2A 1IFJA 2KYVA 4DOJA 1A02F 1LTIC 1KFMA 1FJPA 5AW5B 1LTJB 1AFOA 3RK2D 1JNMA 1NWQA 1NU1K 2HYNA 1FAVA 4IFDK 2KLVA 1N7SC 3O8ZA 2HPCB 2HLOA 4GIFA 3BASA 3SWYA 1RE3C 3M06A 1GL2A 1FZFA 2KB7P 2IFMA 1J2JB 3GHGB 1L4AD 3HD7C 3T97A 2IPPA 1RE4A 2GUSA 3EQ2A 4W7ZA 4WY4D 2WT7A 2YMYA 3OAKA 1G1IA 5AW4B 1LGHB 3VP8A 4I2LC 1Z56A 2GM4A 1SQQK 1SQPK 1FBMA 5AW2B 2Q7CA 2P2UA 2L5GB 1N73C 5AVWB 1L4AB 3RK2C 1J1DB 3RK3D 1LTAC 2ZFCA 5APXA 4C46A 5BU8B 4ZKPA 2XU6A 2W6AA 4GKGA 1N73A 5AVZB 1FOSF 3KYQA 3V2NA 3TK1A 1YYCA 2YKQA 2CPBA 5APQA 3A3YB 1CZQA 1GTWA 1LTGC 2OYIA 5AW0B 2FFDB 3HRNA 1GDTA 1FZCB 1SLQA 2P67A 3V2RA 1FZEA 1IC2A 1KFNA 2XKMA 1NHLA 4AUWA 1HUCA 2NPSB 2H8PD 3RL0C 2M3BA 1NO4A 2HG5D 1MZ9A 5CCGC 2I1JA 2OARA 2Q9IA 3P8CE 1FZCC 2E42A 3V2QA 1VPCA 1HWTC 1LWUB 1XTCC 2KSJA 5APYA 4WY4A 3CI9A 1SVFA 3B5NC 3NMDA 3MGNA 2XNXA 3VMXA 4Y99B 1X8YA 1LT9A 1HTLC 1LTTC 3LW5H 1JY2P 1IO4A 1KILB 2W6BA 1GW3A 3BATA 1N2DC 2N1TA 1LT9C 2ZXEB 3OA7A 1T2KC 3HUSA 5AW9B 2R32A 4EIJA 2HPCA 1G1JA 2P7JA 4C7RA 3B5NA 2PAJA 4C7NB 4XE5B 1N7SD 1RF1B 2YO2A 1CW5A 4DZOA 2P1JA 2WTYA 3M91A 4N6JA 4IFMA 2MJZA 3OJAB 1H89A 2O1KA 1SP4A 1IFNA 3SWFA 3U1CA 4GT1A 3N4XA 1AQ5A 5AVUB 1SFCB 2XZRA 1SFCD 2R5BA 3LIDA 1GU5A 1CI6B 1GZLA 2XV5A 3MIWA 2JJLA 3HTKA 3NTNA 2WZ7A 3HD7B 1M1JB 2OYIC 3H32B 3HE5B 2R5DA 1CSBA 2KP8A 2C0XA 3B5ND 3BVHA 3IFMA 1H8AA 3L35A 3U1AA 2Z4EA 3KDPB 2WPRA 1SQBK 3A7OA 4N78D 1NAFA 4W7YA 3E1IA 3C9IA 3MTUE 2HODA 3TNUA 1KILD 1XTGB 1LWUC 3LIEA 2WPSA 2FYZA 3VMYA 1URQD 3I5CA 4JF7A 2H43A 1RE4C 2GUVA 1T8ZA 2Z5HA 1HGVA 4M3LA 1NTKK 3MD0A 1S9KD 3GHGA 3BRTB 5AVSB 1JY3O 1URQA 1T3JA 2O1JA 5APUA 4LGDE 1PFIA 2OYHA 3HE4B 1JMMA 1N7SA 5KJ7C 2YKPA 2LKMA 1L0NK 4N78E 5AVXB 2WSCH 2FFDC 1N86A 3TSIA 1GW4A 2WITA 1GK4A 1L4AA 2W27A 3P8CD 3P8MC 5AW1B 2IX7C 3EFGA 3WMM0 2NPSA 1G2CA 4I1LA 1GL2D 1N73B 3M9HA 1LTSC 4WB4A 2R3CA 3RK3C 2J59M 1LTJC 1RF0A 1HBWA 1SQVK 2XDJA 3V4WA 1GD2E 2BASA 4EOTA 3L37A 4N3YB 5KJ7D 1RF1A 1SQXK 3P7KA 4AQRD 1JCDA 1ZLLA 1JTHA 3UIAA 5APVA 3M0AA 3VOPA 3M0DA 1JY2O 2QM8A 5AVQB 3N7NA 1SFCA 3BRVB 1S9KE 2H7HA 1X79B 1J1DC 1WRGA 1JOCA 1NKZB 1MFZA 4WY4B 2C9NY 2FKWB 1A02J 2C9LY 1OWAA 2NPSC 3RL0B 1FJKA 2N1TD 1L4AC 3RK2B 2WSEH 1J1EB 2FFDA 2NPSD 1FZCA 4JYBA 1YTZI 3A5TA 2A45I 3CLQA 3II6A 3P32A 5CCGA 2YO3A 3VTPC 1FZAA 2I1KA 2OYHC 4LC1A 1FZGA 1ZN5A 2FYUK 1URQC 2N9BA 1LTJA 1QL1A 1NTZK 2N1TB 5APTA 3GHGC 5CCHD 2CPSA 1FDMA 3RL0D 3V4QA 2VRSA 1IJDB 5CHXA 1LWUA 1DH3A 3U59A 1GK6A 3RK3B 2HFED 1LTBC 1E5WA 3H32A 2WSFH 2WT7B 1JUNA 5KJ7A 3HE4A 3KQGA 3V5BA 1N7SB 3M9QA 1MUUA 1VDFA 5AVRB 1W2EA 4RESB 5AVTB 1LT9B 1OXZA 1M1JC 1X9VA 2JEEA 5CCGD 2M8RA 1DX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CPB A;  1IFJ A;  1NH4 A;  2MJZ A;  1HH0 A;  1IFD A;  2CPS A;  1FDM A;  2C0W A;  1IFI A;  1HGZ A;  1HGV A;  2C0X A; 
#chains in the Genus database with same CATH topology
 4XA4 A;  1KIL A;  3L71 E;  1YBK A;  3CL3 D;  4WVZ A;  3H1K D;  3VN0 A;  4BWN A;  1FZB A;  2QRX A;  2QEX P;  1L0L K;  3E1R A;  2RN0 A;  1KIL C;  3AE9 C;  1LJ2 A;  3CXH H;  4BXL A;  1VQ5 P;  3L4F A;  1NOH A;  4YXW H;  1NTK D;  2FXM A;  3HD7 A;  1L0L D;  1M1J A;  3A2A A;  3H1L D;  1FOS E;  5KTB A;  4JYC A;  2Q3I A;  1YTZ T;  2QM7 A;  2V7Q J;  3L36 A;  3WUU A;  4ZNC A;  1DEB A;  3HUS B;  3NXS A;  1KYO H;  3CXH E;  3GLM A;  1ZV8 A;  1GL2 C;  1P84 H;  1RE3 A;  5DJU B;  5KKZ C;  4K35 A;  2E76 B;  2J5U A;  5AVY B;  2E5T A;  3TGU E;  3HD7 D;  3B5N B;  1GL2 B;  5CJ4 A;  5AW8 B;  4AYC A;  1KZU B;  2UWJ E;  1T2K D;  2W90 A;  1H88 A;  3CC2 P;  3FXD A;  4C7N A;  1OX3 A;  5AW6 B;  1PIX A;  1L0L G;  1WT6 A;  3H1L G;  2IYP A;  3MUD A;  4IFF A;  2W6J H;  1ZR4 A;  4KT0 J;  1ZOY C;  3ITK A;  2O01 H;  3JCU H;  1WMK A;  5C39 A;  3SSU A;  3VYI A;  1NJI Q;  1EXJ A;  3V2P A;  1QVF O;  1JTH B;  2WPQ A;  1JY3 P;  1SS1 A;  2WSS H;  4LLH A;  3CCS P;  3CMA P;  3Q5R A;  3TYY A;  1OW6 A;  1T3U A;  2AXT H;  1HJB A;  4WBA A;  1NH4 A;  2HOD B;  4D6T D;  1SQV G;  4YPC A;  1YI2 P;  2C0W A;  2K9J A;  2KUB A;  1KQL A;  2KNC A;  1S1C X;  3AE5 C;  5AW3 B;  3Q5P A;  3H1H D;  1S5L H;  1S72 P;  3H6P A;  5KLV K;  1CW5 A;  5GTI H;  2P58 A;  1FE6 A;  1K05 A;  3HUS C;  1G2C B;  2ZYA A;  3JCU E;  4TT3 H;  4HYT B;  2IZ1 A;  5E79 E;  5BU5 A;  1VQ6 P;  3G3Z A;  4GDO A;  1Q2N A;  2E74 B;  2IFN A;  3SFE C;  2N1T C;  5AW7 B;  2E76 D;  1N7L A;  1URQ B;  3C8V A;  2YNY A;  5KAI H;  3CXH D;  2AXT E;  3M9B A;  3R2P A;  5CMZ A;  1BDD A;  1NAY A;  5AVV B;  3WU2 H;  1Y9B A;  3AEF C;  4OH8 B;  5E79 H;  3HE5 A;  3KPE A;  1YJN P;  4JYB A;  2YKO A;  1JM0 A;  2WWW A;  5CCH A;  1JCC A;  2OYI B;  3D70 A;  1KTM A;  2B9B A;  3PJS K;  3G71 P;  1YHQ P;  2BEZ F;  1S5L E;  1KQS O;  4B86 A;  1SQX E;  1HH0 A;  1QX8 A;  2G8Y A;  1ZXG A;  3F89 A;  4K3A A;  1OZH A;  3PP5 A;  3VP9 A;  4U3F G;  1N73 B;  4L75 A;  3VMZ A;  1SFC C;  1SQV E;  3CCL P;  3AE2 C;  1M57 D;  1HGZ A;  3WU2 E;  2QJY C;  3S4R A;  3H1K J;  1SQV J;  4O9B A;  1MFT A;  3GF3 A;  4ZKU A;  1FU1 A;  2E43 A;  3M0D C;  1IFD A;  1IFM A;  1YQ4 C;  3H1K E;  4Y99 C;  4DJG A;  4L76 A;  1GMJ A;  3TNU B;  3O6Q A;  1VQM P;  1Q82 Q;  4BRY A;  2E74 C;  4HH2 A;  2SPZ A;  5BVZ A;  1USE A;  1J1E C;  1CI6 A;  2A45 G;  3B8E B;  3GF7 A;  4PD4 D;  1K8A Q;  3L73 G;  1NTM K;  5CCH C;  3CCU P;  2JP3 A;  2J58 A;  3IR9 A;  3AE6 C;  1GU4 A;  2B88 A;  1EQ7 A;  2IDB A;  3HTK B;  2JWD A;  2Q5U A;  1RF1 C;  5APW A;  1JY3 N;  1MV8 A;  3E7K A;  1Y8A A;  1X22 A;  1PGP A;  4U3F D;  3TDK A;  2A45 H;  1IFI A;  2Q3E A;  3G9R A;  4KHX A;  4DT0 A;  1IK9 A;  3MP7 B;  2KOG A;  1HVV A;  1NKN A;  2PGD A;  2ZAE B;  1RF0 C;  3USS A;  2OYH B;  5KKZ B;  2A06 E;  5CJ0 A;  2ZYD A;  3NFQ A;  4H0L C;  1JY2 N;  1DEE G;  1M7L A;  4I6M C;  1SQV D;  1NTM G;  1RY3 A;  2AEF A;  2B89 A;  5B66 E;  3FX0 A;  3L75 J;  3OW2 O;  4WY4 C;  1VQ4 P;  3ABV C;  4W80 A;  1QL2 A;  5APS A;  2POH A;  2Z5I A;  1SQB G;  1NU1 D;  2PP6 A;  3L71 G;  2I8D A;  2Y9Y A;  1ZR2 A;  1IFJ A;  2KYV A;  4DOJ A;  1A02 F;  4Z1M H;  1LTI C;  1KFM A;  2YIU C;  3I56 P;  2KSE A;  3FWN A;  2FYU E;  2BCC D;  1FJP A;  1VQ9 P;  5AW5 B;  1VF5 C;  3PLN A;  3CD6 P;  2B87 A;  1LTJ B;  3TGU D;  1AFO A;  3RK2 D;  3CCJ P;  4H44 C;  3W67 A;  1JNM A;  1JO5 A;  2JDI H;  2KS1 A;  1NU1 K;  2HYN A;  3RGU A;  2Y9Z A;  1NWQ A;  1FAV A;  4IFD K;  4L73 A;  2KLV A;  1LP1 A;  1N7S C;  3L72 J;  3O8Z A;  4OGQ B;  5GTI E;  2HPC B;  2HLO A;  2H88 C;  5B66 H;  1ZRT D;  2O3J A;  2N9Y B;  3L74 J;  3BAS A;  2ZVO B;  4GIF A;  2O01 N;  1BE3 D;  1AVY A;  1FDO A;  1NTK E;  1RE3 C;  3M06 A;  3SWY A;  1GL2 A;  1NTK G;  4EI2 A;  1Q81 Q;  1FZF A;  4D6T J;  2ZT9 B;  2KB7 P;  2OTJ P;  2IFM A;  3CME P;  2IBZ E;  1J2J B;  2YXR B;  2WSE J;  3GHG B;  4GOE A;  5KAI E;  3RK3 B;  2OYO A;  1L4A D;  3FGA D;  1KYO I;  3HD7 C;  1NTZ J;  5TIS E;  1T6A A;  2QSI A;  2V7Q H;  3L70 G;  3T97 A;  4H13 C;  2IPP A;  3VMA A;  1RE4 A;  2GUS A;  3EQ2 A;  2G3A A;  4HJG H;  4W7Z A;  3JC2 2;  4WY4 D;  2WT7 A;  1AJY A;  4JBZ A;  1RH5 B;  2YMY A;  4ASV A;  2M3E A;  3OAK A;  1G1I A;  5AW4 B;  1LGH B;  1KC8 Q;  2QVA A;  3AEG C;  4I2L C;  3VP8 A;  1Z56 A;  2GM4 A;  5TIS H;  1EZV I;  1SQQ K;  1SQP K;  1FBM A;  3CX5 D;  3G4S P;  2FY8 A;  2LXC B;  3TGU G;  3LW5 J;  5AW2 B;  2Q7C A;  2P2U A;  2L5G B;  2W8Z A;  3WUV A;  1N73 C;  1SQP J;  1JEK A;  1SQQ J;  5EFW B;  5GTH H;  5AVW B;  1L4A B;  3RK2 C;  1J1D B;  3RK3 D;  1LTA C;  2ZFC A;  5APX A;  4C46 A;  5BU8 B;  4ZKP A;  2XU6 A;  2W6A A;  1NVO A;  2NRG A;  4GKG A;  2ZT9 D;  3A0H H;  3SWK A;  2JKV A;  1N73 A;  5AVZ B;  1MKM A;  1FOS F;  2PFX A;  3KYQ A;  4DCK A;  4PD4 E;  3V2N A;  1NU1 G;  1SQB D;  3A0B E;  3S1K A;  3TK1 A;  1YYC A;  2KZJ A;  3CC7 P;  2YKQ A;  2CPB A;  3CPW O;  3L74 G;  1RQV A;  3L72 D;  5APQ A;  5CBO A;  1OVV A;  2CK3 H;  3A3Y B;  4IL6 E;  1YIT P;  1H0T B;  3L72 G;  1CZQ A;  1KB9 E;  1LTG C;  2FYN C;  2RMZ A;  5AW0 B;  1DD4 A;  1GTW A;  4D6T G;  2OYI A;  4GOD A;  5GTH E;  1Q7Y Q;  1EDL A;  2FFD B;  3HRN A;  1GDT A;  1FZC B;  1SQP E;  1SQQ E;  1SLQ A;  2P10 A;  3QWO C;  1RHZ B;  1U7J A;  1FC2 C;  2P67 A;  3V2R A;  3L71 D;  1FZE A;  1IC2 A;  1KFN A;  2XKM A;  1NHL A;  2PRR A;  4AUW A;  1PGQ A;  1SQX D;  1HUC A;  1KN7 A;  2NPS B;  2H8P D;  3CX5 H;  5H2F H;  3RL0 C;  2M3B A;  1NO4 A;  2HG5 D;  3BCC J;  2E74 D;  1L0N E;  1MZ9 A;  2KIK A;  5CCG C;  1K73 Q;  2M8R A;  1VQN P;  3TF5 A;  2I1J A;  4QMA A;  2OAR A;  1QVG O;  2FFD C;  1L0N J;  2Q9I A;  3P8C E;  4HB1 A;  2E75 D;  4U7J A;  1FZC C;  2KNC B;  3V2Q A;  2E42 A;  1N8R Q;  3TGU J;  3H1J E;  2FBW C;  1VPC A;  1VQO P;  1HWT C;  5KLI B;  2ZVN B;  1LWU B;  1XTC C;  2E75 C;  2KSJ A;  1K9M Q;  1W2B O;  1ZME C;  1PZQ A;  5APY A;  1M90 Q;  5CBN A;  1AQT A;  4WY4 A;  1EZV E;  1OW7 A;  3CI9 A;  1SVF A;  4JQ0 D;  3L70 D;  3B5N C;  4ZMD A;  4R4L A;  3NMD A;  2K88 A;  5KLV E;  1D7M A;  3MGN A;  1EZV D;  2IBZ G;  2XNX A;  3CX5 I;  1BGY G;  4PV1 D;  1YIJ P;  3RBZ A;  3KXD A;  3VMX A;  4EYY Q;  3AE1 C;  2ITA A;  4PJ0 H;  4Y99 B;  1X8Y A;  1LT9 A;  1HTL C;  1LTT C;  3QH9 A;  3LW5 H;  3EWK A;  3G6E P;  1JY2 P;  1BGY J;  1IO4 A;  1KIL B;  1BSN A;  1SQX J;  2Q6Q A;  2M5A B;  2W6B A;  4H44 D;  1GW3 A;  3BAT A;  3H1I G;  3FWL A;  4NPD A;  2FYU G;  2QJK C;  1X0T A;  2H89 C;  1N2D C;  1OIP A;  1JB0 J;  3H1I E;  3PRJ A;  3BCC G;  2N1T A;  1LNQ A;  1LT9 C;  2A06 G;  2ZXE B;  4OGQ D;  3OA7 A;  1T2K C;  1YJW P;  1RQU A;  3HUS A;  1KOR A;  1QEX A;  1IK7 A;  5AW9 B;  2R32 A;  4EIJ A;  1NTM E;  2HPC A;  1G1J A;  2M0B A;  2P7J A;  2KZI A;  3JSV C;  2QJP B;  1BE3 J;  4C7R A;  3B5N A;  2R44 A;  1PGJ A;  2IYO A;  1KB9 D;  2PAJ A;  4C7N B;  1BGY E;  1N7S D;  4XE5 B;  3S9O A;  2D2C B;  1P84 D;  1RF1 B;  1PP9 J;  2YO2 A;  4PV1 B;  5KLV G;  1IZN B;  1FDI A;  1BCC J;  1PP9 E;  3IAO A;  2P1J A;  4DZO A;  3M91 A;  4N6J A;  4IFM A;  5KAF H;  1SQB E;  2WTY A;  2MJZ A;  1VQL P;  1BCC E;  1S4X A;  3F5H A;  3OJA B;  4OWF A;  2MKV A;  2QIW A;  3H1K G;  2O1K A;  1H89 A;  5B5E E;  1SP4 A;  1HF9 A;  1IFN A;  1UIX A;  3PHL A;  3SWF A;  3U1C A;  2OTL P;  3H1J G;  4GT1 A;  2OGU A;  3N4X A;  3BCC D;  3ZDM A;  5AVU B;  3O6Q B;  3H1J D;  1AQ5 A;  3L73 J;  1SFC B;  2XZR A;  1SFC D;  2OTK E;  2R5B A;  3KHU A;  3AE3 C;  3CWB E;  1CI6 B;  3LID A;  5H2F E;  1GZL A;  5B5E H;  1GU5 A;  1NTZ D;  2XV5 A;  1BDC A;  1P84 E;  1SQX G;  2BCC G;  3MIW A;  2JJL A;  3HTK A;  3NTN A;  2WZ7 A;  1OMI A;  3HD7 B;  1M1J B;  2ZYG A;  1BCC D;  4UB8 H;  2RH0 A;  1NTM D;  2BEQ D;  2OYI C;  3H32 B;  5DJT B;  1SQP G;  1SQQ G;  3HE5 B;  2R5D A;  3GG2 A;  2D2C D;  1KV4 A;  1BE3 G;  1BGY D;  3CCR P;  2O01 J;  1NTM J;  2AEM A;  1CSB A;  2KP8 A;  2L91 A;  3R4Y A;  4H13 D;  2C0X A;  3B5N D;  1BE3 E;  3BVH A;  1L0N G;  3IFM A;  2Q1K A;  2WPV B;  3L73 E;  1H8A A;  3L35 A;  3U1A A;  3L71 J;  2Z4E A;  2LR2 A;  2XND H;  4H44 B;  1NYH A;  1OW8 A;  3KDP B;  2WPR A;  1M1K Q;  1SQB K;  3A7O A;  2QJP C;  2Y0D A;  3RL0 g;  2YMK A;  3H1I D;  3D6Y A;  4N78 D;  1NAF A;  2K37 A;  4KJM A;  4W7Y A;  3E1I A;  3C9I A;  4GOF A;  3K5B A;  3MTU E;  2HOD A;  4PD4 I;  3AE8 C;  1R5S A;  3TNU A;  1KIL D;  1VL2 A;  1LWU C;  1XTG B;  2WPS A;  2DW3 A;  2FYZ A;  3LIE A;  3VMY A;  3L70 E;  1URQ D;  3I5C A;  4IOI H;  3H1H J;  1P84 I;  1NTK J;  1RE4 C;  4JF7 A;  4MN4 C;  2H43 A;  2GUV A;  3AEC C;  1VQ8 P;  1T8Z A;  1S5L X;  2Z5H A;  4D6T E;  4UB6 H;  1HGV A;  4M3L A;  1NTK K;  3MD0 A;  1FS0 E;  1PPJ D;  4PV1 C;  1AV1 A;  1S9K D;  3GHG A;  3BRT B;  4PD4 H;  1PPJ G;  5AVS B;  2KXP B;  1JY3 O;  1VQK P;  2AXC A;  1URQ A;  2NZ2 A;  4H0L D;  4WWI A;  5KLV D;  1T3J A;  1NTZ G;  2O1J A;  3MZW B;  4LGD E;  5APU A;  4A7P A;  2YIU B;  2OYH A;  3HE4 B;  1PFI A;  3C1L A;  3CCV P;  1ZP0 C;  1JMB A;  1JMM A;  1N7S A;  5KJ7 C;  2YKP A;  4RJT A;  2LKM A;  1YQ3 C;  1YJ9 P;  1L0N K;  3W68 A;  2IZ0 A;  4N78 E;  3PH0 A;  1VQ7 P;  3IN6 A;  2WSC H;  5AVX B;  1Y47 A;  2K9J B;  2K3R A;  1E79 H;  1N86 A;  1DD3 A;  1R5L A;  2QG4 A;  3B71 A;  3AEE C;  1S3J A;  1GW4 A;  2AEJ A;  1GK4 A;  2RKL A;  2WMM A;  1M56 D;  1L4A A;  2W27 A;  2E75 B;  2WIT A;  3P8C D;  4PJ0 E;  4R4M A;  2M5A A;  3P8M C;  2IX7 C;  3EFG A;  5AW1 B;  3WMM 0;  2NPS A;  1G2C A;  1L0L E;  1HJ0 A;  3CXH I;  2QE7 H;  3FXE A;  3H1L E;  3L75 D;  1GL2 D;  4I1L A;  3KZI H;  3M9H A;  4L74 A;  1OVR A;  1L0L J;  3H1L J;  1LTS C;  5KAF E;  3WUT A;  3I55 P;  4WB4 A;  1S2E A;  2R3C A;  3RK3 C;  4CPG A;  2W83 C;  3GW6 A;  1LT1 A;  2QJK B;  2J59 M;  4RO0 A;  1VQP P;  1LTJ C;  1M8O B;  2HR3 A;  3GMA A;  4BRY B;  1LP1 B;  1Q90 D;  1DIP A;  1RF0 A;  1SQQ D;  1SQP D;  3A0H E;  1HBW A;  1SQV K;  3L70 J;  3MHV A;  1ZW0 A;  4OGQ C;  3L75 E;  2XDJ A;  3V4W A;  3AE4 C;  4UB8 E;  2BAS A;  1GD2 E;  4EOT A;  1KD1 Q;  3L37 A;  4N3Y B;  2JO1 A;  1W5C E;  5KJ7 D;  1NTZ E;  4YTP C;  3CCM P;  1RF1 A;  1K04 A;  1SQX K;  2FXP A;  4OVN F;  3KZI E;  3P7K A;  3IF4 A;  4AQR D;  4IL6 H;  3T97 B;  1JCD A;  4U3F E;  1KB9 H;  1ZLL A;  1JTH A;  3BCC E;  1EDJ A;  2WQY C;  2BCC J;  3CX5 E;  5APV A;  3UIA A;  4Y28 J;  2R3S A;  3M0A A;  5L8R J;  3VOP A;  1EC5 A;  2K1A A;  3M0D A;  1JY2 O;  2QM8 A;  5AVQ B;  3CCE P;  4TLF A;  3RBX A;  4IL6 X;  2ZT9 C;  2ZXX A;  3RK3 E;  3H1H E;  3N7N A;  4ASW A;  1VF5 D;  1TU3 F;  1VF5 B;  1SFC A;  1KMI Z;  3BRV B;  4JPZ B;  2E76 C;  3CC4 P;  1S9K E;  1EZV G;  2IBZ D;  1PPJ E;  1X79 B;  2H7H A;  1J1D C;  1WRG A;  1JOC A;  4RKU J;  2K9Y A;  1NKZ B;  1USD A;  2D2C C;  2B87 B;  2LXB A;  2WVR A;  1MFZ A;  4WY4 B;  4EDF A;  1PV3 A;  2FKW B;  2C9N Y;  1A02 J;  2C9L Y;  1OWA A;  3AEB C;  1KIL E;  2FYN B;  2NPS C;  5TJH A;  3RL0 B;  1PGO A;  1FJK A;  2KLU A;  3AEA C;  2N1T D;  1L4A C;  4NPE A;  3RK2 B;  2WSE H;  1J1E B;  2KI7 B;  1L2P A;  4H13 B;  1AA0 A;  2FFD A;  2FYU D;  3CCQ P;  2Y0C A;  2NPS D;  1FZC A;  2KK7 A;  1YTZ I;  1ZRT E;  3AED C;  1U7M A;  2A45 I;  3CLQ A;  2YXQ B;  3II6 A;  1QLE D;  3P32 A;  3A5T A;  2V4H A;  1OFC X;  2ZJS E;  1IFP A;  1NU1 E;  4UB6 E;  2YO3 A;  5CCG A;  1KB9 I;  1OVU A;  2FYU J;  1FZA A;  5KLI C;  2I1K A;  3VTP C;  2OYH C;  2OQQ A;  3L73 D;  3D71 A;  3H1I J;  4LC1 A;  1FZG A;  1ZN5 A;  2BCC E;  2FYU K;  1URQ C;  2N9B A;  1LTJ A;  1QL1 A;  1NTZ K;  2N1T B;  4I7Z B;  3GHG C;  5APT A;  5M1B A;  5CCH D;  3D6Z A;  3L72 E;  2CPS A;  1FDM A;  2KS1 B;  4NPF X;  3RL0 D;  2FXO A;  3V4Q A;  2VRS A;  3TSI A;  3L74 E;  2QJY B;  2QA4 P;  1EDI A;  1UII A;  1IJD B;  2JWA A;  1KQF B;  2JR8 A;  4YXD C;  5K5G B;  3Q1M A;  3CWB J;  5CHX A;  1KYO D;  1LWU A;  1Q86 Q;  2WSC J;  5AVT B;  3Q5S A;  1DH3 A;  2A06 D;  3L75 G;  4HKZ H;  1BCC G;  3MUD C;  3U59 A;  1NU1 J;  4XFJ A;  1GK6 A;  1AVO A;  3A0B H;  3AE7 C;  1U57 A;  4I7Z C;  1PP9 G;  3CWB D;  1KQG B;  1SQB J;  2GA1 A;  2HFE D;  4U3F J;  1QGK B;  1LTB C;  5KLV J;  1E5W A;  3B4S A;  3CWB G;  3EFF K;  4H0L B;  1EXI A;  3H32 A;  3H25 A;  1BSH A;  2WSF H;  2WT7 B;  1JUN A;  5KJ7 A;  1H0T A;  3H1H G;  3HE4 A;  3KQG A;  3V5B A;  1N7S B;  3M9Q A;  3V6I A;  1MUU A;  3Q3D A;  1VDF A;  5AVR B;  1W2E A;  1KYO E;  1L0N D;  2E5Y A;  1PL5 A;  2Y0E A;  1LT9 B;  4RES B;  2WSF J;  1EDK A;  1OXZ A;  1M1J C;  2IBZ I;  1X9V A;  1NGM B;  3H1J J;  3PTZ A;  3SFD C;  1R8E A;  2JEE A;  3Q2Y A;  5CCG D;  1PP9 D;  3L74 D;  1DX7 A; 
#chains in the Genus database with same CATH homology
 4XA4 A;  1KIL A;  3VN0 A;  3CL3 D;  1FZB A;  1L0L K;  1KIL C;  3L4F A;  1NOH A;  2FXM A;  3HD7 A;  1M1J A;  3A2A A;  1FOS E;  5KTB A;  4JYC A;  2Q3I A;  1YTZ T;  2QM7 A;  3L36 A;  1DEB A;  3HUS B;  3NXS A;  1ZV8 A;  1GL2 C;  1RE3 A;  5AVY B;  3HD7 D;  3B5N B;  1GL2 B;  5CJ4 A;  5AW8 B;  4AYC A;  1KZU B;  1T2K D;  1H88 A;  4C7N A;  5AW6 B;  1WT6 A;  3MUD A;  4IFF A;  1ZR4 A;  2O01 H;  3VYI A;  3V2P A;  1JTH B;  2WPQ A;  1JY3 P;  4LLH A;  3TYY A;  1T3U A;  1HJB A;  4WBA A;  1NH4 A;  2HOD B;  2C0W A;  1KQL A;  5AW3 B;  3H6P A;  5KLV K;  3HUS C;  1G2C B;  5BU5 A;  4HYT B;  3G3Z A;  2IFN A;  2N1T C;  5AW7 B;  1N7L A;  1URQ B;  2YNY A;  3M9B A;  5CMZ A;  5AVV B;  3R2P A;  4OH8 B;  3HE5 A;  3KPE A;  2YKO A;  2WWW A;  2OYI B;  5CCH A;  1JCC A;  4B86 A;  1HH0 A;  3PP5 A;  3VP9 A;  3VMZ A;  1SFC C;  1HGZ A;  4O9B A;  4ZKU A;  1FU1 A;  2E43 A;  3M0D C;  1IFD A;  1IFM A;  4Y99 C;  3TNU B;  4HH2 A;  5BVZ A;  1J1E C;  1CI6 A;  2A45 G;  3B8E B;  1JO5 A;  1NTM K;  5CCH C;  1GU4 A;  3IR9 A;  2J58 A;  1EQ7 A;  3HTK B;  2Q5U A;  1RF1 C;  5APW A;  1JY3 N;  1MV8 A;  2A45 H;  1IFI A;  4KHX A;  1IK9 A;  2KOG A;  1HVV A;  1NKN A;  2OYH B;  1RF0 C;  5CJ0 A;  3NFQ A;  1JY2 N;  1M7L A;  4I6M C;  1RY3 A;  4WY4 C;  4W80 A;  1QL2 A;  5APS A;  2Z5I A;  2POH A;  2PP6 A;  1ZR2 A;  1IFJ A;  2KYV A;  4DOJ A;  1A02 F;  1LTI C;  1KFM A;  1FJP A;  5AW5 B;  1LTJ B;  1AFO A;  3RK2 D;  1JNM A;  1NWQ A;  1NU1 K;  2HYN A;  1FAV A;  4IFD K;  2KLV A;  1N7S C;  3O8Z A;  2HPC B;  2HLO A;  4GIF A;  3BAS A;  3SWY A;  1RE3 C;  3M06 A;  1GL2 A;  1FZF A;  2KB7 P;  2IFM A;  1J2J B;  3GHG B;  1L4A D;  3HD7 C;  3T97 A;  2IPP A;  1RE4 A;  2GUS A;  3EQ2 A;  4W7Z A;  4WY4 D;  2WT7 A;  2YMY A;  3OAK A;  1G1I A;  5AW4 B;  1LGH B;  3VP8 A;  4I2L C;  1Z56 A;  2GM4 A;  1SQQ K;  1SQP K;  1FBM A;  5AW2 B;  2Q7C A;  2P2U A;  2L5G B;  1N73 C;  5AVW B;  1L4A B;  3RK2 C;  1J1D B;  3RK3 D;  1LTA C;  2ZFC A;  5APX A;  4C46 A;  5BU8 B;  4ZKP A;  2XU6 A;  2W6A A;  4GKG A;  1N73 A;  5AVZ B;  1FOS F;  3KYQ A;  3V2N A;  3TK1 A;  1YYC A;  2YKQ A;  2CPB A;  5APQ A;  3A3Y B;  1CZQ A;  1GTW A;  1LTG C;  2OYI A;  5AW0 B;  2FFD B;  3HRN A;  1GDT A;  1FZC B;  1SLQ A;  2P67 A;  3V2R A;  1FZE A;  1IC2 A;  1KFN A;  2XKM A;  1NHL A;  4AUW A;  1HUC A;  2NPS B;  2H8P D;  3RL0 C;  2M3B A;  1NO4 A;  2HG5 D;  1MZ9 A;  5CCG C;  2I1J A;  2OAR A;  2Q9I A;  3P8C E;  1FZC C;  2E42 A;  3V2Q A;  1VPC A;  1HWT C;  1LWU B;  1XTC C;  2KSJ A;  5APY A;  4WY4 A;  3CI9 A;  1SVF A;  3B5N C;  3NMD A;  3MGN A;  2XNX A;  3VMX A;  4Y99 B;  1X8Y A;  1LT9 A;  1HTL C;  1LTT C;  3LW5 H;  1JY2 P;  1IO4 A;  1KIL B;  2W6B A;  1GW3 A;  3BAT A;  1N2D C;  2N1T A;  1LT9 C;  2ZXE B;  3OA7 A;  1T2K C;  3HUS A;  5AW9 B;  2R32 A;  4EIJ A;  2HPC A;  1G1J A;  2P7J A;  4C7R A;  3B5N A;  2PAJ A;  4C7N B;  4XE5 B;  1N7S D;  1RF1 B;  2YO2 A;  1CW5 A;  4DZO A;  2P1J A;  2WTY A;  3M91 A;  4N6J A;  4IFM A;  2MJZ A;  3OJA B;  1H89 A;  2O1K A;  1SP4 A;  1IFN A;  3SWF A;  3U1C A;  4GT1 A;  3N4X A;  1AQ5 A;  5AVU B;  1SFC B;  2XZR A;  1SFC D;  2R5B A;  3LID A;  1GU5 A;  1CI6 B;  1GZL A;  2XV5 A;  3MIW A;  2JJL A;  3HTK A;  3NTN A;  2WZ7 A;  3HD7 B;  1M1J B;  2OYI C;  3H32 B;  3HE5 B;  2R5D A;  1CSB A;  2KP8 A;  2C0X A;  3B5N D;  3BVH A;  3IFM A;  1H8A A;  3L35 A;  3U1A A;  2Z4E A;  3KDP B;  2WPR A;  1SQB K;  3A7O A;  4N78 D;  1NAF A;  4W7Y A;  3E1I A;  3C9I A;  3MTU E;  2HOD A;  3TNU A;  1KIL D;  1XTG B;  1LWU C;  3LIE A;  2WPS A;  2FYZ A;  3VMY A;  1URQ D;  3I5C A;  4JF7 A;  2H43 A;  1RE4 C;  2GUV A;  1T8Z A;  2Z5H A;  1HGV A;  4M3L A;  1NTK K;  3MD0 A;  1S9K D;  3GHG A;  3BRT B;  5AVS B;  1JY3 O;  1URQ A;  1T3J A;  2O1J A;  5APU A;  4LGD E;  1PFI A;  2OYH A;  3HE4 B;  1JMM A;  1N7S A;  5KJ7 C;  2YKP A;  2LKM A;  1L0N K;  4N78 E;  5AVX B;  2WSC H;  2FFD C;  1N86 A;  3TSI A;  1GW4 A;  2WIT A;  1GK4 A;  1L4A A;  2W27 A;  3P8C D;  3P8M C;  5AW1 B;  2IX7 C;  3EFG A;  3WMM 0;  2NPS A;  1G2C A;  4I1L A;  1GL2 D;  1N73 B;  3M9H A;  1LTS C;  4WB4 A;  2R3C A;  3RK3 C;  2J59 M;  1LTJ C;  1RF0 A;  1HBW A;  1SQV K;  2XDJ A;  3V4W A;  1GD2 E;  2BAS A;  4EOT A;  3L37 A;  4N3Y B;  5KJ7 D;  1RF1 A;  1SQX K;  3P7K A;  4AQR D;  1JCD A;  1ZLL A;  1JTH A;  3UIA A;  5APV A;  3M0A A;  3VOP A;  3M0D A;  1JY2 O;  2QM8 A;  5AVQ B;  3N7N A;  1SFC A;  3BRV B;  1S9K E;  2H7H A;  1X79 B;  1J1D C;  1WRG A;  1JOC A;  1NKZ B;  1MFZ A;  4WY4 B;  2C9N Y;  2FKW B;  1A02 J;  2C9L Y;  1OWA A;  2NPS C;  3RL0 B;  1FJK A;  2N1T D;  1L4A C;  3RK2 B;  2WSE H;  1J1E B;  2FFD A;  2NPS D;  1FZC A;  4JYB A;  1YTZ I;  3A5T A;  2A45 I;  3CLQ A;  3II6 A;  3P32 A;  5CCG A;  2YO3 A;  3VTP C;  1FZA A;  2I1K A;  2OYH C;  4LC1 A;  1FZG A;  1ZN5 A;  2FYU K;  1URQ C;  2N9B A;  1LTJ A;  1QL1 A;  1NTZ K;  2N1T B;  5APT A;  3GHG C;  5CCH D;  2CPS A;  1FDM A;  3RL0 D;  3V4Q A;  2VRS A;  1IJD B;  5CHX A;  1LWU A;  1DH3 A;  3U59 A;  1GK6 A;  3RK3 B;  2HFE D;  1LTB C;  1E5W A;  3H32 A;  2WSF H;  2WT7 B;  1JUN A;  5KJ7 A;  3HE4 A;  3KQG A;  3V5B A;  1N7S B;  3M9Q A;  1MUU A;  1VDF A;  5AVR B;  1W2E A;  4RES B;  5AVT B;  1LT9 B;  1OXZ A;  1M1J C;  1X9V A;  2JEE A;  5CCG D;  2M8R A;  1DX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...