5AW1B

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 85 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw1B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw1B02
2Q5UA 2QM8A 1GZLA 3VN0A 5AVYB 5AVVB 1JNMA 1DH3A 3T97A 3M06A 4RESB 3A5TA 3B8EB 1H89A 2WPQA 3L37A 3NFQA 1A02F 2R5BA 4DZOA 3MD0A 5AVRB 1G2CB 5APXA 4AYCA 1IO4A 2P7JA 4M3LA 4C46A 4KHXA 1MUUA 3NXSA 2E43A 5APTA 3P32A 3VMYA 3V4QA 1T2KC 2R32A 5AVQB 2Q7CA 2IPPA 3VYIA 2YO3A 3P8MC 5AW6B 3A2AA 1KQLA 5AW7B 1SLQA 1A02J 1FOSF 2JJLA 2H7HA 5AW2B 5AW1B 2KP8A 4LC1A 3WGVB 5AW8B 2ZXEB 4RETB 2XZRA 5AVSB 3VMZA 1J2JB 5AW4B 3HE4A 3WGUB 4XE5B 2Z5HA 5APWA 1HUCA 2QM7A 3M0DA 1HJBA 2P67A 3A7OA 1OXZA 2Q3IA 3P7KA 3HTKA 1GD2E 2WWWA 5AW5B 1S9KD 4C7NB 1SP4A 5APSA 3HE4B 5CMZA 1YYCA 3VTPC 4HYTB 1OWAA 2P2UA 5AVXB 3HE5A 3L35A 2YNYA 4GT1A 5APQA 2WTYA 5APYA 3KDPB 2R5DA 1GK6A 2ZFCA 1JUNA 1T2KD 3HE5B 1CI6B 1NAFA 2WT7B 4C7NA 3M91A 4EOTA 2C9LY 1H88A 3M9BA 3L36A 2YO2A 3LIEA 1GU5A 5AVWB 4AUWA 2WPRA 3MGNA 1GU4A 3LIDA 2XV5A 4B86A 1MV8A 2Z5IA 1S9KE 2R3CA 2W6AA 1CZQA 3NMDA 2N9BA 3OAKA 3TNUB 2BASA 3SWFA 5AW9B 4JYBA 3NTNA 1GK4A 1FOSE 1CI6A 3M9HA 2WT7A 2XU6A 5AVZB 3V5BA 5APVA 4GKGA 5AW0B 1MFZA 5AVTB 3KQGA 1FAVA 2WPSA 4I6MC 3A3YB 3UIAA 1HWTC 3IR9A 3TYYA 4I2LC 1NWQA 3M0AA 5AW3B 2VRSA 1GTWA 2C9NY 1HBWA 3TNUA 4AQRD 3TK1A 2E42A 3V4WA 3VMXA 1H8AA 5APUA 1X8YA 4JYCA 5AVUB 1CSBA 3I5CA 3O8ZA 2W27A
chains in the Genus database with same CATH superfamily
1F8TL 3L5XL 4MNGB 4IKNA 1J8KA 2JCCA 2NW2B 1QI3A 3TASA 4U6XB 1Y6KR 3MLXL 1QPPA 1D5BB 2K1MA 3MROB 3P3RA 4AE1A 2EDMA 3GBDA 1MNNA 3VYOA 4LCWB 4JFOA 2IV9A 3ARSA 2ITAA 5F89B 1QWUA 3W67A 1QBLL 2EDTA 2YUVA 3D3VA 4GMTH 1WUNT 4M7ZB 3TS8A 1V27A 3H1KE 5J6GB 2F15A 4MJ5A 1ZT1A 4L4VD 2AJVH 1QA9A 1HEHC 2G3XA 3OHXA 2XNDH 1KTRL 1OL0A 1YG9A 4ODTH 3AC0A 4X4MA 2DWEA 4TLFA 1IKFL 5C0RL 9PCYA 1TETH 3W9EB 1NTKD 4EIUA 1LP1B 3HE6A 3CWGA 5CWSA 1YQVL 3SE4A 4X42A 1LO3L 3G3ZA 5D1QE 4RETB 2OX5B 2ZYDA 4KKLC 5EZJB 1PU0A 3E8UL 1V7MH 2R59A 4I18A 4JGUA 4XNZC 4Q2ZB 2ZSWB 3JWDH 1KYOI 3A0BH 2L7UA 5MENE 3ZT6A 3D06A 1X22A 2PO6B 4NM4H 4R7LA 1S8DA 4I4WA 1BAWA 4XBEH 4BRJA 5E2UH 1O6VA 3BGAA 5IW1A 4S1RH 1LWHA 4H25B 3QFJD 4G9FE 4BKLB 2ENJA 2OCFD 5C07A 1N0XL 1CF8L 1YITP 1SQVD 3T2LA 3I74A 3GB7A 4ACTA 4YDZA 3NOIA 1ZGLP 3MLWH 3EH2A 1K72A 1AMXA 2NX5B 3KH4A 3TA3A 3T8MA 2YPVH 3BFOA 5DUPH 4UDTB 4MRBA 5AKSA 1HZHL 4GAAA 3MO1B 3RFZA 5SWZA 4N90D 3BC9A 3L3OA 3QARA 3ARRA 3RTQB 5FWQA 4ONGH 3P73B 3U9WA 4KX9A 4PY8J 1FIEA 5ESVA 1U8JA 2NXYB 2AQNA 4GODA 4HOWA 4Y9FA 5L4FA 1BD2B 3LEYL 1KY6A 5IW3A 3U0WH 2AVGA 3T4YB 4KDVA 1SDYA 3LNHA 3FQRA 5CGYD 1UA3A 1BV8A 2WWOA 5BVJA 3GXNA 3MV11 3SOBL 4LU5H 4AL8L 3QJZA 2C0WA 2NMSA 4FHBD 4R6UA 4NBZB 3CFNA 5CIPB 1NJ9A 4ZOBA 1NBZB 4EBQL 5FGCB 3WL9A 1UZGA 2KUTA 4NO2B 2VDML 5BS0D 2WKOF 5CHNB 3BVNA 2X53A 3LZRA 4FHKA 4IEFB 4NNXA 3WFCL 1XX9C 3OM3B 4ZUWA 5D7KD 3CMOL 1RP8A 4AMWA 2EC8A 2A06G 4W9DC 4XVJH 4H1LH 2YGPA 3WE6B 3L95A 3MRRB 1R33A 3BIKB 2HP4A 3OAUH 4Z3FA 1USEA 1KC5H 1KIUA 5ANHA 2O5XH 1YEKH 1K8IB 4PTTB 5HYFA 4U1KA 5EEWA 2QTVA 1E6OH 1YMME 4RSYA 3FTUA 1LJ2A 1N7SB 3DK2A 4XRCA 4EUPG 4Z8FL 2O5ZH 4WK4B 1NTZE 5CP7B 3L70G 4LT7A 1DEEG 2XJLA 4PRPE 4OLXL 2QLVB 4WY7L 3UYOD 1Y18A 3PE9A 2H2PC 4GLRH 4GIPD 3O4LD 8CGTA 3DARA 4ZTPL 1ZLVK 2XG4A 2DQEL 3ZU8A 4WO4C 2BIQA 1AGCA 1IUZA 3MRKA 3PS6A 2K9FB 3DMMC 3WS3A 4HWEH 4L4VA 4ZMZA 3VQ1C 1DLFH 5DK0B 1MZ9A 1QOKA 4XBGB 2WB1A 5H35B 1PZ3A 1ZRUA 1MHPL 1EAPA 1QBML 5DZ9A 1HOCB 3V6IA 1X4XA 1EXJA 3QH3A 5B4MD 1CTNA 3UO1H 3D2TA 1XGUA 1KGXA 3BUYB 3A5VA 3QDHA 3Q8EA 5AG8A 2HFGH 2E74D 3KNBA 1KFMA 4NCC1 3UO8B 4HK3J 5ESQA 4OKDA 3EHBD 4OZ4A 5E2WL 3BDXA 3LPGA 1EPFA 4D9QE 2VRQA 2O1JA 1HIMH 4MSWB 2GSGB 3QI9C 1N73C 2VITB 4BSWA 1Q9OB 2KC0A 4LRIC 4WENB 4DN4H 2JB5L 4ATTA 3Q5YA 2DQUH 1TITA 2EECA 5I1IL 3UZQA 1N8ZA 5EC2A 2X4SA 1YEHH 1KCSL 1JPSL 1YLBB 1Z7JA 2WGXA 4Q8BA 3RP1A 3FW6A 2DI8A 5I6KA 3LH9A 2PYFB 2JV6A 4O02H 5B8CB 1I3UA 2K9YA 4K4KA 3LVEA 4M7JL 1JRHL 3QPXL 3WKNA 4QJ4B 2HB0A 2APSA 3H1JG 3RX7A 5DI8B 3EOTL 1AS7A 4Q7DA 4HUUB 5DWUH 1LTAC 3QEGL 1I8IB 4HX1A 1BE3D 1WISA 4JN2B 3TT3H 4QRQA 1DL7H 5GTIH 5FCUL 3TGUE 1EBAA 1GOHA 1IKNA 2N0KA 2HH0H 3G08A 4MQXD 5F7KC 2Y6TE 1U93B 2EVIA 4F1SA 4HKZB 1YECH 2GJZA 2XXMB 5D2NE 1FFRA 3I75A 4RCAA 2CUIA 4I0PC 3BP5A 5F0PB 1LE5A 2J59M 1BAGA 4HOXA 1CGVA 4AQ8C 4K15A 3ZHFA 1AQTA 5BV7C 3OTTA 3QR1A 4X2UA 3P30H 2R1WB 2I5YH 4DAGL 3GJFK 4L0ZA 2YAQA 3EXJA 1J1EC 3ESNA 2X70B 4HBCL 5G5DA 3HFML 3TCXA 3CDYA 4O51A 4FF9A 4LSVL 1LWUC 4KI5C 5BS0A 4X98A 3V4PH 1PF3A 1VPCA 3RK2C 2ED7A 3TEYA 1FORL 3V0GA 1RIUL 5AEAA 1E3FA 1Y6MR 2N1TE 4NQDB 1UZ8A 2WCPA 1NL0L 3H1HE 3K2KA 4HXBH 2AERT 4PJBA 3NK3A 4N8PA 1CXLA 2D3NA 4X7TB 5IHWA 3EJQA 1B2WH 3O4OC 1UB6A 2K8MA 4X0NA 2HRGA 3P3YA 4PJXF 4Y4FD 3O6ML 4AYEC 2NQCA 1UG9A 2DTML 4PJ0H 2OJEA 3GZKA 2OV0A 3QNYA 4XMUA 4FQLL 4HH8A 1TTCA 1E65A 4NGHL 1LEIB 2ZXXA 2KZ1B 2NY3C 4ISVA 4N2AA 4N1CA 4XWGL 1ZLUK 4LPXA 1HDMA 4XI5C 5DD1H 2FTAA 5LQBH 4AZUA 5G2NA 2APVA 4L1HA 4ZS6C 5GGTH 3K6NA 1OLLA 1JNNH 1WO2A 3PABA 3B2UC 3EO1B 1T66D 3O4LA 4KO9A 5IB3B 1MWAH 4MXQD 3DX6A 1OARH 2Z8WC 2A77H 4PD4K 3UPRB 2NQDA 3QFDA 3FT1A 4AEIL 5J06A 2VISB 1JUNA 4FZ8L 1UJ3C 1YPZA 3QZBA 3DUSB 3Q0HA 1UXWB 5AAMA 1N59A 1U2YA 4PREB 2H1LM 4IRSD 1U8NA 4LSTH 4EI0A 4HJTA 5JQHC 4DW2L 4NERA 1JMZA 3DHJA 2GBTA 2PCFA 3O9WC 3WXWL 2DQIL 2CCVA 1KB9J 2P8PA 3LIDA 4EN3C 2ICEB 5IUSA 4BK5A 3CCMP 4EIBA 3DHMA 1IRAY 5EOQL 5JQ6H 1ASQA 4UV4H 3X13A 1J5DA 2JKJA 3B7UX 5FCSH 2AQ3A 3ZKNC 2ESVD 1MCLA 2OMWB 2XY2A 5E7FA 5AOLA 5DUBA 1JWMA 1DQVA 4CSSA 4F7TA 1WTGT 3HR5B 4EQ3A 1Q0YH 1ZPUA 4PBVC 2Y2WA 4Q6IA 4BBWA 1QHQA 1PTZA 3U83A 2BDNL 2IBZG 2OYKA 4DP5X 4HDIB 1IQDB 2FJUB 2PYEB 5KJ7E 1FL6A 1PZCA 1EMTL 1U8QA 5KVFH 2AGJL 1DX7A 2H2SD 2N0MA 4TQEH 3AEAC 4L8SB 5HVGB 2YIUC 5C0DB 4DJMA 3DUUA 4HZLA 4PWHA 1F3RB 1MJJB 3GMLB 4NN7B 5CEXB 1X5ZA 4LCCA 4JLRB 1KT2B 2DY2A 1PFOA 1DEDA 4DPRA 5KN5B 1BZ9B 2FL5B 4DGWC 1L9NA 4NZFA 2PXYD 5JO5B 2GHZA 1N7ML 3UL4A 3OWRA 5HXMA 5GS1B 3QUHA 5MP6L 3T8VA 3LQZA 2BOBA 4FQ1H 4KKCC 4XH2A 4A2LA 4X83A 3TURA 3MRPB 4KHTH 1D5XA 1RJCA 3FQYA 3L9RA 4HG4K 2DN7A 4FOMA 2OYLA 3RBSA 4QLWA 2NY6C 2I9LB 4GRLD 3SJVD 1NCHA 1X3DA 1HXYB 2P7TA 4PTUB 4LVOB 4OBRA 4HV8A 3FSOA 2IWEA 1ACCA 3BKML 1IC4H 5GHWL 3R8BB 4JJOA 4I3RH 1E5YA 4XN8A 2HJKA 3OR7A 3NH7L 3FU3A 3WKQA 1NGZB 4AXWA 1KMGA 3HUSA 5D1XB 4HUWA 3TC9A 2FR4B 1LEGB 4BELD 3VJ6B 1SEBA 3WXVH 4MD0B 3O2DA 1U58A 4BK8A 1JFHA 1OE2A 4LFHG 2YKOA 2WUBL 1UURA 1E7VA 3NJNA 4I0CC 5AW8B 3VI4E 4PU2A 1AGBB 3NFPA 4M5ZL 3BT0A 1IZNB 3W11D 1T1WB 3JV4B 2FO8A 5CJ0A 2ZJSE 1C12B 3S36X 2CPCA 1OSZB 4JS7A 2BP0A 3B5TA 4FQHB 1WYJA 2F08A 1JNHB 3AAZB 3HB3C 4P2OC 5KYXA 2FX7L 3PDDA 4RMSA 3NJFA 3FU0A 2IQ9H 4WU5B 1FWXA 3BESR 2XYCA 2Y0SA 2IDTA 2V5RA 4TS6A 1JGUL 4NKOB 4ECNA 2ZT9B 3H1LE 3S88L 4LCIL 2AEQH 4PJ9D 1DVFB 2FX8L 4NO3B 3WTTA 3ZYJA 2PTVA 1RF1B 4NHUB 1MCOH 3TEXA 1NDTA 2X1QA 2OMYA 4X0KA 3HZMA 1GC1L 3QFGA 4BXSV 3GMAA 1IX2A 4AL8C 1HGVA 2CJSA 3CDCA 2LV4A 2YO2A 3U2SB 4BFEA 3NCFB 3L3HA 3V5DA 1DVSA 3HAEB 1JVKA 2WC7A 4GSQA 3V9CA 3WG7B 4WFFD 5EEYA 1PPJE 1J0HA 2HLFC 3QIWC 3NTCL 5H4ZA 4GOFA 5DJCB 2B0SL 1WEJL 2ZAIA 4YX2L 2CDGB 4V2CB 2IZ1A 4ZI8A 1NCAH 3ARWA 4WWOA 4I77L 2ZAGA 5F7WC 1EDQA 4AM0B 5CZVL 1UM5H 5DRNA 3K71B 3L4WA 2NY4C 4OZGB 1PSKL 1HWWA 3ENEA 4OIIH 5K39B 3GS0A 4IRSA 4L5FE 4QPEA 3DTDA 3T65B 1NCDH 2MKWA 1I1RA 2L4OA 1K73Q 3LRGA 1HKFA 1S9WB 2VLRE 5KYUA 3EG9A 4FABH 2FT8A 1TZ8A 3WUUA 2EIKB 1HL4A 3QUMH 4QYOB 3KL3A 1X7QA 4NNPL 3CFCL 3DBSA 3FRUA 3HE6C 1DBKH 1KACB 4ONHB 2VMJA 1QTYT 3SE4C 4F2FA 1SQPE 3L73J 3D48R 3AEEC 1DJIA 1ZWIA 5D93B 2RD0A 5C7XH 5EA0L 4BRYA 4P3DB 5ESAB 3ZYZA 3ALWA 4E9QA 1S72P 1L0XA 5FUZL 3PWUB 5LXVA 3BHBA 1SQQJ 2JFCA 1L0LE 3ECWA 1BX2B 4LVEA 1BFOA 3NZ8B 4HKBA 4DO4A 1YEEH 4L1SA 4BDVA 2XXGA 4QNPF 4NLHA 1R3IL 2L0DA 5E1GA 3BGFB 4L2LA 1MN4A 2QQLL 4R4BB 5I75B 2ZD0A 1FBMA 2ORBL 5GRUL 1NYHA 3QXAB 5E5UB 4WFHD 3MXWH 4O2EB 1GPOL 4X6CA 3IMRA 4AKQA 3BGMA 3O2DL 1NOLA 5AW6B 3BEVB 1HHHA 2AK1H 4NQED 4ADJA 1PYWB 3U1SL 2P8LB 4LP8A 1PGQA 2PXYA 1ZXGA 3TA3C 2HUHA 2Y25A 1G7IA 4L4TD 4FQIL 1NFDE 4PV8B 5BO1L 4ODXB 4ODWB 1BAFL 3IFLH 3AY4C 2QJYB 4P57A 2VDPH 4HIHB 4QRTA 3WJMA 1I75A 5HHQB 5AZEL 4IU2A 4OJEH 5HGAB 3Q1SH 2NSQA 3SJVA 1OTTC 2R23B 3H4HA 1BQKA 2Z3FA 1FE8L 3PWJA 1CG9A 4PS3A 1CLCA 2I8DA 2A99A 5IB2B 3HTLX 4FLOA 5APSA 3LCYA 3GI8L 2VR6A 1CGSH 1M1KQ 4XODA 5EWIH 1NFKA 4MNQD 4Z23A 4GT1A 3GMPB 2Z1KA 3VMOA 2J3SA 5FM4A 3H8NA 4XPFL 3VXNA 4V1DD 1QACA 1G5AA 3QJFA 3MV8A 4U1JB 5TE6H 4KQ4L 4E41D 1RXLA 2WXKA 4LDLB 4QHUB 4XNAA 3SGJC 4Z7VA 1Q90D 4HCIA 3QA3B 3QE5A 1WDAA 4WTWA 4NWTH 5HD8D 2Z31B 2FJFA 4G1EB 1VEPA 3VFRB 1E30A 2W9EH 5HYJA 2HRLA 4YHKH 3WUWA 3ASOB 4RGMC 5DZNA 1QSED 4LLQA 4FMVA 5BRPA 5B1KA 3GHPA 1ZGLB 4LL4A 4PJ9A 1KCBA 2HUEA 3CZFB 3FT2A 2VDRH 4MS8C 5CSGA 4M4PA 1BZ7A 3ZL1A 2R0ZL 1WH0A 4OIAA 3OZLA 1Q9KA 2JCCB 4R4FH 3L9YA 4JDTH 1PBYA 1FZOB 3M0AA 2NZIA 3AADB 3MUZ1 2VDMB 3CFUA 1T7XA 2EXWC 4NQVA 2WWKO 1YNKL 2UX6A 4JFOB 3ZDWA 5EFWB 5APUA 1X8YA 1PP9J 4K7PY 3D3VB 1YAZA 1LK2A 2H0PA 4JVPA 1NMBH 2K6YA 2XZCL 3MX0A 3OHXB 1QA9B 5CZRA 1XIWB 4PYHA 2O01J 4FGMA 4AENA 3PWVA 4NPKA 5EF1A 1IGCL 4UAOC 2CO3A 3H6JA 4KVNH 4ZD3L 3CFJA 4UYPA 1NBCA 1KN4L 5LB1A 3OXSA 3E1RA 2UXFA 2J25A 4RA3A 3V2QA 2IAMD 1R19A 2GTWA 2Z4QA 4FP8H 2LVEA 3A0OA 1QBBA 5CWSB 4E36A 4EI5B 3MRNB 4FL4B 1DANU 3QIUC 1ZE3C 2IH3A 4X6FB 1IGYA 3TIEB 4I18B 1PKOA 3DROA 2YQBA 5C71A 2E7HA 2KLSA 3S2AA 1P6FA 3RWIB 4EKXA 1KV7A 4JVUA 1B9KA 3NIDE 1S8DB 1PIXA 1X6NA 3QJXA 2J6EH 4YHOH 4RQQA 3ZKQD 4JDEA 1TU2B 2HN7A 4A68A 2YKKA 1G0YR 2W0KA 3BIAX 2YAFA 3QUXD 4K5PA 1PLGH 1XSIA 2XU9A 4PSPA 5KSBE 5JIDA 2RR3A 3EJUA 5IESL 5LNDA 1BPVA 1YPZF 1L0NE 4B53A 1T5XA 3GB7B 2DMGA 4U0RC 3RIKA 1VACA 1XF2A 4OV5B 2UZYB 2NY5H 1ZRTE 4NQEA 3LB6D 3GMRA 3SSGA 1XF1A 5KOMC 5K9OA 1EAOA 4Y4KA 4L4TA 4XVOA 3FAXA 1HYSD 2FKWB 5APQA 1ONQB 2EDFA 2X4OA 3L5JA 5DEGA 2FNBA 3GHGA 2NRGA 2HWZL 3L3OB 3SKOA 4ODVH 2WXJA 4ZTOL 4WW2A 4QXUL 4AV4A 2XXCB 4NJAL 5ESVB 3HE5B 5FUOH 1U8JB 4NHCH 2J5UA 4XXWA 4C7NA 5TPWL 1LNQA 2D4FA 1MREH 2Z7UA 4NUQA 1M90Q 4S0SD 2BWQA 1KPVA 1WIOA 4FLHA 2ZWKA 3FQRB 1KJ2H 3EBAA 5E8DL 3E3QC 1AAJA 1VESA 4JPKH 1CU4H 2HTLC 3PGDA 1KYOH 1CXFA 2AXJA 1NJ9B 3UBFA 2VWEE 4X6EA 4WK0B 3WL9B 3V0EA 5FGBA 1KLUA 5KYWA 1CQKA 4E41A 5IK3B 2CGZA 5F1NB 2NY0C 5ENWA 1Q90A 5GZND 5AW3B 2IMMA 3HHRB 1V3MA 3L95B 3IXTA 5ADPL 4JFFB 2FYZA 1KIUB 2HLEB 1CBVL 4ZX3A 3EJJX 5EOCJ 5B1AB 1I8MB 4Y5YC 1S7WA 4U1KB 5HDBF 1WWBX 1ZK5A 3TN0D 2P58A 2J5LB 3IRZA 4KNTA 4PWKA 5G4OA 1WIUA 4YSSA 1RZKH 2P4AB 4ELKA 3E9UA 3OAZH 3U25A 5IBLC 3F05A 4RBPK 5AENA 2RTTA 3JTSA 1AR2A 3GK8L 3KAAA 4NKDA 3EYUH 2CG9X 1YJDL 5F7HA 3QRGH 1BLNA 1DJGA 5E5MA 1NWPA 1I8UA 2R2EB 1ZEAL 4FFYA 3CBJB 4M62H 3MDJA 5IFJA 2XG4B 3UTOA 4S1QL 2Q20A 5D7LD 4RO0A 3NFSH 4NQXA 1TCRB 3MRKB 3BVHA 1LP9E 3WS3B 4P04A 3GXFA 2BHUA 4L4VB 4KT0J 3HJ0A 4OCSL 2B14A 4XNUL 4WI4A 1KCRH 4KHXH 4OVVA 1BW8A 5HVHB 3L73D 3ETBJ 4NWUH 4GUOA 5EUOB 2OM5A 2RFXA 3LRLA 4Z3GA 4N8CH 1XGUB 1CK0H 4MMZA 4I13B 1WIPA 2VDNL 1SQQD 4GG6B 4BK5C 1E9QA 3AROA 4G80B 1TIUA 1A6WL 2H0FA 3M0DA 4JFZH 4OZ4B 1RPUA 4Z0BL 3UIYA 4WUUE 5KSVA 2IQAB 3LIZH 4F27A 4R4NC 2MOQA 4OB5L 1JO5A 5TDPA 4PSRA 1RL1A 4Q6IC 3HS8A 3ZKXC 2CDEB 5D5MA 4BSWB 4DZBB 4PRHE 1AVAA 4N3UA 1NAKH 5DLMH 2IH9A 2O72A 3VFSA 1KNOA 4HULB 1SQBJ 3HRZC 3C09C 1VF5D 4QOKD 2WQAA 3UZQB 1N8ZB 2X4SB 3QFJB 5IVOA 1G94A 4GAGH 4AQOA 3T0EB 3SB3A 3H1KD 3UAJC 2ZYGA 2AS5M 1NANI 4LCCC 3VVVA 1RUKH 2JWAA 3ATBA 5EULV 1UH2A 1L9RA 5MEPB 4X7DC 3UABA 4RBPH 3ARPA 1J0YA 4KZ0A 1FS0E 1XD1A 2FH8A 5F7LB 1ZA3B 4K07A 4RMQA 3LKNA 2K37A 1I7UA 5CJOH 2OYIA 2GK2A 4NI3A 5K9KA 4XX1E 1GZPA 3D18A 4U7MA 4N6JA 4HB1A 2VM3A 3ZL4H 4PB9L 1I8AA 4QRQB 1MRFH 4Q6YA 5FW7A 4YE0A 4B97A 3Q8FA 3T1FA 2AJUH 5D1QD 3S98A 2GJZB 5TH2B 4O4YL 5DMIL 3OV6A 4I6MC 1XGYH 3I75B 3OKNB 4B9ZA 4Q9RL 1H5BA 2CO2A 3L13A 4IS6A 4RSVA 4AWJC 2ZONA 4YXKL 3RHWF 4I88A 4JDVA 5FR3A 1LE5B 5GTIE 1J48A 4WUKL 2ZNWA 3WELA 4WEBL 2D2CC 2H2PD 2YPLE 3M9QA 3GO1H 1WAPA 1AIFA 3HI5H 2J73A 1VFOA 5G5DB 3IETA 2PPFA 2EVJA 3KS0H 3HI1B 1AXSA 3RK3E 1E5ZA 4DOHE 1W80A 5HHXH 3EFFA 4X9BA 5DJ0B 4X6CF 3UAEA 1A9EA 2WYIA 3E7JA 4JM2D 4X98B 5I8KH 4GMSH 3T6ZA 4FFYL 1KCWA 1I1YA 1USQA 4UTBH 5GZNA 3H1IE 4CMHB 3I9GH 5HI3C 3NN8A 1TJXA 5KBDA 4PJBB 3B56A 4XVSL 1AQDA 2AV7A 4AT6B 2JF1A 5ES4B 1EFXD 1FZKA 3QNYB 1M57D 4CVXA 1U4EA 3TN0A 3IYLW 4NBYB 2ZAHA 1EJFA 1YBKA 3IE9A 5LCVH 1RU9L 1MJUH 1SBSH 5DJDA 5KBKA 1PP9D 1AE6H 3WFHA 2FECI 4ZMOA 1EZVX 3II6A 2F54E 5E4AA 1CD9B 1DQLL 4PG2A 2N59A 3FHQA 2IPUG 2R2BA 4A7GA 1BMZA 3PABB 1D7BA 5D9SB 5F7EH 1RE4C 2KIKA 1UGKA 3P0YH 3ILEA 4H40A 1KCUH 1VRSA 4TUJA 5AWNH 3VXTA 3N04A 3KPLA 2QM7A 4TQIA 4POZC 4XOAA 5FLVA 1GYAA 2BXZA 3BCCJ 2FWOA 4FYQA 2PTTA 1N59B 4Z7VF 1IFJA 3DPDA 3E38A 3I6SA 3LZLA 3N5AA 3SKJL 2VMCA 1FZCB 1DDHB 2QZQA 5EU3A 1XTCC 3B8SA 4KRNA 5HGHA 3I50L 2P8PB 3TCLA 3EZ8A 1UHVA 3DOSA 3HLKA 5FHAH 4Z7OF 2NY7L 2VZVA 3H9SD 3X13B 5IM7B 1WBXA 1LO2H 4HFWA 5I8EA 2E74B 3GKWH 2P3YA 1UH4A 5DUBB 1JWMB 4AIEA 4F7TB 3EHBB 3N1GC 3RWEB 3HBZA 4KPHH 1CLZL 1KJVA 4EMZA 5J13B 1CDYA 2VAAB 3RVXD 5ETUA 4NSKA 2Y23A 1TQBB 4KJPC 4U1SA 3FJTA 5JYLA 1JHTB 1FL6B 1JGEA 2W6AA 1PQZA 1U8QB 3Q9QA 4KOCA 5BVPH 1IC1A 3ZDYF 1OWWA 1M56D 1PV3A 3SPIA 1X5XA 1LEKB 3I2CL 2HR3A 1GRWA 2XU6A 3MBWB 2ZXGA 4IBSA 1K8AQ 5APVA 4BZYA 3CH1A 1QSZA 4LGPB 2AJZA 1HWTC 4MQSB 4KI5D 4NZTH 1SJVA 2DQFA 4JQVA 2JWDA 4PJ5E 1NUNB 4A2DA 3G9VA 1NC2A 1NTDA 1UWEH 1E40A 2BOBB 3NPZB 2FLBT 5CF3A 2Y3AA 3EFGA 3K5RA 3PNRB 4LDCA 3VB9A 1D5XB 3OMIB 4PJ7E 5HDBB 1S5HA 3ULUC 1VQNP 3ARBD 3O3AA 4KTEL 5L9DH 5KSAD 5D1QA 4HV8B 1VKXA 3RBXA 3BW9A 1KD1Q 3ATFA 5DD3H 1P4UA 5EPMA 2ITDA 3U0PA 2HJKB 1OZHA 3V8OA 3W81A 3OZKA 4JFDD 4D9QD 5MHSE 4AXWB 3O2VH 1IFGA 43CAB 3HUSB 4HUWB 4GBXC 1KMIZ 4M3LA 2D7NA 5MENA 4RA0C 4PD4E 1TMQA 3PHOA 2PLTA 1SEBB 2PCXA 4X6DE 3USSA 1A8JH 1GGCL 1U58B 4NO0D 4RMBA 4CADA 2XICA 4OQTH 3C5SA 1SDDA 2IGFH 2XN1A 1WWWX 3LDBC 3NFPB 5A2KH 1AKJD 4S2SA 1XR9B 4ZFFB 5B66E 5HJGA 5CLYA 4JM2A 5AAWC 1DANT 1SOKA 1S7QA 4U1HA 2FGZA 5KYXB 5E6RB 1ED3B 2Z92B 3MRMA 3HRNA 4NZUH 5IOKA 5BQ7B 2X9WA 3EKCA 1EEYA 3PGCA 2CPSA 2ATPB 1KEGH 3CZJA 4FEMA 1JV5A 2WNWA 2WXQA 4Y4FB 3VRLE 1EFXA 3DGCR 3F7RA 4M8QA 2DD8L 4WW2F 1RE3C 5M94B 1IZJA 2LVCA 2VO5A 3SHSA 5KVMC 4U7JA 1BGYJ 4XOEA 4XNYL 1LNUA 4UILH 5CLTA 5DS8A 1N5YL 1EJ6A 1P84D 4PGBB 2HRPL 8FABA 2XY1A 3V5DB 3RVWD 3KLDA 1T0OA 3H6PA 3KXFD 1IT9L 4D6TE 1W2BO 3BT2H 4A7PA 4NEHB 2Q6WB 2OQQA 4IBYA 4UF7C 2CHXA 4MXVF 5EBWB 4M6OH 3OXRB 1E0OB 4QY8A 1C5CH 4EO5A 1KWKA 3S96B 2OBGA 3JV5A 4IRSB 4YO0A 3C8KA 3CGTA 4J8RA 1SBBA 4P5TD 4HF5L 4XHJC 3SDCD 2VXQH 4RH4A 3T77B 5JXAL 2OTLP 2DEWX 3EG9B 5HPOA 2Z34A 1MAKA 4X9YA 1IGIH 1SOXA 4KKCD 1X7QB 2B5IC 4IMKC 4R7VA 2X4RA 4YFDB 4FG6C 3VI3E 4WCYL 4E9TA 5C70A 2ESVB 4WHDA 4JY6A 1SFCD 1EDLA 1YJDC 2GJ6E 2EUWA 2OTPA 1N4XL 3O6FD 1JY2P 3QZPA 1TQWA 4GQZA 1YMMA 4JREB 4CGTA 3CX5I 2E59A 2OMTA 4EYYQ 1GTWA 4DVRL 3BHBB 3IFPB 2EIZA 3FOLA 1TTAA 3IDYC 3ABLB 3MJWA 4L9LB 4N2LA 3D39D 1BFOB 4XR8C 4HKBB 4PRPA 4DTGL 5DMYA 3S9DB 1IGJB 4BDVB 2Z4EA 2ZXDA 4OLYL 3VD5A 3ZZ1A 1U95B 2QFRA 3T09A 4MYPA 1Z9PA 1LO0L 3HR6A 2V2XB 4PCSA 4TULH 3DDGA 2W90A 1F58H 2A9NL 1VGEL 3TJPA 1AQKL 5B21A 4X6CB 3F6JA 1R4XA 3C8VA 3LHPL 3TBTB 1VQOP 4P99A 5I17A 1I9IL 1SF3A 2FYUJ 5DQJA 4YE4L 5K59F 2HT2D 3DVNA 3GJEB 3V6OC 5FYKU 3HB3D 2NW3A 3OSKA 5ITBH 4BFBD 1G7IB 4M1GH 3QDGD 4N0FA 2XUWA 4RAVA 4P57B 3B83A 4WHYG 1IK7A 1QL1A 3GHGC 2ZOKB 1KB5B 3QS3A 4PP2B 4KK9D 5TDNA 1SVFA 2AEOA 3ARBA 4GRLB 4JQXA 3SJVB 3PWJB 5KSAA 3O6KL 1RZIA 1CG9B 2UZXA 4N20A 1FC2C 1KWGA 1S7XA 4JFDA 5D5MF 3PAVA 1Q2NA 1FRGH 4OLVH 1QLEL 4ZMQA 3US9A 4MXWH 3PGFL 2YFOA 4JKWA 5E1AA 1B6UA 4JM0A 3AXHA 3VMZA 3VXNB 3WO4B 3QQ9D 5A3ID 3WGUB 3QJFB 4ABUA 2HLFD 2VZ3A 5BRQA 4U3XA 3VFUA 4YSCA 5DRXA 3MNVB 1ZSDB 5IFAH 3EFDH 2XX1A 3LQAH 1AANA 1EV2E 3UCQA 2GTQA 4F7CA 4M00A 4MKMA 3ARGB 4GAFB 4Z7UB 3CN2A 1IC7H 5E5LA 2KXPB 4IKJA 5EBMA 4F58L 2VMEA 2EXYD 1V55B 5KWYC 2ADJA 1Q0XH 3B34A 2XBDA 2ZWSA 3RA7L 2XWRA 2XA8H 4FNSA 4TNWK 5C0EA 3TEUA 3WUWB 3WIIH 3EJYC 4LLQB 3QXUA 3N1MC 2OYOA 4OI7A 4PJ9B 5F3BA 1JZ4A 1CTOA 3B2VL 3BQUC 3MOQA 2WSKA 3MCKA 4FTVE 1EK3A 2XPGA 5LAXB 3MYJA 1GJWA 3WFBL 4X4XA 3UYRH 2WIIB 2HYNA 5D2NA 4QRSA 1D7DA 1RIVH 4NXSA 3RZCA 1ZANH 3KPRE 4DJGA 3BCCD 1JNLH 1JRHI 2WXGA 1PGRB 4PIBA 5KVEH 3DO7B 2R8SH 3V5HA 4OAWA 1D2PA 1AYOA 2V2WB 1ETJA 3DJRA 4YZWA 1CXIA 3PYCA 4ZOAA 1NAMA 2VJXA 1FI8C 3N41F 2A7BA 3KXFA 1ET5A 3WS6A 1IEBB 1LK2B 1IE4A 3FU6A 4KRPD 1ACYH 1XZWA 1TFPA 3O2WL 5L0QB 1TZHA 3A3YB 5EU7E 4Y9EA 3QR0A 3L6FA 4BM7A 3CC5B 1DSFL 4K3JH 2BOCB 2Q1KA 4M61A 4HVBA 3Q43A 1HJ0A 1HEZA 4P5TA 3K6OA 3KHQA 3SDCA 4CVWA 4HQQH 2DYPD 3MCLH 3QWNA 3WMPA 2GTWB 1A2YA 1S3JA 2WVSA 3JSVC 4WGKA 4ILDA 4IYKA 5EO9A 1GZLA 4MMZC 6CGTA 1UOKA 1QRND 2CK0L 3Q2NA 1F00I 4BQ9A 2IH3B 4X5PA 1SFCA 3DOHA 3R0NA 1YEJL 4F2ME 3M0DC 5SX5K 3VP8A 2CKBA 3O6FA 3WUVA 4YXWH 1D5MB 5I1CH 5MEQA 4N78D 3HN3A 1AVOA 4A7GF 3IAPA 4NQQA 4NAJA 3MZWB 1T5WA 2BH0A 1QVGO 2DB8A 4JDEB 5HDQH 4CMMA 2BWIA 2HN7B 2BSSA 4PLOB 1PX8A 3UTSE 2IFFH 5D1ZA 4WFGE 3C75A 4LPWA 5CIPH 4D0BA 4N8VA 1INEL 3SPCA 4UT6A 2Z4TA 1XF2B 3QEHB 3F7LA 4NKMA 2FD6H 4NQEB 1KTDB 2PPAA 2XWTA 4QHKI 5AW2B 5I82A 1FGVH 1EH9A 2QGDA 4L4TB 4MCZA 3ZE0E 5DEGB 4KMQA 2OXHA 3COOA 3IF4A 5AVSB 5IMMA 4RX4D 5I71C 1AFOA 4NT6B 5FOBB 4WW2B 3WUTA 5IGXL 1BVNT 5FO8A 4AGOA 4BQ8A 2ICES 3UBGA 4ZDHA 3HC2A 3M8OH 5C3LD 1IMHC 5GXBB 1FVCA 1W15A 4C7NB 12E8L 2BSTA 1SP4A 2QGCA 2J12B 1HCZA 2EE2A 2C34A 3DTXA 3CK0H 2P8MA 1KPVB 3D4YA 1A4KA 1G9NC 4NN5B 4CN1A 2V3DA 4MNQB 5BRZD 5C0CE 1IM9D 1QFWM 2C1PA 2IG2H 2XVKA 3CFKB 5TK2A 4D7BA 1FNFA 4H8HA 3MLSH 4PV9B 4V1DB 3TV3H 4CUCA 3A6OA 1EZSA 3MLTA 4WVRA 1JGLL 1KLUB 1EQ7A 3PQYD 4JHZA 3KLAB 4E41B 3TJEH 3PFQA 5ENWB 1YNTA 1NAML 2BS9A 1AI1H 1KYOE 2J88H 4G8GE 1F11A 5E99H 2V17L 2YS4A 1QFWL 3TVMD 5KG9B 4Y7MA 4KVPA 1RK0A 2AXHA 2HG0A 2AXTH 2ENQA 1SJEB 3QEUB 1NO4A 1QSEB 5TQ2H 3T3PF 1S7WB 4WQOA 5C0AE 3W9DB 3KL0A 1GVIA 3TNMB 1PZ5B 1AO7E 2A4ZA 3HG1E 4FFVD 1UATA 3CMGA 4I7ZB 4QRRE 4HZ1A 4BZ1A 5JLZB 2CHDA 3QULB 3JWNG 2BVPA 4MJ2A 4LPTA 3JTSB 3WMQA 4NKDB 4XBMA 5BZWA 1GKOA 1I1FB 4M3HA 4IOIA 4PG2C 1MHEA 4Z3TA 1QLFA 5AVUB 3F7QA 4KZCA 4P3WA 5E5MB 3VA2C 3CVHA 2CKBL 3QZOA 3DX0A 2EIMB 1J8HE 2Y4SA 5AVYB 1J18A 4NC0B 1MJ8L 1U92A 3NJMA 4JE4B 4ZPVA 1EJOH 3IBEA 4PRDA 2AMGA 1V7NH 4JM2F 2R5BA 1Z9LA 4N25A 1PLCA 2GITB 4Y0GA 2JVUA 4HFUL 2W88A 3U46B 3L5WA 1MFAH 4JRFA 5DJ2B 2Y72A 4UT6L 1JZGA 2IAMB 4GIOA 4M6NL 4UQAA 5I9QB 4W9ZA 3DX8A 2N9YB 5I1HL 3QS2A 2QGBA 2VM4A 2Y1AA 4I9XA 2IPPA 5GSRA 1NU1D 3WHXA 1R5SA 5DFTA 3C6LD 5K9QG 2Z35A 4HKZH 1RY7B 1WAAA 2Y07H 25C8H 4ABVA 2OR8A 5TDPB 5J6HA 4S1DC 2Y7OA 4H0IA 1BFTA 5AW1B 4AQAA 5D5MB 4L37A 5E79E 4LP4A 3MBEC 2QMKA 4B9CA 4NC1C 4PJEB 5E1IA 3U7YL 3D25A 2FYUD 4ICWA 1GW3A 3L1OL 1YNLL 3FTVA 3QWOA 2X44D 2XC8A 2QBWA 5GZOA 1PVHA 3QUXB 3AXLA 1OMIA 2ZUQB 2ZUSA 4JHAL 4MHHG 1AH1A 3SGKC 3R8QA 1BJ1J 2VQ1A 4G70B 1C9SA 3VD7A 5JIPA 3FO2B 4ZW5A 3L1FA 3CCUP 4Y4HD 4A63A 1Z9NA 1RHHB 4KUZL 3VXSE 4L1BA 3UJIH 1I7TA 3FB5B 2VO8A 1FNLA 1I7UB 4W4OA 5CEZD 2OYIB 2GSIA 4MKTA 3VG0H 1QMUA 3KR3H 4AJWA 5K9KB 3D18B 3NP3A 4YEFA 3EFOA 4JCMA 3IK2A 4J3OG 4UV7L 4JY5L 1DJHA 4QRBA 1KBBA 5D6CB 3QNXA 5J4MA 5CCGC 4UUJB 2WNKA 4LMQI 1R5IA 5JIKA 3EDJA 5K5GB 3MOBL 4KRMB 4JFVA 4KXZI 5F6IC 3HC0B 1H5BB 3HFFA 3CSFA 4DKTA 2OI9C 5IVXB 1NOHA 3QH9A 2OMVA 4YPCA 1MKMA 1TYJA 3U30B 3TZVD 3WU2H 4W9KC 5BRZA 1IM9A 2NNXA 4BZ1L 3N41B 2R1YA 1Q81Q 1OM3L 1DD4A 1AXSB 5CM1A 5L2JA 5C86A 1HHIA 3QQXA 2XQYK 3PQYA 1A9EB 3BLPX 1RJZB 4P2RE 5EBLA 1L0ND 3GHEL 3UADA 4D3CL 5I1KL 1QO3A 1A7NL 2DLFH 1NGPH 3NJXA 5L2KE 1I1YB 4NFCA 3I6KA 2CK2A 4HKJA 2IEPA 5F9JA 4ALAC 3KLHD 1IBBA 1IEHA 4LVNB 2DH3A 1ZRTD 1AD9A 3ZE2E 1G4RA 3IDGA 3G5YB 1BPLB 3TVMA 1NANH 1AQDB 1P4BH 4FX5A 4DKEL 2AV7B 2OTWA 1NFDA 5EEVA 4MA8H 5FYJH 1WFNA 1XGQA 1S5LH 1F3JB 4CVXB 3TN0B 1ID2A 1T1XA 1T04B 1H89A 3HC3H 2QHRL 1YEGL 2J1ZA 1PLBA 1Y9BA 3QAZB 4N0UB 4ONFH 1WCBA 5DJDB 4MMXA 1XH0A 2ITEA 2PP9A 3ROOA 1ZOYC 4X4ZA 1G2CB 2WINB 1E4WL 3IGKA 4R4ND 2CGRH 5TISE 2IBZX 2R2BB 3R06A 1RZJL 3D85D 4OF7A 3FFDA 4JR9L 1E7UA 1QUNB 3KHOA 2FWUA 4WFEE 2YQGA 1Q8MA 1M05A 5DZOA 3TM6A 3KDMA 5CKGA 4GP8B 3UBXB 4WV1A 3VQLA 1T22A 1CD1A 1EEQA 4TUJB 5D7LB 3VXTB 2W5PA 1GZHC 2C5DC 3QXWA 4GYBA 1R24A 1OP9A 3KCPB 2PTTB 2YPKA 4U1IA 2X4QB 4Y5XA 1CFNB 1SQXJ 2ARJA 1GMIA 3GYRA 3V79C 1I7RA 5EU3B 1Y0LB 4PVMA 5CU5A 1JK9A 5GGUA 1VENA 5FX3A 2SODB 1O9ZA 2LLNA 3DOSB 2GPZA 1GJUA 3PHSA 4U1MB 5T33H 1WBXB 5I8EB 4ZMTA 4YBQD 5EO0A 5CJQH 4L5FL 3GNML 3AE5C 3HMWH 2KQNA 3L74D 4DP4X 4E2OA 3A6BL 4APQA 4BQCA 1KJVB 4FYTA 3P0VL 2BO0A 3BPLC 1MEXH 3N55A 2DMBA 4NYLA 2GUSA 3QWQB 1TG8A 2DM2A 5HYQA 1P4LA 5DT1L 2AXWA 1UD8A 2IAND 4F15B 1PQZB 4NO5A 4M5YH 1CBJA 1T2QH 3CLFL 3G6JA 3KGTA 2YUWA 1EA9C 1O7VA 1VF5B 3JTTA 4QOKB 1HCYA 3ZE1B 5ID1A 3FUDA 2QLYA 4MCNA 4DKAA 4KFMA 1GSKA 3C2AH 3FO1A 1LT9C 1W91A 2EDLA 2VDKL 4YHYB 3QDME 5J57B 4TTDC 3CCHA 2RCSH 4JFWA 3DJTA 4RZKA 4TSBL 4ETQA 1M7IB 4Y4HA 3B5NA 1T03H 5D7SL 2AMUA 1T4WA 2KL6A 2G0KA 3HLAA 2HFFA 4QTHB 3VG9B 4JYBA 5TE7L 2PCPA 4YHIA 2WQXA 3RWJA 3MA9H 3G6DH 4H20H 3ZLQC 1F5WA 3T3PB 1E4XL 2R4SH 4JB9L 1YYML 4KJYA 2W0FA 4UIMB 1MFZA 3O3AB 3KQGA 1MFEH 2ZVOB 3MOAL 3EW3B 5D1QB 3Q1MA 1UD5A 2NT1A 4WHCA 4JZJB 1VQ8P 3VQ2C 4AKOA 3LEXA 1EDHA 1BQHA 2ITDB 4WUUD 4JRYE 5D96C 3WSQL 4C58B 1JZ5A 1RP9A 4P5RA 1I1AD 1JGDB 4KAQH 4F92B 2VQUA 3DI3B 1J1PL 2DIBA 4ORGA 3AG3B 5SWSE 3O8ZA 3PHOB 3TZVA 2FUQA 2IPUK 2QVIA 4FXGC 4UB8E 1B2YA 1DBAH 1QEWA 3HAEH 4CADB 5HYSG 5KTBA 1E8XA 3T1WA 3MXVL 2KZWA 1O5PA 4F8QA 3QXDA 4JJ5B 2HKHH 5G4NA 1X9LA 1S2EA 5KSBA 4UM8B 3CXFA 1NCBH 3UTPD 1MPAH 4XP1H 2KLRA 4JM2B 5C09D 4C55A 2P28B 1MCJA 1S7QB 4JPWH 2IDFA 2AV1A 3MRMB 5LDUA 3A0HH 4A7QA 2DQHL 5GS0H 1WTLA 3SYQA 5CCHC 2FDBP 4OIFA 1XCQA 4N5ED 5FYLH 5LJYH 1GY1A 1F8TH 3L5XH 3FTGA 1MCQA 4XPHL 1T2KC 5AVQB 2IPTL 3DBXA 1EFXB 3GTNA 4EKJA 1M57B 1G5GA 3L9BA 3MLXH 4V33A 4X4YA 4P0DA 1CGWA 1N19A 1N8OE 4NOFA 1L4AD 1IM3B 2ATKA 3RKPA 2EDEA 3V2NA 2XN2A 2BIMA 2YPVA 1LNUB 3FC8A 3EOBA 4XB8A 3VX0A 3MGTA 5E0FA 8FABB 4XN5A 3MRDA 5CN2A 4WY4D 3RZCC 2BW5A 1F4HA 2H6PB 2WCGA 4Y16C 2G2RB 1IE5A 1VQLP 1BQSA 3VH8A 1H3PL 1F1AA 1IKFH 2KQMA 4XP6L 5C0RH 3LXAA 1JN6A 3QUKA 4TVPD 4JHVA 3Q05A 4K9EL 1IO4C 3VTPC 4I9WD 2CR6A 1YNTF 1J12A 1U3NA 1F90L 3DO4A 4AQEB 1LD9A 4YO0B 3L35A 3C8KB 4J8RB 2X2IA 1S7RA 1YQVH 2WAHA 2NLJA 3BKCL 1LO3H 1UCBL 4JPIA 3VFTB 3LAFA 4AG4L 1AD0A 2P5WD 1AQHA 3CX5K 4N0CC 1NM4A 5C0FB 2N1TC 3LJ3A 3E8UH 1QZ1A 3H9SB 1E9OA 2X4RB 3W0WD 4P07A 4KMLB 3NIFB 3L75J 1OQXA 2O1AA 4EPSA 4DGIL 4PJDB 2PABA 3MV7E 5CEZL 4LPVA 1BGXL 4GQQA 4YN3A 4B96A 2OMTB 4XMLL 3GIZH 1QABA 3S34L 2F54D 2BC4A 4OF3A 1N0XH 1CF8H 2E76D 5D7IB 1WCQA 2IANA 3CD6P 1BVOA 4KJMA 2QPUA 1PZQA 2V5TA 3PG2A 3PL6C 4PBWD 2Y0EA 4PYGA 2WXHA 5AVZB 3S8GB 4MD4B 1M56B 4MX7B 3ABKB 3CMAP 5FV1L 2BY2A 3WUZA 2YEQA 3O3DA 2Z9TA 2DIJA 1ZLEA 1FAVA 1I8KA 2VTFA 3ULAB 3IR9A 4LSUL 3UEZA 1HZHH 1QD0A 5JUEL 3UTTD 5I17B 3D69B 3L4UA 5LHDA 4XPTL 3MBXL 1LWUB 5DQJB 2X7LA 3EZJB 1KILC 5ISZD 2QSQA 1NTMJ 4JFYB 3Q2WA 4YDVB 5L6YL 4OZFA 4CSTA 4YSAA 4N0FB 4EF3A 4RAVB 5INDA 5T3XD 3CN4A 4U49A 3IVKA 3Q6GL 4ESKA 3FCGA 3LEYH 4R9HA 1FU1A 3N0AA 5TDNB 3ARBB 2H4EA 4S1RL 4QKXB 1UOVA 1U8HB 3SOBH 2YRBA 5KSAB 1H3TA 4PW4A 4ZKUA 5F7YC 5C6PB 4AYCA 5JQIB 4AL8H 2MNJB 4WUUA 2FSDA 4JQ0D 4JFDB 5DC9B 1I1AA 1HH6A 3AE6C 2BFGA 4EBQH 5T1MA 1JOCA 4K35A 1XEDA 4DF9A 2VDMH 2BNRD 2EQDA 5IIEA 1TJMA 2YN3A 5E1AB 3L3KB 5C0JA 1XBRA 4NO0B 1OK8A 2QZ5A 5KJ7C 4A37A 3WFCH 4MNGE 2ZYAA 3FDWA 4JMXA 2JKVA 3VFUB 1P5VA 2D73A 1OF2B 3CMOH 4HIJB 1AKJB 4R7NB 2BZ7A 7TAAA 3VFOB 2BY3A 3H9YA 4TNEA 2R4RL 4ZX5A 4F7CB 3ARFC 1FLRL 3BZDA 1YJ9P 1GR7A 1G7JB 3HNTL 5C09A 3TWYA 4D7PA 4ASWA 1L3NA 2YSSA 3LPFA 5EBMB 5L8KB 5E8PB 4LCWE 4QRFA 3ZZLA 5CKAA 5BW7A 2I60L 2YD1A 1D7CA 1JXJA 1NBVL 4QJ5B 5C0EB 1MOEA 2GABA 1OTUC 2VXVL 4Z8FH 4MD5A 5IWLA 1L6ZA 2JKWA 1OXZA 3KWWB 2ZXQA 5F3BB 2DMCA 1LTSC 2LLLA 5C08B 1WFJA 3KM2A 4K7PL 5MEOA 4FG6D 3MCKB 4OLXH 2QVAA 4WY7H 3FUEA 2WCSA 2BCCJ 1P1ZA 2XPGB 1L4AA 2Q3ZA 1QBAA 1ZV5A 4ZTPH 3P8CE 2YD2A 5D2NB 1LHZA 3QPQD 5BPPA 4ELMB 2DQEH 5GGSA 5MHSD 1NCWL 2WSPA 3CZKA 3M45A 3V5HB 4OAWB 2ZFCA 1NIBA 2ZX9A 2D3VA 4PD4D 1NCTA 4KI1A 5I18L 5A6LA 3KXFB 1YUKB 1MHPH 2YPLA 2C9LY 2KNCB 1QBMH 4YZFF 3V0HA 5KVEE 3ZTCC 1TZHB 4ZUTA 4GFXA 1CXHA 1R5VA 4ZMDA 2IALA 2GA1A 4ENED 1ROCA 4M61B 3AMLA 4P5TB 1HEZB 2B3IA 3HMXA 3SDCB 2C9UA 2WSEJ 2SPZA 2BJML 2ITFA 3FYIB 1MHCB 5I5MA 5E2WH 3IKCA 1NFDF 3BDYL 1QPKA 5EO9B 3W0WA 5J5EA 3AABA 3TBBA 4J3SA 2AEFA 1T20A 1T3FB 3OKLB 4WNJA 2BWDA 1RF0A 1SFCB 1RULL 2NX5E 3US0A 1UEMA 3O6FB 2JB5H 3SCMA 1GOGA 3BSGA 4LSPL 5BZXA 1HBWA 4YSRA 3O11B 4QT5B 2LU7A 4V11A 3WNMA 1HS6A 4N28A 5I1IH 1G1YA 1M42A 2D0GA 2IMNA 2PW1A 2F54A 1KCSH 4GNKB 1JPSH 1T5WB 3D39B 3ZOAA 5B3JE 3NPSC 4CMMB 5E8EA 2BSSB 2F74A 3GDBA 4ZS7L 1NCIA 1BVZA 2KBGA 2VLJD 3GMOA 3RL1A 4F8LA 3T97A 3MP7B 5GS2H 3QWOC 1HYRC 1BD2E 1JRHH 3QPXH 5GZOC 4I5BA 3BQVA 3OKYA 4JKMA 2MMXA 4D0BB 3HBPA 2EEAA 3GSUB 4OVUA 3QQ4B 3EOTH 3UTTA 2FATL 2HFGL 2P44B 2C9AA 3QEGH 4NKMB 2WLNA 2OJZL 3HD7A 1BXXA 3AREA 4YSOA 1FUNA 3VWKD 4QLRA 2EABA 3HB3B 5FCUH 5ISZA 1FL5B 5FA3A 2OMUA 4QIRA 5JORA 3VD4A 2QPDB 4RMVA 2OXHB 3QDGB 5FGCE 2F7PA 2A4CA 4EIJA 2DQCL 2FQDA 2UY7A 3A24A 3P1VA 2NY2C 3QB7C 4BSVA 1B0GA 4TRPL 5I0WA 4GW1B 1SQVK 4IL6E 5GTHE 1XGTB 3BWAA 2CBPA 5CZXC 3NIGB 4FD0A 4BKTC 4X8XA 4NN6B 2P8MB 4DAGH 5JNYA 1A4KB 4ZZFA 2CJUL 4HBCH 3RX9A 5BMFL 5EU6D 1KTKE 3HFMH 4JCWA 5IEKB 1SQQG 2XWBA 3F85A 1RK7A 1USZA 2C1PB 4LSVH 4M7LT 3C2SA 3G6JF 1AHWB 3GJFA 2FLRT 1L2PA 1RVFH 1BQLL 1U2HA 4G2AA 1FORH 3F7YB 1IB5A 3MLTB 4J3TA 5DWUL 2BSED 1RUAL 1NL0H 3CNKA 3QUZD 4HJ0D 1WBZA 4HJUA 5AFAA 4G6FD 2HFED 2QSIA 1TJIL 3CX2A 5TDOA 3OG6B 1AZRA 1YNTB 1AJ7L 3O6MH 3F6IA 1G1IA 2DTMH 2NDGA 2OJ1A 4FQLH 4PJ5A 5DFWH 3M7FB 1MQKL 4TVPL 4IDLA 4X4KA 5D8JL 1SLVA 2EZ0D 2BVQB 1VERA 1M2OA 4XWGH 4BWUA 2EACA 1OZUA 4L74A 1BXVA 3HMXL 4YDIL 4PJ7A 3RGVD 5KEZA 4CN6A 3KPMA 3HI6L 1EZVD 2BVPB 4MMXC 4PGZA 3W5MA 3ZDMA 4BE6A 3GQFA 3BKJL 5BZWB 3VSTA 1KC8Q 1IAIL 4FQ2L 1G7LB 1G9HA 3ILPB 4AEIH 4FZ8H 3OB0K 3NIDF 1DZBA 1F6FB 1OAXL 4ODBD 1YHPA 4X6DA 2QT6A 3M1BB 4DW2H 2CRYA 3M7OA 5J7CC 5KSBF 1E9PA 3AVEA 4IKKA 4KRPB 4ZPVB 3E6HA 3WXWH 2PP8A 5LXGL 1U3JA 2DQIH 2ZUUA 2DEYX 4YL9A 3L75D 1NBYA 2I25N 2DKSA 4IOSA 4JHWL 1P5UA 3CZEA 2ICWA 2YA0A 3JUYA 1FNSL 3L5WB 4IIZA 3RWFB 3VUAA 1TPXC 3UP1A 2ZG3A 1KTLA 1MCKA 3LW5H 4OH8B 2X0UA 2UXGA 2DYPB 2X9XA 3CFDA 5FM5M 4ZTEA 1MQ8A 4U2YA 4QYAA 3DX8B 4IFMA 5B39A 4X6BA 1COBA 2BDNH 4H8WL 4Y5VC 5FK9A 3RNKB 3MYZA 1QRNB 1M1XB 3P9MA 3KLQA 1CLVA 1EDIA 2Z35B 1ODUA 3BOVA 4RFNB 2YR3A 1W0WA 1TSHA 2AGJH 5T3XL 4APQC 2YA2A 4HCGA 3V6FA 4JFPA 4JNXA 3MJ8A 3M1OA 4XCFL 5KANI 3L71D 1DQJB 3GBLA 5E6SB 4HLEA 3MTUE 1AMYA 1KV4A 2ZYRA 4K9EC 4LAJH 4N2CA 7PAZA 2H7WA 3MUGA 1DQDL 1BHGA 2X6MA 1NTMD 2Y1ZA 4S0HA 3WTUA 3BP4B 1EHXA 1L6XA 1DEBA 1N7MH 2VQ1B 3FSWA 4GKSA 5FKAA 5MP6H 3SOTA 5HVFB 2IGTA 4KK6C 1JPTL 1FH5L 2PRRA 4WAFA 3LXUX 1F41A 3BLKA 1BCCG 1IAKB 3VWKA 2VSCA 3ZY7A 1I7TB 5IB5A 15C8L 3FZUC 1A1MB 3PP4L 3GMQA 3S8WA 4ZUSB 1MJ7L 3WNKA 2B9AA 1VEMA 2WY3B 1JZ3A 1XT5A 1HJBA 2LGNA 4KVCH 5F8QC 3BKMH 3EFOB 5CR8A 5F72S 5GHWH 2Q10A 3CFIC 3WNNA 1NOAA 3K2MC 3MNDA 3NH7H 5DD6B 5JTWA 2W6JH 3CHRA 3VI3A 2PR4L 1R5IB 3UTQA 3SPHA 4D9RD 2VLKE 2GJ6A 3IPEA 2HT4D 1O6SA 3IEAA 2WB7A 3IJ8A 3FT9A 2WUBH 3QT2A 2OMVB 5EB9A 1X4YA 4ES8A 4QI3A 2N01B 1KLFA 2UZIL 3FRPG 4ZT1A 1WT5A 2ADGA 3HEIB 5BRZB 3KVDD 1IM9B 2RJMA 4RDQF 1MI5E 3BPOC 5C0GA 1TTGA 4LBAA 2R1YB 3GDCA 3C5ZC 4F37K 1CFQA 4QEGA 2FX7H 1N26A 2ALAA 4B9FA 3TCTA 4BHUA 1OB1A 5L2JB 3TGUJ 3L70J 1CICC 1HHIB 3AMKA 2BSEA 4DP1X 2C7UA 3PQYB 1SS1A 3QUZA 4U3CA 1N12A 5EBLB 3JWDC 1LP9F 4JX0A 3T8XA 1QO3B 4GXVL 3FH8A 5T5NF 3S88H 1JGUH 4ANKA 5EU4B 4LCIH 1URQA 3HKFA 5F44A 1FZJA 3RUGE 2FX8H 1AD9B 1IC4L 3IDGB 4N2KA 3B4SA 3TVMB 3A22A 5IEHA 4TSCL 1A3RL 2Q7YA 3D0VA 1KENL 1J0IA 3KGUA 3PWNA 2O61A 1GC1H 2OFQA 4LZKA 1SEQL 3EUDA 5GQBA 3SPVA 3U36A 2ZP9A 1RHZB 1DVTA 3RGVA 1WCBB 1IFHL 3QIUB 2GJJA 1KFAL 3GMMB 4RMRA 1UTDA 3NTCH 2H9GA 4CU8A 2B0SH 1WEJH 5DJYA 5FYJE 4YX2H 4H4NA 1CDHA 4IRJD 3FFDB 5DSCA 5HI4D 4CVZA 4I77H 4J3UA 1PJ9A 1SJHB 3VXMD 4KXZH 4XVUD 3FU7A 1W8OA 5CZVH 4OCXL 5C0CD 1PSKH 1T22B 3FONA 5H4YA 1UKTA 3SQRA 4H2AA 4DZOA 1DQQA 2YPKB 2ZKWA 5GGRB 3ETSA 5I74C 2PYEE 4Y5XB 2VWEC 2MNUA 2ARJB 4NNPH 4XWOC 3CFCH 4ODSL 3WJJA 1JK9B 1A6ZB 5GGUB 2OSWA 2XN9D 3KMDA 1A9BB 5FYKD 5GIRB 1F3DH 1L9MA 2XZAL 5F7BA 5EA0H 4KKAD 2HSIA 2CM6A 1UGNA 1ZJAA 1S7UB 5FUZH 1HWHB 4WHTA 2A0LC 1L3WA 3DIFA 3FUHA 4GI8A 2AQQA 1CXKA 3C6LB 4PJHB 4QXWA 3H1JJ 5CCGD 3QQ3A 3RL2A 1AO7D 3WIFB 1R3IH 4K9JA 2F53E 2A6DB 1DHKA 2QQLH 1A21A 1YY8A 3C6SA 5HYQB 5DJ8A 4KU1A 1JFQL 2D7TL 2ORBH 4N2IA 5GRUH 3T4AB 4DSYA 1MCHA 1CWVA 1GPOH 2X88A 3G6JB 5I19L 3P7KA 3FB6A 1BA9A 3O2DH 1Z5HA 3OX8B 4M4RA 2XKSA 3NSJA 5T1LA 2XN0A 3U1SH 1SRDA 3PLNA 4YTPC 1T89A 2I9TA 2HX7A 1JPGA 3WV0A 1GW0A 4FQIH 5BO1H 5D1XE 4MJHA 2DQGL 2DMHA 1BAFH 3CCHB 4PRBB 1XF4B 5F71A 2UUDH 4ETQB 3VXPA 1ADQA 4MZ3A 4N2OA 2B77A 5AD0B 5AZEH 2BNUB 3HLAB 4MJ4A 2WVRA 2PCPB 1FE8H 1SYSA 5IB1B 1RZFL 3VU1A 3KG5A 4IBLT 4KJYB 2M0BA 4Y2DD 2W0FB 2AABL 2Z65C 5BXFB 2PTUA 3CCVP 3GI8H 3VXUD 3JSSA 3NSDA 2MFNA 4P2CG 4TUUA 3ZX1A 3K2UL 4K3GA 1BQHB 3X11B 1JEKA 4F2MA 4XZ4A 4XPFH 5ABAA 3MUUA 2CUMA 3FN9A 4GAYA 4ORGB 4OGAD 4KQ4H 3U59A 1CI6A 2UV3A 3HG3A 4Y99C 3RVUD 1H6UA 4CC0A 1IL1B 1QEWB 3FU9A 3WNOA 1JUFB 1GZQA 3SBQA 4ZMLA 3H25A 1KBWA 3UPCA 1SQBG 1ZR2A 3QXDB 3SBRA 5KSBB 4L8CA 1DBJL 3GXMA 5CLXA 1WZ1L 3HE7A 3TYGH 2K0RA 3RIAK 1LO5A 4DH2A 3KBFA 5D2LB 3ZKMD 4YK4C 2IFMA 4UINL 4QCIB 1URLA 1WK0A 5MERA 1Q7YQ 2OYHB 1AGDA 1T0NA 2GTZB 4AEEA 5C2BL 2R0ZH 1IIIA 1O9VA 3IBOA 4FQXC 1ZA6A 2KH2B 3DBXB 3LH2L 1E4JA 3PREA 4OZGE 4JFTA 1TKWA 3G5XB 3A0HE 3WN6A 4X4YB 4RRPA 2ATKB 2F8XC 2EIJB 1YNKH 3EOBB 4E9WA 3MGTB 3MRDB 3RDTC 3D85B 4IRJA 2DWDA 5D7EA 2XZCH 3QORC 4QHLA 4NWTL 3B8YA 5I73C 5C0CA 2WBJC 1IGCH 2D31A 3H1LJ 1N3NA 4ZD3H 2H32A 3VH8B 1H0TA 1MCPL 3OKDB 3RPIB 1KN4H 4XN9A 4F8PA 3AEBC 4WLCA 4GO9A 1RZGA 2FJHA 5C0ND 1AHMA 3QJHA 4ZNEE 3RK3C 1XAKA 3G9RA 1LD9B 2XKNA 4AM0Q 4TTDD 4A2GA 4JPIB 2NLJB 1ZAGA 3K3QA 5EO1A 2POHA 4ZOCA 2XN9A 1NCNA 3HTKA 4BH8A 4EXPX 2DQTL 3BD3A 5HHOD 1V5JA 1ADQL 4RAUA 1IC0A 4MA3B 1BYOA 2VABA 4CBPA 1P84I 4WI9A 4PJ7F 1MW3A 5C0AA 2JJSC 5KZCD 3L3JA 3MNWA 4WGVB 1AO7A 3HG1A 3BD5A 2CA3A 3SCMC 4U33A 4QRRA 1Z5LB 3KGSA 4LEBA 4JANA 5D6DA 1D6VL 1ZY9A 2YIHA 4PJ6A 2PNDA 2TAAA 2J72A 2BK8A 5IESH 1NGYA 4Z3IA 3IMWA 2IANB 3VGDA 5A43C 2KHAA 2NUPA 2OGUA 2Q7NA 1E8YA 4PI2A 1ZOXA 4X6DF 2XWXA 4KO6A 2F1BA 4NUMA 3O3DB 1J8HA 3FF7A 3LIEA 1I8KB 4U0QB 4XX5A 3STZA 4KTGA 4DPAX 1SQPJ 2CBOA 3L4ZA 4FS0A 5AKRA 1MVUA 5K69A 3B9KD 1CZQA 2APTA 1WWAX 4FN0A 1HZKA 2HWZH 1W0VA 1VB9A 1ZKAA 1R47A 3K81A 3T6WA 3HD7C 4ZTOH 3VE0B 2A06D 4QXUH 1H6FA 4NJAH 4OZFB 3X14A 5GRXG 1QSFE 1ZS8B 1PLAA 3PY9A 5TPWH 1BG1A 2GIMA 4PG9A 2BIHA 4C83A 3EGXA 1A02N 1SNRA 4OD2B 4Q9BA 2Y0DA 1KOAA 2QADD 3VRLF 4CNIA 4QTIL 5EIIB 4AW7A 5L88L 2K3TA 4QRUA 3SE3C 3VXUA 5CGBA 2OYMA 5E8DH 1VJSA 2R1XA 3HUJB 4R3SA 2X42A 4WUUB 3TNNA 3L70D 5DQ9B 1X5LA 4AC4A 1I1AB 3QGVA 1GHFL 4F8OA 2CRMA 4LOEA 5D1ZI 4LCUB 5CBEA 2BHZA 2MTAA 5IIEB 5C0JB 3CXHD 2GUVA 4LASH 1TTBA 2OCCB 2X4NB 2BP3A 4XNMB 2UYLB 3DXAD 5JHBA 2JCCE 2YC1A 5KKZC 2A9ML 1LTJC 2GEQA 3FB8A 2W07B 1G6RA 2R15A 4JO3L 5ADPH 4FFZA 3CL3D 5C09B 3MUDA 2CLVB 1CBVH 2YSSB 2I07A 2A6JB 4FFWD 3CX5E 3SSUA 4LOUD 1T5KA 5APTA 1WFUA 3GUTA 3E6FA 2QJPC 4PGCB 2YD0A 3D3VE 5LG6A 2E9IA 3Q8CA 4IMLA 2BEQD 1CGXA 4MD5B 4P23C 3SDAC 4O5LL 5AW7B 5BU8B 2IDUA 3E2HB 3GK8H 2XV2A 2RKLA 5MEOB 3BISA 1BBJB 2VDOL 1YJDH 4JPKL 1LK3L 3CZUB 3VI3F 5EN3A 3OAYH 4HGKC 3QW9A 5LGKA 1L4AB 1W16A 3CU1A 3P2BA 5FYKL 1CL7L 1ZEAH 3WGVB 3MUY1 4A2MA 4S1QH 4JRYD 4L3CB 4XMPL 1A5FL 5GGSB 4WY4B 3HE4A 2DM7A 2MCPL 3TBYA 2QEXP 1ILUA 1A64A 3FQXA 4F7PB 4XFJA 4OCSH 2AQSA 3R4YA 5HPMA 4G8IA 4XNUH 1QZNA 4P05A 4POYA 2Q2LA 1KIRA 3SPJA 4DOHB 4ENZA 3ZBMA 1R5VB 3N43F 2F0CA 3BRDA 1IQWL 1RZKL 3BYTA 4P2RA 2VDNH 1ZLWK 3C5JA 1R3HA 4YAQA 3H1JD 1A6WH 1DTUA 3EOAA 2P5WB 3JWOH 4Q9QL 2ZIDA 4XNQB 4QR7A 2ZCHL 3IKCB 1H8LA 3ABZA 1R1CA 2IYOA 1BREA 5DD0L 4U3FE 3M9BA 4OB5H 4R0LA 4ANVA 3W0WB 1WAEA 1J7VR 3ZIMA 2B89A 4L75A 2K7QA 3HS9A 4YGAB 1T20B 1KB9K 4ZFQA 1D7FA 4ZMWA 1HFUA 3MGNA 1TVBA 5JHDD 3HCVA 4MQTB 4N9GA 3AT9A 5I66A 1NJIQ 3RWDA 4IBQA 1BGYG 4HIXL 3EYQD 1FYHB 4GINA 2JSFA 2VC2L 3CSYB 2PW1B 2F54B 3CDGA 1QW8A 3BPNB 3K2IA 2E76B 5E8EB 2F74B 2VUKA 2ZZUT 3S4SB 4KK8D 1VIWA 1LMKA 1IU1A 2CR0A 2G3NA 3GMOB 4FQJL 4EZKA 1NKRA 5JA9A 2LU3A 3QIBA 1D5IL 2A74B 1BQRA 1ULVA 4HIPA 3L72G 5KLIC 3UTTB 1OB0A 3WU1A 3ARFD 2WLHA 3B9KA 4AVKA 5ISZB 4H2CA 4LBEB 1ZLDA 5FA3B 5JORB 2OMUB 2ODHA 2EDXA 4QHNA 3VGAC 2BNQD 3GSOB 4XTRD 3WY2A 2WSCH 1G6RL 4EI2A 2XHNA 4O4YH 4FFZL 2UY7B 5DMIH 4Q9RH 1BSHA 2DQDL 3FULA 4XA4A 4P5KA 4HJGB 4KUCD 3X3GL 1KYUA 3V4UL 3UJJL 1S3KL 5AVRB 2I32A 3ULVD 1MCWW 3BKYL 3GPSA 5IQNA 1GTNA 1X5AA 3BWAB 4JHBA 4WEBH 4EUPA 4GAGL 4LKXB 2FGWL 4JFFE 3MZTA 4BFIA 1DEEA 3AITA 2YLHA 2ZYHA 1WA0X 1JV2A 3B2MA 3VD1A 3JCUE 4DN3L 5A2BA 2BNRB 4ZW6A 3GJFB 2IV8A 2R9HD 5IMOA 4FFYH 2ZWYA 2DRUA 5KTEH 1CPUA 4WKZA 5FO2A 3SDDD 3QYNA 4Z7WA 1ZS2A 3U4AA 1FN4A 5F7DB 4IIQC 3HNSL 3OKKA 4G1MB 5DRZB 4XVSH 1M1JB 2HCZX 3H56A 1LE9B 1LDPL 3CUPB 4PJ8D 2YD9A 2ZXEB 3D12B 3ZR6A 1AR1D 3VMNA 3X1EA 3AQDA 5I1EL 1RU9H 1JYWA 3CLEL 3RJQB 3CPWO 4L4VE 2YRZA 4MAUL 3K80A 1DQLH 3ELQA 1FDLL 1OP3K 3X12A 4PJ7B 1SN0A 2E4TA 2FLMA 3F12A 3D51A 5EUOE 3KPMB 4TF4A 3GBNL 1OD7A 5HP5A 1B6DA 4W4NA 1JVOA 1UCTA 4B9IA 2IBZD 2FYYA 1NTKE 4JRYA 5CAYB 4GG6E 4GG8A 3P4OB 1AOHA 4EI6A 1IBYA 2WIMA 2Z7ZA 2FHBA 4EOTA 3SKJH 3FTSA 4TNVK 1FE6A 2DI7A 3WNLA 2F68X 4LDOB 1E4XI 3RU8L 3KEHA 4UB6E 2ZXCA 3RY5A 3I50H 3PP3H 3QNZB 1J5OL 5FDWA 2NY7H 1XDTT 3MJ7B 5D70L 3WIHA 1P5UB 4DEPC 1A6AA 1KTLB 1SY6A 3QFJE 2YKLL 4JM4L 3CFDB 3T0EE 2CO1A 3ZT7A 1SQVE 1KN2L 4DVBA 3ZE0F 5B39B 4W7ZA 1CLZH 5J3HD 4M8VA 1UUNA 1P7QD 3N4XA 3LZFL 3P9MB 2IH1A 2JB6A 2APXA 3FK3A 4K5LA 3QG6B 4W9LC 1X0TA 2XIDA 5E2TH 3WFEL 1W0WB 2MCG1 5F1IA 3PRZA 4OFKA 3FCUB 3LNDA 4ETYA 1ZT4A 2E75C 4PV1D 2CIKA 5DZPA 4N90E 3I2CH 3MJ8B 2K3RA 2ZWNA 4O58L 3D2UA 3A4FA 4FLQA 4N8UA 1SQQK 2VLJB 3MUGB 4LFHD 1KQFB 5GSVA 3V0DA 4MTMA 3MLZL 5FKAB 4C54A 1OP3H 3AE8C 1FG2A 4KXDA 3FF8A 3RNQA 3VWKB 2C8NA 3S5LA 3ZMRA 4YHNB 5EU7C 1YJWP 5IB5B 3H42L 4KTEH 4PP1D 5TGBB 4DP8X 2SEBA 1FZMB 2QSVA 3MRBA 5TF1L 3K6FA 3V4VA 2FSEB 4I89A 5I1GL 1JDAA 3B9EA 3DO3A 4YMPA 3NJHA 3VI3B 2NCMA 5D7KE 4E9SA 1TO4A 3Q5OA 2EEFA 3MV7A 4A1RA 4PPTA 3OF6A 4PJBE 3VGEA 1JMXA 1GGCH 4FYRA 5H2BB 3EYOB 1B4TA 1EUUA 2RA1A 3PAYA 4IHOB 5EU6B 2YXMA 4Z7NB 4YLQT 2MCAA 3KPEA 3NJKA 2HMID 4JGJA 4M02A 4NPDA 1IFIA 2WTRA 2X87A 4U7KA 2NPSD 1TJHL 3OKEA 1OB1B 4UQ2B 2M1KA 3I3BA 4X99A 3SDDA 2J56A 4QJ3B 2BVOB 2C7UB 3QUZB 2J1WA 3DV4A 5E6ID 5K9JL 4G6FB 2HFEB 4PCTA 3T8XB 1BEYL 2XTJC 3N43B 1TSRA 1YUHB 4PJ8A 4DQOL 1FZJB 3MRQB 2DD8H 1K6QL 3LS5L 3ZZSA 2QJKB 3HVDA 3QSKB 5FB8B 5IEHB 1AZZC 3TIDA 3D0VB 2Q7YB 2O61B 4XNYH 1EVTC 1N5YH 3QHFL 3NA9L 4N2HA 3WIHL 3U36B 2HRPH 1OW0C 4HETA 1INDL 1U2CA 1SY6L 2B1OA 3RGVB 4HLJA 1IAMA 3DGGA 2NY5C 3GBEA 2BASA 2WLYA 4L8BA 3GF3A 4GH7B 4D8OA 4YWGL 4BEIA 1UXMA 1IT9H 4G83A 4F8TA 2KYVA 3H1IJ 4P2YA 1OW6A 2CH8A 2N4IA 2HYMA 3BYYA 3FL7A 4AJVA 1K4CA 4FKEA 2R0KL 1ZVSA 1ZTXE 3FONB 5DR5L 3R7QA 3VXRD 4JGMA 4F5CE 1ZIAA 3S7GA 3L4CA 2X05A 3CN1A 4MNGA 4HF5H 2NTFB 4JL2A 1DQQB 2H1PL 4CPGA 3MR9B 5JXAH 4LMQE 1A4CA 1YMHB 4U6XA 3K7UA 3Q1EA 2PETA 1D5BA 4FQQB 1AKPA 4IKLA 4JO5A 4WCYH 1XTLA 4UILL 1U0QA 5ECJE 1IBFA 4WI5A 1N4XH 2VDQL 1MVFA 4R96B 3SKNA 5BZDA 1RUML 4DVRH 1FNAA 3PPEA 3P77B 1P7QA 5I2IB 4DTGH 1T1YB 3RL2B 3IDJA 1DVYA 2ROYA 3QQ3B 3V4VL 1SXNA 3KVPA 1X5KA 1YYLL 4R97B 2WVVA 3HVNA 1LO0H 2BP8B 3C6SB 1FJPA 2DJSA 1URIA 1BE3E 2EADA 5DJ8B 3RL0C 1V8HA 2A9NH 3L48A 5D6DC 1HVXA 1AQKH 3IXAB 3M17B 2QKSA 3GRGA 3LHPH 5A16A 1I9IH 2OX5A 5B1JA 4M4RB 1RZKC 4YE4H 3K46A 5EZJA 4W1TA 3BZEA 3X1BA 4GJTB 3EJZD 2I9TB 4PVBA 1JPGB 2L8AA 1CICD 2ZSWA 3NSXA 4KJWD 1H3GA 3ILQC 2OULB 1U8CB 2AJXL 2LQRA 3VXPB 2FEJA 4HALA 3EIFA 3SGDI 5J1TC 1X6LA 4RFOL 3MJ6A 3ZYOA 1A7PL 4RIRA 1ZLLA 2FFDC 5DVKA 2WNXA 2WBXA 3ZE2F 5DUML 4XB7A 3CV5A 3BH4A 4H25A 3O6KH 4BKLA 2ZTBA 1TJGL 1YN7B 4UMSA 1KG0B 1SMAA 3U4EA 1VCAA 3GLMA 4RMTA 2FYVA 4HP5A 1LLAA 2ZYSA 1QLEH 4HKXA 1J1XL 4YR6A 4M7LL 3S35X 2YRPA 3PGFH 4MWFB 5ID0A 4UU9B 4ZW7A 2YUXA 2Q9IA 3G04A 3B9DA 4F2MB 3VTMA 3S0PA 4UDTA 3QZWB 2DBLL 5JZ7C 5DVNA 3MO1A 2VSMB 1J1DB 1U3HD 1CI6B 1RJLB 2PKDA 3DX7B 1JYNA 4E0RA 3NSFA 4BXLA 5HDRA 3RTQA 2WXLA 3P73A 4ZQTA 1Q1PA 4A39A 1ID5I 5DDHB 4F58H 2NPSA 5AOIA 4L8CB 1JGIA 1VPOL 3MRJA 3C08L 1BD2A 2GY7B 4J3VA 3RA7H 3NEEA 5KLVG 5E6IA 2CO4A 4LLHA 5DJXB 1LO5B 3T4YA 1C7SA 2WUCL 3UC2A 5DO8A 4H13C 2G5BB 3B2VH 4A38A 5MERB 3LN5A 2YSTA 3UERA 3MIWA 1HF9A 5CIPA 3WFBH 1ECZA 4JY4B 5CHNA 3TFKD 2J1KA 3IM1A 5HYEA 2WZ0A 4XMVA 3LN4B 4JRLA 5AOZA 2C9SA 4Z0XA 1HHGB 1RUQL 2OZNA 2VLKD 2W65B 5AZUA 2JELH 3MRRA 3OC8A 4FKHA 1WMKA 3LNGA 1QL2A 1PG7L 3V7AE 1JPEA 3BUPA 1WZAA 4N6QA 3O2WH 1K8IA 2ESVE 4QHLB 3VXMB 2Y06L 1GGBL 5I6XB 1MI5D 1F2XK 1DSFH 4OFVA 2H32B 3VXRA 7FABL 1H0TB 4Z7WF 2N7BA 5JPMC 4JK0D 1RZGB 1N9PA 32C2B 1P84K 2XKNB 4AVJA 1V3KA 3SBWC 1WLHA 2O6CA 4KROC 2VDOB 2CK0H 1NZRA 3CVCA 2XN9B 4R26L 3D70A 2BVUA 3IU3A 1YEJH 4XCCL 2X6VA 3HTKB 4QGTA 5KVEL 1GY2A 1SLQA 1Q9WA 4X6CE 3T71A 1OVZA 4D6TJ 1HXMB 4HGMA 3NAAL 2VABB 1JAEA 3DHUA 5DK0A 1CXEA 1U30A 1RMFL 3D34A 4LC1A 1AHKA 3H4FA 1AO7B 3L3DB 2CRIA 1ACYL 4PUBL 3AEFC 1HOCA 5MI0C 3H7BB 1DQTA 2OI9B 3APNA 3KWVA 1INEH 2NUPB 3SJVE 2IDSA 4URTB 2YJLA 1D3CA 4ZSOA 1JP5A 4EN2A 5JIQA 4RVBA 1Q86Q 1XF5A 4X7FC 1K8DA 3QIBC 3ZRFC 3STZB 2FXMA 1SQBK 5BQDA 1MIML 2NYYD 1J0ZA 1BSIA 1MVUB 2CLRA 3MRLB 4MSWA 1ASOA 3SO3B 2GSGA 4HIIB 2FEDC 1ZPLA 2XIIA 1P7BA 1AXTL 1JCCA 5IGXH 1H3VA 2GCYA 1SQXG 5CJ5A 4LEXL 5T8IA 1IAII 1DDTA 2J1XA 2GFBB 2P43B 3D4CA 5E9DD 2CKNA 4GI9A 4M5SA 3M1CA 12E8H 5DZLA 4X80L 1GDTA 5LN4A 4C83B 2VC2B 4Y2DB 2ZCZA 2JKLA 4WI7A 4Z7UE 1QHPA 3FT0A 5B8CA 4QRUB 3VXUB 2WV3A 2N9BA 1NQBA 2R1XB 1QKZL 4X50A 1MCCA 5CD5C 3ZRCC 2WQSA 4R3SB 3TNNB 4XNDA 3JVGA 3P02A 2XVLA 3MKKA 1P84H 5JOPD 2F53D 3HOGA 1JGLH 1U3HA 3C60C 2RAMA 3CXDL 2EKSA 3DYPA 2WW8A 2NR6C 2NXZC 1NAMH 5DA0B 1JTPA 4L2YA 3BI9X 4KXAA 1MCWM 5EU5B 2V17H 3FB8B 1QFWH 5DHVA 1MZZA 4TOYH 1G6RB 1QTPA 3VP9A 1R3LA 2Q1EA 4Z3HA 4OJCA 5TD4A 2X5PA 3E1ZA 5FC9A 1G0XA 3B6SB 2JQMA 4CW1A 3M8OL 3TO4C 4WFFE 2LHAA 3GUTB 3MGOA 4X5QA 1FL3B 2R1WA 3DNKA 4IMLB 5HHMD 4M03A 5DMGC 1A02F 4XO9A 4HSQA 3FN0L 4KUCF 2WNGA 4R2GC 2A6IA 3QQDA 3T08A 3N42B 1ETZB 2RMNA 4OU3A 5IKCB 4ZO8A 3WHE1 4P4KD 2V8MA 2CKBH 1E90A 2VL5B 4OGQC 2VLKA 4BJLA 5A1AA 2JE8A 1BZQK 1MVYA 1MJ8H 1WGVA 1ZHBB 2AEJA 4ZO7A 2WBKA 1GGYA 2WM0A 3FQXB 3OLGA 4AV0A 4GS7C 5HPMB 4G8IB 3U7AA 5M7QA 1Z2KA 1MI5A 1HNGA 1LEIA 3HIZA 5FWRA 3PDGA 4K23L 3O3BA 1KIRB 5ABDE 4N6RA 4UT6H 2YQ2A 1CJYA 1WZLA 4M6NH 1AC0A 1MCFA 3C5JB 4PJCB 5I1HH 4JBSA 1HUCA 3ZW3A 3FFOA 2LT9A 4XNXL 4CC4A 1CI5A 3EOAB 5IQLA 3CLWA 3RUGA 3O0LA 2DH2A 2LXCB 3L17A 3UPRA 1S9KD 3VGHA 3GM8A 1KJMA 4F80A 4WFHE 3RRQA 5HHOB 1X9RA 4UQ3B 4GI6A 1I85C 1TVBB 4KMTL 4PREA 3HCVB 1WF5A 4N9GB 5JXEC 4G6AC 5KZCB 3U7YH 5I66B 3P54A 1F45A 3L1OH 4JO1L 1YNLH 2V2TB 1J9CT 1WQVT 1RV6X 2Q8AL 2EYTA 3O8XD 5DFVC 4PD4I 3CDGB 4LVHC 2AFNA 4JHAH 1SHWA 4N0RA 3WEOA 4X7SL 2TRHA 2QEJA 4AUWA 4XAKD 4CAGA 3KJ4C 2E7MA 4KUZH 2A45G 1OQOA 3NCMA 2VXTL 1PEWA 5JLZA 3BVWA 4J4PD 4MNQE 3B9KB 1DJWA 2IWFA 4UV7H 2F8VA 2Y5EA 4AUYA 3DRTB 4V1DE 4UQBA 1G87A 4GQPH 4L8SA 2B9BA 3N0PB 5C0DA 4QO1A 3MOBH 4DK3A 1MJJA 3GMLA 1W72A 5CEXA 4E41E 4FCAA 3B3IB 4P23D 2FQEA 3FXIC 2QADB 4WNSA 3L4VA 1MHHA 4GO8A 2VR9A 2FL5A 4EUPB 4KH9A 4BZ1H 5HHVL 1WHPA 1NLBL 1OM3H 1DEEB 1OANA 3U0TA 1E2WA 2F53A 1QSEE 1JV2B 1ADWA 2EXSA 4IOIH 1UVQB 1M7XA 4P46D 4D3CH 3GHEH 5I1DA 5I1KH 1RY3A 2EDQA 2I9LA 3KYMB 4L8DB 3DXAB 3VFWA 2XQYA 3KR3L 3IB4A 4Z7WB 2X4UB 1FN4B 3KPOA 3LXBA 3QUYC 3OKKB 1HK6A 1BCIA 1T0MB 4DKEH 3GXDA 1NGZA 5D1XA 4ZFOA 2FR4A 1LEGA 3VJ6A 4MD0A 5AG9A 1YIJP 2QHRH 1YEGH 3FQWB 5CP3A 5JHAA 2GQHA 4PMEA 1OHQA 1QSFD 4X8JB 1AGBA 1RIHL 5KBMA 3CFBA 3JV4A 1E4WH 1G43A 4AOFA 1C12A 1RZJH 1FCGA 3F12B 4FQHA 3AAZA 2XVBA 4U1GB 1NC4D 4JR9H 4PJFA 5E7BA 5EF0A 3SFDC 1KBPA 4B0MB 4P4KA 1RQ5A 3PH0A 3K4AA 1YO4A 3ZR5A 2FYYB 1KYOJ 4JRYB 5E23A 1RZPA 1UT2A 1VAHA 4BHUI 2KZIA 2YKPA 4EI6B 3D0AA 4HHAA 4NKOA 3VFVB 4PY7B 5JPNA 3Q06A 2M3BA 4HD5A 4NO3A 5CMZA 3FCBA 5KAIE 3PDOA 4NHUA 4J5VA 1S5LX 2G3AA 3PL6B 3JT2A 2P2UA 3GMNA 5C1MB 5EHFA 1GYCA 5D5ME 4PHZA 1PZAA 4PJEE 3FQTA 4ONFL 5IMLB 4TNWF 3GHBH 2CCLA 1NAFA 1A6UL 5KOVC 4L5FH 2CGRL 3GNMH 1BMGA 4V2BA 4JGNA 4U1NA 1W8NA 4U7SA 2CDGA 3A6BH 1UZ6F 4MA7L 1CURA 3VW3L 2FCBA 2WPRA 4I2XA 4AM0A 3P0VH 4M7ZC 3LQAC 1FNEB 4B86A 1EZVI </