1IFIA

Molecular models and structural comparisons of native and mutant class i filamentous bacteriophages ff (fd, f1, m13), if1 and ike
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
50
structure length
50
Chain Sequence
AEGDDPAKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords INOVIRUS
publication title Molecular models and structural comparisons of native and mutant class I filamentous bacteriophages Ff (fd, f1, M13), If1 and IKe.
pubmed doi rcsb
source organism Enterobacteria phage fd
total genus 21
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1994-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ifiA00
1IFIA 1HH0A 1IFDA 1HGVA 1IFJA 1NH4A 2CPSA 1FDMA 2C0WA 2CPBA 2MJZA 1HGZA 2C0XA
chains in the Genus database with same CATH superfamily
1VQNP 1JCCA 1KB9H 1USEA 3L35A 3JCUH 3NXSA 1NU1D 1DEBA 1JEKA 2AEMA 1PGJA 1PGQA 3IF4A 1VF5B 2M5AB 2BCCJ 1ZXGA 1N7SB 2N9YB 3MUDC 3JCUE 2KZJA 3I5CA 4I1LA 3C1LA 1SFCB 5BVZA 3G6EP 4L73A 4RO0A 1IK7A 4BRYB 1EXJA 4PD4I 3M0DC 1N7LA 1MUUA 2Z5IA 3H1JG 2ZT9D 2N1TC 5KTBA 1YI2P 4GKGA 3BCCJ 1IO4A 3O6QA 1J1EB 2GA1A 5M1BA 1FDOA 5GTHH 2LXCB 3CL3D 1OVVA 4U3FD 1S9KD 3L74J 2PFXA 3AE8C 3L72E 2QJKB 1Q2NA 1G1JA 4N6JA 2BASA 1S2EA 3M9HA 4I7ZC 2O01H 3L73D 3EFGA 1SP4A 5B66H 1L4AB 2M5AA 2POHA 3SWYA 5H2FE 1JB0J 1N7SA 1ZMEC 2OTKE 1JMBA 2XV5A 3L72G 2Q1KA 1SFCA 1SLQA 2M3BA 3L75D 3L37A 4BRYA 1R5LA 5AW6B 5KJ7A 4JF7A 2FYUJ 1K05A 3WUTA 2QRXA 1GL2B 2QM7A 3D6ZA 3CMEP 1YIJP 3AEGC 1P84I 4XFJA 3D70A 1BCCD 2N9BA 2A45H 3RBZA 2OTJP 2IZ0A 5AW5B 3TGUE 3A0HH 1Y9BA 1KV4A 1T2KC 2OARA 3HTKA 3IR9A 1VQ7P 1VF5C 3LW5J 1J2JB 1N7SC 3HUSB 2E42A 1S5LH 5APQA 1S72P 3A0HE 3G3ZA 4IL6X 1SFCC 1EDKA 1AJYA 2WZ7A 3BRTB 5APTA 1AV1A 1SQVD 1P84D 5KJ7C 1FU1A 3Q1MA 1SQPK 3IN6A 1L4AA 2WSCH 1BE3D 4NPEA 1FC2C 1HJBA 3TGUG 1NTME 1KYOH 4ZKPA 1YYCA 4OH8B 2NPSD 2E74D 1PGPA 1JY3P 1A02J 1OVUA 2BEQD 2QIWA 3NTNA 1QX8A 1JY2O 1NGMB 2V4HA 1KYOE 3VYIA 1FAVA 2QJKC 1KQLA 5CJ4A 3H1KJ 3FX0A 1GL2A 1KILD 2JWDA 4UB6H 1SQBK 2H7HA 1NTZD 1GZLA 2K9YA 1NTMG 3HD7B 1LTBC 1SQQD 1L4AC 2OGUA 4UB6E 4KJMA 3CC7P 1L0LK 2OYHA 1X8YA 4Y28J 4LC1A 2JJLA 3PH0A 4QMAA 3AE6C 3SFEC 2KYVA 3SWKA 2D2CD 2ZVOB 4PD4H 1KQGB 4NPFX 1GL2C 3AE1C 1NKZB 3NMDA 3QH9A 1ZLLA 2A06E 1ZV8A 2HPCB 1JNMA 2BCCD 2QEXP 3VP8A 5AVYB 2YO2A 4R4MA 4HJGH 1YJWP 4IL6H 1PP9J 2Q3IA 4PD4E 3KHUA 2KS1A 2HLOA 3VN0A 2XDJA 2AXCA 4AUWA 2H89C 4D6TE 1CI6A 3HE4B 2WVRA 1AVYA 4IL6E 3L70J 4GT1A 2C9NY 2OYHC 2WPSA 4H0LD 5CJ0A 1QEXA 3BCCD 5CCHD 1NTKE 3VMZA 5AW1B 1HUCA 3HD7A 4H44D 3BVHA 2A06G 4MN4C 1LWUB 3PHLA 1OZHA 4L75A 5CCGA 5AW9B 1N73B 3RK2C 4D6TG 3CCQP 4HKZH 2WT7B 3C9IA 5KAIH 1RH5B 3CCVP 3V2NA 3MIWA 1K73Q 3G4SP 1WMKA 1ZP0C 3CCEP 2B9BA 2IYOA 3WUVA 1U7JA 3E7KA 2K9JA 1HGZA 1AFOA 3KZIH 2ZAEB 1E5WA 1NTKG 1QVGO 3H1LD 1BGYE 5AVWB 1YTZT 1VQ5P 1P84H 3A0BE 1NU1K 2YXQB 3HD7C 3KZIE 3HE5A 1RHZB 3CC2P 2J59M 3GW6A 3HE4A 1LNQA 1P84E 4EI2A 5CCGC 1LT9B 5AVXB 1NWQA 4JPZB 1ZRTE 1GW3A 5AW7B 1VQMP 2FXOA 2MKVA 2KXPB 3MHVA 1VQPP 1BGYG 4K3AA 1DIPA 3VP9A 2L5GB 2NZ2A 1LWUA 1MKMA 1W2EA 5APWA 1M1KQ 3L71E 2O3JA 3S9OA 1KFNA 1BSNA 2E76B 4EOTA 3G9RA 1MFZA 1FBMA 1N73A 2M3EA 1EZVI 1L2PA 4XE5B 2QM8A 2WT7A 2K37A 1TU3F 2Y0CA 3AE2C 1URQD 2YIUC 2R5BA 2XZRA 2Q9IA 1YBKA 1KD1Q 1VL2A 3RL0C 4DJGA 2W6JH 3TK1A 3CWBJ 2V7QJ 2E75D 1M1JA 3ITKA 1Z56A 1A02F 4RJTA 1OIPA 5KLVJ 5KLIB 2L91A 3L71G 3ABVC 2IFMA 1EZVD 3B5ND 1LWUC 3TF5A 3L71J 3TDKA 2E5YA 2Y9ZA 2WWWA 4IFDK 1H89A 1W5CE 1LT9A 2H8PD 1N73C 3BATA 3H1KD 1PGOA 2KI7B 4N78D 1NOHA 1W2BO 2JO1A 1UIIA 1L0ND 2QSIA 2IBZE 4OWFA 1H88A 2N1TD 4W7YA 3OW2O 5TJHA 2LR2A 3WU2H 1KN7A 1OWAA 1HGVA 1FS0E 1J1DB 1M1JC 1HBWA 3H1IE 4H13D 1N86A 1QLED 1E79H 1OW8A 3CXHI 5E79H 1BSHA 2IFNA 4C46A 1KB9E 4HYTB 2WITA 1SQPE 5AW2B 1LT9C 2B88A 5CBNA 2J58A 5E79E 2IBZG 1WRGA 3P32A 4WY4A 1GU5A 1SQVK 1U7MA 3RK3E 3H1IG 1S5LX 1PP9D 1LTJA 3H1JJ 1FDMA 4YXDC 3CXHD 2WSFH 1M56D 2E76C 1ZN5A 3NFQA 1H0TB 1HTLC 3LIDA 1SQPG 1NAYA 1SQBE 3H1LE 5APYA 4XA4A 1CW5A 4Z1MH 5GTHE 3P7KA 1YITP 4K35A 2Q3EA 2AXTH 2KB7P 2KZIA 3JC22 2KLUA 1KZUB 1L0LE 1XTCC 3PP5A 3MP7B 3FWLA 1JO5A 5AW4B 3A2AA 5KLIC 1NTZK 5CHXA 4WY4C 3H6PA 3D71A 3P8CD 4I2LC 1OVRA 1OX3A 3KDPB 1ZR2A 3SSUA 4W7ZA 3GG2A 1LTJC 2FXMA 1T2KD 5C39A 4Y99B 1SQQK 1Q86Q 2YKOA 1SQBG 3H1LG 2YMYA 3AEEC 1SQBJ 5B66E 3M9BA 3L72J 1SFCD 3TNUB 1FDIA 1AQTA 2FY8A 2NPSB 2E74B 1Q90D 4JYCA 1YJNP 1L0LG 3CC4P 3VOPA 2RMZA 3VMXA 3PTZA 4PV1C 1L0LJ 1VQLP 1NHLA 1OW7A 1CZQA 1KC8Q 3TYYA 1J1DC 3C8VA 1Q81Q 3GLMA 1KILB 3V5BA 1OXZA 2B89A 1LTIC 4KHXA 4IOIH 3M0AA 1DH3A 2OYIB 1DEEG 1NYHA 2O01J 3H1HE 1IFDA 1SQXD 3GF7A 2KLVA 4N3YB 1JY3N 3RBXA 4M3LA 1GU4A 1JTHB 1S5LE 1IFMA 2KSJA 3UIAA 2Z4EA 1VQ4P 5K5GB 4OGQD 4DZOA 1FZCB 1J1EC 2D2CB 3TGUJ 3KXDA 2A45G 1EC5A 3TNUA 3V2PA 1ZOYC 3H1HG 2NPSA 2W90A 2RKLA 2I1KA 1NU1E 5KLVD 1EDLA 1X0TA 2KSEA 2OYOA 2FYNB 2ZYGA 3V2RA 1FZFA 2WSEH 1NJIQ 1S3JA 3CCRP 5AVVB 1IZNB 3SFDC 1DD3A 3V4WA 2IYPA 2GUSA 2Q6QA 4H0LB 3QWOC 1NTMJ 4YTPC 4ASVA 4C7NB 2P67A 4Y99C 4KT0J 3CXHH 3HUSA 1NKNA 3CX5I 4H44B 1MV8A 1PZQA 2GM4A 2WSCJ 5EFWB 1QL2A 2FYUK 4ZMDA 3CCMP 2O1KA 1NU1G 5L8RJ 2C0WA 2SPZA 1SS1A 1KQSO 2OTLP 1NU1J 2NPSC 3CXHE 3RL0g 3N7NA 3RK3B 3U1AA 3P8MC 1D7MA 4U3FE 1S9KE 4L76A 1FZCA 3IAOA 2YKPA 3FXDA 1BDDA 3USSA 3GHGB 3RK2D 3CX5D 3CI9A 1WT6A 4DOJA 1HH0A 1RE3A 4HB1A 2G3AA 1LP1B 4JBZA 2W6AA 3HUSC 3CD6P 3L73E 1FZAA 2PP6A 3H1JD 1Q7YQ 3PLNA 4U3FG 2JWAA 3Q5PA 5BU8B 4TT3H 1EDJA 1LJ2A 3L75E 1KTMA 3HD7D 2FYZA 1FE6A 4C7NA 3L74D 1GW4A 2HR3A 3BASA 1FZCC 2JR8A 1OFCX 1UIXA 5AVRB 5CCGD 3I56P 1FZEA 3MZWB 3V2QA 3FXEA 4D6TJ 3MGNA 1BCCE 2QJPB 3L73G 1RE3C 3PJSK 5AVZB 1PV3A 3T97B 3F89A 2FBWC 3AE4C 2HFED 5AVQB 1L0NK 3S4RA 5KAIE 3GMAA 4B86A 1URQB 1AQ5A 2HPCA 2R32A 1NTKJ 1YTZI 3L75G 3KQGA 4O9BA 3GHGA 1QL1A 1Y47A 2E75B 1JM0A 3L72D 1K8AQ 2M0BA 1SQVE 2FYUD 4H44C 1BCCG 3RL0D 2ZYAA 3B5NB 2RH0A 1BE3E 1VDFA 3A7OA 2HYNA 2WPQA 3RK3C 1PPJD 3MD0A 5APVA 1BGYJ 2E5TA 3Q5SA 1HWTC 3A3YB 3WMM0 4IFFA 3V6IA 1SVFA 3II6A 3GHGC 1SQVG 4BWNA 1KILE 1FJKA 4W80A 4AYCA 3SWFA 2YXRB 1NTZE 1BE3G 4H13B 2IZ1A 2G8YA 1GDTA 4AQRD 2QA4P 1AA0A 1S4XA 4GDOA 1SQQE 1JY3O 2Y9YA 4LGDE 1GK4A 2ZVNB 3IFMA 5AVTB 3TGUD 1RY3A 4U7JA 3L4FA 2R3CA 1HF9A 2Y0EA 2K1AA 2ZT9B 1RF0A 4LLHA 2W27A 3B5NA 1NTZG 3CX5H 1JY2P 4L74A 1JMMA 2P2UA 1NTZJ 3HRNA 3O6QB 2BCCE 1LGHB 1SQQG 1T3UA 1RQUA 3CX5E 1JUNA 2ZXEB 3CLQA 1NTMD 2ZXXA 2JDIH 3OAKA 1X22A 3AECC 3D6YA 1LTSC 4WBAA 1KORA 1IK9A 4RKUJ 5APUA 2KIKA 2E75C 3BRVB 3WU2E 2WPRA 3BCCE 1KYOD 4R4LA 2KOGA 1FOSE 3I55P 1RF0C 2BCCG 4DCKA 3B5NC 4GOEA 3L74E 1SQXK 2Q5UA 1M90Q 1YQ3C 4RESB 2ZFCA 3AE7C 4WY4D 1DD4A 1EQ7A 3O8ZA 1YHQP 2WSSH 3H1IJ 1GTWA 1KQFB 3BCCG 3AE3C 3L70D 4ASWA 1X9VA 1SQPJ 2YMKA 1G2CB 4H13C 2K3RA 1U57A 3L74G 5KKZB 5KLVK 3Q3DA 4PV1D 1DX7A 3HTKB 2A06D 4HH2A 1XTGB 1S1CX 3VMYA 1IFPA 1G1IA 2FYUE 4PD4D 2AXTE 4ZNCA 1VF5D 5H2FH 2W8ZA 4D6TD 2B87B 2CK3H 3LW5H 1N8RQ 1N7SD 2ZT9C 1PPJE 1EXIA 3H1LJ 1R8EA 2M8RA 1RF1B 4OGQB 2CPBA 2LKMA 2WSFJ 1HVVA 1NTKD 3AEAC 1M8OB 3Q2YA 5KJ7D 2P1JA 2ITAA 3LIEA 2FYUG 2E43A 2WMMA 2AEFA 3OA7A 5AW3B 1H0TA 4EIJA 3W68A 1MZ9A 2IPPA 1M7LA 1PPJG 5AVUB 1G2CA 1LTGC 2P58A 3OJAB 5DJUB 2ZYDA 1X79B 3CPWO 3MTUE 4C7RA 2QG4A 2Z5HA 1EZVE 1BGYD 4OVNF 3EFFK 1FZGA 5AVSB 2DW3A 2OYHB 3H1KE 3CCLP 2UWJE 1L4AD 2FFDB 2JEEA 2KP8A 2B87A 4N78E 1H8AA 2R5DA 3AE9C 3EQ2A 2HODB 1L0NE 2KNCB 1RF1A 2OQQA 1ZRTD 3CWBD 4WB4A 2K88A 1GD2E 1EZVG 3H1HJ 3S1KA 2LXBA 3RK2B 1GL2D 4WVZA 3G71P 5KKZC 2KS1B 2QJYB 2R3SA 3KYQA 3L71D 4JYBA 3AEFC 2XU6A 3H1KG 1PL5A 1CI6B 4I6MC 3CCUP 1KILA 3PRJA 2ZJSE 3Q5RA 4YXWH 4EYYQ 3B71A 1L0NG 1T3JA 1FZBA 3TSIA 2YO3A 2OYIA 5GTIH 1L0NJ 1NH4A 2IDBA 4ZKUA 1LTAC 1GK6A 1PP9E 4CPGA 3CCJP 1RF1C 4OGQC 5TISH 1OMIA 2IBZI 2E74C 3GF3A 5GTIE 1JTHA 1HJ0A 2W83C 1VPCA 2FFDA 3L70E 2P10A 5TISE 2HODA 3H32B 3R4YA 2BEZF 3B8EB 2KNCA 1KILC 2K9JB 2WSEJ 1M57D 4GOFA 1KB9I 1KMIZ 5KAFH 1LT1A 2FKWB 3E1IA 1PP9G 4GODA 2Q7CA 3CMAP 2OYIC 5APXA 2IBZD 2I1JA 2MJZA 5B5EH 3P8CE 3M9QA 3AE5C 3HE5B 5KAFE 2YIUB 1VQ8P 3H1ID 2KUBA 1IJDB 3L70G 5AW8B 3RL0B 1NO4A 1FOSF 4U3FJ 5B5EE 5CCHA 4PJ0H 2FFDC 2JKVA 2AEJA 1KB9D 2IX7C 3B4SA 4WWIA 2D2CC 2HG5D 4EDFA 1SQPD 1K04A 1JCDA 4GIFA 1ZR4A 4PJ0E 2YNYA 1VQOP 5APSA 2R44A 2W6BA 2JP3A 3L73J 3RK3D 2FYNC 5DJTB 2QJYC 3RGUA 3R2PA 2PAJA 3CCSP 1NTMK 1NVOA 3H32A 1KFMA 3A0BH 3L75J 1QVFO 1RQVA 4H0LC 2YKQA 1SQBD 2FXPA 1SQXE 1LP1A 1M1JB 5CCHC 5AW0B 1PIXA 1VQ6P 1BDCA 2NRGA 1USDA 1BCCJ 3WUUA 2V7QH 1L0LD 1CSBA 3A5TA 1FJPA 3FWNA 2QE7H 2C0XA 2O01N 1OW6A 1NAFA 2J5UA 1IC2A 1T6AA 3K5BA 3EWKA 3CWBE 5CMZA 2Y0DA 2WTYA 3U59A 3FGAD 3JSVC 1RE4A 1SQXG 3M06A 5KLVE 2N1TB 1SQXJ 1Y8AA 2GUVA 2A45I 1SQVJ 2XKMA 1R5SA 2VRSA 3KPEA 3N4XA 3W67A 2RN0A 3T97A 4JQ0D 1BE3J 1EDIA 2O1JA 2KK7A 5CBOA 1N2DC 1URQA 4A7PA 3VMAA 2QVAA 1IFNA 4IFMA 2CPSA 1JY2N 1K9MQ 3ZDMA 3CWBG 4UB8H 2C9LY 1VQKP 1Q82Q 4TLFA 2H88C 5KLVG 4BXLA 1LTTC 1VQ9P 3AEBC 4I7ZB 2PRRA 4WY4B 4UB8E 3H1HD 1QGKB 1RE4C 2P7JA 1KYOI 1LTJB 2I8DA 2H43A 3F5HA 1IFIA 1GMJA 3E1RA 3H25A 3MUDA 1YQ4C 2QJPC 2XNDH 1NTKK 3L36A 2WQYC 1SQQJ 1T8ZA 4DT0A 3AEDC 1IFJA 2XNXA 3M0DA 1URQC 4NPDA 1MFTA 2PGDA 1YJ9P 1ZW0A 3M91A 3VTPC 2E76D 3U1CA 5BU5A 2N1TA 1PFIA 1JOCA 3V4QA 2WPVB 1AVOA 4YPCA 4PV1B 3H1JE
chains in the Genus database with same CATH topology
1JCCA 2J59M 3HE4A 2NPSC 3L35A 3OA7A 3N7NA 5AW3B 3RK3B 3U1AA 3NXSA 4EIJA 5CCGC 3P8MC 1DEBA 1LT9B 5AVXB 1NWQA 1S9KE 1MZ9A 2IPPA 1M7LA 1GW3A 5AW7B 1FZCA 5AVUB 1N7SB 1G2CA 2YKPA 1LTGC 3OJAB 3VP9A 1X79B 3MTUE 4C7RA 2L5GB 3GHGB 3RK2D 3I5CA 4I1LA 1LWUA 1SFCB 2Z5HA 3CI9A 1WT6A 5BVZA 4DOJA 1W2EA 1HH0A 5APWA 1RE3A 1FZGA 3M0DC 1KFNA 1N7LA 4EOTA 1MFZA 1MUUA 2Z5IA 1FBMA 5AVSB 2W6AA 1N73A 3HUSC 4XE5B 2N1TC 2QM8A 2WT7A 2OYHB 5KTBA 1FZAA 4GKGA 2PP6A 1L4AD 2FFDB 1IO4A 2JEEA 2KP8A 1URQD 4N78E 1J1EB 2R5BA 1H8AA 2XZRA 2R5DA 2Q9IA 3EQ2A 2HODB 3CL3D 3RL0C 5BU8B 3TK1A 3HD7D 2FYZA 1RF1A 1S9KD 4C7NA 1M1JA 4WB4A 1Z56A 1GW4A 1A02F 1GD2E 3BASA 1FZCC 5AVRB 3RK2B 5CCGD 1FZEA 2IFMA 1GL2D 3V2QA 3B5ND 1LWUC 3MGNA 3KYQA 1G1JA 4JYBA 4N6JA 2WWWA 2XU6A 4IFDK 1RE3C 2BASA 1H89A 1CI6B 3M9HA 5AVZB 4I6MC 1LT9A 2HFED 1KILA 2H8PD 5AVQB 1N73C 2O01H 3EFGA 3BATA 1L0NK 1SP4A 1L4AB 4B86A 2POHA 3SWYA 1URQB 1AQ5A 2HPCA 2R32A 1T3JA 1YTZI 1FZBA 4N78D 2YO3A 1N7SA 3TSIA 2OYIA 1NOHA 3KQGA 1NH4A 4O9BA 3GHGA 2XV5A 4ZKUA 1SFCA 1QL1A 1LTAC 1SLQA 2M3BA 1H88A 1GK6A 2N1TD 4W7YA 3L37A 1RF1C 1OWAA 1HGVA 5AW6B 1J1DB 1M1JC 1HBWA 5KJ7A 4JF7A 1JTHA 1N86A 3RL0D 1GL2B 3B5NB 2QM7A 1VPCA 2FFDA 1VDFA 3A7OA 2IFNA 2HYNA 2N9BA 4C46A 2A45H 4HYTB 2WITA 2HODA 3H32B 2WPQA 5AW2B 5AW5B 3RK3C 3MD0A 5APVA 3B8EB 1LT9C 1KILC 2J58A 1T2KC 2OARA 3HTKA 3IR9A 1HWTC 3A3YB 3WMM0 2FKWB 3E1IA 4IFFA 2Q7CA 1WRGA 3P32A 1J2JB 4WY4A 1SVFA 1N7SC 1GU5A 3HUSB 2OYIC 2E42A 1SQVK 5APXA 2I1JA 5APQA 2MJZA 3II6A 3GHGC 3P8CE 1LTJA 3G3ZA 3M9QA 1SFCC 3HE5B 2WZ7A 1FJKA 4W80A 4AYCA 1FDMA 3BRTB 3SWFA 5APTA 2WSFH 1IJDB 5KJ7C 5AW8B 1FU1A 1ZN5A 3RL0B 3NFQA 1NO4A 1GDTA 1SQPK 1FOSF 4AQRD 1HTLC 1L4AA 2WSCH 3LIDA 5CCHA 5APYA 1HJBA 1JY3O 4XA4A 2FFDC 4LGDE 1CW5A 4ZKPA 1GK4A 2IX7C 1YYCA 2HG5D 2NPSD 3IFMA 4OH8B 3P7KA 5AVTB 1RY3A 1JY3P 1A02J 1JCDA 2KB7P 3L4FA 2R3CA 3NTNA 1KZUB 1JY2O 4GIFA 1ZR4A 1XTCC 3PP5A 2YNYA 3VYIA 1JO5A 1FAVA 5AW4B 3A2AA 5APSA 2W6BA 1NTZK 1RF0A 1KQLA 5CJ4A 5CHXA 3RK3D 1GL2A 4WY4C 3H6PA 4LLHA 2W27A 3B5NA 3P8CD 4I2LC 1JY2P 3KDPB 1ZR2A 1KILD 4W7ZA 1JMMA 1LTJC 2P2UA 2FXMA 1T2KD 4Y99B 1SQBK 3R2PA 1SQQK 2H7HA 3HRNA 2PAJA 1LGHB 2YKOA 1NTMK 3H32A 1GZLA 1T3UA 2YMYA 1KFMA 3HD7B 1LTBC 2YKQA 3M9BA 1JUNA 1L4AC 1SFCD 3TNUB 2ZXEB 3CLQA 1M1JB 5CCHC 2NPSB 1L0LK 3OAKA 5AW0B 4JYCA 1LTSC 3VOPA 2OYHA 1X8YA 3VMXA 4WBAA 1IK9A 5APUA 4LC1A 2JJLA 1NHLA 3BRVB 1CSBA 1CZQA 2WPRA 3A5TA 2KYVA 1FJPA 3TYYA 1J1DC 2KOGA 1FOSE 2C0XA 1RF0C 1KILB 3V5BA 1GL2C 1NAFA 1OXZA 1IC2A 1NKZB 3B5NC 1LTIC 3NMDA 4KHXA 1ZLLA 5CMZA 3M0AA 1ZV8A 2HPCB 1JNMA 1SQXK 2Q5UA 2WTYA 3U59A 5AVYB 3VP8A 2YO2A 1DH3A 2OYIB 1RE4A 4RESB 3M06A 2ZFCA 2Q3IA 2N1TB 4WY4D 1IFDA 2HLOA 1EQ7A 3O8ZA 3VN0A 2GUVA 2A45I 2XDJA 2KLVA 4N3YB 4AUWA 2XKMA 2VRSA 3KPEA 1GTWA 1JY3N 3N4XA 1CI6A 3T97A 3HE4B 4M3LA 1GU4A 1JTHB 2O1JA 1IFMA 2KSJA 4GT1A 1N2DC 3UIAA 2C9NY 2OYHC 2WPSA 1URQA 2Z4EA 5CJ0A 1IFNA 4IFMA 4DZOA 1X9VA 2CPSA 5CCHD 1FZCB 1JY2N 1J1EC 3VMZA 5AW1B 1G2CB 1HUCA 2C9LY 3HD7A 3BVHA 2A45G 5KLVK 1LWUB 3TNUA 3V2PA 1DX7A 3HTKB 1LTTC 2NPSA 4HH2A 5CCGA 1XTGB 2I1KA 3VMYA 5AW9B 4WY4B 1G1IA 1N73B 3RK2C 2P7JA 1RE4C 2WT7B 3C9IA 1LTJB 2H43A 3V2RA 1FZFA 2WSEH 1IFIA 3V2NA 3MIWA 5AVVB 3MUDA 3LW5H 1N7SD 3V4WA 1NTKK 2GUSA 3L36A 1HGZA 1AFOA 1T8ZA 1E5WA 2M8RA 1IFJA 1RF1B 2CPBA 2XNXA 3M0DA 1URQC 5AVWB 4C7NB 2P67A 2LKMA 1YTZT 1HVVA 4Y99C 3HUSA 1NKNA 3M91A 3VTPC 5KJ7D 1MV8A 2P1JA 3U1CA 5BU5A 2N1TA 1PFIA 2GM4A 1JOCA 3V4QA 1NU1K 3HD7C 1QL2A 2FYUK 3HE5A 2O1KA 3LIEA 2C0WA 2E43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFI A;  1HH0 A;  1IFD A;  1HGV A;  1IFJ A;  1NH4 A;  2CPS A;  1FDM A;  2C0W A;  2CPB A;  2MJZ A;  1HGZ A;  2C0X A; 
#chains in the Genus database with same CATH topology
 1VQN P;  1JCC A;  1KB9 H;  1USE A;  3L35 A;  3JCU H;  3NXS A;  1NU1 D;  1DEB A;  1JEK A;  2AEM A;  1PGJ A;  1PGQ A;  3IF4 A;  1VF5 B;  2M5A B;  2BCC J;  1ZXG A;  1N7S B;  2N9Y B;  3MUD C;  3JCU E;  2KZJ A;  3I5C A;  4I1L A;  3C1L A;  1SFC B;  5BVZ A;  3G6E P;  4L73 A;  4RO0 A;  1IK7 A;  4BRY B;  1EXJ A;  4PD4 I;  3M0D C;  1N7L A;  1MUU A;  2Z5I A;  3H1J G;  2ZT9 D;  2N1T C;  5KTB A;  1YI2 P;  4GKG A;  3BCC J;  1IO4 A;  3O6Q A;  1J1E B;  2GA1 A;  5M1B A;  1FDO A;  5GTH H;  2LXC B;  3CL3 D;  1OVV A;  4U3F D;  1S9K D;  3L74 J;  2PFX A;  3AE8 C;  3L72 E;  2QJK B;  1Q2N A;  1G1J A;  4N6J A;  2BAS A;  1S2E A;  3M9H A;  4I7Z C;  2O01 H;  3L73 D;  3EFG A;  1SP4 A;  5B66 H;  1L4A B;  2M5A A;  2POH A;  3SWY A;  5H2F E;  1JB0 J;  1N7S A;  1ZME C;  2OTK E;  1JMB A;  2XV5 A;  3L72 G;  2Q1K A;  1SFC A;  1SLQ A;  2M3B A;  3L75 D;  3L37 A;  4BRY A;  1R5L A;  5AW6 B;  5KJ7 A;  4JF7 A;  2FYU J;  1K05 A;  3WUT A;  2QRX A;  1GL2 B;  2QM7 A;  3D6Z A;  3CME P;  1YIJ P;  3AEG C;  1P84 I;  4XFJ A;  3D70 A;  1BCC D;  2N9B A;  2A45 H;  3RBZ A;  2OTJ P;  2IZ0 A;  5AW5 B;  3TGU E;  3A0H H;  1Y9B A;  1KV4 A;  1T2K C;  2OAR A;  3HTK A;  3IR9 A;  1VQ7 P;  1VF5 C;  3LW5 J;  1J2J B;  1N7S C;  3HUS B;  2E42 A;  1S5L H;  5APQ A;  1S72 P;  3A0H E;  3G3Z A;  4IL6 X;  1SFC C;  1EDK A;  1AJY A;  2WZ7 A;  3BRT B;  5APT A;  1AV1 A;  1SQV D;  1P84 D;  5KJ7 C;  1FU1 A;  3Q1M A;  1SQP K;  3IN6 A;  1L4A A;  2WSC H;  1BE3 D;  4NPE A;  1FC2 C;  1HJB A;  3TGU G;  1NTM E;  1KYO H;  4ZKP A;  1YYC A;  4OH8 B;  2NPS D;  2E74 D;  1PGP A;  1JY3 P;  1A02 J;  1OVU A;  2BEQ D;  2QIW A;  3NTN A;  1QX8 A;  1JY2 O;  1NGM B;  2V4H A;  1KYO E;  3VYI A;  1FAV A;  2QJK C;  1KQL A;  5CJ4 A;  3H1K J;  3FX0 A;  1GL2 A;  1KIL D;  2JWD A;  4UB6 H;  1SQB K;  2H7H A;  1NTZ D;  1GZL A;  2K9Y A;  1NTM G;  3HD7 B;  1LTB C;  1SQQ D;  1L4A C;  2OGU A;  4UB6 E;  4KJM A;  3CC7 P;  1L0L K;  2OYH A;  1X8Y A;  4Y28 J;  4LC1 A;  2JJL A;  3PH0 A;  4QMA A;  3AE6 C;  3SFE C;  2KYV A;  3SWK A;  2D2C D;  2ZVO B;  4PD4 H;  1KQG B;  4NPF X;  1GL2 C;  3AE1 C;  1NKZ B;  3NMD A;  3QH9 A;  1ZLL A;  2A06 E;  1ZV8 A;  2HPC B;  1JNM A;  2BCC D;  2QEX P;  3VP8 A;  5AVY B;  2YO2 A;  4R4M A;  4HJG H;  1YJW P;  4IL6 H;  1PP9 J;  2Q3I A;  4PD4 E;  3KHU A;  2KS1 A;  2HLO A;  3VN0 A;  2XDJ A;  2AXC A;  4AUW A;  2H89 C;  4D6T E;  1CI6 A;  3HE4 B;  2WVR A;  1AVY A;  4IL6 E;  3L70 J;  4GT1 A;  2C9N Y;  2OYH C;  2WPS A;  4H0L D;  5CJ0 A;  1QEX A;  3BCC D;  5CCH D;  1NTK E;  3VMZ A;  5AW1 B;  1HUC A;  3HD7 A;  4H44 D;  3BVH A;  2A06 G;  4MN4 C;  1LWU B;  3PHL A;  1OZH A;  4L75 A;  5CCG A;  5AW9 B;  1N73 B;  3RK2 C;  4D6T G;  3CCQ P;  4HKZ H;  2WT7 B;  3C9I A;  5KAI H;  1RH5 B;  3CCV P;  3V2N A;  3MIW A;  1K73 Q;  3G4S P;  1WMK A;  1ZP0 C;  3CCE P;  2B9B A;  2IYO A;  3WUV A;  1U7J A;  3E7K A;  2K9J A;  1HGZ A;  1AFO A;  3KZI H;  2ZAE B;  1E5W A;  1NTK G;  1QVG O;  3H1L D;  1BGY E;  5AVW B;  1YTZ T;  1VQ5 P;  1P84 H;  3A0B E;  1NU1 K;  2YXQ B;  3HD7 C;  3KZI E;  3HE5 A;  1RHZ B;  3CC2 P;  2J59 M;  3GW6 A;  3HE4 A;  1LNQ A;  1P84 E;  4EI2 A;  5CCG C;  1LT9 B;  5AVX B;  1NWQ A;  4JPZ B;  1ZRT E;  1GW3 A;  5AW7 B;  1VQM P;  2FXO A;  2MKV A;  2KXP B;  3MHV A;  1VQP P;  1BGY G;  4K3A A;  1DIP A;  3VP9 A;  2L5G B;  2NZ2 A;  1LWU A;  1MKM A;  1W2E A;  5APW A;  1M1K Q;  3L71 E;  2O3J A;  3S9O A;  1KFN A;  1BSN A;  2E76 B;  4EOT A;  3G9R A;  1MFZ A;  1FBM A;  1N73 A;  2M3E A;  1EZV I;  1L2P A;  4XE5 B;  2QM8 A;  2WT7 A;  2K37 A;  1TU3 F;  2Y0C A;  3AE2 C;  1URQ D;  2YIU C;  2R5B A;  2XZR A;  2Q9I A;  1YBK A;  1KD1 Q;  1VL2 A;  3RL0 C;  4DJG A;  2W6J H;  3TK1 A;  3CWB J;  2V7Q J;  2E75 D;  1M1J A;  3ITK A;  1Z56 A;  1A02 F;  4RJT A;  1OIP A;  5KLV J;  5KLI B;  2L91 A;  3L71 G;  3ABV C;  2IFM A;  1EZV D;  3B5N D;  1LWU C;  3TF5 A;  3L71 J;  3TDK A;  2E5Y A;  2Y9Z A;  2WWW A;  4IFD K;  1H89 A;  1W5C E;  1LT9 A;  2H8P D;  1N73 C;  3BAT A;  3H1K D;  1PGO A;  2KI7 B;  4N78 D;  1NOH A;  1W2B O;  2JO1 A;  1UII A;  1L0N D;  2QSI A;  2IBZ E;  4OWF A;  1H88 A;  2N1T D;  4W7Y A;  3OW2 O;  5TJH A;  2LR2 A;  3WU2 H;  1KN7 A;  1OWA A;  1HGV A;  1FS0 E;  1J1D B;  1M1J C;  1HBW A;  3H1I E;  4H13 D;  1N86 A;  1QLE D;  1E79 H;  1OW8 A;  3CXH I;  5E79 H;  1BSH A;  2IFN A;  4C46 A;  1KB9 E;  4HYT B;  2WIT A;  1SQP E;  5AW2 B;  1LT9 C;  2B88 A;  5CBN A;  2J58 A;  5E79 E;  2IBZ G;  1WRG A;  3P32 A;  4WY4 A;  1GU5 A;  1SQV K;  1U7M A;  3RK3 E;  3H1I G;  1S5L X;  1PP9 D;  1LTJ A;  3H1J J;  1FDM A;  4YXD C;  3CXH D;  2WSF H;  1M56 D;  2E76 C;  1ZN5 A;  3NFQ A;  1H0T B;  1HTL C;  3LID A;  1SQP G;  1NAY A;  1SQB E;  3H1L E;  5APY A;  4XA4 A;  1CW5 A;  4Z1M H;  5GTH E;  3P7K A;  1YIT P;  4K35 A;  2Q3E A;  2AXT H;  2KB7 P;  2KZI A;  3JC2 2;  2KLU A;  1KZU B;  1L0L E;  1XTC C;  3PP5 A;  3MP7 B;  3FWL A;  1JO5 A;  5AW4 B;  3A2A A;  5KLI C;  1NTZ K;  5CHX A;  4WY4 C;  3H6P A;  3D71 A;  3P8C D;  4I2L C;  1OVR A;  1OX3 A;  3KDP B;  1ZR2 A;  3SSU A;  4W7Z A;  3GG2 A;  1LTJ C;  2FXM A;  1T2K D;  5C39 A;  4Y99 B;  1SQQ K;  1Q86 Q;  2YKO A;  1SQB G;  3H1L G;  2YMY A;  3AEE C;  1SQB J;  5B66 E;  3M9B A;  3L72 J;  1SFC D;  3TNU B;  1FDI A;  1AQT A;  2FY8 A;  2NPS B;  2E74 B;  1Q90 D;  4JYC A;  1YJN P;  1L0L G;  3CC4 P;  3VOP A;  2RMZ A;  3VMX A;  3PTZ A;  4PV1 C;  1L0L J;  1VQL P;  1NHL A;  1OW7 A;  1CZQ A;  1KC8 Q;  3TYY A;  1J1D C;  3C8V A;  1Q81 Q;  3GLM A;  1KIL B;  3V5B A;  1OXZ A;  2B89 A;  1LTI C;  4KHX A;  4IOI H;  3M0A A;  1DH3 A;  2OYI B;  1DEE G;  1NYH A;  2O01 J;  3H1H E;  1IFD A;  1SQX D;  3GF7 A;  2KLV A;  4N3Y B;  1JY3 N;  3RBX A;  4M3L A;  1GU4 A;  1JTH B;  1S5L E;  1IFM A;  2KSJ A;  3UIA A;  2Z4E A;  1VQ4 P;  5K5G B;  4OGQ D;  4DZO A;  1FZC B;  1J1E C;  2D2C B;  3TGU J;  3KXD A;  2A45 G;  1EC5 A;  3TNU A;  3V2P A;  1ZOY C;  3H1H G;  2NPS A;  2W90 A;  2RKL A;  2I1K A;  1NU1 E;  5KLV D;  1EDL A;  1X0T A;  2KSE A;  2OYO A;  2FYN B;  2ZYG A;  3V2R A;  1FZF A;  2WSE H;  1NJI Q;  1S3J A;  3CCR P;  5AVV B;  1IZN B;  3SFD C;  1DD3 A;  3V4W A;  2IYP A;  2GUS A;  2Q6Q A;  4H0L B;  3QWO C;  1NTM J;  4YTP C;  4ASV A;  4C7N B;  2P67 A;  4Y99 C;  4KT0 J;  3CXH H;  3HUS A;  1NKN A;  3CX5 I;  4H44 B;  1MV8 A;  1PZQ A;  2GM4 A;  2WSC J;  5EFW B;  1QL2 A;  2FYU K;  4ZMD A;  3CCM P;  2O1K A;  1NU1 G;  5L8R J;  2C0W A;  2SPZ A;  1SS1 A;  1KQS O;  2OTL P;  1NU1 J;  2NPS C;  3CXH E;  3RL0 g;  3N7N A;  3RK3 B;  3U1A A;  3P8M C;  1D7M A;  4U3F E;  1S9K E;  4L76 A;  1FZC A;  3IAO A;  2YKP A;  3FXD A;  1BDD A;  3USS A;  3GHG B;  3RK2 D;  3CX5 D;  3CI9 A;  1WT6 A;  4DOJ A;  1HH0 A;  1RE3 A;  4HB1 A;  2G3A A;  1LP1 B;  4JBZ A;  2W6A A;  3HUS C;  3CD6 P;  3L73 E;  1FZA A;  2PP6 A;  3H1J D;  1Q7Y Q;  3PLN A;  4U3F G;  2JWA A;  3Q5P A;  5BU8 B;  4TT3 H;  1EDJ A;  1LJ2 A;  3L75 E;  1KTM A;  3HD7 D;  2FYZ A;  1FE6 A;  4C7N A;  3L74 D;  1GW4 A;  2HR3 A;  3BAS A;  1FZC C;  2JR8 A;  1OFC X;  1UIX A;  5AVR B;  5CCG D;  3I56 P;  1FZE A;  3MZW B;  3V2Q A;  3FXE A;  4D6T J;  3MGN A;  1BCC E;  2QJP B;  3L73 G;  1RE3 C;  3PJS K;  5AVZ B;  1PV3 A;  3T97 B;  3F89 A;  2FBW C;  3AE4 C;  2HFE D;  5AVQ B;  1L0N K;  3S4R A;  5KAI E;  3GMA A;  4B86 A;  1URQ B;  1AQ5 A;  2HPC A;  2R32 A;  1NTK J;  1YTZ I;  3L75 G;  3KQG A;  4O9B A;  3GHG A;  1QL1 A;  1Y47 A;  2E75 B;  1JM0 A;  3L72 D;  1K8A Q;  2M0B A;  1SQV E;  2FYU D;  4H44 C;  1BCC G;  3RL0 D;  2ZYA A;  3B5N B;  2RH0 A;  1BE3 E;  1VDF A;  3A7O A;  2HYN A;  2WPQ A;  3RK3 C;  1PPJ D;  3MD0 A;  5APV A;  1BGY J;  2E5T A;  3Q5S A;  1HWT C;  3A3Y B;  3WMM 0;  4IFF A;  3V6I A;  1SVF A;  3II6 A;  3GHG C;  1SQV G;  4BWN A;  1KIL E;  1FJK A;  4W80 A;  4AYC A;  3SWF A;  2YXR B;  1NTZ E;  1BE3 G;  4H13 B;  2IZ1 A;  2G8Y A;  1GDT A;  4AQR D;  2QA4 P;  1AA0 A;  1S4X A;  4GDO A;  1SQQ E;  1JY3 O;  2Y9Y A;  4LGD E;  1GK4 A;  2ZVN B;  3IFM A;  5AVT B;  3TGU D;  1RY3 A;  4U7J A;  3L4F A;  2R3C A;  1HF9 A;  2Y0E A;  2K1A A;  2ZT9 B;  1RF0 A;  4LLH A;  2W27 A;  3B5N A;  1NTZ G;  3CX5 H;  1JY2 P;  4L74 A;  1JMM A;  2P2U A;  1NTZ J;  3HRN A;  3O6Q B;  2BCC E;  1LGH B;  1SQQ G;  1T3U A;  1RQU A;  3CX5 E;  1JUN A;  2ZXE B;  3CLQ A;  1NTM D;  2ZXX A;  2JDI H;  3OAK A;  1X22 A;  3AEC C;  3D6Y A;  1LTS C;  4WBA A;  1KOR A;  1IK9 A;  4RKU J;  5APU A;  2KIK A;  2E75 C;  3BRV B;  3WU2 E;  2WPR A;  3BCC E;  1KYO D;  4R4L A;  2KOG A;  1FOS E;  3I55 P;  1RF0 C;  2BCC G;  4DCK A;  3B5N C;  4GOE A;  3L74 E;  1SQX K;  2Q5U A;  1M90 Q;  1YQ3 C;  4RES B;  2ZFC A;  3AE7 C;  4WY4 D;  1DD4 A;  1EQ7 A;  3O8Z A;  1YHQ P;  2WSS H;  3H1I J;  1GTW A;  1KQF B;  3BCC G;  3AE3 C;  3L70 D;  4ASW A;  1X9V A;  1SQP J;  2YMK A;  1G2C B;  4H13 C;  2K3R A;  1U57 A;  3L74 G;  5KKZ B;  5KLV K;  3Q3D A;  4PV1 D;  1DX7 A;  3HTK B;  2A06 D;  4HH2 A;  1XTG B;  1S1C X;  3VMY A;  1IFP A;  1G1I A;  2FYU E;  4PD4 D;  2AXT E;  4ZNC A;  1VF5 D;  5H2F H;  2W8Z A;  4D6T D;  2B87 B;  2CK3 H;  3LW5 H;  1N8R Q;  1N7S D;  2ZT9 C;  1PPJ E;  1EXI A;  3H1L J;  1R8E A;  2M8R A;  1RF1 B;  4OGQ B;  2CPB A;  2LKM A;  2WSF J;  1HVV A;  1NTK D;  3AEA C;  1M8O B;  3Q2Y A;  5KJ7 D;  2P1J A;  2ITA A;  3LIE A;  2FYU G;  2E43 A;  2WMM A;  2AEF A;  3OA7 A;  5AW3 B;  1H0T A;  4EIJ A;  3W68 A;  1MZ9 A;  2IPP A;  1M7L A;  1PPJ G;  5AVU B;  1G2C A;  1LTG C;  2P58 A;  3OJA B;  5DJU B;  2ZYD A;  1X79 B;  3CPW O;  3MTU E;  4C7R A;  2QG4 A;  2Z5H A;  1EZV E;  1BGY D;  4OVN F;  3EFF K;  1FZG A;  5AVS B;  2DW3 A;  2OYH B;  3H1K E;  3CCL P;  2UWJ E;  1L4A D;  2FFD B;  2JEE A;  2KP8 A;  2B87 A;  4N78 E;  1H8A A;  2R5D A;  3AE9 C;  3EQ2 A;  2HOD B;  1L0N E;  2KNC B;  1RF1 A;  2OQQ A;  1ZRT D;  3CWB D;  4WB4 A;  2K88 A;  1GD2 E;  1EZV G;  3H1H J;  3S1K A;  2LXB A;  3RK2 B;  1GL2 D;  4WVZ A;  3G71 P;  5KKZ C;  2KS1 B;  2QJY B;  2R3S A;  3KYQ A;  3L71 D;  4JYB A;  3AEF C;  2XU6 A;  3H1K G;  1PL5 A;  1CI6 B;  4I6M C;  3CCU P;  1KIL A;  3PRJ A;  2ZJS E;  3Q5R A;  4YXW H;  4EYY Q;  3B71 A;  1L0N G;  1T3J A;  1FZB A;  3TSI A;  2YO3 A;  2OYI A;  5GTI H;  1L0N J;  1NH4 A;  2IDB A;  4ZKU A;  1LTA C;  1GK6 A;  1PP9 E;  4CPG A;  3CCJ P;  1RF1 C;  4OGQ C;  5TIS H;  1OMI A;  2IBZ I;  2E74 C;  3GF3 A;  5GTI E;  1JTH A;  1HJ0 A;  2W83 C;  1VPC A;  2FFD A;  3L70 E;  2P10 A;  5TIS E;  2HOD A;  3H32 B;  3R4Y A;  2BEZ F;  3B8E B;  2KNC A;  1KIL C;  2K9J B;  2WSE J;  1M57 D;  4GOF A;  1KB9 I;  1KMI Z;  5KAF H;  1LT1 A;  2FKW B;  3E1I A;  1PP9 G;  4GOD A;  2Q7C A;  3CMA P;  2OYI C;  5APX A;  2IBZ D;  2I1J A;  2MJZ A;  5B5E H;  3P8C E;  3M9Q A;  3AE5 C;  3HE5 B;  5KAF E;  2YIU B;  1VQ8 P;  3H1I D;  2KUB A;  1IJD B;  3L70 G;  5AW8 B;  3RL0 B;  1NO4 A;  1FOS F;  4U3F J;  5B5E E;  5CCH A;  4PJ0 H;  2FFD C;  2JKV A;  2AEJ A;  1KB9 D;  2IX7 C;  3B4S A;  4WWI A;  2D2C C;  2HG5 D;  4EDF A;  1SQP D;  1K04 A;  1JCD A;  4GIF A;  1ZR4 A;  4PJ0 E;  2YNY A;  1VQO P;  5APS A;  2R44 A;  2W6B A;  2JP3 A;  3L73 J;  3RK3 D;  2FYN C;  5DJT B;  2QJY C;  3RGU A;  3R2P A;  2PAJ A;  3CCS P;  1NTM K;  1NVO A;  3H32 A;  1KFM A;  3A0B H;  3L75 J;  1QVF O;  1RQV A;  4H0L C;  2YKQ A;  1SQB D;  2FXP A;  1SQX E;  1LP1 A;  1M1J B;  5CCH C;  5AW0 B;  1PIX A;  1VQ6 P;  1BDC A;  2NRG A;  1USD A;  1BCC J;  3WUU A;  2V7Q H;  1L0L D;  1CSB A;  3A5T A;  1FJP A;  3FWN A;  2QE7 H;  2C0X A;  2O01 N;  1OW6 A;  1NAF A;  2J5U A;  1IC2 A;  1T6A A;  3K5B A;  3EWK A;  3CWB E;  5CMZ A;  2Y0D A;  2WTY A;  3U59 A;  3FGA D;  3JSV C;  1RE4 A;  1SQX G;  3M06 A;  5KLV E;  2N1T B;  1SQX J;  1Y8A A;  2GUV A;  2A45 I;  1SQV J;  2XKM A;  1R5S A;  2VRS A;  3KPE A;  3N4X A;  3W67 A;  2RN0 A;  3T97 A;  4JQ0 D;  1BE3 J;  1EDI A;  2O1J A;  2KK7 A;  5CBO A;  1N2D C;  1URQ A;  4A7P A;  3VMA A;  2QVA A;  1IFN A;  4IFM A;  2CPS A;  1JY2 N;  1K9M Q;  3ZDM A;  3CWB G;  4UB8 H;  2C9L Y;  1VQK P;  1Q82 Q;  4TLF A;  2H88 C;  5KLV G;  4BXL A;  1LTT C;  1VQ9 P;  3AEB C;  4I7Z B;  2PRR A;  4WY4 B;  4UB8 E;  3H1H D;  1QGK B;  1RE4 C;  2P7J A;  1KYO I;  1LTJ B;  2I8D A;  2H43 A;  3F5H A;  1IFI A;  1GMJ A;  3E1R A;  3H25 A;  3MUD A;  1YQ4 C;  2QJP C;  2XND H;  1NTK K;  3L36 A;  2WQY C;  1SQQ J;  1T8Z A;  4DT0 A;  3AED C;  1IFJ A;  2XNX A;  3M0D A;  1URQ C;  4NPD A;  1MFT A;  2PGD A;  1YJ9 P;  1ZW0 A;  3M91 A;  3VTP C;  2E76 D;  3U1C A;  5BU5 A;  2N1T A;  1PFI A;  1JOC A;  3V4Q A;  2WPV B;  1AVO A;  4YPC A;  4PV1 B;  3H1J E; 
#chains in the Genus database with same CATH homology
 1JCC A;  2J59 M;  3HE4 A;  2NPS C;  3L35 A;  3OA7 A;  3N7N A;  5AW3 B;  3RK3 B;  3U1A A;  3NXS A;  4EIJ A;  5CCG C;  3P8M C;  1DEB A;  1LT9 B;  5AVX B;  1NWQ A;  1S9K E;  1MZ9 A;  2IPP A;  1M7L A;  1GW3 A;  5AW7 B;  1FZC A;  5AVU B;  1N7S B;  1G2C A;  2YKP A;  1LTG C;  3OJA B;  3VP9 A;  1X79 B;  3MTU E;  4C7R A;  2L5G B;  3GHG B;  3RK2 D;  3I5C A;  4I1L A;  1LWU A;  1SFC B;  2Z5H A;  3CI9 A;  1WT6 A;  5BVZ A;  4DOJ A;  1W2E A;  1HH0 A;  5APW A;  1RE3 A;  1FZG A;  3M0D C;  1KFN A;  1N7L A;  4EOT A;  1MFZ A;  1MUU A;  2Z5I A;  1FBM A;  5AVS B;  2W6A A;  1N73 A;  3HUS C;  4XE5 B;  2N1T C;  2QM8 A;  2WT7 A;  2OYH B;  5KTB A;  1FZA A;  4GKG A;  2PP6 A;  1L4A D;  2FFD B;  1IO4 A;  2JEE A;  2KP8 A;  1URQ D;  4N78 E;  1J1E B;  2R5B A;  1H8A A;  2XZR A;  2R5D A;  2Q9I A;  3EQ2 A;  2HOD B;  3CL3 D;  3RL0 C;  5BU8 B;  3TK1 A;  3HD7 D;  2FYZ A;  1RF1 A;  1S9K D;  4C7N A;  1M1J A;  4WB4 A;  1Z56 A;  1GW4 A;  1A02 F;  1GD2 E;  3BAS A;  1FZC C;  5AVR B;  3RK2 B;  5CCG D;  1FZE A;  2IFM A;  1GL2 D;  3V2Q A;  3B5N D;  1LWU C;  3MGN A;  3KYQ A;  1G1J A;  4JYB A;  4N6J A;  2WWW A;  2XU6 A;  4IFD K;  1RE3 C;  2BAS A;  1H89 A;  1CI6 B;  3M9H A;  5AVZ B;  4I6M C;  1LT9 A;  2HFE D;  1KIL A;  2H8P D;  5AVQ B;  1N73 C;  2O01 H;  3EFG A;  3BAT A;  1L0N K;  1SP4 A;  1L4A B;  4B86 A;  2POH A;  3SWY A;  1URQ B;  1AQ5 A;  2HPC A;  2R32 A;  1T3J A;  1YTZ I;  1FZB A;  4N78 D;  2YO3 A;  1N7S A;  3TSI A;  2OYI A;  1NOH A;  3KQG A;  1NH4 A;  4O9B A;  3GHG A;  2XV5 A;  4ZKU A;  1SFC A;  1QL1 A;  1LTA C;  1SLQ A;  2M3B A;  1H88 A;  1GK6 A;  2N1T D;  4W7Y A;  3L37 A;  1RF1 C;  1OWA A;  1HGV A;  5AW6 B;  1J1D B;  1M1J C;  1HBW A;  5KJ7 A;  4JF7 A;  1JTH A;  1N86 A;  3RL0 D;  1GL2 B;  3B5N B;  2QM7 A;  1VPC A;  2FFD A;  1VDF A;  3A7O A;  2IFN A;  2HYN A;  2N9B A;  4C46 A;  2A45 H;  4HYT B;  2WIT A;  2HOD A;  3H32 B;  2WPQ A;  5AW2 B;  5AW5 B;  3RK3 C;  3MD0 A;  5APV A;  3B8E B;  1LT9 C;  1KIL C;  2J58 A;  1T2K C;  2OAR A;  3HTK A;  3IR9 A;  1HWT C;  3A3Y B;  3WMM 0;  2FKW B;  3E1I A;  4IFF A;  2Q7C A;  1WRG A;  3P32 A;  1J2J B;  4WY4 A;  1SVF A;  1N7S C;  1GU5 A;  3HUS B;  2OYI C;  2E42 A;  1SQV K;  5APX A;  2I1J A;  5APQ A;  2MJZ A;  3II6 A;  3GHG C;  3P8C E;  1LTJ A;  3G3Z A;  3M9Q A;  1SFC C;  3HE5 B;  2WZ7 A;  1FJK A;  4W80 A;  4AYC A;  1FDM A;  3BRT B;  3SWF A;  5APT A;  2WSF H;  1IJD B;  5KJ7 C;  5AW8 B;  1FU1 A;  1ZN5 A;  3RL0 B;  3NFQ A;  1NO4 A;  1GDT A;  1SQP K;  1FOS F;  4AQR D;  1HTL C;  1L4A A;  2WSC H;  3LID A;  5CCH A;  5APY A;  1HJB A;  1JY3 O;  4XA4 A;  2FFD C;  4LGD E;  1CW5 A;  4ZKP A;  1GK4 A;  2IX7 C;  1YYC A;  2HG5 D;  2NPS D;  3IFM A;  4OH8 B;  3P7K A;  5AVT B;  1RY3 A;  1JY3 P;  1A02 J;  1JCD A;  2KB7 P;  3L4F A;  2R3C A;  3NTN A;  1KZU B;  1JY2 O;  4GIF A;  1ZR4 A;  1XTC C;  3PP5 A;  2YNY A;  3VYI A;  1JO5 A;  1FAV A;  5AW4 B;  3A2A A;  5APS A;  2W6B A;  1NTZ K;  1RF0 A;  1KQL A;  5CJ4 A;  5CHX A;  3RK3 D;  1GL2 A;  4WY4 C;  3H6P A;  4LLH A;  2W27 A;  3B5N A;  3P8C D;  4I2L C;  1JY2 P;  3KDP B;  1ZR2 A;  1KIL D;  4W7Z A;  1JMM A;  1LTJ C;  2P2U A;  2FXM A;  1T2K D;  4Y99 B;  1SQB K;  3R2P A;  1SQQ K;  2H7H A;  3HRN A;  2PAJ A;  1LGH B;  2YKO A;  1NTM K;  3H32 A;  1GZL A;  1T3U A;  2YMY A;  1KFM A;  3HD7 B;  1LTB C;  2YKQ A;  3M9B A;  1JUN A;  1L4A C;  1SFC D;  3TNU B;  2ZXE B;  3CLQ A;  1M1J B;  5CCH C;  2NPS B;  1L0L K;  3OAK A;  5AW0 B;  4JYC A;  1LTS C;  3VOP A;  2OYH A;  1X8Y A;  3VMX A;  4WBA A;  1IK9 A;  5APU A;  4LC1 A;  2JJL A;  1NHL A;  3BRV B;  1CSB A;  1CZQ A;  2WPR A;  3A5T A;  2KYV A;  1FJP A;  3TYY A;  1J1D C;  2KOG A;  1FOS E;  2C0X A;  1RF0 C;  1KIL B;  3V5B A;  1GL2 C;  1NAF A;  1OXZ A;  1IC2 A;  1NKZ B;  3B5N C;  1LTI C;  3NMD A;  4KHX A;  1ZLL A;  5CMZ A;  3M0A A;  1ZV8 A;  2HPC B;  1JNM A;  1SQX K;  2Q5U A;  2WTY A;  3U59 A;  5AVY B;  3VP8 A;  2YO2 A;  1DH3 A;  2OYI B;  1RE4 A;  4RES B;  3M06 A;  2ZFC A;  2Q3I A;  2N1T B;  4WY4 D;  1IFD A;  2HLO A;  1EQ7 A;  3O8Z A;  3VN0 A;  2GUV A;  2A45 I;  2XDJ A;  2KLV A;  4N3Y B;  4AUW A;  2XKM A;  2VRS A;  3KPE A;  1GTW A;  1JY3 N;  3N4X A;  1CI6 A;  3T97 A;  3HE4 B;  4M3L A;  1GU4 A;  1JTH B;  2O1J A;  1IFM A;  2KSJ A;  4GT1 A;  1N2D C;  3UIA A;  2C9N Y;  2OYH C;  2WPS A;  1URQ A;  2Z4E A;  5CJ0 A;  1IFN A;  4IFM A;  4DZO A;  1X9V A;  2CPS A;  5CCH D;  1FZC B;  1JY2 N;  1J1E C;  3VMZ A;  5AW1 B;  1G2C B;  1HUC A;  2C9L Y;  3HD7 A;  3BVH A;  2A45 G;  5KLV K;  1LWU B;  3TNU A;  3V2P A;  1DX7 A;  3HTK B;  1LTT C;  2NPS A;  4HH2 A;  5CCG A;  1XTG B;  2I1K A;  3VMY A;  5AW9 B;  4WY4 B;  1G1I A;  1N73 B;  3RK2 C;  2P7J A;  1RE4 C;  2WT7 B;  3C9I A;  1LTJ B;  2H43 A;  3V2R A;  1FZF A;  2WSE H;  1IFI A;  3V2N A;  3MIW A;  5AVV B;  3MUD A;  3LW5 H;  1N7S D;  3V4W A;  1NTK K;  2GUS A;  3L36 A;  1HGZ A;  1AFO A;  1T8Z A;  1E5W A;  2M8R A;  1IFJ A;  1RF1 B;  2CPB A;  2XNX A;  3M0D A;  1URQ C;  5AVW B;  4C7N B;  2P67 A;  2LKM A;  1YTZ T;  1HVV A;  4Y99 C;  3HUS A;  1NKN A;  3M91 A;  3VTP C;  5KJ7 D;  1MV8 A;  2P1J A;  3U1C A;  5BU5 A;  2N1T A;  1PFI A;  2GM4 A;  1JOC A;  3V4Q A;  1NU1 K;  3HD7 C;  1QL2 A;  2FYU K;  3HE5 A;  2O1K A;  3LIE A;  2C0W A;  2E43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...