1IFIA

Molecular models and structural comparisons of native and mutant class i filamentous bacteriophages ff (fd, f1, m13), if1 and ike
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
50
structure length
50
Chain Sequence
AEGDDPAKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOVIRUS
publication title Molecular models and structural comparisons of native and mutant class I filamentous bacteriophages Ff (fd, f1, M13), If1 and IKe.
pubmed doi rcsb
source organism Enterobacteria phage fd
molecule tags Virus
total genus 21
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1994-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ifiA00
1HGZA 2MJZA 2C0XA 2C0WA 1NH4A 2CPSA 2CPBA 1HGVA 1IFJA 1FDMA 1IFIA 1IFDA 1HH0A
chains in the Genus database with same CATH superfamily
3TGUG 4JF7A 1QLED 2O1KA 1NTKE 1PZQA 1RF0A 1FZCA 3E1IA 5AW1B 1J2JB 2HPCB 1H0TB 4IFFA 3L73G 2IZ1A 2QEXP 1AV1A 1PV3A 1SP4A 3N4XA 2LR2A 3RK2B 1JEKA 1N7SA 4PD4H 2OYIB 5CJ0A 1SQVD 3MUDC 2FYUE 1AVOA 1UIXA 2XZRA 1BE3D 4OGQC 4H13D 4I7ZC 1YJNP 2WVRA 2D2CB 2ITAA 1YYCA 3WUVA 3Q1MA 1S72P 1VF5C 1SQPK 3H1LG 2GUSA 3BATA 3RK3B 3IF4A 1K04A 1LT9A 2CK3H 4PJ0H 2R5BA 1USEA 1J1EB 1GL2D 3FGAD 1KYOI 2P67A 1Z56A 3M9HA 1W2EA 3QH9A 1NTMG 2WSCH 2B87B 1LTJC 1SFCC 5BVZA 5KAIE 3HE5A 2FFDB 1JY2O 3P8MC 1BDCA 2N1TB 5AW3B 3LW5J 1UIIA 3A2AA 1RH5B 1SQXK 3KZIH 2FYUJ 2K9JB 3HD7D 2QJYB 3P32A 4N6JA 2QRXA 3CCMP 1RQUA 1MUUA 3CXHD 1ZR4A 1SQQE 3P8CD 2GA1A 2OTJP 5K5GB 1OZHA 5AVVB 1JUNA 4L73A 1YJ9P 3HTKA 2HODA 2YXQB 4U3FE 1S5LH 1Q81Q 1FS0E 4C46A 4HYTB 3HRNA 1S9KD 3AE4C 1NKZB 3IN6A 3EWKA 3H1IE 1OVVA 3SSUA 3WU2E 1KTMA 1YQ3C 1NAYA 1HVVA 1GDTA 2HYNA 4RESB 1KQGB 3I55P 3A0BH 1GW3A 1YITP 3EQ2A 3CMEP 1L4AB 5TISH 1NTZG 3Q3DA 1SQVJ 1P84E 3L74E 1PFIA 1FDIA 3H1KG 1GK4A 1RF1A 3L75E 5KLVD 1M1KQ 1JY3N 1SQBD 2QG4A 3CX5D 1T3JA 2KOGA 2E76B 2QJPC 1N8RQ 3CXHE 4BXLA 5H2FH 2Y0DA 2ZXXA 2OYHB 2H89C 2IBZE 1N73A 2QM7A 2JDIH 2HR3A 1JY3P 4U7JA 1QEXA 2E75B 3GW6A 4PV1D 2A45G 1M1JA 1S9KE 2RH0A 1N73C 1LWUA 1KILE 2Y0CA 2ZT9D 1M8OB 3AE5C 1FBMA 3GHGA 3RBXA 3M0AA 1ZRTE 2XU6A 1M1JC 4DOJA 3B5NC 1EDKA 3GG2A 3U1CA 4H13C 1SQPD 1OX3A 4OH8B 1E79H 2YIUC 2E42A 3GHGC 1VQNP 1GL2A 1SQBE 3E7KA 2LKMA 1GTWA 3WUTA 1PGPA 3CCUP 1NTKK 1HGZA 2RKLA 3L73E 1K05A 2V7QH 2W8ZA 1PPJE 1FZGA 1USDA 1HUCA 2FXPA 3FX0A 1L0LG 2WSSH 1KFNA 3R4YA 1L0ND 3H32A 3HD7A 3L36A 3EFFK 4H44C 4BRYA 3L71E 2FYUK 2KXPB 4PD4D 2FY8A 1A02F 2UWJE 1IJDB 3CWBG 3USSA 1R5LA 2JO1A 2JWAA 3HD7C 3V2QA 4WB4A 1FZCB 1DD4A 1W2BO 2QIWA 2BCCE 3AE7C 1G1JA 4OVNF 3H1JD 4ZKPA 1T2KD 1M7LA 1SQBJ 3GF3A 2KZIA 3O8ZA 1KYOE 5BU8B 4TLFA 1N7SB 3L73J 5B66H 5AVYB 3WU2H 3LIDA 2NRGA 1EXJA 3CCJP 2LXBA 1KILC 2YKPA 1L0NE 1BGYE 3MP7B 1P84H 4N3YB 4OGQD 4OWFA 3L71J 3CMAP 3D6ZA 1Q82Q 5DJUB 4PD4E 3TYYA 2ZXEB 2V4HA 3AE8C 5APXA 3PP5A 3L37A 2NPSB 3BRTB 4DJGA 2MJZA 1SQQK 4QMAA 1BCCG 2BCCJ 4D6TE 3HE5B 1LNQA 2ZAEB 1H8AA 3O6QA 1AJYA 1SFCD 3Q2YA 1FZAA 1AQ5A 3C9IA 4PJ0E 2E74C 1NH4A 3BRVB 2O3JA 1XTCC 4RO0A 3B8EB 4PV1C 5GTIH 1KV4A 2K88A 5CCGD 3FWNA 1NO4A 2POHA 1NTZE 1L0NJ 1BGYJ 4ZNCA 1JCDA 2MKVA 2PAJA 4MN4C 1IZNB 2N9YB 3KZIE 2ZJSE 3HTKB 3TDKA 3NFQA 2JWDA 5AW9B 2W6AA 3S1KA 4D6TJ 1NTKD 3W67A 4AUWA 3H1JJ 5APVA 5AVZB 3PJSK 2KZJA 1GK6A 5GTHH 3MD0A 5APWA 3TNUA 2O01H 3IR9A 4TT3H 3L72G 2WITA 4WY4D 2K37A 1LP1A 3VYIA 1FDMA 2QJKB 1S5LE 3RL0g 1PP9G 2FYUD 2WSCJ 1RF1B 1ZN5A 1FZBA 1OVUA 2YMYA 2BEQD 2JKVA 1GW4A 3CLQA 5AVXB 2W83C 1TU3F 2WPSA 3KYQA 3A0BE 5TISE 5APYA 1EZVI 1KYOH 1SQBK 1EZVG 1S1CX 5KLIC 1G2CB 2W27A 3Q5RA 4Y28J 1T2KC 1XTGB 5KKZC 1LWUB 2Z5HA 1Q7YQ 2O1JA 4Y99C 1BSHA 1U7MA 5H2FE 2GUVA 1L0LE 2OYOA 2I8DA 5CMZA 3MUDA 1JY2N 2R32A 1VQLP 1ZV8A 5C39A 1GU5A 1GZLA 1M57D 1OIPA 5E79H 2P7JA 4ZMDA 1JY2P 5DJTB 3JCUH 3B5ND 1GL2B 2KLVA 2ZYAA 3VP8A 1JMMA 4KT0J 1YHQP 1JNMA 2SPZA 4H0LD 1CI6A 1SQQD 4R4LA 1U7JA 1LTSC 1ZR2A 1LTJA 1SFCA 2QM8A 2KLUA 3V2RA 1HWTC 1RY3A 3H32B 1FJKA 4U3FD 1NTKJ 1OW8A 3VTPC 5CCGA 4BRYB 4GIFA 1KB9I 1SQPG 3H1ID 2ZVNB 2B9BA 2W90A 1J1DC 4I6MC 1VQPP 1VQ8P 2BEZF 3EFGA 3CCEP 4H44D 2FYNC 1NAFA 1R8EA 5CCGC 1L0NK 3GMAA 3GLMA 2Z5IA 3M9BA 3OA7A 3ITKA 3PH0A 1H88A 2YO3A 1P84D 3L74D 3AEEC 4JYBA 1CSBA 3L75D 1KMIZ 1LTIC 5AW5B 2W6JH 3MTUE 4EOTA 3CCLP 2J5UA 1X0TA 2WPQA 1URQC 2A45H 1SQXG 1SLQA 2IBZD 3M06A 4BWNA 4RKUJ 4WY4A 4L75A 2A06G 5APQA 4CPGA 3WMM0 4YXDC 2N1TD 2ZYGA 5B66E 1KILD 3HE4A 4UB6E 4WY4C 4GODA 2V7QJ 4JQ0D 3RGUA 1NTZK 1ZRTD 3G3ZA 2G8YA 3BCCD 4LLHA 2HLOA 2QE7H 1VDFA 3WUUA 5CBOA 1NU1G 4GT1A 3KDPB 5CCHD 2R44A 1CZQA 1BSNA 3TGUD 4R4MA 3RK3E 3L70E 1X9VA 2WSFH 1VL2A 4KJMA 1SQQJ 4C7NA 3L73D 3D71A 1IK9A 2C9NY 3RL0B 1PPJD 2JEEA 2E74D 4U3FJ 2A45I 3V5BA 1NOHA 3B5NA 5B5EH 3H1IJ 3L71D 3HUSB 1N7LA 3KHUA 1L4AD 1YQ4C 1S5LX 3D70A 5GTIE 1DEEG 5AVRB 3V4QA 3BCCE 1N2DC 2WT7B 2IFMA 3L74J 1DIPA 2E76D 1EZVE 2BCCD 2FYZA 2H43A 4H0LC 1M56D 3L75J 1QX8A 3TGUE 3TNUB 3L70J 3E1RA 5AW0B 4AQRD 1VQMP 1KYOD 1LP1B 2RN0A 1Q86Q 2E75D 1NTMD 2OQQA 2WSEJ 5EFWB 3H1HG 2VRSA 3PTZA 1PGJA 3MGNA 1L0LK 2WPRA 3TSIA 3CCVP 5APUA 3RK2C 1HJ0A 1JB0J 5GTHE 1BGYD 2OYIC 5AVQB 3G71P 1ZW0A 3FWLA 2J59M 3G9RA 2E5YA 3T97B 3AEBC 1YTZI 2D2CC 2PP6A 2P2UA 3H1LE 3BCCJ 3PLNA 4W7YA 4L76A 2XNXA 2IDBA 2Q3EA 3RK3C 1LJ2A 1RE4C 1T6AA 4D6TD 3VMZA 5AW6B 2B87A 3TGUJ 1VQ9P 2FFDA 1LT1A 3M91A 4OGQB 2FYUG 2N1TA 2M3EA 4I7ZB 1J1EC 1EDLA 2QA4P 2HG5D 1NTME 1KILA 1KB9E 3A0HH 1VF5B 2YMKA 4UB6H 1RHZB 2M5AA 3OJAB 2FFDC 5AVSB 4DT0A 1K8AQ 1HH0A 2N1TC 2R3SA 4XA4A 1S3JA 1IC2A 1LGHB 3GF7A 1T8ZA 1DEBA 1W5CE 2YKQA 2CPBA 1NTZD 4AYCA 2O01J 3I5CA 5CCHA 5APSA 1FJPA 2QJYC 3PHLA 1LT9B 1D7MA 1VQOP 3L4FA 5AW8B 1LTJB 1SFCB 3CL3D 1MZ9A 5E79E 1ZMEC 3H1LJ 3JCUE 1OFCX 2IYOA 5CCHC 4W80A 2WSEH 2K1AA 1JO5A 1HJBA 1QGKB 5CJ4A 1FU1A 4LGDE 1PL5A 1VQ7P 3C1LA 1JOCA 2A06E 1SQVG 2FKWB 3FXDA 3B4SA 1KQSO 4GOFA 3NMDA 1BE3G 2KB7P 4YXWH 1MKMA 1CW5A 1NTMJ 4JPZB 1X22A 4Z1MH 1L4AA 2WMMA 2Y9YA 3Q5PA 2YKOA 4IL6H 4I2LC 2FXOA 1L4AC 3ABVC 1NU1E 2XNDH 2M8RA 2C9LY 5AVUB 3H1KE 2NPSD 1PGQA 1AA0A 1Y9BA 4O9BA 4XE5B 1HGVA 3CC7P 4I1LA 4YTPC 3M0DC 2E76C 2HODB 1URQD 3SWFA 3MHVA 3H25A 2OYHC 5KJ7C 5AVTB 4IFDK 3CX5H 2E75C 4WWIA 1M90Q 1L0LD 1KZUB 1EXIA 4NPDA 1S2EA 2YNYA 3AEAC 4XFJA 2KNCA 2QJPB 3CXHI 2RMZA 2Q6QA 1ZLLA 1YIJP 3CCQP 3CWBD 2BASA 1MV8A 2JJLA 3JC22 1NTZJ 2IBZG 2P10A 2WZ7A 2R5DA 4C7NB 2KS1A 3H1KJ 5APTA 4N78E 2P1JA 1N73B 3G4SP 3V2PA 3QWOC 1X79B 3VN0A 3H1HE 1KB9H 1M1JB 3CCSP 3BASA 3B5NB 2PGDA 4K35A 4JYCA 1VQ5P 4H13B 3II6A 3N7NA 3M9QA 2YIUB 3GHGB 1WMKA 3K5BA 5KLVG 3CX5I 1SQBG 2Q5UA 4JBZA 3TK1A 5KAFE 1NGMB 1QVFO 2YXRB 1DD3A 3CWBE 5B5EE 3P7KA 1EDJA 4NPEA 2I1JA 3AE2C 3RBZA 1JTHA 3B71A 2ZFCA 3JSVC 5L8RJ 2AXTE 1PPJG 1RF0C 1FZCC 1BCCD 1JM0A 1LTTC 1KD1Q 3SWKA 1FDOA 2LXCB 4H44B 1VPCA 2H88C 2ZYDA 1IFNA 3L71G 1FOSF 1E5WA 2GM4A 3H1HJ 1IK7A 1WT6A 1N7SC 4EIJA 3IFMA 1NTMK 3HD7B 2WSFJ 2I1KA 1L0LJ 1GMJA 3RK2D 2PFXA 2YO2A 2OGUA 2BCCG 2L5GB 3KXDA 4L74A 4M3LA 1HBWA 5KTBA 1GU4A 2NPSA 2Q9IA 3VOPA 1PIXA 2Q3IA 1Y47A 2D2CD 1LT9C 2FXMA 3CWBJ 4GDOA 2E5TA 1ZP0C 5AW7B 1URQA 2NPSC 4K3AA 4UB8H 2M0BA 1BCCE 3RK3D 3L70D 1KQFB 1KILB 2OTLP 1AFOA 1ZXGA 1JMBA 2M5AB 1L0NG 1SQVE 2JR8A 1BGYG 3CC4P 1OMIA 2KP8A 1BE3E 1PGOA 4DCKA 1AVYA 4PD4I 4C7RA 1Y8AA 3L72D 3SWYA 1FE6A 2IZ0A 4EYYQ 1PP9D 2CPSA 1IFIA 3AECC 1ZOYC 3A0HE 1K73Q 4D6TG 2K3RA 3H1JG 4HJGH 1MFTA 3BVHA 3CPWO 2PRRA 1NU1K 2W6BA 3W68A 5AVWB 3R2PA 2E74B 1T3UA 1EZVD 4PV1B 3H6PA 3LIEA 1RQVA 1OVRA 3U1AA 1BCCJ 1HF9A 3O6QB 1DH3A 4WBAA 1KN7A 2E43A 2ZT9B 3AE1C 1BE3J 5AW2B 4KHXA 1OXZA 2NZ2A 3L72E 1AQTA 3A3YB 2ZVOB 5KAFH 3VMYA 2QJKC 1PP9E 3P8CE 2R3CA 2Y9ZA 2N9BA 1KQLA 1RF1C 1LTAC 1NKNA 2AXTH 2Q1KA 3LW5H 2AEMA 2B89A 3H1LD 2XDJA 4IL6E 2H8PD 1G2CA 3FXEA 3MZWB 1OW7A 2K9YA 5BU5A 1IO4A 2HPCA 1H0TA 1DX7A 5KJ7D 2AEFA 2KNCB 1IFDA 3RL0D 1LWUC 1G1IA 3ZDMA 1KB9D 2QVAA 2QSIA 2OYIA 3NXSA 1KC8Q 3V6IA 5KLVE 3L72J 1JY3O 1MFZA 3CX5E 1A02J 2P58A 1KORA 4GKGA 2KS1B 1PP9J 5KLIB 3PRJA 5AW4B 3S4RA 5KAIH 1K9MQ 5KKZB 2O01N 3VP9A 2Q7CA 1GL2C 1NTKG 4Y99B 3NTNA 1FZFA 1RE4A 3UIAA 3CC2P 3AEDC 2FBWC 3A7OA 2OTKE 1IFPA 1U57A 1SQXD 5M1BA 3CD6P 3C8VA 1L2PA 4HKZH 1QL2A 2C0XA 2WWWA 4NPFX 2KUBA 2A06D 4ASWA 2H7HA 4HH2A 1NYHA 3AE3C 1SQPE 1EQ7A 1NWQA 2AXCA 3KPEA 5KLVJ 2K9JA 4ASVA 1JTHB 4DZOA 1QL1A 4EI2A 3V2NA 1NU1D 1CI6B 2J58A 1WRGA 2KSEA 3AE6C 3H1KD 1YI2P 2Z4EA 2KK7A 1YJWP 2KYVA 1J1DB 3D6YA 2IFNA 3MIWA 1YBKA 1OW6A 2FYNB 4IOIH 2DW3A 2Y0EA 1SQXE 1QVGO 2JP3A 1SQVK 4GOEA 3AE9C 3OW2O 1N7SD 3F89A 1VF5D 3CXHH 3A5TA 2AEJA 1LTBC 2M3BA 4IFMA 2G3AA 1R5SA 3SFEC 1SQPJ 2XKMA 2IYPA 2KI7B 1SS1A 2WTYA 2OARA 3KQGA 1EDIA 3H1JE 1URQB 1SQQG 4HB1A 4WVZA 1YTZT 3I56P 3M0DA 3S9OA 4EDFA 3TF5A 4YPCA 5CHXA 1Q90D 4U3FG 3L35A 4N78D 3AEGC 5KJ7A 2OYHA 3IAOA 1IFJA 3H1IG 4WY4B 1NVOA 1EC5A 1FAVA 3V4WA 2IPPA 3H1HD 2ZT9C 1S4XA 3VMXA 3Q5SA 4UB8E 1NHLA 1SQXJ 3VMAA 2KIKA 2B88A 4W7ZA 3HE4B 3RL0C 1P84I 3HUSA 2IX7C 1KFMA 3L74G 3F5HA 2WQYC 1LTGC 1VQ4P 1FZEA 1HTLC 3L75G 1H89A 1Q2NA 5CBNA 3L70G 3SFDC 2WT7A 1JCCA 3HUSC 2WPVB 1N86A 4RJTA 2IBZI 2XV5A 1NJIQ 1NU1J 1FOSE 2HFED 4B86A 4IL6X 2KSJA 1RE3A 4ZKUA 4LC1A 1OWAA 1VQ6P 2C0WA 3G6EP 3CI9A 3CCRP 1BDDA 1SVFA 1GD2E 3AEFC 5TJHA 3BCCG 1RE3C 4A7PA 2L91A 1X8YA 3OAKA 3T97A 5KLVK 1VQKP 4H0LB 1IFMA 3U59A 1FC2C
chains in the Genus database with same CATH topology
3MGNA 2CPSA 4JF7A 1H8AA 2O1KA 1L0LK 1IFIA 2WPRA 3TSIA 1RF0A 1FZCA 5APUA 3E1IA 5AW1B 1J2JB 1SFCD 1FZAA 1AQ5A 3C9IA 2HPCB 4IFFA 3RK2C 1NH4A 3BRVB 3BVHA 1XTCC 2OYIC 3B8EB 5AVQB 1NU1K 5CCGD 2W6BA 1SP4A 3N4XA 2J59M 5AVWB 3R2PA 1NO4A 2POHA 3RK2B 1N7SA 1YTZI 1T3UA 1JCDA 2OYIB 2PP6A 5CJ0A 3H6PA 2P2UA 2PAJA 3LIEA 4W7YA 3U1AA 2XZRA 2XNXA 1DH3A 4WBAA 3RK3C 2E43A 1RE4C 3HTKB 3VMZA 5AW6B 1YYCA 1SQPK 3NFQA 2FFDA 2GUSA 5AW2B 4KHXA 3M91A 5AW9B 2W6AA 2N1TA 1J1EC 1OXZA 3BATA 3RK3B 4AUWA 1LT9A 2HG5D 1KILA 3A3YB 5APVA 5AVZB 3VMYA 3P8CE 3OJAB 2R3CA 1GK6A 2FFDC 2R5BA 5AVSB 2N9BA 1HH0A 1J1EB 3MD0A 5APWA 1GL2D 1KQLA 3TNUA 2N1TC 4XA4A 2P67A 2O01H 1Z56A 3IR9A 3M9HA 1LTAC 1RF1C 1IC2A 1LGHB 1NKNA 1W2EA 1T8ZA 2WITA 1DEBA 2WSCH 2YKQA 2CPBA 4WY4D 3VYIA 1FDMA 1LTJC 3LW5H 1SFCC 5BVZA 3HE5A 4AYCA 2FFDB 1JY2O 3I5CA 3P8MC 5CCHA 2XDJA 5APSA 2H8PD 2N1TB 1G2CA 1RF1B 1ZN5A 1FJPA 1FZBA 5AW3B 1LT9B 3L4FA 5AW8B 2YMYA 3A2AA 1LTJB 1SFCB 3CL3D 1MZ9A 5BU5A 1GW4A 3CLQA 1SQXK 1IO4A 5AVXB 2HPCA 2WPSA 5CCHC 3HD7D 3KYQA 3P32A 2WSEH 4W80A 1DX7A 5KJ7D 4N6JA 1JO5A 1HJBA 1IFDA 3RL0D 5CJ4A 1LWUC 5APYA 1FU1A 1G1IA 4LGDE 1MUUA 1SQBK 1JOCA 2OYIA 2FKWB 1ZR4A 1G2CB 2W27A 3P8CD 3NXSA 3NMDA 1T2KC 1XTGB 2KB7P 1CW5A 1JY3O 1LWUB 2Z5HA 1MFZA 2O1JA 1A02J 4Y99C 5AVVB 4GKGA 1L4AA 1JUNA 2GUVA 3HTKA 5CMZA 5AW4B 3MUDA 2HODA 1JY2N 2R32A 4C46A 4HYTB 3HRNA 1S9KD 2YKOA 3VP9A 4I2LC 2Q7CA 1GL2C 1NKZB 4Y99B 3NTNA 1ZV8A 1FZFA 1RE4A 1GU5A 1L4AC 3UIAA 1GZLA 2M8RA 2C9LY 5AVUB 2P7JA 3A7OA 1JY2P 1HVVA 3B5ND 1GDTA 2NPSD 2HYNA 1GL2B 2KLVA 4RESB 4O9BA 4XE5B 3VP8A 1JMMA 1GW3A 3EQ2A 1L4AB 1HGVA 1QL2A 4I1LA 2C0XA 1JNMA 3M0DC 2HODB 1PFIA 2WWWA 1URQD 3SWFA 1CI6A 1GK4A 1RF1A 2H7HA 4HH2A 5KJ7C 2OYHC 1LTSC 1JY3N 1ZR2A 5AVTB 1EQ7A 1T3JA 1NWQA 2KOGA 1LTJA 4IFDK 1SFCA 2QM8A 3V2RA 1HWTC 1KZUB 1RY3A 3H32B 3KPEA 1FJKA 2OYHB 1JTHB 3VTPC 5CCGA 2YNYA 4GIFA 2QM7A 1N73A 1JY3P 4DZOA 1QL1A 4I6MC 1J1DC 1ZLLA 3V2NA 1CI6B 2J58A 2A45G 1WRGA 2BASA 1MV8A 3EFGA 1M1JA 1S9KE 2Z4EA 1NAFA 2JJLA 5CCGC 1L0NK 1N73C 1LWUA 2KYVA 1J1DB 2Z5IA 3M9BA 2WZ7A 2R5DA 3OA7A 2IFNA 4C7NB 3MIWA 1H88A 2YO3A 5APTA 1FBMA 3GHGA 3M0AA 4JYBA 2XU6A 4N78E 2P1JA 1M1JC 4DOJA 1N73B 3B5NC 1CSBA 1SQVK 3V2PA 1LTIC 3U1CA 1X79B 3VN0A 5AW5B 1N7SD 4OH8B 3MTUE 4EOTA 2E42A 1M1JB 3GHGC 3BASA 3B5NB 2WPQA 3A5TA 1LTBC 1URQC 2M3BA 2A45H 4JYCA 4IFMA 1GL2A 2XKMA 3II6A 1SLQA 3N7NA 2LKMA 1GTWA 3M06A 3M9QA 4WY4A 2WTYA 2OARA 3KQGA 1NTKK 1HGZA 3GHGB 5APQA 1URQB 3WMM0 2N1TD 2Q5UA 1FZGA 1YTZT 3TK1A 1KILD 1HUCA 3HE4A 3M0DA 4WY4C 1KFNA 5CHXA 3P7KA 1NTZK 3H32A 2I1JA 3HD7A 3G3ZA 3L35A 3L36A 4N78D 2OYHA 1JTHA 5KJ7A 4LLHA 2ZFCA 1IFJA 2HLOA 1RF0C 1FZCC 2FYUK 4WY4B 1LTTC 1VDFA 1A02F 1FAVA 4GT1A 3V4WA 2IPPA 1IJDB 3KDPB 3VMXA 5CCHD 1NHLA 1CZQA 3HD7C 1VPCA 3V2QA 1IFNA 4WB4A 4W7ZA 1FZCB 3HE4B 1X9VA 1E5WA 1FOSF 3RL0C 2WSFH 2GM4A 3HUSA 1WT6A 2IX7C 1KFMA 1N7SC 4C7NA 4EIJA 1G1JA 3IFMA 1NTMK 3HD7B 4ZKPA 1T2KD 1M7LA 1LTGC 1IK9A 1FZEA 1HTLC 2C9NY 1H89A 3RL0B 3O8ZA 5BU8B 2I1KA 2WT7A 1JCCA 1N7SB 2JEEA 3RK2D 3HUSC 2YO2A 2A45I 2L5GB 5AVYB 4M3LA 3V5BA 1N86A 1HBWA 5KTBA 1NOHA 3LIDA 1GU4A 3B5NA 2NPSA 2Q9IA 3VOPA 2XV5A 2Q3IA 1FOSE 3HUSB 1N7LA 1L4AD 1LT9C 2FXMA 2HFED 1KILC 2YKPA 4B86A 5AW7B 4N3YB 2KSJA 5AVRB 1URQA 3V4QA 1N2DC 1RE3A 4ZKUA 2NPSC 4LC1A 1OWAA 2C0WA 2WT7B 3RK3D 1KILB 2IFMA 1AFOA 3TYYA 2ZXEB 3CI9A 2FYZA 5APXA 2H43A 1SVFA 3PP5A 1GD2E 3L37A 2NPSB 2KP8A 3TNUB 1RE3C 3BRTB 2MJZA 1SQQK 5AW0B 4C7RA 4AQRD 1X8YA 3OAKA 3T97A 5KLVK 3SWYA 3HE5B 2VRSA 1IFMA 3U59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HGZ A;  2MJZ A;  2C0X A;  2C0W A;  1NH4 A;  2CPS A;  2CPB A;  1HGV A;  1IFJ A;  1FDM A;  1IFI A;  1IFD A;  1HH0 A; 
#chains in the Genus database with same CATH topology
 3TGU G;  4JF7 A;  1QLE D;  2O1K A;  1NTK E;  1PZQ A;  1RF0 A;  1FZC A;  3E1I A;  5AW1 B;  1J2J B;  2HPC B;  1H0T B;  4IFF A;  3L73 G;  2IZ1 A;  2QEX P;  1AV1 A;  1PV3 A;  1SP4 A;  3N4X A;  2LR2 A;  3RK2 B;  1JEK A;  1N7S A;  4PD4 H;  2OYI B;  5CJ0 A;  1SQV D;  3MUD C;  2FYU E;  1AVO A;  1UIX A;  2XZR A;  1BE3 D;  4OGQ C;  4H13 D;  4I7Z C;  1YJN P;  2WVR A;  2D2C B;  2ITA A;  1YYC A;  3WUV A;  3Q1M A;  1S72 P;  1VF5 C;  1SQP K;  3H1L G;  2GUS A;  3BAT A;  3RK3 B;  3IF4 A;  1K04 A;  1LT9 A;  2CK3 H;  4PJ0 H;  2R5B A;  1USE A;  1J1E B;  1GL2 D;  3FGA D;  1KYO I;  2P67 A;  1Z56 A;  3M9H A;  1W2E A;  3QH9 A;  1NTM G;  2WSC H;  2B87 B;  1LTJ C;  1SFC C;  5BVZ A;  5KAI E;  3HE5 A;  2FFD B;  1JY2 O;  3P8M C;  1BDC A;  2N1T B;  5AW3 B;  3LW5 J;  1UII A;  3A2A A;  1RH5 B;  1SQX K;  3KZI H;  2FYU J;  2K9J B;  3HD7 D;  2QJY B;  3P32 A;  4N6J A;  2QRX A;  3CCM P;  1RQU A;  1MUU A;  3CXH D;  1ZR4 A;  1SQQ E;  3P8C D;  2GA1 A;  2OTJ P;  5K5G B;  1OZH A;  5AVV B;  1JUN A;  4L73 A;  1YJ9 P;  3HTK A;  2HOD A;  2YXQ B;  4U3F E;  1S5L H;  1Q81 Q;  1FS0 E;  4C46 A;  4HYT B;  3HRN A;  1S9K D;  3AE4 C;  1NKZ B;  3IN6 A;  3EWK A;  3H1I E;  1OVV A;  3SSU A;  3WU2 E;  1KTM A;  1YQ3 C;  1NAY A;  1HVV A;  1GDT A;  2HYN A;  4RES B;  1KQG B;  3I55 P;  3A0B H;  1GW3 A;  1YIT P;  3EQ2 A;  3CME P;  1L4A B;  5TIS H;  1NTZ G;  3Q3D A;  1SQV J;  1P84 E;  3L74 E;  1PFI A;  1FDI A;  3H1K G;  1GK4 A;  1RF1 A;  3L75 E;  5KLV D;  1M1K Q;  1JY3 N;  1SQB D;  2QG4 A;  3CX5 D;  1T3J A;  2KOG A;  2E76 B;  2QJP C;  1N8R Q;  3CXH E;  4BXL A;  5H2F H;  2Y0D A;  2ZXX A;  2OYH B;  2H89 C;  2IBZ E;  1N73 A;  2QM7 A;  2JDI H;  2HR3 A;  1JY3 P;  4U7J A;  1QEX A;  2E75 B;  3GW6 A;  4PV1 D;  2A45 G;  1M1J A;  1S9K E;  2RH0 A;  1N73 C;  1LWU A;  1KIL E;  2Y0C A;  2ZT9 D;  1M8O B;  3AE5 C;  1FBM A;  3GHG A;  3RBX A;  3M0A A;  1ZRT E;  2XU6 A;  1M1J C;  4DOJ A;  3B5N C;  1EDK A;  3GG2 A;  3U1C A;  4H13 C;  1SQP D;  1OX3 A;  4OH8 B;  1E79 H;  2YIU C;  2E42 A;  3GHG C;  1VQN P;  1GL2 A;  1SQB E;  3E7K A;  2LKM A;  1GTW A;  3WUT A;  1PGP A;  3CCU P;  1NTK K;  1HGZ A;  2RKL A;  3L73 E;  1K05 A;  2V7Q H;  2W8Z A;  1PPJ E;  1FZG A;  1USD A;  1HUC A;  2FXP A;  3FX0 A;  1L0L G;  2WSS H;  1KFN A;  3R4Y A;  1L0N D;  3H32 A;  3HD7 A;  3L36 A;  3EFF K;  4H44 C;  4BRY A;  3L71 E;  2FYU K;  2KXP B;  4PD4 D;  2FY8 A;  1A02 F;  2UWJ E;  1IJD B;  3CWB G;  3USS A;  1R5L A;  2JO1 A;  2JWA A;  3HD7 C;  3V2Q A;  4WB4 A;  1FZC B;  1DD4 A;  1W2B O;  2QIW A;  2BCC E;  3AE7 C;  1G1J A;  4OVN F;  3H1J D;  4ZKP A;  1T2K D;  1M7L A;  1SQB J;  3GF3 A;  2KZI A;  3O8Z A;  1KYO E;  5BU8 B;  4TLF A;  1N7S B;  3L73 J;  5B66 H;  5AVY B;  3WU2 H;  3LID A;  2NRG A;  1EXJ A;  3CCJ P;  2LXB A;  1KIL C;  2YKP A;  1L0N E;  1BGY E;  3MP7 B;  1P84 H;  4N3Y B;  4OGQ D;  4OWF A;  3L71 J;  3CMA P;  3D6Z A;  1Q82 Q;  5DJU B;  4PD4 E;  3TYY A;  2ZXE B;  2V4H A;  3AE8 C;  5APX A;  3PP5 A;  3L37 A;  2NPS B;  3BRT B;  4DJG A;  2MJZ A;  1SQQ K;  4QMA A;  1BCC G;  2BCC J;  4D6T E;  3HE5 B;  1LNQ A;  2ZAE B;  1H8A A;  3O6Q A;  1AJY A;  1SFC D;  3Q2Y A;  1FZA A;  1AQ5 A;  3C9I A;  4PJ0 E;  2E74 C;  1NH4 A;  3BRV B;  2O3J A;  1XTC C;  4RO0 A;  3B8E B;  4PV1 C;  5GTI H;  1KV4 A;  2K88 A;  5CCG D;  3FWN A;  1NO4 A;  2POH A;  1NTZ E;  1L0N J;  1BGY J;  4ZNC A;  1JCD A;  2MKV A;  2PAJ A;  4MN4 C;  1IZN B;  2N9Y B;  3KZI E;  2ZJS E;  3HTK B;  3TDK A;  3NFQ A;  2JWD A;  5AW9 B;  2W6A A;  3S1K A;  4D6T J;  1NTK D;  3W67 A;  4AUW A;  3H1J J;  5APV A;  5AVZ B;  3PJS K;  2KZJ A;  1GK6 A;  5GTH H;  3MD0 A;  5APW A;  3TNU A;  2O01 H;  3IR9 A;  4TT3 H;  3L72 G;  2WIT A;  4WY4 D;  2K37 A;  1LP1 A;  3VYI A;  1FDM A;  2QJK B;  1S5L E;  3RL0 g;  1PP9 G;  2FYU D;  2WSC J;  1RF1 B;  1ZN5 A;  1FZB A;  1OVU A;  2YMY A;  2BEQ D;  2JKV A;  1GW4 A;  3CLQ A;  5AVX B;  2W83 C;  1TU3 F;  2WPS A;  3KYQ A;  3A0B E;  5TIS E;  5APY A;  1EZV I;  1KYO H;  1SQB K;  1EZV G;  1S1C X;  5KLI C;  1G2C B;  2W27 A;  3Q5R A;  4Y28 J;  1T2K C;  1XTG B;  5KKZ C;  1LWU B;  2Z5H A;  1Q7Y Q;  2O1J A;  4Y99 C;  1BSH A;  1U7M A;  5H2F E;  2GUV A;  1L0L E;  2OYO A;  2I8D A;  5CMZ A;  3MUD A;  1JY2 N;  2R32 A;  1VQL P;  1ZV8 A;  5C39 A;  1GU5 A;  1GZL A;  1M57 D;  1OIP A;  5E79 H;  2P7J A;  4ZMD A;  1JY2 P;  5DJT B;  3JCU H;  3B5N D;  1GL2 B;  2KLV A;  2ZYA A;  3VP8 A;  1JMM A;  4KT0 J;  1YHQ P;  1JNM A;  2SPZ A;  4H0L D;  1CI6 A;  1SQQ D;  4R4L A;  1U7J A;  1LTS C;  1ZR2 A;  1LTJ A;  1SFC A;  2QM8 A;  2KLU A;  3V2R A;  1HWT C;  1RY3 A;  3H32 B;  1FJK A;  4U3F D;  1NTK J;  1OW8 A;  3VTP C;  5CCG A;  4BRY B;  4GIF A;  1KB9 I;  1SQP G;  3H1I D;  2ZVN B;  2B9B A;  2W90 A;  1J1D C;  4I6M C;  1VQP P;  1VQ8 P;  2BEZ F;  3EFG A;  3CCE P;  4H44 D;  2FYN C;  1NAF A;  1R8E A;  5CCG C;  1L0N K;  3GMA A;  3GLM A;  2Z5I A;  3M9B A;  3OA7 A;  3ITK A;  3PH0 A;  1H88 A;  2YO3 A;  1P84 D;  3L74 D;  3AEE C;  4JYB A;  1CSB A;  3L75 D;  1KMI Z;  1LTI C;  5AW5 B;  2W6J H;  3MTU E;  4EOT A;  3CCL P;  2J5U A;  1X0T A;  2WPQ A;  1URQ C;  2A45 H;  1SQX G;  1SLQ A;  2IBZ D;  3M06 A;  4BWN A;  4RKU J;  4WY4 A;  4L75 A;  2A06 G;  5APQ A;  4CPG A;  3WMM 0;  4YXD C;  2N1T D;  2ZYG A;  5B66 E;  1KIL D;  3HE4 A;  4UB6 E;  4WY4 C;  4GOD A;  2V7Q J;  4JQ0 D;  3RGU A;  1NTZ K;  1ZRT D;  3G3Z A;  2G8Y A;  3BCC D;  4LLH A;  2HLO A;  2QE7 H;  1VDF A;  3WUU A;  5CBO A;  1NU1 G;  4GT1 A;  3KDP B;  5CCH D;  2R44 A;  1CZQ A;  1BSN A;  3TGU D;  4R4M A;  3RK3 E;  3L70 E;  1X9V A;  2WSF H;  1VL2 A;  4KJM A;  1SQQ J;  4C7N A;  3L73 D;  3D71 A;  1IK9 A;  2C9N Y;  3RL0 B;  1PPJ D;  2JEE A;  2E74 D;  4U3F J;  2A45 I;  3V5B A;  1NOH A;  3B5N A;  5B5E H;  3H1I J;  3L71 D;  3HUS B;  1N7L A;  3KHU A;  1L4A D;  1YQ4 C;  1S5L X;  3D70 A;  5GTI E;  1DEE G;  5AVR B;  3V4Q A;  3BCC E;  1N2D C;  2WT7 B;  2IFM A;  3L74 J;  1DIP A;  2E76 D;  1EZV E;  2BCC D;  2FYZ A;  2H43 A;  4H0L C;  1M56 D;  3L75 J;  1QX8 A;  3TGU E;  3TNU B;  3L70 J;  3E1R A;  5AW0 B;  4AQR D;  1VQM P;  1KYO D;  1LP1 B;  2RN0 A;  1Q86 Q;  2E75 D;  1NTM D;  2OQQ A;  2WSE J;  5EFW B;  3H1H G;  2VRS A;  3PTZ A;  1PGJ A;  3MGN A;  1L0L K;  2WPR A;  3TSI A;  3CCV P;  5APU A;  3RK2 C;  1HJ0 A;  1JB0 J;  5GTH E;  1BGY D;  2OYI C;  5AVQ B;  3G71 P;  1ZW0 A;  3FWL A;  2J59 M;  3G9R A;  2E5Y A;  3T97 B;  3AEB C;  1YTZ I;  2D2C C;  2PP6 A;  2P2U A;  3H1L E;  3BCC J;  3PLN A;  4W7Y A;  4L76 A;  2XNX A;  2IDB A;  2Q3E A;  3RK3 C;  1LJ2 A;  1RE4 C;  1T6A A;  4D6T D;  3VMZ A;  5AW6 B;  2B87 A;  3TGU J;  1VQ9 P;  2FFD A;  1LT1 A;  3M91 A;  4OGQ B;  2FYU G;  2N1T A;  2M3E A;  4I7Z B;  1J1E C;  1EDL A;  2QA4 P;  2HG5 D;  1NTM E;  1KIL A;  1KB9 E;  3A0H H;  1VF5 B;  2YMK A;  4UB6 H;  1RHZ B;  2M5A A;  3OJA B;  2FFD C;  5AVS B;  4DT0 A;  1K8A Q;  1HH0 A;  2N1T C;  2R3S A;  4XA4 A;  1S3J A;  1IC2 A;  1LGH B;  3GF7 A;  1T8Z A;  1DEB A;  1W5C E;  2YKQ A;  2CPB A;  1NTZ D;  4AYC A;  2O01 J;  3I5C A;  5CCH A;  5APS A;  1FJP A;  2QJY C;  3PHL A;  1LT9 B;  1D7M A;  1VQO P;  3L4F A;  5AW8 B;  1LTJ B;  1SFC B;  3CL3 D;  1MZ9 A;  5E79 E;  1ZME C;  3H1L J;  3JCU E;  1OFC X;  2IYO A;  5CCH C;  4W80 A;  2WSE H;  2K1A A;  1JO5 A;  1HJB A;  1QGK B;  5CJ4 A;  1FU1 A;  4LGD E;  1PL5 A;  1VQ7 P;  3C1L A;  1JOC A;  2A06 E;  1SQV G;  2FKW B;  3FXD A;  3B4S A;  1KQS O;  4GOF A;  3NMD A;  1BE3 G;  2KB7 P;  4YXW H;  1MKM A;  1CW5 A;  1NTM J;  4JPZ B;  1X22 A;  4Z1M H;  1L4A A;  2WMM A;  2Y9Y A;  3Q5P A;  2YKO A;  4IL6 H;  4I2L C;  2FXO A;  1L4A C;  3ABV C;  1NU1 E;  2XND H;  2M8R A;  2C9L Y;  5AVU B;  3H1K E;  2NPS D;  1PGQ A;  1AA0 A;  1Y9B A;  4O9B A;  4XE5 B;  1HGV A;  3CC7 P;  4I1L A;  4YTP C;  3M0D C;  2E76 C;  2HOD B;  1URQ D;  3SWF A;  3MHV A;  3H25 A;  2OYH C;  5KJ7 C;  5AVT B;  4IFD K;  3CX5 H;  2E75 C;  4WWI A;  1M90 Q;  1L0L D;  1KZU B;  1EXI A;  4NPD A;  1S2E A;  2YNY A;  3AEA C;  4XFJ A;  2KNC A;  2QJP B;  3CXH I;  2RMZ A;  2Q6Q A;  1ZLL A;  1YIJ P;  3CCQ P;  3CWB D;  2BAS A;  1MV8 A;  2JJL A;  3JC2 2;  1NTZ J;  2IBZ G;  2P10 A;  2WZ7 A;  2R5D A;  4C7N B;  2KS1 A;  3H1K J;  5APT A;  4N78 E;  2P1J A;  1N73 B;  3G4S P;  3V2P A;  3QWO C;  1X79 B;  3VN0 A;  3H1H E;  1KB9 H;  1M1J B;  3CCS P;  3BAS A;  3B5N B;  2PGD A;  4K35 A;  4JYC A;  1VQ5 P;  4H13 B;  3II6 A;  3N7N A;  3M9Q A;  2YIU B;  3GHG B;  1WMK A;  3K5B A;  5KLV G;  3CX5 I;  1SQB G;  2Q5U A;  4JBZ A;  3TK1 A;  5KAF E;  1NGM B;  1QVF O;  2YXR B;  1DD3 A;  3CWB E;  5B5E E;  3P7K A;  1EDJ A;  4NPE A;  2I1J A;  3AE2 C;  3RBZ A;  1JTH A;  3B71 A;  2ZFC A;  3JSV C;  5L8R J;  2AXT E;  1PPJ G;  1RF0 C;  1FZC C;  1BCC D;  1JM0 A;  1LTT C;  1KD1 Q;  3SWK A;  1FDO A;  2LXC B;  4H44 B;  1VPC A;  2H88 C;  2ZYD A;  1IFN A;  3L71 G;  1FOS F;  1E5W A;  2GM4 A;  3H1H J;  1IK7 A;  1WT6 A;  1N7S C;  4EIJ A;  3IFM A;  1NTM K;  3HD7 B;  2WSF J;  2I1K A;  1L0L J;  1GMJ A;  3RK2 D;  2PFX A;  2YO2 A;  2OGU A;  2BCC G;  2L5G B;  3KXD A;  4L74 A;  4M3L A;  1HBW A;  5KTB A;  1GU4 A;  2NPS A;  2Q9I A;  3VOP A;  1PIX A;  2Q3I A;  1Y47 A;  2D2C D;  1LT9 C;  2FXM A;  3CWB J;  4GDO A;  2E5T A;  1ZP0 C;  5AW7 B;  1URQ A;  2NPS C;  4K3A A;  4UB8 H;  2M0B A;  1BCC E;  3RK3 D;  3L70 D;  1KQF B;  1KIL B;  2OTL P;  1AFO A;  1ZXG A;  1JMB A;  2M5A B;  1L0N G;  1SQV E;  2JR8 A;  1BGY G;  3CC4 P;  1OMI A;  2KP8 A;  1BE3 E;  1PGO A;  4DCK A;  1AVY A;  4PD4 I;  4C7R A;  1Y8A A;  3L72 D;  3SWY A;  1FE6 A;  2IZ0 A;  4EYY Q;  1PP9 D;  2CPS A;  1IFI A;  3AEC C;  1ZOY C;  3A0H E;  1K73 Q;  4D6T G;  2K3R A;  3H1J G;  4HJG H;  1MFT A;  3BVH A;  3CPW O;  2PRR A;  1NU1 K;  2W6B A;  3W68 A;  5AVW B;  3R2P A;  2E74 B;  1T3U A;  1EZV D;  4PV1 B;  3H6P A;  3LIE A;  1RQV A;  1OVR A;  3U1A A;  1BCC J;  1HF9 A;  3O6Q B;  1DH3 A;  4WBA A;  1KN7 A;  2E43 A;  2ZT9 B;  3AE1 C;  1BE3 J;  5AW2 B;  4KHX A;  1OXZ A;  2NZ2 A;  3L72 E;  1AQT A;  3A3Y B;  2ZVO B;  5KAF H;  3VMY A;  2QJK C;  1PP9 E;  3P8C E;  2R3C A;  2Y9Z A;  2N9B A;  1KQL A;  1RF1 C;  1LTA C;  1NKN A;  2AXT H;  2Q1K A;  3LW5 H;  2AEM A;  2B89 A;  3H1L D;  2XDJ A;  4IL6 E;  2H8P D;  1G2C A;  3FXE A;  3MZW B;  1OW7 A;  2K9Y A;  5BU5 A;  1IO4 A;  2HPC A;  1H0T A;  1DX7 A;  5KJ7 D;  2AEF A;  2KNC B;  1IFD A;  3RL0 D;  1LWU C;  1G1I A;  3ZDM A;  1KB9 D;  2QVA A;  2QSI A;  2OYI A;  3NXS A;  1KC8 Q;  3V6I A;  5KLV E;  3L72 J;  1JY3 O;  1MFZ A;  3CX5 E;  1A02 J;  2P58 A;  1KOR A;  4GKG A;  2KS1 B;  1PP9 J;  5KLI B;  3PRJ A;  5AW4 B;  3S4R A;  5KAI H;  1K9M Q;  5KKZ B;  2O01 N;  3VP9 A;  2Q7C A;  1GL2 C;  1NTK G;  4Y99 B;  3NTN A;  1FZF A;  1RE4 A;  3UIA A;  3CC2 P;  3AED C;  2FBW C;  3A7O A;  2OTK E;  1IFP A;  1U57 A;  1SQX D;  5M1B A;  3CD6 P;  3C8V A;  1L2P A;  4HKZ H;  1QL2 A;  2C0X A;  2WWW A;  4NPF X;  2KUB A;  2A06 D;  4ASW A;  2H7H A;  4HH2 A;  1NYH A;  3AE3 C;  1SQP E;  1EQ7 A;  1NWQ A;  2AXC A;  3KPE A;  5KLV J;  2K9J A;  4ASV A;  1JTH B;  4DZO A;  1QL1 A;  4EI2 A;  3V2N A;  1NU1 D;  1CI6 B;  2J58 A;  1WRG A;  2KSE A;  3AE6 C;  3H1K D;  1YI2 P;  2Z4E A;  2KK7 A;  1YJW P;  2KYV A;  1J1D B;  3D6Y A;  2IFN A;  3MIW A;  1YBK A;  1OW6 A;  2FYN B;  4IOI H;  2DW3 A;  2Y0E A;  1SQX E;  1QVG O;  2JP3 A;  1SQV K;  4GOE A;  3AE9 C;  3OW2 O;  1N7S D;  3F89 A;  1VF5 D;  3CXH H;  3A5T A;  2AEJ A;  1LTB C;  2M3B A;  4IFM A;  2G3A A;  1R5S A;  3SFE C;  1SQP J;  2XKM A;  2IYP A;  2KI7 B;  1SS1 A;  2WTY A;  2OAR A;  3KQG A;  1EDI A;  3H1J E;  1URQ B;  1SQQ G;  4HB1 A;  4WVZ A;  1YTZ T;  3I56 P;  3M0D A;  3S9O A;  4EDF A;  3TF5 A;  4YPC A;  5CHX A;  1Q90 D;  4U3F G;  3L35 A;  4N78 D;  3AEG C;  5KJ7 A;  2OYH A;  3IAO A;  1IFJ A;  3H1I G;  4WY4 B;  1NVO A;  1EC5 A;  1FAV A;  3V4W A;  2IPP A;  3H1H D;  2ZT9 C;  1S4X A;  3VMX A;  3Q5S A;  4UB8 E;  1NHL A;  1SQX J;  3VMA A;  2KIK A;  2B88 A;  4W7Z A;  3HE4 B;  3RL0 C;  1P84 I;  3HUS A;  2IX7 C;  1KFM A;  3L74 G;  3F5H A;  2WQY C;  1LTG C;  1VQ4 P;  1FZE A;  1HTL C;  3L75 G;  1H89 A;  1Q2N A;  5CBN A;  3L70 G;  3SFD C;  2WT7 A;  1JCC A;  3HUS C;  2WPV B;  1N86 A;  4RJT A;  2IBZ I;  2XV5 A;  1NJI Q;  1NU1 J;  1FOS E;  2HFE D;  4B86 A;  4IL6 X;  2KSJ A;  1RE3 A;  4ZKU A;  4LC1 A;  1OWA A;  1VQ6 P;  2C0W A;  3G6E P;  3CI9 A;  3CCR P;  1BDD A;  1SVF A;  1GD2 E;  3AEF C;  5TJH A;  3BCC G;  1RE3 C;  4A7P A;  2L91 A;  1X8Y A;  3OAK A;  3T97 A;  5KLV K;  1VQK P;  4H0L B;  1IFM A;  3U59 A;  1FC2 C; 
#chains in the Genus database with same CATH homology
 3MGN A;  2CPS A;  4JF7 A;  1H8A A;  2O1K A;  1L0L K;  1IFI A;  2WPR A;  3TSI A;  1RF0 A;  1FZC A;  5APU A;  3E1I A;  5AW1 B;  1J2J B;  1SFC D;  1FZA A;  1AQ5 A;  3C9I A;  2HPC B;  4IFF A;  3RK2 C;  1NH4 A;  3BRV B;  3BVH A;  1XTC C;  2OYI C;  3B8E B;  5AVQ B;  1NU1 K;  5CCG D;  2W6B A;  1SP4 A;  3N4X A;  2J59 M;  5AVW B;  3R2P A;  1NO4 A;  2POH A;  3RK2 B;  1N7S A;  1YTZ I;  1T3U A;  1JCD A;  2OYI B;  2PP6 A;  5CJ0 A;  3H6P A;  2P2U A;  2PAJ A;  3LIE A;  4W7Y A;  3U1A A;  2XZR A;  2XNX A;  1DH3 A;  4WBA A;  3RK3 C;  2E43 A;  1RE4 C;  3HTK B;  3VMZ A;  5AW6 B;  1YYC A;  1SQP K;  3NFQ A;  2FFD A;  2GUS A;  5AW2 B;  4KHX A;  3M91 A;  5AW9 B;  2W6A A;  2N1T A;  1J1E C;  1OXZ A;  3BAT A;  3RK3 B;  4AUW A;  1LT9 A;  2HG5 D;  1KIL A;  3A3Y B;  5APV A;  5AVZ B;  3VMY A;  3P8C E;  3OJA B;  2R3C A;  1GK6 A;  2FFD C;  2R5B A;  5AVS B;  2N9B A;  1HH0 A;  1J1E B;  3MD0 A;  5APW A;  1GL2 D;  1KQL A;  3TNU A;  2N1T C;  4XA4 A;  2P67 A;  2O01 H;  1Z56 A;  3IR9 A;  3M9H A;  1LTA C;  1RF1 C;  1IC2 A;  1LGH B;  1NKN A;  1W2E A;  1T8Z A;  2WIT A;  1DEB A;  2WSC H;  2YKQ A;  2CPB A;  4WY4 D;  3VYI A;  1FDM A;  1LTJ C;  3LW5 H;  1SFC C;  5BVZ A;  3HE5 A;  4AYC A;  2FFD B;  1JY2 O;  3I5C A;  3P8M C;  5CCH A;  2XDJ A;  5APS A;  2H8P D;  2N1T B;  1G2C A;  1RF1 B;  1ZN5 A;  1FJP A;  1FZB A;  5AW3 B;  1LT9 B;  3L4F A;  5AW8 B;  2YMY A;  3A2A A;  1LTJ B;  1SFC B;  3CL3 D;  1MZ9 A;  5BU5 A;  1GW4 A;  3CLQ A;  1SQX K;  1IO4 A;  5AVX B;  2HPC A;  2WPS A;  5CCH C;  3HD7 D;  3KYQ A;  3P32 A;  2WSE H;  4W80 A;  1DX7 A;  5KJ7 D;  4N6J A;  1JO5 A;  1HJB A;  1IFD A;  3RL0 D;  5CJ4 A;  1LWU C;  5APY A;  1FU1 A;  1G1I A;  4LGD E;  1MUU A;  1SQB K;  1JOC A;  2OYI A;  2FKW B;  1ZR4 A;  1G2C B;  2W27 A;  3P8C D;  3NXS A;  3NMD A;  1T2K C;  1XTG B;  2KB7 P;  1CW5 A;  1JY3 O;  1LWU B;  2Z5H A;  1MFZ A;  2O1J A;  1A02 J;  4Y99 C;  5AVV B;  4GKG A;  1L4A A;  1JUN A;  2GUV A;  3HTK A;  5CMZ A;  5AW4 B;  3MUD A;  2HOD A;  1JY2 N;  2R32 A;  4C46 A;  4HYT B;  3HRN A;  1S9K D;  2YKO A;  3VP9 A;  4I2L C;  2Q7C A;  1GL2 C;  1NKZ B;  4Y99 B;  3NTN A;  1ZV8 A;  1FZF A;  1RE4 A;  1GU5 A;  1L4A C;  3UIA A;  1GZL A;  2M8R A;  2C9L Y;  5AVU B;  2P7J A;  3A7O A;  1JY2 P;  1HVV A;  3B5N D;  1GDT A;  2NPS D;  2HYN A;  1GL2 B;  2KLV A;  4RES B;  4O9B A;  4XE5 B;  3VP8 A;  1JMM A;  1GW3 A;  3EQ2 A;  1L4A B;  1HGV A;  1QL2 A;  4I1L A;  2C0X A;  1JNM A;  3M0D C;  2HOD B;  1PFI A;  2WWW A;  1URQ D;  3SWF A;  1CI6 A;  1GK4 A;  1RF1 A;  2H7H A;  4HH2 A;  5KJ7 C;  2OYH C;  1LTS C;  1JY3 N;  1ZR2 A;  5AVT B;  1EQ7 A;  1T3J A;  1NWQ A;  2KOG A;  1LTJ A;  4IFD K;  1SFC A;  2QM8 A;  3V2R A;  1HWT C;  1KZU B;  1RY3 A;  3H32 B;  3KPE A;  1FJK A;  2OYH B;  1JTH B;  3VTP C;  5CCG A;  2YNY A;  4GIF A;  2QM7 A;  1N73 A;  1JY3 P;  4DZO A;  1QL1 A;  4I6M C;  1J1D C;  1ZLL A;  3V2N A;  1CI6 B;  2J58 A;  2A45 G;  1WRG A;  2BAS A;  1MV8 A;  3EFG A;  1M1J A;  1S9K E;  2Z4E A;  1NAF A;  2JJL A;  5CCG C;  1L0N K;  1N73 C;  1LWU A;  2KYV A;  1J1D B;  2Z5I A;  3M9B A;  2WZ7 A;  2R5D A;  3OA7 A;  2IFN A;  4C7N B;  3MIW A;  1H88 A;  2YO3 A;  5APT A;  1FBM A;  3GHG A;  3M0A A;  4JYB A;  2XU6 A;  4N78 E;  2P1J A;  1M1J C;  4DOJ A;  1N73 B;  3B5N C;  1CSB A;  1SQV K;  3V2P A;  1LTI C;  3U1C A;  1X79 B;  3VN0 A;  5AW5 B;  1N7S D;  4OH8 B;  3MTU E;  4EOT A;  2E42 A;  1M1J B;  3GHG C;  3BAS A;  3B5N B;  2WPQ A;  3A5T A;  1LTB C;  1URQ C;  2M3B A;  2A45 H;  4JYC A;  4IFM A;  1GL2 A;  2XKM A;  3II6 A;  1SLQ A;  3N7N A;  2LKM A;  1GTW A;  3M06 A;  3M9Q A;  4WY4 A;  2WTY A;  2OAR A;  3KQG A;  1NTK K;  1HGZ A;  3GHG B;  5APQ A;  1URQ B;  3WMM 0;  2N1T D;  2Q5U A;  1FZG A;  1YTZ T;  3TK1 A;  1KIL D;  1HUC A;  3HE4 A;  3M0D A;  4WY4 C;  1KFN A;  5CHX A;  3P7K A;  1NTZ K;  3H32 A;  2I1J A;  3HD7 A;  3G3Z A;  3L35 A;  3L36 A;  4N78 D;  2OYH A;  1JTH A;  5KJ7 A;  4LLH A;  2ZFC A;  1IFJ A;  2HLO A;  1RF0 C;  1FZC C;  2FYU K;  4WY4 B;  1LTT C;  1VDF A;  1A02 F;  1FAV A;  4GT1 A;  3V4W A;  2IPP A;  1IJD B;  3KDP B;  3VMX A;  5CCH D;  1NHL A;  1CZQ A;  3HD7 C;  1VPC A;  3V2Q A;  1IFN A;  4WB4 A;  4W7Z A;  1FZC B;  3HE4 B;  1X9V A;  1E5W A;  1FOS F;  3RL0 C;  2WSF H;  2GM4 A;  3HUS A;  1WT6 A;  2IX7 C;  1KFM A;  1N7S C;  4C7N A;  4EIJ A;  1G1J A;  3IFM A;  1NTM K;  3HD7 B;  4ZKP A;  1T2K D;  1M7L A;  1LTG C;  1IK9 A;  1FZE A;  1HTL C;  2C9N Y;  1H89 A;  3RL0 B;  3O8Z A;  5BU8 B;  2I1K A;  2WT7 A;  1JCC A;  1N7S B;  2JEE A;  3RK2 D;  3HUS C;  2YO2 A;  2A45 I;  2L5G B;  5AVY B;  4M3L A;  3V5B A;  1N86 A;  1HBW A;  5KTB A;  1NOH A;  3LID A;  1GU4 A;  3B5N A;  2NPS A;  2Q9I A;  3VOP A;  2XV5 A;  2Q3I A;  1FOS E;  3HUS B;  1N7L A;  1L4A D;  1LT9 C;  2FXM A;  2HFE D;  1KIL C;  2YKP A;  4B86 A;  5AW7 B;  4N3Y B;  2KSJ A;  5AVR B;  1URQ A;  3V4Q A;  1N2D C;  1RE3 A;  4ZKU A;  2NPS C;  4LC1 A;  1OWA A;  2C0W A;  2WT7 B;  3RK3 D;  1KIL B;  2IFM A;  1AFO A;  3TYY A;  2ZXE B;  3CI9 A;  2FYZ A;  5APX A;  2H43 A;  1SVF A;  3PP5 A;  1GD2 E;  3L37 A;  2NPS B;  2KP8 A;  3TNU B;  1RE3 C;  3BRT B;  2MJZ A;  1SQQ K;  5AW0 B;  4C7R A;  4AQR D;  1X8Y A;  3OAK A;  3T97 A;  5KLV K;  3SWY A;  3HE5 B;  2VRS A;  1IFM A;  3U59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...