1IFIA

Molecular models and structural comparisons of native and mutant class i filamentous bacteriophages ff (fd, f1, m13), if1 and ike
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
50
structure length
50
Chain Sequence
AEGDDPAKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular models and structural comparisons of native and mutant class I filamentous bacteriophages Ff (fd, f1, M13), If1 and IKe.
pubmed doi rcsb
source organism Enterobacteria phage fd
molecule tags Virus
molecule keywords INOVIRUS
total genus 21
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1994-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ifiA00
2MJZA 1NH4A 1HH0A 1IFJA 1HGVA 1IFIA 2CPSA 1FDMA 1HGZA 1IFDA 2C0WA 2CPBA 2C0XA
chains in the Genus database with same CATH superfamily
2G3AA 3AEEC 1FZCC 2C9LY 1PGOA 1PGPA 2N1TB 2AEMA 5AW3B 3CCEP 3HE4B 3L75D 1MKMA 1AFOA 1FJKA 3L70J 2K9JA 4O9BA 1EDKA 5KLIC 5AW5B 5KKZC 2OYHA 3M91A 2WQYC 5CBOA 3TDKA 1VQNP 1VF5D 1IFNA 2GA1A 1L0NG 1SP4A 2ZT9B 2K1AA 4EIJA 1Y47A 3L72D 1SQQG 2Y0DA 1KB9H 3CWBE 4W80A 1KQFB 1J1EC 3IR9A 3MHVA 2BEQD 3RK3B 1P84D 1SQQE 5CHXA 5APUA 1H8AA 3V2NA 3L36A 1KILB 2Q5UA 2R3CA 4H13B 1KILE 3M0AA 5KJ7A 3M9HA 3PH0A 1LTJC 1ZR2A 5KKZB 2KI7B 1QEXA 2LR2A 3CX5D 2O01N 2WT7B 4HYTB 5KAIE 5DJUB 3PLNA 3M9QA 1OVVA 1SQVJ 1KB9E 1IJDB 1K04A 5KLVK 5APXA 1A02J 1SFCA 1NJIQ 3AEBC 2V4HA 2BCCE 2DW3A 3RL0B 3L70D 1EDJA 4GIFA 3A0HH 4BRYA 4C7RA 4C7NA 3H1KJ 1IFJA 2ZVOB 1KORA 2R32A 3H1IJ 3L74G 1KV4A 1KYOD 3P32A 5GTIH 3VTPC 5TISH 4DOJA 2QE7H 1DIPA 2E43A 3MIWA 3H1HG 1S5LX 2WPSA 3L73G 1QVFO 2IDBA 2FYNB 4L75A 4R4LA 5AW8B 3D71A 1R8EA 1NKNA 2KZIA 2NRGA 2H8PD 3BCCG 3H1LD 5APYA 1FZGA 2OYIC 1NOHA 2O1JA 1JCDA 2IBZD 2BASA 3AE2C 3T97A 1NYHA 2IFNA 2WSFH 3PTZA 3BVHA 1ZMEC 2MKVA 3M06A 1IK9A 1X79B 2KK7A 3TNUA 2P2UA 2QM7A 2C0XA 2M5AB 2W27A 1USEA 2Q6QA 3VOPA 1NTKK 2FYUE 4WY4A 1BGYD 1L4AC 1G1IA 1NHLA 4WB4A 1NTZE 1HJBA 1N7SD 1U7MA 1VL2A 1GL2B 1BE3J 1FS0E 2WSCJ 4WWIA 1E79H 1UIXA 2FYUG 2KB7P 1Y9BA 2W8ZA 3FWLA 3H1LJ 2IFMA 3AE3C 4CPGA 1NTZK 1VQMP 1BCCE 1KFNA 1SQVK 2H88C 3A0BH 4YTPC 5TISE 1H88A 2CPBA 1QL2A 4JF7A 2WZ7A 1FC2C 3Q2YA 1PGQA 3VMXA 1RF1B 1AVYA 4QMAA 2CPSA 1SQPG 2JWAA 3BCCE 1IC2A 3AEDC 3L72E 4H0LC 3I55P 3Q5RA 1YHQP 1PV3A 1KILC 1L2PA 1JY2N 1JY2P 3H1HE 1OWAA 2JEEA 1ZRTD 4WY4B 1YTZT 4ASWA 2FXOA 1X22A 4K3AA 3CMEP 3A2AA 3MUDA 2HODA 4OH8B 2FXMA 4PD4H 1AA0A 1SQXE 3RL0D 4ZKPA 1SQXK 2QEXP 1BGYJ 4LC1A 5B66E 1FOSF 5AW2B 2NPSD 1SQBG 2M0BA 1KQGB 1VPCA 2NPSC 2YNYA 2IYPA 1RY3A 3V4WA 1OW8A 3AE6C 5GTIE 5CCGC 3O8ZA 3RL0C 2ZVNB 1MFZA 4U3FJ 3IAOA 3TK1A 3CX5H 2FYZA 1LWUB 1URQA 3CXHE 4KT0J 4Y28J 2A06D 2XZRA 3A3YB 2R5DA 3NMDA 2KUBA 3HUSC 3L72J 3IFMA 3Q5SA 1DD3A 2H43A 2YIUC 5AW1B 5B5EH 2KNCB 1LTBC 2Y0EA 1FDIA 3G71P 1EXJA 3QH9A 1YI2P 3CWBG 2JP3A 2Q3EA 2M8RA 3H1LE 3KXDA 1NU1G 1HBWA 3N7NA 3WUUA 3U1AA 2Q9IA 1KFMA 3L37A 1AVOA 3AE5C 2I8DA 1YYCA 1NKZB 1BSNA 2IBZI 3HE5A 3MTUE 1CI6A 3AE7C 2PAJA 3U59A 2A45I 5CCGD 2C9NY 2WT7A 2Y0CA 1DH3A 3CCUP 3K5BA 2P1JA 1NTZD 5KLVG 2E5YA 4I6MC 2WVRA 2B89A 2HFED 2XNDH 1SQXG 4L74A 4OGQD 4UB8H 1VQKP 2XV5A 3CCLP 3TF5A 1H89A 4AUWA 1M56D 3H32A 4WY4D 4H0LB 3G3ZA 1JY3P 2L91A 2QJKC 1MZ9A 2A45G 3EFFK 3ABVC 1HF9A 3PRJA 1URQC 3RK2C 4DZOA 1BCCD 2FFDB 3GMAA 4A7PA 4D6TG 1GDTA 3AEFC 1RH5B 3GF7A 3H1KE 3KQGA 1K9MQ 5BU8B 2QRXA 2YO3A 3NFQA 3KDPB 3HE4A 2FXPA 2HPCB 2YKOA 4LLHA 1S2EA 3VMYA 1LJ2A 1OVRA 3BRVB 1HTLC 3H1ID 2OYHB 5M1BA 1SQVE 1GK4A 1RE4A 2P10A 1Q90D 2W83C 1LTGC 3C9IA 5TJHA 5KAIH 1JY3N 1NTZG 2IZ0A 5KLVD 3VMZA 2ZYDA 3OJAB 4ASVA 5CCHC 5CCHD 2W6JH 3M0DC 1U57A 2OTJP 5APWA 2IBZG 1QVGO 1FDMA 2O3JA 1G2CB 1GL2A 2WTYA 3CD6P 1USDA 3V6IA 3E1IA 3O6QB 1VQ9P 3CX5E 3CXHH 3TGUE 1RF1C 2Q7CA 1PP9G 1NGMB 3D70A 5E79E 1L0NK 1Q7YQ 3SWKA 2J58A 2AXCA 3IN6A 4ZMDA 2WSCH 3Q5PA 1EXIA 1RF0C 1W2EA 5AVTB 2B9BA 4GOEA 1KD1Q 3C8VA 1EC5A 3OAKA 2WSEH 3L70E 3B5NC 1VDFA 2SPZA 1N7SA 4PD4E 4Y99B 3UIAA 1FZAA 3L74E 1LT9A 1PPJG 5CJ0A 2ZYGA 3JCUH 1YBKA 1FBMA 3B4SA 4H13C 1DX7A 3HD7B 2A06E 1L0LG 2ZT9D 1E5WA 4MN4C 1QL1A 1T3JA 3HUSA 5DJTB 1OW7A 2E5TA 1YJ9P 4GDOA 1RE4C 1S3JA 2RKLA 1H0TA 2R44A 2YMKA 4IFDK 3GHGA 1DD4A 4U7JA 1SS1A 2OQQA 1LTJA 5H2FE 3T97B 3OW2O 3RK3C 1LWUA 3PHLA 3H6PA 1N8RQ 3W68A 2YXQB 2FBWC 3GF3A 4WBAA 1NTKJ 5CMZA 2AXTH 2IX7C 5AVUB 3LIEA 4KJMA 3TNUB 3CCJP 1BCCJ 1LT9B 3I56P 1S9KE 3VN0A 2Z4EA 3TGUJ 2KNCA 1VQ4P 1SQPD 3AE8C 1L0NE 1X0TA 1SFCC 3L75G 1FZCB 1ZP0C 1AV1A 4NPFX 4DJGA 1SLQA 2FKWB 2K37A 3H1JJ 3IF4A 2WSFJ 3CLQA 3CC7P 2M3EA 1FAVA 2HLOA 1ZLLA 2K3RA 1T2KC 1FOSE 1JY2O 1SFCD 3TSIA 1IK7A 4AYCA 2RMZA 2LXBA 2XU6A 1S5LH 2D2CB 1NTMJ 2OYIB 2PP6A 1MUUA 2WPQA 4NPEA 5AVYB 1J1EB 3R4YA 3WUTA 1LNQA 1BSHA 1PP9D 2Q3IA 1JTHB 3V5BA 2POHA 1S9KD 3D6YA 2KS1B 1M1JC 1NTMD 3L71G 4DCKA 4PD4I 3TYYA 4AQRD 2R5BA 3BCCD 1KB9I 2KOGA 3H32B 2GM4A 2KSJA 3H1IE 3L4FA 4OVNF 4WY4C 5KLIB 1FJPA 2ITAA 4EOTA 1L4AA 2G8YA 1KYOH 3MD0A 3P8MC 2BEZF 2C0WA 1T3UA 1GL2D 2BCCJ 2QVAA 1XTGB 2ZT9C 3H1JD 3W67A 4ZKUA 1T2KD 1UIIA 3GLMA 1T8ZA 3KZIH 4OWFA 3V2QA 4I1LA 1PPJE 1GD2E 4W7YA 1HJ0A 1L0LD 3WMM0 3RGUA 3CC2P 3L70G 1FZBA 1EQ7A 2QM8A 1WMKA 1NVOA 5AW7B 1JTHA 2OTKE 1LP1B 3KHUA 1G1JA 1L0NJ 2JO1A 5AW0B 1PFIA 1PIXA 1SQQJ 3G6EP 1K05A 1KQLA 5AVWB 1RE3C 1EDIA 2KP8A 4EYYQ 5CJ4A 1P84H 1ZXGA 4TT3H 5AVRB 3Q3DA 1JM0A 4XE5B 1VQ5P 3Q1MA 4C46A 1DEEG 1NTMK 2O1KA 3HE5B 3KZIE 2WSSH 5K5GB 1AJYA 5B66H 2FFDA 1KTMA 1OIPA 3E7KA 1VF5C 3CI9A 1P84E 1SQQD 5BU5A 1L4AD 5B5EE 5CCGA 2J5UA 4U3FE 1SQVG 3I5CA 3BRTB 2KXPB 1J2JB 1M7LA 1Z56A 1N7SB 4H44C 1N73C 1IFPA 4H44D 1BE3D 1N86A 2ZXXA 2NPSA 3H1KG 1IFMA 3H1IG 3L74J 4I2LC 1RQUA 5AVZB 3HD7A 1M90Q 1VF5B 2D2CC 1YTZI 3L71E 4TLFA 1VQPP 4BXLA 1JMBA 1URQD 2OARA 3RK2D 3LW5J 1XTCC 1HVVA 3H1HJ 3L73J 2K88A 3NXSA 4H0LD 4K35A 3TGUD 2E76D 1BDDA 1KILD 1NO4A 3EFGA 1K73Q 1KYOE 2XNXA 3BCCJ 2HPCA 3GG2A 4DT0A 1LGHB 1A02F 4OGQC 4EDFA 4N6JA 1HWTC 3AE1C 5KLVE 1IO4A 1SFCB 2K9YA 3MGNA 4PD4D 1KB9D 2QJKB 3MZWB 2E42A 2ZFCA 4WVZA 3S1KA 3ITKA 3G4SP 3L75E 1S5LE 1BE3G 1GK6A 1N7SC 2E75D 3O6QA 1AQ5A 1FE6A 1Q2NA 2FYUJ 1Y8AA 3CXHI 3H1LG 1OVUA 3FXEA 3L35A 1R5LA 2P58A 1GZLA 2B87A 3MP7B 4L76A 3OA7A 2QJPC 2NZ2A 4I7ZB 4JBZA 3RBZA 4HKZH 4IL6H 2Z5HA 3RK3D 2YKQA 1KQSO 3S9OA 5APVA 1HGVA 3A0HE 3CWBD 3M0DA 2QA4P 1SQPJ 1M1JB 2B88A 3L74D 2OYIA 1IFDA 2H7HA 1T6AA 4PV1D 4EI2A 2M5AA 2FYUD 2P7JA 2AXTE 1X8YA 3JSVC 2JWDA 1JB0J 3CCMP 1R5SA 2A06G 4H13D 1KZUB 1BGYG 3CXHD 4IOIH 1SQBE 2FY8A 2YIUB 5H2FH 2I1JA 1SQBJ 4H44B 1JMMA 4PJ0H 2AEFA 1FU1A 2B87B 2R3SA 2WMMA 3F89A 2WITA 2WSEJ 3HTKA 1GU4A 1H0TB 3MUDC 5APQA 4W7ZA 5E79H 1SQBD 2VRSA 4U3FG 1LTJB 5AVQB 2JKVA 1NAYA 2N9BA 3B5ND 1LTIC 3EQ2A 5BVZA 2XDJA 4XFJA 4YPCA 2IZ1A 3USSA 4ZNCA 1YITP 2K9JB 1Q82Q 1M1KQ 2P67A 1LT1A 2E76B 2ZJSE 1SQPE 2O01H 2KZJA 2OGUA 3H1HD 3L72G 1ZRTE 3L73D 3H25A 4B86A 1S1CX 2FYNC 1QLED 2HODB 5KJ7D 2J59M 1FZCA 4UB6H 3CWBJ 3RBXA 4U3FD 2IBZE 4GT1A 1IFIA 1SQQK 3A7OA 1M8OB 1NU1J 3KYQA 1AQTA 3BASA 4RJTA 4YXWH 2E74D 1W2BO 2OYHC 1QX8A 4N78E 1BDCA 1SVFA 1FZEA 1U7JA 2IPPA 4HJGH 1WT6A 2PGDA 3G9RA 2V7QH 4XA4A 2GUVA 3B8EB 1URQB 3RK2B 1N7LA 4RKUJ 3FGAD 1OXZA 2LKMA 2YMYA 3E1RA 5AW9B 1GL2C 3AE9C 5KLVJ 3SWYA 2LXCB 1BGYE 2WPRA 1OZHA 5KTBA 1VQOP 1SQXJ 1KC8Q 4D6TE 1J1DB 1MV8A 1RHZB 2KS1A 2QJPB 2W6AA 4I7ZC 4PV1B 3LIDA 3II6A 3PJSK 1MFTA 2QG4A 1EDLA 1GW3A 4BRYB 1LTSC 1YQ3C 4JYBA 2KYVA 1JOCA 4C7NB 2E76C 2QSIA 3AECC 3SWFA 3M9BA 4RESB 3S4RA 1LTAC 1GU5A 5APTA 3B5NA 3V2RA 5KAFE 3P8CD 2D2CD 4D6TJ 2AEJA 3U1CA 2KLVA 1K8AQ 3QWOC 1L0LK 2ZXEB 3HRNA 2PFXA 2N1TA 4N78D 1RE3A 3VMAA 1NAFA 1D7MA 1QGKB 2GUSA 2YXRB 1LTTC 4N3YB 5APSA 3VP9A 2IYOA 1EZVI 2QJYB 2N9YB 4JQ0D 4R4MA 1JNMA 1X9VA 1BE3E 3CCSP 1PL5A 2BCCD 1LP1A 1W5CE 2E74C 2JJLA 1NTZJ 1ZN5A 4UB8E 1NU1K 1N2DC 5CBNA 1NU1E 1JUNA 1S4XA 4JPZB 3GHGC 3AEAC 1OFCX 2CK3H 4IL6X 1TU3F 5L8RJ 2JDIH 2RH0A 1PPJD 3B5NB 2KLUA 3CCRP 3HUSB 1PP9J 3P8CE 2ZYAA 2YKPA 5EFWB 1GW4A 1SQXD 5AVVB 2E74B 1CSBA 1LT9C 2Z5IA 3PP5A 1YQ4C 3GHGB 2Y9YA 3CCVP 4PJ0E 1JEKA 1VQ7P 5AW6B 1NWQA 3JCUE 5CCHA 4UB6E 1M1JA 1Q86Q 2HG5D 3CL3D 1L0ND 5GTHH 1SQPK 3D6ZA 1KMIZ 4L73A 3SFEC 4NPDA 1HH0A 1SQVD 1YIJP 1RQVA 2NPSB 1PZQA 3WU2H 1L0LE 3V2PA 1ZV8A 1G2CA 2N1TC 1L0LJ 1VQ8P 2N1TD 4M3LA 1N73B 4YXDC 2W90A 4OGQB 3F5HA 2ZAEB 2L5GB 4LGDE 4JYCA 4IL6E 4PV1C 3SSUA 1FZFA 1J1DC 2WWWA 3VP8A 3BATA 2W6BA 3R2PA 2RN0A 3GW6A 3KPEA 3WU2E 2HR3A 3EWKA 3AEGC 3CX5I 3C1LA 3FWNA 1S72P 5GTHE 1ZOYC 3HD7C 2FFDC 1NTKG 1JO5A 4D6TD 1JCCA 1NTME 4RO0A 1BCCG 1NH4A 1PP9E 2XKMA 1OX3A 3JC22 3LW5H 4IFFA 2V7QJ 1OW6A 3TGUG 2HYNA 3CCQP 5AVSB 1HGZA 1LWUC 1M57D 2PRRA 3L75J 3CC4P 4Y99C 4Z1MH 1N73A 4GKGA 2O01J 3CMAP 2MJZA 3CPWO 5AW4B 1EZVE 2E75C 2Q1KA 2QJYC 3H1KD 1EZVG 3H1JE 1DEBA 1L4AB 3H1JG 1KYOI 5AVXB 1WRGA 1JY3O 1YJWP 1VQLP 3WUVA 3A0BE 1YJNP 2WPVB 2M3BA 4GODA 1EZVD 2YO2A 1CI6B 2I1KA 2KSEA 1RF1A 2A45H 4BWNA 1PGJA 2JR8A 2OYOA 2QIWA 3FXDA 5KJ7C 1HUCA 3L71D 1VQ6P 2H89C 1NTMG 2Y9ZA 1NTKE 2FYUK 3VYIA 4HH2A 3HD7D 1FDOA 1IZNB 1RF0A 2KIKA 3N4XA 4KHXA 1NU1D 1OMIA 2E75B 3B71A 3L73E 5C39A 1NTKD 1ZW0A 3L71J 4HB1A 3V4QA 3ZDMA 1CW5A 3P7KA 3NTNA 3SFDC 3RL0g 1GTWA 3RK3E 2OTLP 1GMJA 1P84I 5KAFH 1KN7A 3HTKB 1CZQA 1KILA 3AE4C 1SQBK 4GOFA 2BCCG 4IFMA 3A5TA 1Q81Q 3FX0A 2UWJE 1ZR4A
chains in the Genus database with same CATH topology
1FZCC 2C9LY 2N1TB 5AW3B 3HE4B 1FJKA 2OYHA 5AW5B 3M91A 1IFNA 1SP4A 4EIJA 4W80A 1J1EC 3IR9A 3RK3B 5APUA 5CHXA 1H8AA 3V2NA 3L36A 1KILB 2Q5UA 2R3CA 5KJ7A 3M0AA 1ZR2A 3M9HA 1LTJC 2WT7B 4HYTB 3M9QA 1IJDB 1A02J 5KLVK 5APXA 1SFCA 3RL0B 4GIFA 4C7RA 4C7NA 1IFJA 2R32A 3P32A 3VTPC 4DOJA 3MIWA 2WPSA 5AW8B 1NKNA 2H8PD 5APYA 1FZGA 1NOHA 2O1JA 1JCDA 3T97A 2BASA 2IFNA 2WSFH 3BVHA 3M06A 1IK9A 1X79B 3TNUA 2P2UA 2QM7A 2C0XA 2W27A 3VOPA 1NTKK 4WY4A 1L4AC 1G1IA 1NHLA 4WB4A 1HJBA 1N7SD 1GL2B 2KB7P 2IFMA 1NTZK 1KFNA 1SQVK 1H88A 2CPBA 1QL2A 4JF7A 2WZ7A 3VMXA 1RF1B 2CPSA 1IC2A 1KILC 1JY2N 1JY2P 1OWAA 2JEEA 4WY4B 1YTZT 3A2AA 3MUDA 2HODA 4OH8B 2FXMA 3RL0D 4ZKPA 1FOSF 1SQXK 4LC1A 5AW2B 2NPSD 2NPSC 2YNYA 1VPCA 1RY3A 3V4WA 5CCGC 3O8ZA 3RL0C 3TK1A 1MFZA 5AVTB 2FYZA 1LWUB 1URQA 3NMDA 2XZRA 3A3YB 2R5DA 3HUSC 3IFMA 2H43A 5AW1B 1LTBC 2M8RA 1HBWA 3N7NA 2Q9IA 3U1AA 2FFDA 1KFMA 3L37A 3HE5A 3MTUE 1YYCA 1NKZB 3U59A 5CCHC 5CCGD 1CI6A 2C9NY 2PAJA 2A45I 2WT7A 1DH3A 2P1JA 4I6MC 2HFED 2XV5A 1H89A 4AUWA 3H32A 4WY4D 3G3ZA 1JY3P 1MZ9A 2A45G 1URQC 3RK2C 4DZOA 2FFDB 1GDTA 3KQGA 5BU8B 2YO3A 3NFQA 3KDPB 3HE4A 2HPCB 2YKOA 4LLHA 3VMYA 3BRVB 1HTLC 2OYHB 1GK4A 1RE4A 1LTGC 3C9IA 1JY3N 3VMZA 3OJAB 5CCHD 3M0DC 5APWA 1FDMA 1G2CB 1GL2A 2WTYA 3E1IA 1RF1C 2Q7CA 1L0NK 2J58A 2WSCH 1RF0C 1W2EA 4Y99B 3OAKA 2WSEH 3UIAA 3B5NC 1VDFA 1N7SA 1FZAA 1LT9A 5CJ0A 1FBMA 1DX7A 3HD7B 1E5WA 1QL1A 1T3JA 3HUSA 1RE4C 4IFDK 3GHGA 1LTJA 3RK3C 1LWUA 3H6PA 4WBAA 5CMZA 2IX7C 5AVUB 3LIEA 3TNUB 1S9KE 1LT9B 2Z4EA 3VN0A 1SFCC 1FZCB 1SLQA 2FKWB 3CLQA 1FAVA 2HLOA 1ZLLA 1T2KC 1FOSE 1JY2O 1SFCD 3TSIA 4AYCA 2XU6A 2OYIB 2PP6A 1MUUA 2WPQA 5AVYB 1J1EB 2Q3IA 1JTHB 3V5BA 2POHA 1S9KD 1M1JC 3TYYA 4AQRD 2R5BA 3H32B 2KOGA 2GM4A 2KSJA 3L4FA 1FJPA 4WY4C 4EOTA 3MD0A 1L4AA 3P8MC 2C0WA 1T3UA 1GL2D 1XTGB 4ZKUA 1T2KD 1T8ZA 3V2QA 4I1LA 1GD2E 4W7YA 3WMM0 1FZBA 1EQ7A 2QM8A 5AW7B 1JTHA 1G1JA 5AW0B 1PFIA 1KQLA 5AVWB 1RE3C 5CJ4A 2KP8A 5AVRB 4XE5B 4C46A 1NTMK 2O1KA 3HE5B 3CI9A 5BU5A 1L4AD 5CCGA 3I5CA 3BRTB 1J2JB 1M7LA 1Z56A 1N7SB 1N73C 1N86A 2NPSA 1IFMA 4I2LC 5AVZB 3HD7A 1YTZI 1URQD 2OARA 3RK2D 1XTCC 1HVVA 3NXSA 1KILD 1NO4A 3EFGA 2XNXA 2HPCA 1LGHB 1A02F 4N6JA 1HWTC 1IO4A 1SFCB 3MGNA 2E42A 2ZFCA 1GK6A 1N7SC 1AQ5A 4O9BA 3L35A 1GZLA 3OA7A 2Z5HA 3RK3D 2YKQA 5APVA 1HGVA 3M0DA 1M1JB 2OYIA 2H7HA 1IFDA 2P7JA 1X8YA 1KZUB 2I1JA 1JMMA 3HTKA 1FU1A 2WITA 1GU4A 5APQA 4W7ZA 2VRSA 1LTJB 5AVQB 3EQ2A 3B5ND 2N9BA 1LTIC 5BVZA 2XDJA 2P67A 2O01H 4B86A 2HODB 5KJ7D 2J59M 1FZCA 4GT1A 1IFIA 1SQQK 3A7OA 3KYQA 3BASA 2OYHC 4N78E 1SVFA 1FZEA 2IPPA 4XA4A 1WT6A 2GUVA 3B8EB 1URQB 3RK2B 1N7LA 1OXZA 2LKMA 2YMYA 5AW9B 1GL2C 3SWYA 2WPRA 5KTBA 1J1DB 1MV8A 2W6AA 3LIDA 3II6A 1GW3A 1LTSC 4C7NB 4JYBA 2KYVA 1JOCA 3SWFA 3M9BA 4RESB 1LTAC 1GU5A 5APTA 3B5NA 3V2RA 3P8CD 3U1CA 2KLVA 1L0LK 2ZXEB 3HRNA 4N78D 2N1TA 1RE3A 1NAFA 4N3YB 2GUSA 5APSA 3VP9A 1LTTC 1JNMA 1X9VA 2JJLA 1JUNA 1ZN5A 1NU1K 1N2DC 3GHGC 3B5NB 3HUSB 3P8CE 2YKPA 5AVVB 1GW4A 1CSBA 1LT9C 2Z5IA 3PP5A 3GHGB 5AW6B 1NWQA 5CCHA 1M1JA 2HG5D 3CL3D 1SQPK 1HH0A 2NPSB 3V2PA 1ZV8A 1G2CA 2N1TC 2N1TD 4M3LA 1N73B 2L5GB 4LGDE 4JYCA 1FZFA 1J1DC 2WWWA 3VP8A 3BATA 2W6BA 3R2PA 3KPEA 2FFDC 1JO5A 3HD7C 1JCCA 1NH4A 2XKMA 3LW5H 4IFFA 2HYNA 5AVSB 1HGZA 1LWUC 4Y99C 1N73A 4GKGA 2MJZA 5AW4B 1AFOA 1DEBA 1L4AB 5AVXB 1WRGA 1JY3O 2M3BA 2YO2A 1CI6B 2I1KA 1RF1A 2A45H 2E43A 5KJ7C 1HUCA 2FYUK 3VYIA 4HH2A 3HD7D 3N4XA 1RF0A 4KHXA 3V4QA 1CW5A 3P7KA 3NTNA 1GTWA 3HTKB 1CZQA 1KILA 4IFMA 1SQBK 3A5TA 2OYIC 1ZR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJZ A;  1NH4 A;  1HH0 A;  1IFJ A;  1HGV A;  1IFI A;  2CPS A;  1FDM A;  1HGZ A;  1IFD A;  2C0W A;  2CPB A;  2C0X A; 
#chains in the Genus database with same CATH topology
 2G3A A;  3AEE C;  1FZC C;  2C9L Y;  1PGO A;  1PGP A;  2N1T B;  2AEM A;  5AW3 B;  3CCE P;  3HE4 B;  3L75 D;  1MKM A;  1AFO A;  1FJK A;  3L70 J;  2K9J A;  4O9B A;  1EDK A;  5KLI C;  5AW5 B;  5KKZ C;  2OYH A;  3M91 A;  2WQY C;  5CBO A;  3TDK A;  1VQN P;  1VF5 D;  1IFN A;  2GA1 A;  1L0N G;  1SP4 A;  2ZT9 B;  2K1A A;  4EIJ A;  1Y47 A;  3L72 D;  1SQQ G;  2Y0D A;  1KB9 H;  3CWB E;  4W80 A;  1KQF B;  1J1E C;  3IR9 A;  3MHV A;  2BEQ D;  3RK3 B;  1P84 D;  1SQQ E;  5CHX A;  5APU A;  1H8A A;  3V2N A;  3L36 A;  1KIL B;  2Q5U A;  2R3C A;  4H13 B;  1KIL E;  3M0A A;  5KJ7 A;  3M9H A;  3PH0 A;  1LTJ C;  1ZR2 A;  5KKZ B;  2KI7 B;  1QEX A;  2LR2 A;  3CX5 D;  2O01 N;  2WT7 B;  4HYT B;  5KAI E;  5DJU B;  3PLN A;  3M9Q A;  1OVV A;  1SQV J;  1KB9 E;  1IJD B;  1K04 A;  5KLV K;  5APX A;  1A02 J;  1SFC A;  1NJI Q;  3AEB C;  2V4H A;  2BCC E;  2DW3 A;  3RL0 B;  3L70 D;  1EDJ A;  4GIF A;  3A0H H;  4BRY A;  4C7R A;  4C7N A;  3H1K J;  1IFJ A;  2ZVO B;  1KOR A;  2R32 A;  3H1I J;  3L74 G;  1KV4 A;  1KYO D;  3P32 A;  5GTI H;  3VTP C;  5TIS H;  4DOJ A;  2QE7 H;  1DIP A;  2E43 A;  3MIW A;  3H1H G;  1S5L X;  2WPS A;  3L73 G;  1QVF O;  2IDB A;  2FYN B;  4L75 A;  4R4L A;  5AW8 B;  3D71 A;  1R8E A;  1NKN A;  2KZI A;  2NRG A;  2H8P D;  3BCC G;  3H1L D;  5APY A;  1FZG A;  2OYI C;  1NOH A;  2O1J A;  1JCD A;  2IBZ D;  2BAS A;  3AE2 C;  3T97 A;  1NYH A;  2IFN A;  2WSF H;  3PTZ A;  3BVH A;  1ZME C;  2MKV A;  3M06 A;  1IK9 A;  1X79 B;  2KK7 A;  3TNU A;  2P2U A;  2QM7 A;  2C0X A;  2M5A B;  2W27 A;  1USE A;  2Q6Q A;  3VOP A;  1NTK K;  2FYU E;  4WY4 A;  1BGY D;  1L4A C;  1G1I A;  1NHL A;  4WB4 A;  1NTZ E;  1HJB A;  1N7S D;  1U7M A;  1VL2 A;  1GL2 B;  1BE3 J;  1FS0 E;  2WSC J;  4WWI A;  1E79 H;  1UIX A;  2FYU G;  2KB7 P;  1Y9B A;  2W8Z A;  3FWL A;  3H1L J;  2IFM A;  3AE3 C;  4CPG A;  1NTZ K;  1VQM P;  1BCC E;  1KFN A;  1SQV K;  2H88 C;  3A0B H;  4YTP C;  5TIS E;  1H88 A;  2CPB A;  1QL2 A;  4JF7 A;  2WZ7 A;  1FC2 C;  3Q2Y A;  1PGQ A;  3VMX A;  1RF1 B;  1AVY A;  4QMA A;  2CPS A;  1SQP G;  2JWA A;  3BCC E;  1IC2 A;  3AED C;  3L72 E;  4H0L C;  3I55 P;  3Q5R A;  1YHQ P;  1PV3 A;  1KIL C;  1L2P A;  1JY2 N;  1JY2 P;  3H1H E;  1OWA A;  2JEE A;  1ZRT D;  4WY4 B;  1YTZ T;  4ASW A;  2FXO A;  1X22 A;  4K3A A;  3CME P;  3A2A A;  3MUD A;  2HOD A;  4OH8 B;  2FXM A;  4PD4 H;  1AA0 A;  1SQX E;  3RL0 D;  4ZKP A;  1SQX K;  2QEX P;  1BGY J;  4LC1 A;  5B66 E;  1FOS F;  5AW2 B;  2NPS D;  1SQB G;  2M0B A;  1KQG B;  1VPC A;  2NPS C;  2YNY A;  2IYP A;  1RY3 A;  3V4W A;  1OW8 A;  3AE6 C;  5GTI E;  5CCG C;  3O8Z A;  3RL0 C;  2ZVN B;  1MFZ A;  4U3F J;  3IAO A;  3TK1 A;  3CX5 H;  2FYZ A;  1LWU B;  1URQ A;  3CXH E;  4KT0 J;  4Y28 J;  2A06 D;  2XZR A;  3A3Y B;  2R5D A;  3NMD A;  2KUB A;  3HUS C;  3L72 J;  3IFM A;  3Q5S A;  1DD3 A;  2H43 A;  2YIU C;  5AW1 B;  5B5E H;  2KNC B;  1LTB C;  2Y0E A;  1FDI A;  3G71 P;  1EXJ A;  3QH9 A;  1YI2 P;  3CWB G;  2JP3 A;  2Q3E A;  2M8R A;  3H1L E;  3KXD A;  1NU1 G;  1HBW A;  3N7N A;  3WUU A;  3U1A A;  2Q9I A;  1KFM A;  3L37 A;  1AVO A;  3AE5 C;  2I8D A;  1YYC A;  1NKZ B;  1BSN A;  2IBZ I;  3HE5 A;  3MTU E;  1CI6 A;  3AE7 C;  2PAJ A;  3U59 A;  2A45 I;  5CCG D;  2C9N Y;  2WT7 A;  2Y0C A;  1DH3 A;  3CCU P;  3K5B A;  2P1J A;  1NTZ D;  5KLV G;  2E5Y A;  4I6M C;  2WVR A;  2B89 A;  2HFE D;  2XND H;  1SQX G;  4L74 A;  4OGQ D;  4UB8 H;  1VQK P;  2XV5 A;  3CCL P;  3TF5 A;  1H89 A;  4AUW A;  1M56 D;  3H32 A;  4WY4 D;  4H0L B;  3G3Z A;  1JY3 P;  2L91 A;  2QJK C;  1MZ9 A;  2A45 G;  3EFF K;  3ABV C;  1HF9 A;  3PRJ A;  1URQ C;  3RK2 C;  4DZO A;  1BCC D;  2FFD B;  3GMA A;  4A7P A;  4D6T G;  1GDT A;  3AEF C;  1RH5 B;  3GF7 A;  3H1K E;  3KQG A;  1K9M Q;  5BU8 B;  2QRX A;  2YO3 A;  3NFQ A;  3KDP B;  3HE4 A;  2FXP A;  2HPC B;  2YKO A;  4LLH A;  1S2E A;  3VMY A;  1LJ2 A;  1OVR A;  3BRV B;  1HTL C;  3H1I D;  2OYH B;  5M1B A;  1SQV E;  1GK4 A;  1RE4 A;  2P10 A;  1Q90 D;  2W83 C;  1LTG C;  3C9I A;  5TJH A;  5KAI H;  1JY3 N;  1NTZ G;  2IZ0 A;  5KLV D;  3VMZ A;  2ZYD A;  3OJA B;  4ASV A;  5CCH C;  5CCH D;  2W6J H;  3M0D C;  1U57 A;  2OTJ P;  5APW A;  2IBZ G;  1QVG O;  1FDM A;  2O3J A;  1G2C B;  1GL2 A;  2WTY A;  3CD6 P;  1USD A;  3V6I A;  3E1I A;  3O6Q B;  1VQ9 P;  3CX5 E;  3CXH H;  3TGU E;  1RF1 C;  2Q7C A;  1PP9 G;  1NGM B;  3D70 A;  5E79 E;  1L0N K;  1Q7Y Q;  3SWK A;  2J58 A;  2AXC A;  3IN6 A;  4ZMD A;  2WSC H;  3Q5P A;  1EXI A;  1RF0 C;  1W2E A;  5AVT B;  2B9B A;  4GOE A;  1KD1 Q;  3C8V A;  1EC5 A;  3OAK A;  2WSE H;  3L70 E;  3B5N C;  1VDF A;  2SPZ A;  1N7S A;  4PD4 E;  4Y99 B;  3UIA A;  1FZA A;  3L74 E;  1LT9 A;  1PPJ G;  5CJ0 A;  2ZYG A;  3JCU H;  1YBK A;  1FBM A;  3B4S A;  4H13 C;  1DX7 A;  3HD7 B;  2A06 E;  1L0L G;  2ZT9 D;  1E5W A;  4MN4 C;  1QL1 A;  1T3J A;  3HUS A;  5DJT B;  1OW7 A;  2E5T A;  1YJ9 P;  4GDO A;  1RE4 C;  1S3J A;  2RKL A;  1H0T A;  2R44 A;  2YMK A;  4IFD K;  3GHG A;  1DD4 A;  4U7J A;  1SS1 A;  2OQQ A;  1LTJ A;  5H2F E;  3T97 B;  3OW2 O;  3RK3 C;  1LWU A;  3PHL A;  3H6P A;  1N8R Q;  3W68 A;  2YXQ B;  2FBW C;  3GF3 A;  4WBA A;  1NTK J;  5CMZ A;  2AXT H;  2IX7 C;  5AVU B;  3LIE A;  4KJM A;  3TNU B;  3CCJ P;  1BCC J;  1LT9 B;  3I56 P;  1S9K E;  3VN0 A;  2Z4E A;  3TGU J;  2KNC A;  1VQ4 P;  1SQP D;  3AE8 C;  1L0N E;  1X0T A;  1SFC C;  3L75 G;  1FZC B;  1ZP0 C;  1AV1 A;  4NPF X;  4DJG A;  1SLQ A;  2FKW B;  2K37 A;  3H1J J;  3IF4 A;  2WSF J;  3CLQ A;  3CC7 P;  2M3E A;  1FAV A;  2HLO A;  1ZLL A;  2K3R A;  1T2K C;  1FOS E;  1JY2 O;  1SFC D;  3TSI A;  1IK7 A;  4AYC A;  2RMZ A;  2LXB A;  2XU6 A;  1S5L H;  2D2C B;  1NTM J;  2OYI B;  2PP6 A;  1MUU A;  2WPQ A;  4NPE A;  5AVY B;  1J1E B;  3R4Y A;  3WUT A;  1LNQ A;  1BSH A;  1PP9 D;  2Q3I A;  1JTH B;  3V5B A;  2POH A;  1S9K D;  3D6Y A;  2KS1 B;  1M1J C;  1NTM D;  3L71 G;  4DCK A;  4PD4 I;  3TYY A;  4AQR D;  2R5B A;  3BCC D;  1KB9 I;  2KOG A;  3H32 B;  2GM4 A;  2KSJ A;  3H1I E;  3L4F A;  4OVN F;  4WY4 C;  5KLI B;  1FJP A;  2ITA A;  4EOT A;  1L4A A;  2G8Y A;  1KYO H;  3MD0 A;  3P8M C;  2BEZ F;  2C0W A;  1T3U A;  1GL2 D;  2BCC J;  2QVA A;  1XTG B;  2ZT9 C;  3H1J D;  3W67 A;  4ZKU A;  1T2K D;  1UII A;  3GLM A;  1T8Z A;  3KZI H;  4OWF A;  3V2Q A;  4I1L A;  1PPJ E;  1GD2 E;  4W7Y A;  1HJ0 A;  1L0L D;  3WMM 0;  3RGU A;  3CC2 P;  3L70 G;  1FZB A;  1EQ7 A;  2QM8 A;  1WMK A;  1NVO A;  5AW7 B;  1JTH A;  2OTK E;  1LP1 B;  3KHU A;  1G1J A;  1L0N J;  2JO1 A;  5AW0 B;  1PFI A;  1PIX A;  1SQQ J;  3G6E P;  1K05 A;  1KQL A;  5AVW B;  1RE3 C;  1EDI A;  2KP8 A;  4EYY Q;  5CJ4 A;  1P84 H;  1ZXG A;  4TT3 H;  5AVR B;  3Q3D A;  1JM0 A;  4XE5 B;  1VQ5 P;  3Q1M A;  4C46 A;  1DEE G;  1NTM K;  2O1K A;  3HE5 B;  3KZI E;  2WSS H;  5K5G B;  1AJY A;  5B66 H;  2FFD A;  1KTM A;  1OIP A;  3E7K A;  1VF5 C;  3CI9 A;  1P84 E;  1SQQ D;  5BU5 A;  1L4A D;  5B5E E;  5CCG A;  2J5U A;  4U3F E;  1SQV G;  3I5C A;  3BRT B;  2KXP B;  1J2J B;  1M7L A;  1Z56 A;  1N7S B;  4H44 C;  1N73 C;  1IFP A;  4H44 D;  1BE3 D;  1N86 A;  2ZXX A;  2NPS A;  3H1K G;  1IFM A;  3H1I G;  3L74 J;  4I2L C;  1RQU A;  5AVZ B;  3HD7 A;  1M90 Q;  1VF5 B;  2D2C C;  1YTZ I;  3L71 E;  4TLF A;  1VQP P;  4BXL A;  1JMB A;  1URQ D;  2OAR A;  3RK2 D;  3LW5 J;  1XTC C;  1HVV A;  3H1H J;  3L73 J;  2K88 A;  3NXS A;  4H0L D;  4K35 A;  3TGU D;  2E76 D;  1BDD A;  1KIL D;  1NO4 A;  3EFG A;  1K73 Q;  1KYO E;  2XNX A;  3BCC J;  2HPC A;  3GG2 A;  4DT0 A;  1LGH B;  1A02 F;  4OGQ C;  4EDF A;  4N6J A;  1HWT C;  3AE1 C;  5KLV E;  1IO4 A;  1SFC B;  2K9Y A;  3MGN A;  4PD4 D;  1KB9 D;  2QJK B;  3MZW B;  2E42 A;  2ZFC A;  4WVZ A;  3S1K A;  3ITK A;  3G4S P;  3L75 E;  1S5L E;  1BE3 G;  1GK6 A;  1N7S C;  2E75 D;  3O6Q A;  1AQ5 A;  1FE6 A;  1Q2N A;  2FYU J;  1Y8A A;  3CXH I;  3H1L G;  1OVU A;  3FXE A;  3L35 A;  1R5L A;  2P58 A;  1GZL A;  2B87 A;  3MP7 B;  4L76 A;  3OA7 A;  2QJP C;  2NZ2 A;  4I7Z B;  4JBZ A;  3RBZ A;  4HKZ H;  4IL6 H;  2Z5H A;  3RK3 D;  2YKQ A;  1KQS O;  3S9O A;  5APV A;  1HGV A;  3A0H E;  3CWB D;  3M0D A;  2QA4 P;  1SQP J;  1M1J B;  2B88 A;  3L74 D;  2OYI A;  1IFD A;  2H7H A;  1T6A A;  4PV1 D;  4EI2 A;  2M5A A;  2FYU D;  2P7J A;  2AXT E;  1X8Y A;  3JSV C;  2JWD A;  1JB0 J;  3CCM P;  1R5S A;  2A06 G;  4H13 D;  1KZU B;  1BGY G;  3CXH D;  4IOI H;  1SQB E;  2FY8 A;  2YIU B;  5H2F H;  2I1J A;  1SQB J;  4H44 B;  1JMM A;  4PJ0 H;  2AEF A;  1FU1 A;  2B87 B;  2R3S A;  2WMM A;  3F89 A;  2WIT A;  2WSE J;  3HTK A;  1GU4 A;  1H0T B;  3MUD C;  5APQ A;  4W7Z A;  5E79 H;  1SQB D;  2VRS A;  4U3F G;  1LTJ B;  5AVQ B;  2JKV A;  1NAY A;  2N9B A;  3B5N D;  1LTI C;  3EQ2 A;  5BVZ A;  2XDJ A;  4XFJ A;  4YPC A;  2IZ1 A;  3USS A;  4ZNC A;  1YIT P;  2K9J B;  1Q82 Q;  1M1K Q;  2P67 A;  1LT1 A;  2E76 B;  2ZJS E;  1SQP E;  2O01 H;  2KZJ A;  2OGU A;  3H1H D;  3L72 G;  1ZRT E;  3L73 D;  3H25 A;  4B86 A;  1S1C X;  2FYN C;  1QLE D;  2HOD B;  5KJ7 D;  2J59 M;  1FZC A;  4UB6 H;  3CWB J;  3RBX A;  4U3F D;  2IBZ E;  4GT1 A;  1IFI A;  1SQQ K;  3A7O A;  1M8O B;  1NU1 J;  3KYQ A;  1AQT A;  3BAS A;  4RJT A;  4YXW H;  2E74 D;  1W2B O;  2OYH C;  1QX8 A;  4N78 E;  1BDC A;  1SVF A;  1FZE A;  1U7J A;  2IPP A;  4HJG H;  1WT6 A;  2PGD A;  3G9R A;  2V7Q H;  4XA4 A;  2GUV A;  3B8E B;  1URQ B;  3RK2 B;  1N7L A;  4RKU J;  3FGA D;  1OXZ A;  2LKM A;  2YMY A;  3E1R A;  5AW9 B;  1GL2 C;  3AE9 C;  5KLV J;  3SWY A;  2LXC B;  1BGY E;  2WPR A;  1OZH A;  5KTB A;  1VQO P;  1SQX J;  1KC8 Q;  4D6T E;  1J1D B;  1MV8 A;  1RHZ B;  2KS1 A;  2QJP B;  2W6A A;  4I7Z C;  4PV1 B;  3LID A;  3II6 A;  3PJS K;  1MFT A;  2QG4 A;  1EDL A;  1GW3 A;  4BRY B;  1LTS C;  1YQ3 C;  4JYB A;  2KYV A;  1JOC A;  4C7N B;  2E76 C;  2QSI A;  3AEC C;  3SWF A;  3M9B A;  4RES B;  3S4R A;  1LTA C;  1GU5 A;  5APT A;  3B5N A;  3V2R A;  5KAF E;  3P8C D;  2D2C D;  4D6T J;  2AEJ A;  3U1C A;  2KLV A;  1K8A Q;  3QWO C;  1L0L K;  2ZXE B;  3HRN A;  2PFX A;  2N1T A;  4N78 D;  1RE3 A;  3VMA A;  1NAF A;  1D7M A;  1QGK B;  2GUS A;  2YXR B;  1LTT C;  4N3Y B;  5APS A;  3VP9 A;  2IYO A;  1EZV I;  2QJY B;  2N9Y B;  4JQ0 D;  4R4M A;  1JNM A;  1X9V A;  1BE3 E;  3CCS P;  1PL5 A;  2BCC D;  1LP1 A;  1W5C E;  2E74 C;  2JJL A;  1NTZ J;  1ZN5 A;  4UB8 E;  1NU1 K;  1N2D C;  5CBN A;  1NU1 E;  1JUN A;  1S4X A;  4JPZ B;  3GHG C;  3AEA C;  1OFC X;  2CK3 H;  4IL6 X;  1TU3 F;  5L8R J;  2JDI H;  2RH0 A;  1PPJ D;  3B5N B;  2KLU A;  3CCR P;  3HUS B;  1PP9 J;  3P8C E;  2ZYA A;  2YKP A;  5EFW B;  1GW4 A;  1SQX D;  5AVV B;  2E74 B;  1CSB A;  1LT9 C;  2Z5I A;  3PP5 A;  1YQ4 C;  3GHG B;  2Y9Y A;  3CCV P;  4PJ0 E;  1JEK A;  1VQ7 P;  5AW6 B;  1NWQ A;  3JCU E;  5CCH A;  4UB6 E;  1M1J A;  1Q86 Q;  2HG5 D;  3CL3 D;  1L0N D;  5GTH H;  1SQP K;  3D6Z A;  1KMI Z;  4L73 A;  3SFE C;  4NPD A;  1HH0 A;  1SQV D;  1YIJ P;  1RQV A;  2NPS B;  1PZQ A;  3WU2 H;  1L0L E;  3V2P A;  1ZV8 A;  1G2C A;  2N1T C;  1L0L J;  1VQ8 P;  2N1T D;  4M3L A;  1N73 B;  4YXD C;  2W90 A;  4OGQ B;  3F5H A;  2ZAE B;  2L5G B;  4LGD E;  4JYC A;  4IL6 E;  4PV1 C;  3SSU A;  1FZF A;  1J1D C;  2WWW A;  3VP8 A;  3BAT A;  2W6B A;  3R2P A;  2RN0 A;  3GW6 A;  3KPE A;  3WU2 E;  2HR3 A;  3EWK A;  3AEG C;  3CX5 I;  3C1L A;  3FWN A;  1S72 P;  5GTH E;  1ZOY C;  3HD7 C;  2FFD C;  1NTK G;  1JO5 A;  4D6T D;  1JCC A;  1NTM E;  4RO0 A;  1BCC G;  1NH4 A;  1PP9 E;  2XKM A;  1OX3 A;  3JC2 2;  3LW5 H;  4IFF A;  2V7Q J;  1OW6 A;  3TGU G;  2HYN A;  3CCQ P;  5AVS B;  1HGZ A;  1LWU C;  1M57 D;  2PRR A;  3L75 J;  3CC4 P;  4Y99 C;  4Z1M H;  1N73 A;  4GKG A;  2O01 J;  3CMA P;  2MJZ A;  3CPW O;  5AW4 B;  1EZV E;  2E75 C;  2Q1K A;  2QJY C;  3H1K D;  1EZV G;  3H1J E;  1DEB A;  1L4A B;  3H1J G;  1KYO I;  5AVX B;  1WRG A;  1JY3 O;  1YJW P;  1VQL P;  3WUV A;  3A0B E;  1YJN P;  2WPV B;  2M3B A;  4GOD A;  1EZV D;  2YO2 A;  1CI6 B;  2I1K A;  2KSE A;  1RF1 A;  2A45 H;  4BWN A;  1PGJ A;  2JR8 A;  2OYO A;  2QIW A;  3FXD A;  5KJ7 C;  1HUC A;  3L71 D;  1VQ6 P;  2H89 C;  1NTM G;  2Y9Z A;  1NTK E;  2FYU K;  3VYI A;  4HH2 A;  3HD7 D;  1FDO A;  1IZN B;  1RF0 A;  2KIK A;  3N4X A;  4KHX A;  1NU1 D;  1OMI A;  2E75 B;  3B71 A;  3L73 E;  5C39 A;  1NTK D;  1ZW0 A;  3L71 J;  4HB1 A;  3V4Q A;  3ZDM A;  1CW5 A;  3P7K A;  3NTN A;  3SFD C;  3RL0 g;  1GTW A;  3RK3 E;  2OTL P;  1GMJ A;  1P84 I;  5KAF H;  1KN7 A;  3HTK B;  1CZQ A;  1KIL A;  3AE4 C;  1SQB K;  4GOF A;  2BCC G;  4IFM A;  3A5T A;  1Q81 Q;  3FX0 A;  2UWJ E;  1ZR4 A; 
#chains in the Genus database with same CATH homology
 1FZC C;  2C9L Y;  2N1T B;  5AW3 B;  3HE4 B;  1FJK A;  2OYH A;  5AW5 B;  3M91 A;  1IFN A;  1SP4 A;  4EIJ A;  4W80 A;  1J1E C;  3IR9 A;  3RK3 B;  5APU A;  5CHX A;  1H8A A;  3V2N A;  3L36 A;  1KIL B;  2Q5U A;  2R3C A;  5KJ7 A;  3M0A A;  1ZR2 A;  3M9H A;  1LTJ C;  2WT7 B;  4HYT B;  3M9Q A;  1IJD B;  1A02 J;  5KLV K;  5APX A;  1SFC A;  3RL0 B;  4GIF A;  4C7R A;  4C7N A;  1IFJ A;  2R32 A;  3P32 A;  3VTP C;  4DOJ A;  3MIW A;  2WPS A;  5AW8 B;  1NKN A;  2H8P D;  5APY A;  1FZG A;  1NOH A;  2O1J A;  1JCD A;  3T97 A;  2BAS A;  2IFN A;  2WSF H;  3BVH A;  3M06 A;  1IK9 A;  1X79 B;  3TNU A;  2P2U A;  2QM7 A;  2C0X A;  2W27 A;  3VOP A;  1NTK K;  4WY4 A;  1L4A C;  1G1I A;  1NHL A;  4WB4 A;  1HJB A;  1N7S D;  1GL2 B;  2KB7 P;  2IFM A;  1NTZ K;  1KFN A;  1SQV K;  1H88 A;  2CPB A;  1QL2 A;  4JF7 A;  2WZ7 A;  3VMX A;  1RF1 B;  2CPS A;  1IC2 A;  1KIL C;  1JY2 N;  1JY2 P;  1OWA A;  2JEE A;  4WY4 B;  1YTZ T;  3A2A A;  3MUD A;  2HOD A;  4OH8 B;  2FXM A;  3RL0 D;  4ZKP A;  1FOS F;  1SQX K;  4LC1 A;  5AW2 B;  2NPS D;  2NPS C;  2YNY A;  1VPC A;  1RY3 A;  3V4W A;  5CCG C;  3O8Z A;  3RL0 C;  3TK1 A;  1MFZ A;  5AVT B;  2FYZ A;  1LWU B;  1URQ A;  3NMD A;  2XZR A;  3A3Y B;  2R5D A;  3HUS C;  3IFM A;  2H43 A;  5AW1 B;  1LTB C;  2M8R A;  1HBW A;  3N7N A;  2Q9I A;  3U1A A;  2FFD A;  1KFM A;  3L37 A;  3HE5 A;  3MTU E;  1YYC A;  1NKZ B;  3U59 A;  5CCH C;  5CCG D;  1CI6 A;  2C9N Y;  2PAJ A;  2A45 I;  2WT7 A;  1DH3 A;  2P1J A;  4I6M C;  2HFE D;  2XV5 A;  1H89 A;  4AUW A;  3H32 A;  4WY4 D;  3G3Z A;  1JY3 P;  1MZ9 A;  2A45 G;  1URQ C;  3RK2 C;  4DZO A;  2FFD B;  1GDT A;  3KQG A;  5BU8 B;  2YO3 A;  3NFQ A;  3KDP B;  3HE4 A;  2HPC B;  2YKO A;  4LLH A;  3VMY A;  3BRV B;  1HTL C;  2OYH B;  1GK4 A;  1RE4 A;  1LTG C;  3C9I A;  1JY3 N;  3VMZ A;  3OJA B;  5CCH D;  3M0D C;  5APW A;  1FDM A;  1G2C B;  1GL2 A;  2WTY A;  3E1I A;  1RF1 C;  2Q7C A;  1L0N K;  2J58 A;  2WSC H;  1RF0 C;  1W2E A;  4Y99 B;  3OAK A;  2WSE H;  3UIA A;  3B5N C;  1VDF A;  1N7S A;  1FZA A;  1LT9 A;  5CJ0 A;  1FBM A;  1DX7 A;  3HD7 B;  1E5W A;  1QL1 A;  1T3J A;  3HUS A;  1RE4 C;  4IFD K;  3GHG A;  1LTJ A;  3RK3 C;  1LWU A;  3H6P A;  4WBA A;  5CMZ A;  2IX7 C;  5AVU B;  3LIE A;  3TNU B;  1S9K E;  1LT9 B;  2Z4E A;  3VN0 A;  1SFC C;  1FZC B;  1SLQ A;  2FKW B;  3CLQ A;  1FAV A;  2HLO A;  1ZLL A;  1T2K C;  1FOS E;  1JY2 O;  1SFC D;  3TSI A;  4AYC A;  2XU6 A;  2OYI B;  2PP6 A;  1MUU A;  2WPQ A;  5AVY B;  1J1E B;  2Q3I A;  1JTH B;  3V5B A;  2POH A;  1S9K D;  1M1J C;  3TYY A;  4AQR D;  2R5B A;  3H32 B;  2KOG A;  2GM4 A;  2KSJ A;  3L4F A;  1FJP A;  4WY4 C;  4EOT A;  3MD0 A;  1L4A A;  3P8M C;  2C0W A;  1T3U A;  1GL2 D;  1XTG B;  4ZKU A;  1T2K D;  1T8Z A;  3V2Q A;  4I1L A;  1GD2 E;  4W7Y A;  3WMM 0;  1FZB A;  1EQ7 A;  2QM8 A;  5AW7 B;  1JTH A;  1G1J A;  5AW0 B;  1PFI A;  1KQL A;  5AVW B;  1RE3 C;  5CJ4 A;  2KP8 A;  5AVR B;  4XE5 B;  4C46 A;  1NTM K;  2O1K A;  3HE5 B;  3CI9 A;  5BU5 A;  1L4A D;  5CCG A;  3I5C A;  3BRT B;  1J2J B;  1M7L A;  1Z56 A;  1N7S B;  1N73 C;  1N86 A;  2NPS A;  1IFM A;  4I2L C;  5AVZ B;  3HD7 A;  1YTZ I;  1URQ D;  2OAR A;  3RK2 D;  1XTC C;  1HVV A;  3NXS A;  1KIL D;  1NO4 A;  3EFG A;  2XNX A;  2HPC A;  1LGH B;  1A02 F;  4N6J A;  1HWT C;  1IO4 A;  1SFC B;  3MGN A;  2E42 A;  2ZFC A;  1GK6 A;  1N7S C;  1AQ5 A;  4O9B A;  3L35 A;  1GZL A;  3OA7 A;  2Z5H A;  3RK3 D;  2YKQ A;  5APV A;  1HGV A;  3M0D A;  1M1J B;  2OYI A;  2H7H A;  1IFD A;  2P7J A;  1X8Y A;  1KZU B;  2I1J A;  1JMM A;  3HTK A;  1FU1 A;  2WIT A;  1GU4 A;  5APQ A;  4W7Z A;  2VRS A;  1LTJ B;  5AVQ B;  3EQ2 A;  3B5N D;  2N9B A;  1LTI C;  5BVZ A;  2XDJ A;  2P67 A;  2O01 H;  4B86 A;  2HOD B;  5KJ7 D;  2J59 M;  1FZC A;  4GT1 A;  1IFI A;  1SQQ K;  3A7O A;  3KYQ A;  3BAS A;  2OYH C;  4N78 E;  1SVF A;  1FZE A;  2IPP A;  4XA4 A;  1WT6 A;  2GUV A;  3B8E B;  1URQ B;  3RK2 B;  1N7L A;  1OXZ A;  2LKM A;  2YMY A;  5AW9 B;  1GL2 C;  3SWY A;  2WPR A;  5KTB A;  1J1D B;  1MV8 A;  2W6A A;  3LID A;  3II6 A;  1GW3 A;  1LTS C;  4C7N B;  4JYB A;  2KYV A;  1JOC A;  3SWF A;  3M9B A;  4RES B;  1LTA C;  1GU5 A;  5APT A;  3B5N A;  3V2R A;  3P8C D;  3U1C A;  2KLV A;  1L0L K;  2ZXE B;  3HRN A;  4N78 D;  2N1T A;  1RE3 A;  1NAF A;  4N3Y B;  2GUS A;  5APS A;  3VP9 A;  1LTT C;  1JNM A;  1X9V A;  2JJL A;  1JUN A;  1ZN5 A;  1NU1 K;  1N2D C;  3GHG C;  3B5N B;  3HUS B;  3P8C E;  2YKP A;  5AVV B;  1GW4 A;  1CSB A;  1LT9 C;  2Z5I A;  3PP5 A;  3GHG B;  5AW6 B;  1NWQ A;  5CCH A;  1M1J A;  2HG5 D;  3CL3 D;  1SQP K;  1HH0 A;  2NPS B;  3V2P A;  1ZV8 A;  1G2C A;  2N1T C;  2N1T D;  4M3L A;  1N73 B;  2L5G B;  4LGD E;  4JYC A;  1FZF A;  1J1D C;  2WWW A;  3VP8 A;  3BAT A;  2W6B A;  3R2P A;  3KPE A;  2FFD C;  1JO5 A;  3HD7 C;  1JCC A;  1NH4 A;  2XKM A;  3LW5 H;  4IFF A;  2HYN A;  5AVS B;  1HGZ A;  1LWU C;  4Y99 C;  1N73 A;  4GKG A;  2MJZ A;  5AW4 B;  1AFO A;  1DEB A;  1L4A B;  5AVX B;  1WRG A;  1JY3 O;  2M3B A;  2YO2 A;  1CI6 B;  2I1K A;  1RF1 A;  2A45 H;  2E43 A;  5KJ7 C;  1HUC A;  2FYU K;  3VYI A;  4HH2 A;  3HD7 D;  3N4X A;  1RF0 A;  4KHX A;  3V4Q A;  1CW5 A;  3P7K A;  3NTN A;  1GTW A;  3HTK B;  1CZQ A;  1KIL A;  4IFM A;  1SQB K;  3A5T A;  2OYI C;  1ZR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...