5AW1B

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 85 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw1B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw1B02
2R32A 2N9BA 3L36A 1OXZA 1H88A 3NXSA 2WPQA 2ZFCA 5AW6B 1GU5A 1CZQA 3L37A 4KHXA 1T2KD 2WT7B 3V4QA 3KQGA 2WT7A 4GT1A 5APVA 5AVWB 2QM7A 2JJLA 5AW9B 2WWWA 3UIAA 5AVYB 2Z5IA 1YYCA 3B8EB 3NMDA 1S9KD 1JUNA 3NFQA 5APXA 5AW5B 5AVQB 1GK6A 1X8YA 3V4WA 1A02J 4LC1A 3VTPC 3KDPB 1GD2E 4C46A 3LIEA 5AVXB 1NWQA 2XZRA 4AYCA 1OWAA 2YO2A 2ZXEB 3NTNA 5AW8B 5AW3B 4RESB 3VMYA 4JYCA 3MD0A 4RETB 3M06A 3MGNA 1A02F 2VRSA 2Q7CA 1T2KC 1IO4A 3OAKA 1GK4A 3HE5B 4HYTB 3A2AA 4I6MC 4AQRD 4C7NB 4C7NA 5APSA 4XE5B 1MFZA 1DH3A 3M9HA 1NAFA 2P7JA 3IR9A 5AW2B 3HTKA 3TYYA 5AW0B 1HBWA 2P67A 2YO3A 3TNUB 2KP8A 1J2JB 2Q5UA 3M0DA 3T97A 2R5DA 2R5BA 4DZOA 4M3LA 5APWA 2BASA 1S9KE 2C9LY 3VYIA 4GKGA 3A5TA 3I5CA 2Z5HA 3A3YB 3P32A 3A7OA 3P8MC 3HE5A 2YNYA 5AVUB 1H89A 5APYA 4EOTA 2P2UA 5AW1B 3P7KA 2E43A 2WPSA 3M9BA 2Q3IA 3VMXA 3LIDA 1H8AA 2XV5A 5APUA 1SLQA 5AVRB 3WGVB 1CSBA 3O8ZA 1SP4A 3SWFA 4B86A 1KQLA 4I2LC 1HJBA 1CI6B 3TNUA 1CI6A 2IPPA 3M91A 1FOSF 4JYBA 2W27A 3TK1A 3M0AA 5CMZA 1MV8A 3WGUB 3L35A 1MUUA 2WTYA 5AVSB 1HWTC 4AUWA 1HUCA 2R3CA 2WPRA 5AW4B 1G2CB 2W6AA 2QM8A 1FAVA 3VMZA 1GU4A 1JNMA 5AW7B 2C9NY 1GZLA 3HE4B 5AVTB 2XU6A 3HE4A 3V5BA 1GTWA 5APTA 2E42A 5AVVB 5AVZB 1FOSE 5APQA 3VN0A 2H7HA
chains in the Genus database with same CATH superfamily
1IL1A 2LKMA 3II6A 1DSFL 2COVD 1PIGA 3PXLA 3HNVL 3PDOA 1EZVI 4UOW1 1UZ8A 3ZKSD 2WYIA 1KENL 2FJGA 1QA9B 3H6JA 4L9LC 1BZDA 1RF0C 4GSRA 2HVJB 4G8IB 1ZLSL 1HXMB 3QNYA 2P28B 4WWID 3QDMD 3H1HG 1D7DA 1GW4A 5DZLA 2V2TB 2CRYA 3QFJD 2AAVA 1OT1A 1UD3A 4PYHA 1LDPH 1P4BH 4LIQH 1DVZA 2WBJD 3BAEH 2N1TB 1V55B 1Z9LA 3Q5TA 4P2RB 5JUEL 3SDAB 2X4QA 5BW7C 3IFMA 1DJIA 3LZPA 1EDQA 3EWKA 3VFUB 4Y4KC 3VXSE 1XD1A 3ZR5A 1INQB 3Q8FA 3L4VA 1VERA 2VXTL 4HZAA 5KSAD 2GJPA 1DQKA 3MNWB 2J7LA 2VQ4A 3MRRA 4W6XB 1X5MA 1GK4A 2AQQA 1G6VK 1XF3B 3QS3A 4IOIB 5APSA 4AVHA 2EUVA 3DROB 3DSFH 2NZ2A 1C16B 4XVJH 4BFRA 4J3UA 3VFSA 3E38A 3S4SB 3V5HA 1I7TA 4OD3H 4L29A 3QYMA 3O8XC 4K94L 3CHXA 4W9IC 3BPLC 3APFA 4Y4FB 5BVJA 2ZWSA 4D0BB 4PJAA 1DN0B 2P47B 4UMSA 2MOGA 3VWKA 1V3JA 2W38A 3VNYA 4FZ8L 1JHKL 2L91A 4DP9X 4NI6A 5HHMB 5IHUL 2H32A 3S88H 4ZW7A 4AENB 2CH8A 3TO4B 1CXFA 9CGTA 1JZJA 5BS0A 2OK0L 1BJ8A 2P5EE 2Y1ZA 3CC5A 5I18H 1YMMD 3LIZA 4KK6D 2DWXA 4KV5F 1BZOA 4U3CA 1A4AA 1KTLB 2PABA 4G6AD 1W2BO 3STBA 3EH1A 5D2NC 4L8SB 2AQTA 1JYWA 3QXAA 1L0QA 3MLTA 3CTTA 3ZZQA 7TAAA 4OZFB 4H44D 2X40A 4K7PL 4IBWA 1IGCH 2XZAL 4M9PA 1W0VA 2GEEA 4N0UA 3B5GA 3QEGH 3BW9A 1CFNB 4LASL 5FUCE 4CC1A 5CD5D 2OBGA 1HJBC 4NNPL 4YLQT 2AF2A 3FQ1A 1ULVA 2HFEA 5CCKH 4ELKB 1PZSA 4N2IA 4GAGH 2ROYA 4PRPA 1XXFC 1ZLDA 4JFOB 3S36X 3QAZC 3VWJA 1RZIA 1U95A 1CU4H 5ICXA 3TA3B 1F11A 4U1SA 5DD1H 3L3OC 5JHDA 1ET8A 5C7XH 3S3DB 2Y07H 4M48H 2G4GA 4TTDD 3ZX1A 1AQTA 3HI5H 1NUDA 2XNAA 4LBEB 1ETB1 1S7VB 1FYTD 3MUZ1 1SVCP 3INUL 4JCLA 5IHZA 3DNKA 4G3YH 5DHMC 1LHZA 1WLHA 2ESVD 2QZ5A 3SKNA 1NTKD 2W6BA 3WE1A 1J10A 5FM5O 4Z7WB 5CEZD 4R2GD 4D2NA 4U1LB 2KPNA 5D72H 4DT0A 3L36A 1BV8A 1G0DA 4IU3B 4NLAA 4JQ0D 1UH4A 3V6FA 3V4UL 3NSYA 4HIJB 2JI2A 1IAOB 5KTEL 2XN9B 3L74D 1MJ8L 4GBXC 4FKHA 1ORQB 2WT7A 4MD4B 3IFOB 5BRQA 4LLHA 1WS8A 2OJ1A 1PYWA 1SPDA 2R0ZL 1A6UH 1HYSC 4Z0XA 4Y4HD 2EVHA 3IJHA 1UUSA 5I5MA 3OAWA 2R44A 1DIPA 5EA0L 3FTUA 1T2XA 2EYRB 2IBBA 2ZSVB 5C8JA 2WXOA 3MJ7A 1AXSA 5EC1A 5FOBA 4IRZH 5IBUG 3P3RA 5FYKE 1JZ8A 3VG0H 3VD3A 4NHUA 1OK0A 2GYSA 3F3HA 5IMLA 3G3LA 1GA2A 3N2JA 2HJFB 1WT5C 3C5ZB 3KBHE 4HYTB 1DQDH 3WUWA 2Z31B 5DD0L 4ZW5A 1QSVA 3JZYA 3E1F1 4A2HA 3KCWA 2Q3EA 2MKWA 2YRLA 5K1VA 2HMID 1PD0A 3VXUE 5I6XB 1X9LA 3UGEA 1ED3A 5KVGH 4HC1H 3AMKA 1RZKL 1TZIB 1SF3A 5T3ZH 5FYJH 3OAZH 5KN5B 3TH2T 3PIQA 3FB5A 5IB3A 4Z7OB 1M1SA 4IBQA 5TF1L 2QELA 3TXAA 1JZ4A 2BY0A 2I85A 2VLKB 1YEIH 2BVQA 4OQTA 1JGIA 3ZDXE 2ZOWA 3QIBA 5GJSH 5IF0A 3HHSB 1OY3B 2HX7A 5DJ2A 3R4YA 3GKZA 4CW1A 1ZEAL 4BZ1L 4YHIB 1BZ8A 5KYUB 1KD1Q 3RGBA 1TCMA 4DEPB 4ANXA 4LXFA 4N0YL 5MERA 2ZJSL 4MD5B 4NKMA 1X9VA 5DJYA 5INCA 1B9KA 3ROOB 4F80A 3O6FA 1DR9A 1T20B 1JZ7A 2VLMD 1JZIA 1NGZA 3A4AA 5CMZA 1VPCA 4PCSA 4CGTA 1IQDA 5GSRA 1XF1A 2GTQA 3U48A 4HSQA 1Y1UA 5G55A 4RA0C 3A47A 4BA8A 3L3GB 1GS8A 3FHAA 2XPGA 3GLAA 5C9JB 2BNRE 1TVHB 3V79C 5C08E 5EORL 3AREA 3HE7C 5FO8A 3X13A 2ZCKH 4CVXB 4HIQA 1TEYA 5A2LH 3MRNA 2XC8A 3PWNB 1PG7H 5EBWB 4BFOA 5I1CL 5KZCB 3GMNB 1LE9A 3CFJB 1FL6B 1G9NH 2AXFB 4ONGH 1TETL 4QRSB 3VVWA 1VQ7P 4PS3A 2QQLH 4WFED 3CPLA 2ZCZA 2M5AA 2ZFCA 1R46A 4A6YL 2NY3D 1HJ0A 1ACZA 1THAA 1O7DE 2IWKA 4UV7L 2Y06H 3MBEA 2ZOKA 1O6TA 3C2AL 4BK4A 4KK8D 4L1DA 3MUJA 3X12B 2F54D 3MV7A 4X6DE 5BRZD 2CA3A 1R19A 1KIRA 4X4MA 3PHSA 3RL0D 1P5VA 2P58A 3AC0A 1KJ2H 3N91A 3EYSH 1LTGC 3ZE1B 2ZYIA 3ZKMD 1IZNB 5AOZA 2ARJQ 1UD2A 3VFVB 1PP9G 2FJFA 2LE9A 3HUJF 2A9DA 3AE6C 1U3ZA 2XZCL 3ZYOA 1D5BB 1AHWB 2JVUA 4JFEE 4OLYL 3WY3A 2F18A 3MROB 3CQPA 4OGYH 3K91A 4M6AA 2X4UA 1OP9A 3KL5A 2UYLB 1SQBJ 3RK2D 1KCRL 5DR5L 1J1DB 4U0QB 4OIBA 4OI8A 5D96C 5ITFA 1ITBB 1H19A 4XBEL 1R5LA 2GK0A 2F8VA 4PUBL 4JR9H 2PP7A 2J25A 4WUUA 3BVWA 1AXIB 4XCEB 3K72B 4O4YH 1NL0H 2BSTA 5D7JD 4HWBA 5ABZA 2VL5A 1KT2A 3GS4A 1VZIA 2WBJC 5SWSD 3MNMA 4FNUA 3DTUB 3REWA 1W0YT 4HS8H 2YUWA 4JREB 1BIHA 5HDWA 1NLDL 4OFYD 3IN6A 2C9LY 4QTFA 3PL6B 5KSAC 3QXDA 3PUUA 3MOBH 1OSPH 2CKBB 5GS2D 3ATBA 3GXTA 3P40A 5IB5A 5IESL 2GW5A 3HFML 3TBSA 1EZLA 3BCCE 1WMKA 5IJVA 3WS6C 3N0AA 2OS7A 5D7LE 3WL9A 3D6GA 4F2ME 5CCGA 1S5LH 2OTUB 4EN3D 4ZUSA 1HHIB 2ZX5A 1HL5A 4YHZH 2HG5B 3KPRE 3SBWA 2OYHC 4G72B 3THMH 3OZKA 4FG2A 3W57A 3WG7B 3RTLA 1R8EA 4UOJA 4JG1H 5K59F 5KBKA 5I1GH 2ICEA 3G6AB 3QR1A 2B4CC 1VFBA 4GRLB 3S7GA 4KK6C 4QRPA 2VSMB 1Y18A 4PWHA 3BIAX 2ZZUT 3NACL 4G6AC 3ECBA 5AEAA 3S4SG 4KTGA 4FTVB 3X14B 8CGTA 5KVFL 3W9DA 2WSFJ 2GC7C 4N2MA 5LUMA 3L70D 3EFGA 4H44C 1ZA3A 3G9RA 2JIXB 2YK1L 4X5LA 2WLNA 4ZMTA 3ZTNH 5CD5C 2EEDA 2IYOA 4G6MH 4KQ3H 4WI6A 4EKXA 1AI1L 1U8JB 1ZLVH 2FYZA 2HUEA 2EIDA 2WPQA 3V52L 4OJFH 1FNEA 1HILA 2X2UA 3KPLB 5PCYA 1I4FB 4IIQC 1AGBB 5HYSB 4BCXA 5D5ME 5K69A 4G8EA 4TTDC 3ULUL 3V0HA 4OZFG 2YBRA 2GFBB 4M00A 4OJEH 1UD5A 5D93B 2FXOA 3V6BR 1D7FA 3B8EB 3IFLL 3QGVA 5HHNB 1SVBA 2LVCA 2IPUG 3UZVB 1F8TL 2DM3A 2X0VA 4L18A 2HKAA 1YJNP 4KI1A 3RU8H 5A1AA 4N3TA 4R2GC 1OWAA 1ZHNB 4LOVA 5HYJE 2LU5A 3PREA 4DESA 2VXVH 1INDL 2PO6D 2YRBA 1SLUA 1FNSL 4GXVL 4MNQE 1A02F 1UB5B 1GC1C 4R7NB 4OFPA 1K2DA 2TSBA 3MJ8B 4I9WE 4N6RA 3V0FA 4JQVC 1P2CB 1KTKE 2Q76A 3Q1SH 4AEIH 4JPWL 4Y4HC 3KYAA 3M45A 1TQCC 2DLIA 2X3CA 4OCXH 3NESA 1S9XA 4M5ZH 3W68A 4LLQA 3WTVA 1CQYA 5GPRA 1WAAE 3J8F7 3R1GH 1U8NA 4ZOCA 2IBZE 4GKZB 1KTDB 5GGVL 5L7XL 2J71A 3JWNG 2CO7B 4X7EC 1LWRA 4JE0A 3FUIA 3GMQB 1NU1D 1A7PL 5I19L 5L4JA 2H3NA 4ZRGA 3PGCB 2QSTA 3UL4A 2TSAA 1S8DA 2CIIA 3A6BL 4UOQA 4RH4A 1CCZA 1SOXA 4AYSA 2ATPA 3Q6GH 4OM0H 5KVDH 1QTSA 2YS4A 3GZPA 5LKNA 2OLDA 2WUCL 3OSKA 3USSA 3KPSD 5CSZB 2HMIC 3PP4H 4RQQB 3MV01 4MJIB 3UTQB 3HR5B 4GT7A 4C4KO 4U0RC 3SE6A 1AKJB 4TKWA 1M42A 2HFFA 2VMEA 4WHDA 5FA4B 1DFBH 2CR6A 3AT0A 3FTGB 3WIFB 2W07A 4XNUL 2NNXA 4UNIA 3WYRA 4LEXL 2DW3A 4PV1B 3OLDA 5ECJE 1XAKA 3HPJB 2JQZA 4DGIL 3S36H 2YMYA 1T80A 3CCQP 3LYRA 2BIMA 3OJDB 4MXVE 1MAKA 3GTNA 5LBSL 3TNNA 2EYSA 4O2EA 4ANUA 1Y8AA 3EIFA 2A6KB 5ISZE 2GBUA 3CI9A 4ZYKA 4FFTA 5IVXE 1NDMA 4FI6A 2RAMA 2KBGA 3SKOB 3SOBH 2MMXA 3DIVA 1CLCA 3M8OH 3FFDA 1WC7A 4RFEA 4IHOA 4LVHC 3AFLA 3ZU8A 2OMYA 4WO4B 5CLZA 2H6PA 4MA8L 3GI8L 2EDXA 4IRZA 1LEIB 4LSVH 3U2JA 2EE6A 1JCKA 2B1AL 3L5XL 3BZ4B 4G9FD 3RGVB 2JKNA 1BJ1J 3CZLA 5L2KB 4P99A 4JHWH 1EGJH 3A0HH 1NCBH 5C3IA 2HLEB 3CX2A 2GITB 1OT2A 3PP3H 4PRAB 4JKPL 3N4XA 5H2BB 3UZQA 4AM0B 5GS1C 3RBZA 1IRAY 4BQBA 3MREB 3NJHA 3M1BB 4L4VB 5ADPH 1WWBX 2ZP8A 3T2NH 1HQ4A 3HG1A 1DANT 2NPSB 1TJHL 5C0DB 1MCCA 1JCVA 2ZXEB 5DA4A 3BZ5A 3HN3A 2W9LA 1SJVA 4HC1A 3QT2A 1AR1D 4GAYB 2NY3C 4EEEA 4HJ1A 1ACXA 1ILUA 3POCA 3WJMB 1U92B 4PSPA 5EU7C 1NCNA 1MFBH 4BRYA 4M56A 4KK8C 1RP9A 2AKRB 4X80L 2XCMC 2QJYB 1LTSC 2P24B 4ZG1A 4A2GA 5D1ZA 3RL0C 2QSCL 2JF1A 5IMKA 3ZKMC 3O9WD 4D94A 1N8ZA 3S2CA 1LJ2A 2E6JA 3DK2A 3TBVA 3VGDA 3MO1A 4RRPM 1N0LA 2M8RA 1Q81Q 1OARH 3VFWB 5A7BA 3HRNA 2X9YA 3P4LA 4UTBL 1BF8A 4FFWD 2H3KA 1CXLA 4RGNB 4CC4A 3M0DA 4YHYC 3L3KB 4BUGA 1FZCC 3IRZA 2FH8A 5CF3A 3IDGA 1RE4A 5I24A 5IEHA 2P7TA 3L1OH 1VLXA 3RK2C 3VSQA 1MDAA 4WVZA 4AGPA 2OR9L 1P5UA 1W72L 3APDA 5IW3A 3TT3H 1YNKL 4E2OA 5AW1B 4JHBA 4BFGA 1CQKA 1NOFA 1SXSA 3FUDA 5FM4A 4K7FA 2OTLP 2DAVA 2AEOA 1OK8A 4M4RA 5D7JC 5DRZB 1QR1A 1NTMK 5JLZA 4MYPA 2VERN 1YMME 2YEVB 1MPAH 1MCEA 5H4ZA 5HBBA 4PGBB 4AQAB 1OGTB 1QEWB 4DP7X 3QJHB 5F89A 5C71A 1HCZA 4HS6B 3GLDA 1ZRUA 2BCCD 1PPIA 5K39A 5F7YC 3I9IA 4JRYA 1MIMH 3DHMA 3O2VL 1NSNL 2A3TA 1GL4B 4HZLB 3TWYA 1JTOA 3D3VE 1ZLWH 3UYOD 3OX8A 1UXSA 3VXSB 4A2LA 2ITDA 3IDUA 1SQVG 2X2IA 4XO4A 4PJXA 3OSVA 4EN3C 2UV3A 5KLVK 5BXFA 1KB5B 1FOSE 5IW6A 3MXVL 1DBBL 2VM9A 2CBPA 1KJ2A 1N2DC 2V2WB 2YXQB 1MNUH 2IWFA 3ES6A 2A38A 3TPUB 1O6SB 3Q01A 1BHGA 1ANUA 2DMKA 1KFGA 2IALA 3PCYA 5IT2L 1G7HB 3JWOC 2PW2B 5CWSB 3AWFA 2CKBH 2YIHA 3F64A 1MFAL 4CSPA 5B3JF 2ITAA 3ABLB 3ISWA 4JFFB 4LAQH 2JJLA 1JM0A 4DPCX 5FA3B 1B0IA 2X05A 1HDMA 2RCSH 1BE3J 3CFEA 1PPJG 4KU1A 1YLBB 4NJ9H 4OCYH 3RLSA 3IDMB 1YA5A 2FZ3B 4AJWA 1A02J 4AIOA 4GIPD 3NQIA 5I1LA 4ZPVA 2I69A 1YCSA 1JCDA 3TFBA 3FMGL 2Q2LA 5CBEA 2DBLL 3VFOB 2DMCA 4F37F 2QPUA 5LNEA 2RIKA 5E51A 3CX5H 2WWNA 4CBZA 3NBNA 3IFNH 2ZXAA 3GW6A 3NTCL 1QA9A 2R0LH 2E8YA 3GXMA 3BISA 2LU3A 2E4TA 2EC8A 4PJBE 2EXWD 1WGOA 1G7IA 2JNZA 3BESR 3FNKA 3LHPH 1HOCB 2DEWX 5F71A 4YSOA 3RA7L 3MLSH 1U91B 4FGMA 3PJSK 3PS6A 2QJKC 1MW3A 4H8PA 2BVPB 1T0MA 4PGEB 2VDPB 4NQCB 3T97B 5JXED 3JV4B 3BO8B 3BRGC 1CI5A 3H1HJ 4GEIA 2YPLB 3MACL 3D25B 4Q52A 2PO6C 5HYSG 1DEEB 1INQA 4ACPA 1JHLH 3NJLA 1I53A 4FCHA 1IC4L 4KGLA 3ZDYF 1SDDB 2P8PB 4HJIA 3I5CA 5DZJA 4E41E 3GBNH 1FE8L 1B0WA 2YRZA 5FYLL 2C9VA 1U3NA 3QZOA 1XGUB 3HCVA 2L5GB 2OSXA 2FBWC 1R5IB 3RP1A 3DROA 3L72J 1C16A 4BWUA 4EN2A 3S8GB 2H47C 1FGVL 3UO8B 2O5YH 4F8OA 1ONQB 1RJLB 1TQBC 3RUGF 4RWHA 5BPPA 3ZDWA 1L9RA 1QFWH 2XETA 1NTZD 43C9B 3RWCA 1I3GL 4ZI8A 1GYUA 3QS2A 4O2FA 4P49A 5EIIG 5KAIH 5JORA 3B9DA 4YSDA 3V8CA 4M7ZB 3M91A 3PP5A 3HAEB 4HIEB 3FB7B 3LRSB 4AENA 1RUAL 2ENYA 5F9OL 2QIWA 1S4IA 1SXBA 1X6NA 3Q44A 2WZ5A 4O51B 5DS1A 4UB0H 3TESA 2R0WH 1A7QH 1F3DH 4WEBH 4L8SA 4P9ML 1T5KA 1L7TH 3EYVA 4DQAA 3G3ZA 1JMXA 1KXTA 3WN5C 1EZUA 1BIIA 3BP7B 1CT8B 2V9TA 3TO2B 1MRCL 4M61A 5IUCA 2KZWA 2XWEA 4N87A 5FHAH 1HWGB 4K9EH 1HH9B 4ELKA 4U1JA 3T0EB 5C0JA 5CLXA 5TDOB 2AJXH 3AS0A 4FD0A 3UP6A 3TA3A 1BQKA 4OB5H 4JO5A 3V2QA 5F7DB 4CC0A 5I6MA 3A6OA 2FSDA 4IM8A 3EDJA 2NX5D 4M7KL 2EVFA 4PS8A 3DXAA 4WHCA 5KYYB 1FJKA 4PG2C 1DJSA 3G5ZB 2CJSA 4DKTA 1PL3A 1ZHLB 4YDJA 4DKDC 1QFPA 1IU1A 3ARTA 3WKMH 3V55A 1M71B 2ICWB 3ZDXB 3RWHA 4W6WB 1JMZA 4B0MB 5TFSH 4NO3A 3GJFB 1KJ3H 1UM6H 1BQLL 1KMIZ 3I6LE 1KEML 3QUXB 4IU3A 4U6HB 3FQRB 2O5XL 3O3DA 3FH7A 5DQ9B 2ODIA 5GGUA 4M93B 2XN9A 1VGEH 4R7LA 4YDKL 2DD8H 3DVNA 1ORQA 2K8QA 2Y36L 1FJPA 4TUJB 5D70L 4XNXH 3GMAA 2DKMA 2X4OB 2BRQA 4K3EH 3SGKA 4PHZA 4OLVL 3PHOB 4K5MA 3BP5A 4FQIL 3MRIB 2EYRA 1Q9KA 5J6GB 1KLFA 4UQ3A 5K33A 5IJKC 1CR9L 2PETA 4MX7A 1PQZB 1AR1C 3S34L 4TN9A 4HIXL 4XZUB 2NSMA 4IKLA 3O2WH 2HJFA 5DJCB 4F24A 1AMXA 4UIMB 4DK3A 3SKMB 3ILDA 1U6AH 1PD1A 5D6DA 1U8CB 1Z32X 2OV0A 1AACA 1FHGA 2Y72A 4BSVB 5C2BL 2H8PA 4WGWB 2E43A 3GSRB 4J4PA 3O9WC 1L9SA 3O4OC 2GJ6E 2PCFB 1NTKK 4P3DA 1JN6B 1MNNA 1JGLH 4B7IA 3LXBA 3O3AB 3D87B 4NN5C 4GG6B 1EXHA 1X5LA 1H6EA 1OWWA 2XXGA 4FFWC 2H45A 2E8ZA 1JPSH 5CEXB 1PX3A 3LEYH 4UAOC 3EFFK 2UXFA 1OQOA 2P5PA 1UVQB 2FSEB 1DEBA 4IGBD 4JAMA 4NO0B 3RWIB 3DIFA 4DJMA 1TLKA 2AVGA 5DZVA 2W65B 1W8OA 3HMWL 4PBVC 1I8KB 2XJLA 3MOAH 2W8CA 5DUBB 4P46B 3LKOB 1EGJA 3KBEA 4NP9A 3QXWA 4GKNB 5CN1A 3TF5A 4B9FA 5HGDB 4FHBD 4YHPB 2X6UA 3AECC 2FGWH 4Z7WF 2VMJA 4HQQL 3ASNB 3HZVA 3B5NB 2E5YA 3QUHA 2KPWA 3TBTB 1V3LA 2IAMB 2YJQA 4NZUH 3WMPA 2H0PA 3FZUD 3EO1A 1H3VA 3CZNA 3CVIL 4PIRF 2XWDA 4JM2D 1TT6A 4MCNA 2YKOA 1K8AQ 1DBKH 5I1DB 4LPWA 4QCIB 4HXBL 3UO1L 3VRJA 1GJUA 2JKIS 1DQMH 3Q6FB 3CQFA 5IJDC 1BEXA 1FUNA 1TVHA 3QJZA 4P06A 4DN4L 2DPKA 3T2LA 5HD8D 3ULVF 4OLZL 3NZHL 1JXJA 4C46A 2H6OA 1ODUA 3CFJA 1NWQA 4WJKB 2X4TB 4AQEB 2NXZB 5L6YH 4HCIA 1WITA 4UCFA 5K5YA 2WP3O 1QATA 2ARJB 2F2HA 2F7PA 4RAVB 1P9MC 4R83A 2WXHA 4TQIA 4OFKA 1IVTA 4AVJA 2OMWB 2JKVA 3EYFB 1JGDA 2G2RB 3P0VH 1MHCA 2OR7A 4HWZB 3VD2A 4ZFOA 2CJTA 1BMZA 3H9SD 4JBZA 1UACH 2E9JA 3KYNB 1PIFA 2CA4A 4E9XA 3FRUA 4LPVA 5J6HA 1JK9A 4FP8H 3RK3B 1KB5H 3N42B 3GK8L 4OF3A 5KSBA 1IEHA 3P3SA 3E1ZA 3VFVA 2Y0DA 4XRCB 8FABB 2WLYA 1LJMA 3U0PB 1R3IL 2ORBL 1F6LL 4Z7OF 5D7SL 2NXYD 1D5BA 1AHWA 5DSCA 1MCKA 2CLRA 5DMGD 2J5LC 1ZLUK 3BZEA 2IBZX 1C5DA 3GSQA 2ZOLB 2JLLA 3JT2A 1IGJB 1EFXA 2UYLA 4M7JH 5MEQB 4PJ7E 1DE4A 3DPBB 4JLRB 4S1RH 4YDMA 5KSUB 5I15L 4QTIL 4PJIE 5I8OH 1QBLL 1CMOA 1USQA 3VVVA 2EXWC 2BHUA 3LQAC 4U6VH 1PZ2A 4U33A 1LEGB 5EPMB 1Z9SA 4OLUH 3VXRB 1F4WH 5D1XA 4A55A 1W2EA 1BCIA 4QYOA 1M1JB 3CFUA 4LB8A 2HT4D 3WV0A 4YL4A 1NC2A 1ZDSA 3V7AE 1CURA 2IQ9L 1JI1A 4PY8I 4G5ZH 4Y5YC 3SDCB 3BHBB 1BFVL 1EDLA 4QF1B 4X7SL 5DURB 1GR7A 3V7MA 3EOTH 3MUUA 5DCCA 4L4JA 5HGGS 1R3LB 3PL6A 3H4HA 5HDOA 2DWTA 3ABMB 3QIUA 4RMQA 4Y7OC 5DEGA 1Z56A 3AE8C 3AE2C 1TQSA 2CKBA 5HYJB 1KULA 1B2WH 2HYMA 3ZTEA 2X28A 2VLRB 5F96L 2AZUA 1GL2D 4P4KB 4X0KB 1ZRTE 1CTOA 2IXQB 1YEKL 5MHSE 1YEJH 1Q0YL 3F58L 3B2PA 3GHBH 1YEGH 2AJYL 4X7DC 1OAQL 1CG9A 3FUHA 1WBYA 3V6ZA 1WD8A 1KCVL 2HG5A 3M9QA 2RGSA 4R7XA 2NUTB 3QUGA 4ZMPA 2G2PA 3SFDC 5HI3D 2UZXA 1DEEG 3FFCD 4O58H 5CN2A 3G5WA 2F0CA 5T1KA 2EUWA 2BVTA 2BS8A 4K07A 1IM3A 4W9ZA 4GRLA 3EYUL 3HNSH 5D2LE 2YZ8A 4LHUD 5DD6B 1FL5B 3ARGB 3ZE1F 2Z5IA 2R15A 1OP5H 3MGTB 4IOSA 3TJPA 5BUPA 4Y5VC 1FO0L 3WJJA 2QE7H 1QX1A 2PXYB 4HK3J 4R0LA 5GGQH 3FQWA 3IPFA 5HI4D 4QXUH 1K4CB 1GGYA 1JI2A 3NQKA 1HINH 1SY6L 2R1XB 2YA0A 4XE0A 2ZCHH 5CBNA 1YECH 1YY8B 3CFBB 3V5DA 5CJ4A 1LTJA 1E2ZA 2J6WA 2NQDA 3MNVA 1U8JA 5K93A 3MD0A 4X4YA 2JQMA 1EDHA 4C56B 1S9WB 2A74A 3FQNB 3NFPA 4ZAKB 3US0A 5BV7C 1ZV8A 3CMOH 5F7FA 1YUHB 5IOPB 2DM4A 2GCYB 1QZ1A 4OF0A 3ULAB 3T6QC 1PDKA 5HYSA 1IC2A 3DO4A 5CJQH 1BAGA 3VW3H 2WSDA 2J88H 1FBIH 4G7RB 1YNTB 3FSAA 1FU1A 4JFHD 1CDHA 3NCFB 5E08L 1HBWA 1AQKL 3HC3H 2J3SA 1ZSDB 2I8DA 1J8HD 2CO6A 5ITBL 5IVXB 5C09B 1VQNP 2BASA 3R4RA 5EIIA 3K2KA 2LR2A 2KYVA 5TISE 1QUPA 3E3QE 4HBQA 2C9XA 4Q0XH 4TOYL 5F6HI 1JWMA 4DN3L 3FCUB 3LN4A 4XTRD 2C3XA 5JO5A 4YL9A 4R8WL 4A2MA 3GTVA 4Y2DD 1R0AL 2KMWA 2B1HL 4BFIB 2VXSH 5BZXA 2BIOA 1R4XA 5BVPH 1MY7A 2YKQA 2XDHA 4IBZA 1MWAL 3CUPA 1QWNA 2FO8A 25C8H 3KLAA 4R4MA 2IFGA 4UT6H 3QUZD 5IB2B 1ZXKA 1J18A 1PKOA 2GQHA 1HCFX 1OTTD 2NW3B 4B86A 1EZVY 1NBVH 4GKZA 1ZIAA 3L5WB 1H3PH 3K8KA 2FJSA 1IQWH 3KHOA 2QL1A 4I2XB 4KXDA 5HHQA 3QXVA 4MA3A 5F9WB 1GYWA 4QRRD 3VQLA 3BEWB 4BZ2L 4GIAA 1IM9B 3SB3A 4HKZH 3F62A 1L5GB 4BA0A 3HE4A 1KB3A 3AU1A 4NKDB 4X9YA 5LGYA 5I23A 2NTFA 1T0NA 4PRHD 1EMTH 4NN7C 4LCIH 1KDJA 4XP6L 3SYCA 5JA8B 4MJIA 3BPCA 3HR5A 3M17B 3UTQA 1VPOL 3TYGL 3KR3H 1CLVA 4JRXB 1SUHA 3NFSL 1SFDA 3AW5A 1UD6A 2E76D 3FTGA 4JL1A 1E4WL 3KBFA 4XNQA 4MXWH 3WIFA 2QFPA 4IGBC 2AXTH 4WHTA 2A99A 3CZEA 3HPJA 2YMXL 1EDKA 3BIBX 4JFZH 1UWEH 3HZ3A 2L3BA 4MRCA 4M7LH 1R5WB 4EVNA 2ADGB 3AQXA 2DDQH 4JDZB 4QKTA 4XNZC 2EYTB 1INEL 5ALCL 3TEYA 4D0CB 3V10A 2QQNL 2ID5A 3VI3B 2AK4E 4PB0H 2ZYRA 4P2QA 3RWJB 3WFBH 2ZWNA 3BI9X 4YR6B 1PGRB 4BM7A 3SE8L 3W81A 1KYAA 5GS0D 2H6UA 3FZUC 4TUKL 3L4WA 3LV3A 1LWJA 2OXGB 2UX6A 2XI9A 4Q6YA 3AG1B 3ARBD 3HJEA 4JM2C 3UBHA 2EEBA 3ZN6A 4A6YB 1OW6A 3KXFD 1JPST 1DQTA 5L2KA 2XFXB 5IQOA 2EO1A 1FLRH 3QG7L 1Q9OA 3SPIA 5ABAA 4I3RH 2R56H 3TDKA 4A7QA 3OB0H 4PRAA 4YE4H 1AO7D 1T1WB 3CNKA 3NYKA 5F3HA 2CXGA 4KZCA 5HD8C 3MQIA 1MIEH 1JWSB 2NUPB 4XVTH 2OKMA 2DQ6A 1ZR2A 5MP6L 2YKLH 3B1TA 4L4VA 3RFZC 5EFIA 4EYYQ 3AM8C 2BRRH 2NPSA 1J05B 2ZX6A 4M62H 5L8LB 1KGUA 2AMUA 4CKVX 1NMBL 2BFVL 3C5SB 2QMKA 4YUEH 5BO1H 3U7YL 4JGNA 4ZUUA 4PY8J 4APQB 1ZGLB 3VDBA 1IJ9A 1U92A 2X4RA 3F12B 5T1DH 3GSOB 3OJMB 3TV8A 4LP5A 5DRWB 1EEYA 1E7UA 1ZT7A 2R29H 5E9DB 4D9LH 3HG4A 4FXKC 5EF0A 1WQVT 4JHAL 1G9EA 1DCEA 1VQMP 3BCCG 3NCWA 5FDWA 3IXAA 5F1KC 3UBXA 5AG9A 4H0GA 5B1BB 1RIHH 4J3TA 5BMFH 1KBKA 2NXYC 5E95B 2EDMA 3V0VB 1NCTA 3IJ7A 5DMGC 3H3PL 1JV2B 4XP5L 1NGPL 1N7SD 1JNHB 4XO8A 3WKYA 1SXNA 1NH4A 1YN6A 2QTVA 2BWIA 2HH0L 3FCSA 2DM7A 2AJZA 4I7ZC 3HRZC 3T71A 3ZHDA 1E28A 3MCYA 1OIPA 2VLLB 2A73B 4MB4A 3RWGA 4YOKA 4KNTA 5SWZE 2YARA 4TYUA 1T2QH 4MQTB 5TGBA 1MFDH 2B59B 3BUDA 4HWEL 3C08H 4LCUB 1WEJL 3K4ZA 4JRFA 5FW7A 2I9LA 3OC5A 3GWJA 1OW0C 4MMZC 2WQAA 2HT4C 5K1JA 3PPEA 4PJBB 4GP5B 5EZIL 4HLZH 3H1LE 4NRZB 5DYFA 1VQPP 3UTZB 2LFEA 1VF5D 1SQPE 2IMMA 3RPBA 2FECL 4HX1B 4D8OA 2EDRA 4YTPC 1YTZI 3KLHD 3JWDC 1PJWA 4OKDA 4CA4A 2EDWA 2YBGA 2ITCB 4NN6B 4H8WH 1T5WB 1TFPA 1EUTA 4RZKA 1N64H 5A2CA 3JVFC 4E9WA 5JW3L 1GL2C 3VXSA 4GUCA 1A1NA 3EDFA 2WPVB 1SQQE 1FO0A 2E27L 2NYKA 4LCCB 5IFHL 2I1JA 1FFOA 3HHMA 1VESA 2WVTA 4OCNC 4YSQA 1QFOA 5C0CE 1KB5A 1Q0XL 1P84E 3FFOA 2J4WH 2V2WA 3C09C 4JB9L 2G9KA 1OQXA 1SOQA 5JXEA 1ID5I 1N0XL 1Q90A 3BPOB 3NZSA 5HI3C 1SQVJ 4AC2A 4RETB 1U3HA 1I9RH 2BWQA 4I0KA 2J59M 3BLBA 4XXCC 3LS4L 5LWYL 5C0AE 3BKMH 3RDJA 1G7HA 3QWQB 4AMWA 2HLOA 4KJMA 5F6HJ 2BY2A 3RWDB 2AI0L 2ZCLH 3VXMB 4JFFA 1DQVA 4WZ9A 1GCYA 3SODB 1GSKA 4LLUB 3RY6A 1QLEH 3ZIYA 4I5BB 2P5EA 4DVRL 3Q2CA 5HI4C 1YRKA 2ZF9A 2NY5H 2VIRB 4YSSA 1T7XA 3Q8BA 4LARL 3B3BA 3CG8A 4WW1B 5FW6A 1PCXA 2K1AA 1YY9D 1ZCRA 2QVMA 5D8JH 4HOWA 3A0OA 4HK0B 5EHFA 4GKLA 3UBXI 1OPGH 1RPQA 1XF5A 3IMTA 5EO9A 4EI0A 3K0YA 3SYQA 4UUJA 5LBGA 5HXMA 3VMNA 1C08B 4LEOB 1JZ3A 3N9GH 1E30A 3LKSB 3FSVA 3U1SH 3MBXL 1TTCA 1DJGA 4AYDC 3H1JG 2N7AA 5I1IL 1P4IH 1H15A 2WLIB 1AOZA 1ERNA 3APCA 1CLOL 3CX5J 3GSVA 3SDXE 1HOCA 3ULSB 4M5YL 2O01N 4MMXB 3SIKA 4BWWA 4OVUA 5E4OA 2Q3AA 3EO9L 2BVPA 3NRFA 4WNJA 5IP4A 3FO1A 5EIQA 1BSNA 1PZBA 5JW4N 5KANG 2IVFC 2X12A 3JV4A 3BO8A 2P8MA 4TPRL 5ELIA 2VE6B 3CHSA 3WGUB 4RFNC 1NLBH 3D25A 3L5HA 3EOAA 4QXTB 3G6EP 3PWPD 2EDBA 3JSSA 1FAIH 4DVBB 4XTRC 1FAVA 1N8OE 1SDDA 3NH7L 3QB7C 2EQDA 3UC0H 2V5SA 3I9AA 4Y2DC 2EIZA 2ZT9B 1XGUA 2R0KL 5HVHB 2APSA 3D52A 4HGWB 1NWPA 3QUMB 4BUQA 4LU5H 4YK4C 4ZO7A 3MN8A 3NEXA 1ONQA 3MLVH 4R5VA 2NY6D 2BWDA 3KYMA 3LMJL 43C9A 3QUZC 4RGOL 4IRSB 1OTTC 2VMCA 3H1KJ 2DB8A 4S1QH 5LG1A 2A9NH 2DIAA 1HE7A 2H0JA 1Q72H 1MRDL 4MNHB 5TD4A 1OZUA 2LABA 4Q6IB 5F6IC 1VADB 2XG4B 1CBVL 1HEZB 4UDTA 1Q1PA 5E23A 2E75B 1OB1B 1KN4L 3N1MC 1OMIA 1WBXB 2WNGA 4K5PA 2FYUG 3N44B 2A6JA 1SHWA 2PF6A 5MEOB 2Y1AA 3O4LB 3BSZH 4P2OA 4L0ZA 3BP7A 3DURA 1MQKH 4V1DB 2H88C 1MF2H 5GTHE 1RV6X 4AYCA 3ESVF 1MVYA 3RI5F 2E76C 2GJ6B 2WC7A 1C5BH 3NZ8B 3VXUA 4M3JA 4LHQB 1L7IL 2F9BT 1X9UA 4F3FB 4KZDL 1AQHA 1TJGL 4CU6A 2XWJB 3HFFA 4NP4H 4I1LA 2N56A 3LEXB 1TUPA 3VACA 2I07B 3WFCH 5KYYA 2ZKWA 4HV8B 3IR9A 1G9MC 1NTZK 1FVCA 3WI9A 3VTMA 1FQ9C 2ICWA 3I3EA 2PWFA 4KJYB 1BD2E 2D7NA 1PEZA 3A21A 4GQRA 5LAXB 4PD4E 2AEPL 3VG9C 1NCGA 1BWMA 1PLCA 2L7EA 5GS0C 4W9EC 4FEIA 4B27A 3GBLA 2R5DA 4UT6A 3WIHH 1F97A 1UWYA 1BYOA 2IG2L 2OX5B 3BEVA 3ARBC 3QDJE 1LWUC 5BZZA 3FO0L 2R1YB 4QGTA 2PNDA 5DQ9A 3MUY1 4MQ7A 4QY8B 1SQPK 1RY7B 4TF4A 3BATA 5E6ID 1G7LA 5IGXL 1R5VA 2W0PA 4M43H 4TUJA 1MAMH 2YMKA 3ZQ9A 5ICZB 4Z7AA 4HKZA 4JANA 4L2LA 4YXKH 1AVOA 1UB6A 3V0IA 4M7LT 3VSVA 4MCYB 4EIZC 3D0VB 5KJ7E 4JBSA 1I8MA 2ED6A 4PGDA 4G1EB 3SE3C 1A21A 4JDEB 2DV6A 1KILB 2YKPA 4JFXB 2BNRA 1I1YA 1MW1A 5C08A 5ACLA 1GZHC 2WYHA 2K3HA 1P84K 2PN5A 4XZUA 3B9KB 1N5YH 1GPOH 3MBWA 4OUUB 1YEEH 1XGRA 3GRBA 4R97B 3TV3L 3GUFA 1KTBA 2BY1A 1W72B 5A3ID 5DJCA 4UQ2B 5ADOL 4OZIB 1E67A 1QPPA 4BSVA 1IBHA 4BK5A 2C0XA 1MKFA 3V2PA 3VGFA 1EZVD 1AJ7L 3C8DA 3GSRA 5E1IA 6FABH 3WIAA 3SY0A 4D7PA 5DU7A 3VD1A 2Q1KA 2PCFA 2X4SB 3RPKA 1JN6A 2OMBA 2MRYA 2JP3A 1H88A 3BP4B 1VACB 2M1KA 3T0WA 4ERSH 1ZHBB 1N7SC 2DQFA 1E0OB 5IB4A 4PS4L 1R3HB 4N90E 1TYJA 1WTLA 5C0GB 2FSEA 3BC9A 3OKYA 1DBAH 1A6VL 3MLUL 3RGUA 1IFHL 1I8KA 1TQVA 2A1WH 3EFOB 4G9DB 2VR4A 4PJHB 5DUBA 2V17L 4ZUVA 3ZDXF 2MKLC 4BSWB 1TO5A 4PSRA 3L45A 3MLWH 1MHEB 4JY5L 5ACMA 5JHAA 2R9HD 3DGDA 4PJ8D 1QFUL 4PJ7B 3LH8A 3WDHA 4KZEL 4S1SL 4HKJB 1LO5A 1DTUA 3JTBA 4N24A 4WV1C 4H0IA 2IAMA 4NO5B 3UTTE 1KN7A 1VF5C 5A40E 3X3GL 1KZUB 1AE6H 1U21A 5JHMA 1URQB 2GI7A 4XI5D 2WAQA 4W4OC 2MCPL 3KLHC 1DQJA 3HE5B 4QCIA 1U8OA 9PCYA 3ZLQC 4DERA 5F9JB 1M8OB 1BLNB 1D5MB 2K9FB 2YZ1A 4N86A 3L4XA 4RWYH 1MW0A 1R6VA 4W9JC 5LN4A 2I24N 3Q6FA 2OYMA 1GOFA 5IROC 2YQBA 1KBGL 1CFQB 3NPSB 1SQBD 2VQTA 1YEHL 2R29A 4HMEA 1T83C 4A7UA 5EZOH 1H0TB 3QO1A 4URKA 4L5FL 4WSKA 4QHNA 4ZXBB 3CH1B 4GS7B 5DFVD 5D7LA 4X9IA 4F2MA 2CPUA 2QQKH 3MV9B 2NT1A 4A38A 2B5IB 5KJRH 3KHQA 3BKJH 4KH2A 2EP6A 3UJIH 3A7OA 2B4CL 3KPRA 2OMWA 1XF4A 3MZTA 2F15A 2YN5A 2QHLA 3ZRSA 2DLFL 3LH2L 5DJAB 3NAAH 5CUSL 2FEDD 5EO0A 3P77A 5TPWL 4ABUA 1MEXH 2XRAL 3KYNA 5G5DB 4NSKB 2ICCA 1PGQA 4WO0A 2DYPA 1I7RA 4GG6F 1MJ7H 4ETYA 5L4FA 5D2LB 3DVGB 1FRGH 4D6TG 3NIFE 1YY9C 4DPRA 5ESQA 8FABA 3PWJA 5FECB 3QNXB 4J23A 2FD6H 3U0PA 5IIEB 2OYIB 2DF3A 5DMIH 3QJOA 3WCYA 1S7SA 1LO2L 5ERWB 5L9DL 5DMKB 3N1QC 4Y5XB 2ADIB 2G3AA 2R59A 1Q9LA 5JZ7D 5I5RA 5MEQA 1S9YB 3AJ7A 3DPBA 3WTXA 1PSKH 4GPVA 1NCDL 1AY1L 5KSUA 3SPVB 4E9QA 5FFLA 4LDLB 4QO1B 3HJ0A 1KIPB 2CG9X 4WHYG 1NCIA 4WHYH 4J3SA 3GMLA 4ZO6A 1VEMA 3FCTA 1FPTL 3UTSB 3F7YA 3QQ3B 4NZFA 5D5MA 1TSHA 1WO2A 4QRRE 4ODTL 4HBCL 4ZMZA 5CEZL 5I76B 1MRFL 1O75A 1ZANH 3ORJA 4TMPA 1ZLUH 4XWGL 4AWJC 1R3KA 1XZWA 5E8DH 1FNSH 1E4HA 4PD4K 1J8KA 3E1IA 4YX2H 1SJHB 4POYA 1WIOA 1YPZB 2UY6B 1GC1L 2Y7OA 4KMTL 4RDQG 4W70A 5F2FA 1UGKA 2CIKA 1OAYH 2VLJB 2X7LA 3HLAB 4NRYB 5DHYB 4F33A 2DQCL 5ESVA 1JK8B 3VWKD 5AAWA 4YGAB 2VLRA 3V5KB 4X0KA 1F18A 5C0FB 1FZMB 2IXQA 1GGIL 2NY6C 1KC5L 2R2BB 4GRWE 5KKZC 1DO5A 3D39E 4NUJB 1EBAA 4EIBA 3NCEB 3MA9H 4KXZH 2Y2YA 3TBWA 5BS0D 5L7XH 3CFKA 4HJGH 3EJRA 1PS3A 3PNRB 4KNSA 1IKFH 5D7KD 5E94B 3LNFA 3GSNB 2ZYHA 1D5XB 3DRTB 4KKZA 2FBJH 2WO4A 2IPTL 4EI5B 5KSVA 2X2HA 3KL3A 2K1MA 4RJTA 3DV4B 2VH5H 1BG9A 3ELQA 3RY5A 3N42F 1KNOA 5DD6A 3QUMH 3ARGA 1F4YL 3E6HB 2YXWA 1EDIA 4K5NA 1FJ1B 3MGTA 2P4AB 1SDAB 2HFED 1P7BA 1KB9E 2JELL 3IMRA 4JFWA 1JZ2A 1V54B 3X1NA 2PXYA 4PRPD 5HP5A 4WTXA 1Z3GH 4JPIB 3VWJD 3IT8D 3EJSA 4I1RA 4OLWL 1AS7A 4M6NH 3CD6P 4CSSA 5JHDD 3G7TA 1KEGL 2FEEI 3QWOC 1RF1C 1ADQH 4HIIB 4J2XA 1BWWA 2J8HA 3K46A 2Z34A 4C56A 1S9WA 3GHPA 4ZAKA 4EE2A 1GCFA 5IOPA 2IPKA 5GRVL 2AJSH 2JB5H 2MHAB 2R4SH 2ZWYA 4JHZA 4LL1A 3KPPA 2DIBA 4FS0A 4LQFL 5HHOB 3OQRA 4HDIA 4R4FL 4JCMA 2V37A 3NIGB 2XQBH 1JG9A 3BT2H 5CR1A 3GRWH 4DP5X 2JI3A 2NNAB 4ZD3H 5GGRB 2WUBH 1AFVH 5HVWA 1QBML 3CDYA 1UIXA 4P4RA 2ATKB 2YGQA 2ZSWB 5ISZA 1ZSDA 4PRIB 1OTSD 1PY4A 5DJDA 4J1UA 5IVXA 1EAPB 2OSYA 4QWWD 2AK4B 3D2UB 3QEHB 4R90L 1IEBB 2R3CA 4ZFQA 1BVZA 1VFOA 1XXDC 4MCZB 4D8PA 3GXDA 2B20A 5E6IC 4B53A 3PRJA 3PDDA 4GMTH 3PU7A 1DDTA 1BCCE 1IBGL 3AAZB 2YXRB 4BFIA 4LSUH 4GAAA 1DBJH 1F41A 3IRPX 1G94A 4NEHB 2DY2A 3PHAA 1SLWA 2QJPC 1TJIH 2OMZB 1SEQH 1HF9A 3BSZA 1CFSB 3SGEI 2CE6A 2J1KA 3QPXL 4X6CE 2FK9A 2P26A 5DUMH 4YDLC 1ZTMA 2WLLB 2IGFL 4KVCH 2ICWJ 5EOQL 5FWRA 4JKLA 1JV5B 3LNDA 2R2HB 2XKMA 4IRJA 4UM9A 1QLRA 2UX7A 4JZOA 3A6CL 3FSZA 1IC5H 4XPHH 1IE5A 3V0WH 4X7FC 3BIKB 5DQDH 1USDA 1E42A 5AWNH 1DHKA 4HULB 3MRMA 5A3IC 2FX8H 1MFEL 4XCCL 5TQ2L 1L5GA 4WKZB 2IBZI 2MJZA 5AW5B 2HJLB 4I3GA 1BZQK 5FDYA 3L71D 4K2UL 3MGOB 3U25A 3E8UH 2RALA 3FT4B 4NZTH 2XHNA 4TQ8A 2WSKA 1F45A 3NCYP 3D6YA 4ZOBA 1NAKH 3M17A 1EAOA 4FLOA 3NN8A 5C0RL 3SPGA 4O02H 4JRXA 1QR4A 3D18B 3K5RA 3QHTC 1BZ9B 4NFBA 4F7MB 4JFDB 1VGKB 1EXJA 3QIBD 5HHVH 1YMHB 3WIHA 5I2IB 4N1HB 1JGVL 1JD9A 1J0ZA 2JTYA 3CZFB 1RZGB 1RZJC 3N06B 2CGRL 3AE5C 1ITCA 1YNTF 2K9UA 3N3EA 4ZS6D 1HZHH 1I8IB 3IGKA 1G1CA 1QFWM 3AXIA 4J8RB 1C12B 4X7TA 4JDZA 3OD3A 1WS7A 1L0LG 3F6IA 4GKSA 1L9MA 2R9HC 4PJ8C 4XMKH 3IDJA 4P2CG 2DWEB 1NKGA 4G5AA 5FWQA 2R83A 5IVXF 1G5AA 3EOBB 2BIPA 3EGXB 4G71B 1H8NA 1I3RB 5E6YA 3PWLA 2J5WA 2PCPA 3W38A 5FPIA 1K6QH 5E4EB 2ED8A 1A1MA 2YUXA 2P5WE 2FT7A 4AQ1B 4XI5C 2P45B 3ARED 3ARXA 3VP8A 3TSIA 4Y2OA 2G2NA 5AOLA 4N28A 1J1OL 4AGNA 1EDYA 1T1WA 4A2DA 3H8NA 1KTRL 4OZHF 3WO4C 3I2CL 3CHOA 4R6UA 4BK8A 1I1AA 3MRHA 3D3VA 4HUNB 1NPUA 3MBED 1J05A 1A02N 5DFVC 4FNQA 3KW7A 3MV7D 2DKUA 2A2QT 2Q0ZX 3K2UL 3FU9A 3UG4A 4WTZG 3V7AG 4ASVA 5SX5H 3QUYB 3JWOL 3CVCA 3HTLX 4JS7A 1KELL 2CR0A 3AB0C 3GBML 2IDQA 4NQXB 1HH6A 3WY2A 2FEDC 4CVWA 2OL3L 5DRWA 3KWXA 2VL4A 3PNWB 3T65A 5C0AB 3X3FH 4ZS7L 4NWUL 5EU5B 5AKSA 3II1A 3SZKC 2HKHH 1FH5H 3H54A 3LXAA 2FXMA 1KB9K 1O0VA 1DQLL 2G3ZA 2F7IA 4N6JA 1L9PA 2PWEA 3SPHA 1OZHA 3BCCJ 4TLUA 2PTTB 3EFFA 4P8QA 5JZ7C 4WUUD 4XPBL 1X5IA 4XMPH 2VLLA 5KBPA 2F5AL 4JO2L 3LCYA 3VI3F 4FQJL 3TJHD 1T6BX 4TNWK 3UZEA 3KDMB 5E5LA 4LCUA 3S5YA 3ZY7A 1ACCA 2B87B 3NA9H 4HIHB 3KCPB 3GGWA 1IFNA 3RGHA 2J8OA 1T0OA 3QC5X 4ETQB 3B5HA 4PJBA 1FN4A 4NGHH 4KOBA 2JQAA 4NRZA 1FC2D 1RURH 2QPDB 3ISYA 1RUKH 2HCZX 2QKIB 2OW6A 3VFNA 3DUUB 3MRGB 2KYIA 4GUPA 5E2UL 2WSSH 3ARFB 5CCGD 3T3PE 3K4DA 2ITCA 1FGVH 2D7PA 1T5WA 2G0LA 4W7YA 3I74A 3Q7JA 3VWKC 3LNGA 1BGYD 2WKOF 3G5YB 3QZMA 3FYIB 3LN9A 4HCRL 4U6YB 1FL3A 4L4TE 3S3SA 4AOFA 4BXLA 4E41A 5IKCA 2VO8A 3OKKB 1CGSH 3GIVB 1LP9E 5GIRA 4LO9A 4QRPD 4LSRL 4J3XA 1F4XL 4E9RA 3OKLB 3TT1L 3KWUA 2V5YA 2OP4L 4JPKH 3IVKB 2OMUA 3H1ZA 2PW1A 3TIEB 3ZIMA 2IH3B 1MCPL 1I3VA 2NW2B 4EI6A 5JR1H 2EICA 3L4FA 2AITA 1SYVB 3V0EA 3RWDA 3TF4A 5TISH 2I60H 3EG9A 2WV3A 4AZ8A 3M9BA 1JVKA 4CGUB 2WN3A 2DH3A 5CXPA 3FUMA 1KGYE 2PR4H 4RMUA 5FIEA 5GRJL 3BSGA 1SJEB 3GTTA 1WISA 3W0WB 3VWJC 3GSNH 2HFGL 4ZTOH 3ZGHA 1P4LB 2O4EA 2DMHA 3ARVA 1GHFH 4HXAH 5ETUB 3MCLH 4EDWL 5TJWK 3HBZA 1OOAA 2Q8AH 4QHLB 3MTRA 1G6RL 4LGPB 1C08A 1N73B 4Q14A 1BBDL 4XMTA 4LKCB 1QI3A 1EEQA 3LKSA 2BP0A 4IKJA 5F7EL 3QJXA 1SQXE 3EH2A 5E4AA 3OKDA 2CHNA 5E1AB 2JE8A 2OR8A 4PJBF 1MWAB 1SBSL 2DTSA 3CN3A 2AJVL 2VJ8A 5DZOA 3O6LH 4CNIB 2VRKA 3A24A 3NJGA 3H1JJ 5LXGL 3ASWA 1OTSC 1JF6A 2IANB 4HJGA 5DLML 5FO7B 3VTTA 1T7ZA 4H0LD 2XWZA 4QWWC 3ZYZA 1U8KA 3B56A 4U1MA 3ARUA 5AB2A 3LPOA 1NM9A 3UADA 2EXTA 4Y1AE 1OVRA 4RSYA 3PAUA 5T33L 2HPCA 1EUUA 1OAUL 5DQJB 5DDHB 3WFDL 1MFCL 1JDAA 2UZIH 1X6LA 2V5RA 4HGWA 3QUMA 3TCLB 2FQFA 5E9NA 2HWZH 3ABKB 1GD2E 2DI7A 3CLEL 3SYPA 1GVIA 3KM2A 1FDMA 1G84A 1UWGH 1NDTA 2C9PA 1ID2A 4UB8E 4HF5L 3ZHNA 1DBMH 4RESB 3RKDD 5ANHA 2EXSA 4YLBA 4PM1A 4XB7A 4WWPA 3ULUF 4MNHA 1EZSA 2Y5QA 2ZG3A 4P5RA 1ADQA 1VADA 2XG4A 3U30C 4BFFA 1IV8A 1DJHA 5JNYA 1U2CA 3HBGA 1OB1A 3VUAA 2LXCB 2XKSA 1OCWL 2JKTM 2KS1B 2AQSA 1OTUD 5F72S 3FBKA 3NABH 4DKFL 4KVNH 5MEOA 3B2UD 1NVOA 2W1NA 4M8QB 2JJUA 2WYTA 3GBEA 3CC2P 3GRWA 4NX0A 2FX7H 4V1DA 1J2JB 2FYUJ 4N8CL 3QRGL 4JY4B 2Z4QA 4DZOA 2YD7A 2VDOL 3QIBC 1S9KE 3IPBA 1J1EB 4OWFA 3MHVA 3MFFA 4KY1L 4MVBD 5DGRA 2GJ6A 5ABDE 1AS8A 2C9SA 3CDZB 2NY0D 3FTVA 2LFGA 4P23A 4MB3A 4RDQF 4F3FA 4ZS6C 4XB3A 4U49A 4XPGL 1UTDA 4IDJH 1JRHH 1ZWIB 2I07A 5I75C 3L4CA 5CFAA 2ZWKA 4WI4A 2A4ZA 5D1QE 4PP2B 3GSXA 4KJYA 1SXCA 4PJDE 3K2MC 4TULH 2N9YB 2H9GA 4HETA 4KV5E 4WWNA 3BWZA 1FG2B 4Y8AA 4YXLL 4I9XA 2F1AA 4NUMA 2OX5A 1WICA 4KXZI 1S7RA 1S3KL 1I1CA 3EJJX 3AREC 4OLXL 1E5UI 3PGDB 2R1YA 1KORA 1LK2B 1UC6A 4UZGA 3D4CA 1N9PA 5ALBH 3N5AA 5GZNA 3HG1D 2E9IA 1XF2B 5F9AC 4YIQA 3JBG7 3S3PA 3M07A 4UDUB 5FCUH 4YEFA 4MCYA 3D0VA 4FYRA 1BQSA 4QPEA 5T3ZD 1Q1JL 3HG5A 5FYJD 4G1EA 2A4EA 3D07A 3MBEC 1BGXL 1C8PA 1FG9C 3FT2B 1HAWA 4O02A 4P48A 1OAXL 5IJCC 2KZ1B 3CFCL 3H56A 4S0HA 4FQ1L 4ZDHA 3B9KA 2A45I 3N44F 4CN4A 4HHWA 1JUNA 1ZR4A 5C86A 4L9LB 4E5XB 3SGJA 4JPZB 1RMFL 3CFDA 4FAAB 2FLMA 3M1OA 2IF7A 4LBAA 2OTJP 3TJEL 4WI0A 1TJMA 1IMHC 4F58H 1IKNA 3OAUH 4CN1A 3PQYB 4NERA 3ZKXC 3VQMA 3ESUF 1SQQG 3VGAC 3K5SA 2CLZB 2X5PA 3BZFB 3FS9A 2EUXA 3BP4A 1P84H 1XIWA 4PV8A 1J86A 3HMXL 4F20A 5TQ0L 4CMMA 1WUNT 4KO6A 4R5TA 5JW5B 4B0MM 3MV8B 1NAFA 4G8GB 3TJHC 3EXJA 5I6OA 2FATH 3GO1H 3LQAL 1X3DA 5JW4R 2FYNB 1OP3K 4HCRA 4IKKA 3O8XB 3PWUB 2WXIA 3BPLB 4PJ7A 2BNQB 2PFXA 2YA1A 1TTUA 5EOCH 2VISB 2KP8A 4PJIA 1NBCA 4NPYB 1JY3N 1N8RQ 1ZIBA 3ZKND 2KQNA 4JRYD 1FC2C 4X8JA 5E2WH 3REVB 4PLOB 1M05B 2NTSP 1DLFH 3VE0A 5TK2A 3S3JA 4NQTA 4TQHA 3HE5A 2IH1B 5CCGC 3D4ZA 3WS3B 4LE8A 4WTZA 3VDCA 3FUFA 2JKWA 1NAML 3IJ9A 1A22B 3BVNB 3GEFA 5D2NB 3F5WA 4NQSA 1FP5A 1S6NA 3KYOA 3SBWC 3T3MB 5I66B 2CMRH 2YEZB 1EXUB 1UA6L 2E56A 1PP9D 1FLTX 5IFAL 3TYFA 1U8MA 1BQRA 3FL7A 3FN3A 1BMGA 3H9HA 3O2DH 4TNVF 1H0TA 3IMSA 2XV0A 2ICEC 5T5FH 3L75G 5BCAA 4J3OG 3FB8B 2MPAL 1QACA 1W9XA 4J3OH 4ZSOE 3Q13A 3CAFA 2VAAB 3CH1A 4MZRA 1TPXC 5KVEH 2OGUA 2RTTA 4KJWD 3H42L 4GRWB 1JE6A 1CI3M 3QAZB 4G7QB 1TZOA 5F7AA 4OZIF 4JPVL 3L3OB 3HS0A 2FHFA 3HNTH 2Y7SA 1E6OH 3CZUB 5I30L 4YPCA 5IFJB 1L0XA 3ZHFA 4C8XA 1MZ9A 1P7KA 3T5WA 4XOCA 4R96B 1YBKA 4ZTPH 5D2LA 3IMBA 1OXZA 2HSIA 3U9UA 3CZKA 4G1MB 1PBYA 1RK1B 1QABA 3K1DA 3QQ9D 5CZVH 4DQOL 2YHGA 1K73Q 4YAQB 4FMFA 2XZQL 4N26A 4PJHF 4D6TJ 3ZT5A 5BV7L 3FKUS 4GBXB 5DMKA 2IGLA 3K6IA 1ZPUA 1L0YA 4X5QA 3WNJA 1PAZA 4DCQA 2HZHA 1SQBK 1M56D 4WW2A 4I77L 2LGNA 4OF5A 3CBRA 5TH2B 2XV2A 3PAZA 2YPVL 4WWKA 3RJDA 4TQPA 1N2RA 4HGKC 1HHHB 3WAKA 4ZODA 7FABL 1A64A 1N68A 3EW3B 3DDFA 5FEBA 1ZT4A 1BVLB 1GRWA 2EXYD 4H0HB 1BOGB 2WXPA 4MN4C 2ZP0T 4H0LC 4HWNA 2Z65C 5T8IA 1JDCA 5E0FA 2BVOB 3U46A 1NFDB 2CDGB 3NGBB 2VR8A 2AANA 4XFJA 3BLKA 3HUJE 2UY6A 4WUKH 4JZJA 4Q89A 2C3VB 3HLAA 4B7LA 1S9VA 5DHYA 1KTMA 1RZKC 2JCWA 4BCZA 3TYYA 3BPNB 5J0BA 1CZ8H 1FZMA 3CJJA 4ZMOA 1LT1A 4NUJA 5T1MA 2P67A 1OIOA 3QO0A 4W7ZA 2FO4B 4F1ZA 4L3EB 2AEWA 3BH9A 3RKDC 3GSNA 2PLTA 3DRTA 3FUEA 4PD4H 4XNBA 4LVNC 5E7BA 3P8MC 4TLKA 2JWAA 1F6AB 3V9EA 3MRFA 2BVEA 1FGNH 1OTUC 3FK3A 2VRQA 2AEQL 4HISA 2ZXGA 5GRUH 3JTSA 3P9LB 4UQIM 3S37X 3VGGA 3B2UC 5AYUH 4XMXA 1VPOH 1CSBA 5FO9A 2WKGA 2YXFA 2WNKA 1FNAA 5GJTL 4XAKE 2C3WA 2DEYX 3WLBB 4KHXL 3TA3D 2HRLA 4QRAA 1T03H 4KT0J 4MVBC 4HIIA 3DXAD 2NY0C 2YD6A 2WVSA 4OM1L 2G9HB 5M7QA 1JDDA 5HHOA 4KZ0A 2EVJA 5SWQA 2X6CA 1U93B 1TZHB 1S7WB 2QQNH 2BM3A 1OM3H 3JUYA 4Z78B 1D2OA 3L81A 4YDNA 5K59E 3IDXL 5JA9A 5E5UB 4OKVA 1SYSB 4Q6KA 4PU2A 3I02B 1NFIB 3EDEA 3LKNB 5DJ6B 3PJSB 3KNBB 1WFOA 2ATKA 1B6DA 5CJ8A 3RVTD 5IMOA 1QI5A 2DL2A 1YPZF 5E4IA 2AK4A 4FMKA 2WQYC 5APVA 3LSOB 4GOFA 1IEBA 3LIUA 2JEEA 1XGPB 2KIKA 2WN2A 2F5BH 1RJZB 3BD3A 3SKJH 3SSUA 3ARQA 1RZ8A 2HX8A 1J0IA 4NKQB 5GGSB 1L4AA 1PJ9A 2ZXBA 3AAZA 3C8KB 5B21A 3L6FB 3SDDA 4ADJA 1JZ5A 3MRPB 3T08A 2OMZA 3QARA 3V4PL 4RO0A 2QPSA 3IU3B 3Q3GB 4P04A 3RPIA 5HTSA 5DS8A 4LLWA 2WLLA 2Y5TB 4L3FA 3K81A 4NB7A 1ASOA 3IWUA 2R2HA 3W2DL 4HUWB 1U8IB 2X87A 3HC0B 2H8PD 1OAKH 3TC9A 4J4PD 1T7YA 4WGKA 1GGBL 5D96B 1XWVA 1YYLL 3DYMA 2W94A 4NIYE 4ENZA 4WFHE 2D7MA 1BE3E 3EUUA 4X83A 5GISL 5TE6H 4CC4C 3QDMB 3M0DC 1DUYB 3FT4A 2C1PA 4QMAA 3QFJB 5GGTH 5TE4L 1D9KD 1CBJA 1RE4C 4UILL 2WBJB 1DJZA 1NGPH 5IHHA 3B43A 5IQ7L 1P5UC 4WY7L 1BZ9A 3G5VA 3ABZA 4JFDA 1CDIA 4A7PA 1PL5A 2KNCA 3HKFA 4R84A 5I2IA 1LO4L 3M7OA 5TDPB 5KSAB 1LO3H 4E5XG 4LHJB 3NIGF 1RVFH 3VH8A 5C6TL 2VNCA 5EWIL 1I8IA 3OKMB 4MBRA 3R7RA 4V2BA 3GSUA 1C12A 2ZVOB 4XHJD 5APUA 1G9NC 3VFGL 4MJ6B 5IBTH 2A77L 3FJTA 3WTYA 2YUVA 5LBVA 5SWZA 1AGEB 2J1WA 3EOBA 2VXQL 1C7TA 3P11L 4MXQD 3ZKNC 1V8HA 2EDKA 1W15A 4XXWA 1L0LJ 3BN9D 2VAJA 3MLYL 3H1HE 1W91A 1MFVA 4AQ1A 4ZFGL 1NTDA 4LIQE 3JWDL 4WK0B 5CR8A 2N7SA 2V7HA 4GFTB 4DP1X 1T0PB 4Z76A 3L72E 4KJPD 2EO9A 3QJFA 3FOMB 4H26A 1TMQA 3PUCA 1B4JH 4U1IA 1LNUB 2O72A 5FK9B 2EDNA 1NCAL 4GAJH 1EEZB 4NKOB 2IEPA 4JFPB 4C4KT 5IW1A 4Q9RH 4G2AA 1X22A 1GZPB 1FFPA 1JFQL 1KJMA 2DQEH 4LSSH 4OT1L 4YEEA 5K9QG 4XMLH 2Z3FA 4R26H 5LWYH 2X1QA 2XQYG 4KJWC 1UIIA 4WJ5B 4J12A 3FXIC 3WIIL 3CXDH 5IK3B 1KFAH 3RAJH 3OGOE 3H7BB 5BOZG 4IIQB 3CSFA 1KCWA 4OU3A 1IILE 5I9QC 4NQXA 3DX6A 1WJ3A 3QI9B 3D33A 2RD0A 3V0AC 1FYTB 3T8VA 4LC1A 4LVOC 4KH9A 3KDPB 5F1IB 5C0AA 3O11A 4I8DA 5AVXB 1F3JB 1JRHI 5BU5A 1GIGH 4LDEB 3FTWA 3WEXB 4M8UA 5KOMC 1L6ZA 5JIKA 1EFXD 5KEZA 3TGUG 2K7PA 4QOKD 4GRWH 3RL1B 2YGVA 4F57H 4NC1E 4QNPF 1G43A 1N6QL 3AG2B 4N0CD 5AYTA 3QQ9C 3RL2B 5B39B 4DH2A 1EA9C 4K3DH 5D1XD 1OKEA 1OSZA 5CJXA 4ZMNA 2M0BA 1IC7H 2NQCA 4YGVB 2DTMH 1NC2D 4LGDE 1NEZG 4KXCA 3CVHH 2QHRL 4Y4HB 3S3BB 3WSQH 5DC9B 1MI5E 1TQCB 3S0PA 3A67H 1H8LA 1RULH 1Q0EA 3P69A 1C1EL 4IOFD 5IB1A 4F7CB 4DW2L 3O2DA 5JHLH 1KB9H 3PL6D 3U0WL 2IZ1A 3KPEA 5KYXB 3WNMA 2EXYC 3QIUD 5T5FA 1MN4A 2QPEB 2M2DA 2FJHA 3NCJH 2FY8A 5C0IB 3SDXA 5CGMA 4XVSH 3P32A 5DHEA 5CILL 1IARB 3DUUA 1JS4A 4JMXA 4F7KA 2NCMA 3EJPA 1TXKA 3TU6A 4BQ6A 3KZIE 3H4FA 5INDA 3MJ9L 1PPJD 1RZQA 4F8LA 2POHA 1N12A 2I27N 2HG5D 5DJ0A 1A4JA 4LLDA 4Y1AB 4UI2A 4YVUA 4RGOH 1JUFA 3MMEA 3JYBA 4EDXA 4DAGL 4OZGB 1KJVB 3NRPA 1KQLA 1J9RA 4U0RB 5T1KD 2XFGB 4ODHL 3Q5PA 4XP9L 1EQ7A 1IM3D 3S3CB 3GIVA 4GRLD 4KUZL 1SBBA 1BAWA 1WK0A 2BOBB 2DJ4A 1Y47A 2HPTA 1HWTC 1CFBA 3MLRL 1O5PA 3DMMA 4MS8D 2BOCA 4L8SC 3O3BA 1ZTXE 5LQBH 1XB6A 3OLGA 4O5LL 3TTYA 2NW2A 1P84I 3ZZSA 3Q05A 3PXJA 1HCVA 3UYRH 4CKQA 2BW4A 4H13B 1YQVH 1LLAA 1ZV5A 2D7QA 5CBOA 2O93L 1URZA 1HSAB 1CL7L 1D5IH 3WXWL 3KGRA 1F4AA 2HJKB 1SJEA 4ZZFA 2A6DB 1BFSA 2BIHA 2WOYA 1SNRA 3O6KL 3TA3C 2X70B 2WK2A 4LVHB 1F42A 4WGVB 3U83A 1T22B 3GXPA 5J12C 1IIKA 4HJTA 4Z7VB 3VD4A 5K9JH 3B9AA 4QHLA 2VGLM 4RBPK 3QQDA 4Z95H 3RNQB 3UTPE 4UF7C 4RA3A 4LKCA 4OGXH 2DYSB 5FYJE 1FI8C 5AVQB 2QGDA 5CHXA 4H25B 3V4WA 1P1VA 4NRXA 1G9ML 1D2PA 1WFTA 2Y3NA 4H5SB 4JVPA 1JVLA 4XGZA 1EXGA 2J1YA 1ZHKA 1RZFL 1A7NL 1AP2B 3HKZA 4J3OF 4YSEA 5B3JE 3F8UB 2C34A 4Y9FA 5GS0L 1KXQE 1B4LA 3RVTC 4TSAL 3IKCB 1E50A 2IDCA 1UATA 2HT3D 4KHTH 3OJVC 1XDTT 4YDZA 4PJDB 1J8SA 5DJUB 2XICA 1BD2A 3GZQA 4LCWE 2E74B 3IDYC 3SGKC 3D4GA 4HUMB 2D7TL 3FT0A 1R3JB 2KH2B 5FHBH 2N0KA 1EHKB 2W9EH 4W80A 1QFHA 2CUMA 4NHCL 3OHXA 4MDIA 5DDHA 4ZMVA 5BRZB 2DH2A 5L2JB 1ZVHA 4Y16A 2B2XL 3EH4B 2X6BA 2BZ7A 5IQ9B 3RL0B 3DO7B 3TCLA 3IU4H 3P0GB 3AE1C 4MAYA 1XTLA 5DC4B 1F90L 3N85L 2C1OB 5E8PB 1EHLL 3LN5B 2HR3A 2OTWB 5HPMB 4M3LA 1AC6A 4HT1L 5EF3A 4X2UA 5D6DC 1OGAE 1YYML 3MRLB 1JTTA 3BE1H 3MV11 3U1QA 2EH7L 5LLIC 2FBOJ 2G0KA 4PJ5B 1FZCB 4XPTL 1NCOA 2OZ4H 4ODSL 4OBSA 5JQ6L 4J4PC 4AT6A 3RK2B 4NPDA 2DQIH 4AYMC 2X1WL 2GG1A 4MJID 2RR3A 5I0YA 5DVPA 1UXWA 2G5BB 4TVPH 1NBYA 4R5XA 4PVLA 4JM4L 3S37H 5HYQA 1M7XA 1FZKA 4E68A 5D7JB 1K5WA 1D9KC 4YHLH 3RIFF 1DD3A 5SWSB 2VXUL 3QRFM 2CDFB 2XIBA 1XSOA 3AS3A 3OAYH 4F9PA 5HHPA 1QNIA 4KI5F 2R8SL 4F8NA 1JNNL 2I5YL 3RUGE 1KTCA 4WF7A 3MA7B 4YSPA 1RU9L 1NIEA 1KV7A 2X4PB 5I74C 4WJG3 1YJ9P 1M6OB 3EO0B 3MLXH 4HS3A 4P2QD 5I0VA 3KGUA 4HUVA 3Q43A 2KZJA 3UBFA 4HJEA 1TU3F 4XHJC 3J07A 2ZYDA 4HHGA 3OZLA 4WY4B 4GP8B 2YXMA 5HGHA 4GEJA 3CCHB 3D34A 2BVUA 1HXYA 3FT3A 3EH5B 2VABA 1MHHA 5DD3L 3WEMA 5HYFA 2RJMA 4MXQC 4B9GA 1UCBH 1FG2A 12E8L 5L2KD 3QCVL 1U4EA 3BN9C 4XPAH 1KMGA 4MAZA 2AV7B 2XTJD 2I25N 3LS5H 2FWSA 3D85A 4NWTH 4Z7UF 3F7QA 2D03H 3UTTA 4XWOD 3HZYB 4PD4I 2AXJA 1E4XH 4L4VD 3W82A 1LK3H 2WSPA 4B95C 1VQ4P 1IGIH 1CD1B 1NDGA 3IN2A 2OL3B 4KJPC 4NJAL 4TUOB 2NPSD 3I9GL 3ZJAA 4Z6AT 3P2DA 3MCKA 1XF2A 3OR6B 3OKEB 1WZKA 1EO8H 4JKKA 4ORGA 4U6XA 5F7BA 3ZMEA 4DNLA 4ZMXA 3CC7P 4B9IA 4HJ0D 4NI3A 4FA7B 5GGTA 5LDUA 4IJTA 4AG4H 3T0BA 4K55A 5DC2A 1NMAH 1XZ0B 1F00I 4OJYA 3KE0A 2Q5BA 1X7SA 4MQSB 4P2RE 2YFOA 1WBZA 1OPOA 2N1TE 3WUUA 2PCXA 3EZJB 3RY4A 3VE0B 3K71B 5F7LB 3FT9A 1HHJA 4ZSOB 5C7ZA 1UKQA 4A7GF 2EIJB 4U3HA 1QVOA 1V7MH 4W9GC 5IQNA 4BFEA 2HN7A 4L9LA 4NXSA 3HN8A 3L2LA 2ZXDA 3JCUE 4NQUA 1I8LA 3VXQB 3HTKB 4JF7A 2VT0A 3PGFH 1RK0B 1HKFA 1V3KA 1F1DA 3BUYB 3MC0A 4G6KH 5BZWB 4X50A 3O3EB 2O01H 1QTYT 1RLBA 3VGEA 1G7QB 5M95B 1CFVL 4ZZKA 5F7KC 3EFDL 1IAMA 4N0CC 4RMSA 5K9OB 4OTXH 1J12A 3MIWA 1KPVA 1QO3B 3ZKQD 5I17B 3P3TA 1HKLH 1GGUA 1AZCA 3VD5A 5D1XC 5HHME 3VXNB 4TRPH 4HH2A 5JW5A 2WPSA 3H25A 1G9HA 4XX5A 4U2ZA 1QNZL 4KDWA 4N78E 1TQBB 4IBYA 1CIDA 3P4OA 3KJ6H 3OAZK 3PWUA 2I9TA 2AGJH 1UWXH 4QHUB 4X6EA 1MW2A 2BNQA 4IOFC 4UINL 1NGXB 2GPZA 3NJJA 3PL6C 4NPYA 3TK1A 3M0AA 3QIUC 1U8LA 2HVKA 4H8HA 4DKEL 1E4JA 4HA1A 5B39G 1W6LA 3L74G 3D0AA 2VDLH 1M05A 1RK7A 3K6SB 3X11B 3L73E 3VXSD 5GQBA 2PWHA 3CLFH 2XQYA 1CICA 2FNBA 2IBZY 1LYQA 3FUNA 4NDMB 3FTYA 3B37A 3VRLF 4OJCA 4XPFH 1A7OL 3L9EA 3G6DH 2KSJA 1K3ZA 4FXTA 1RZ7H 3UMNA 3B2VH 3R0MA 1JF5A 4M1DL 3KPSB 3L7EA 5T3XE 1XH1A 2VM3A 1EXUA 2YEZA 1Q90D 1OP3H 3VOPA 3WN5B 3AS2A 3W11D 4UOZA 3OZ9H 4YDIH 1SQXG 1U3HD 1NPNA 1PZ5B 1JF1A 1AZZC 3LPFA 3ZRCC 3MOQA 2HRGA 3Q8EA 2Y69B 2ZPKL 1CZQA 4GRLC 1A6TA 2ALWA 2YIUC 1Q9WB 4F37K 3KH4A 1IFMA 4OCLC 3WTSA 4JFFD 5IQMA 3L4UA 5IEKA 4AXWB 4MS8C 1HEJC 2DOCA 3GJEA 1G6RB 1JPGA 3D39A 3HC4H 4KTDL 4Z7WE 5I1KL 5AVWB 5H37H 3WJJC 1HWHB 3BKCL 1NKZB 3L75J 2CPSA 2P5ED 2XWBB 3OWEA 4N6QA 4R0LC 2D3JA 1X79B 3JWNE 2K6WA 5BVZA 1SMDA 2XIDA 4NT6A 4PY7A 1KZYA 2B15A 2FJUB 3DIDA 2XN9E 5FGSA 3OWRA 5KW9H 4B3EA 1F56A 5AZEL 1WSST 2HRPH 1IT9L 1LTJC 5ID1B 4OFIA 1E65A 5FC9A 2A74C 3OLIA 1D6EB 1DN2A 1G87A 1XHHA 2VC2H 1NEZA 3CVHA 4MNGB 2MCAA 3SE9H 4APXB 2H2PD 4YDVB 1IGFL 4TSBH 4NNYB 3V8OA 2R23B 4MAUL 1AGDB 3GIZL 3VXOB 1BEYH 5JHLA 5K9KB 2IV8A 3HBQA 5EO1A 4M6OH 4UB8H 1D5ZB 2Y7QB 3ULVE 2NNRA 2NY4D 3BDYL 4YAQA 1I8UA 3T09A 1G7JA 2VDNL 4OJAA 2CU9A 1NBZA 3VSUA 2W81C 1BQ5A 3HZMA 4IBUA 5C70A 3CIQA 1URLA 4BXVA 3D69B 1S7XA 3CFTA 2H1PH 4NUGL 3UIYA 1PGJA 1USZA 1EJ8A 3H0TB 3I75A 1ETZB 1OHQA 3GFUA 1HHHA 1DDHB 2V5MA 1JZEA 1LP1A 4GOSA 1PY0A 2PYEE 2QV4A 4G7SB 2JB6B 3CGTA 4JHVA 2BP5M 2P80A 2WP3T 4N2CA 1VFMA 2HT3C 3N43B 2YAOA 3SYOA 1H5BA 4N2NA 3NCBB 3KLSA 5HYIA 2BVOA 5FLUA 2CJUL 1CGYA 1NFDA 3LRHA 5KTBA 1OGPA 4IEFA 4OR1A 4PIBA 3T3MF 3UAFA 5K9QI 5IM7A 1XCTB 1HS6A 4HFWB 1XEUA 4Z7OE 1NCCH 2NZ1A 3VAEA 4RIRB 3ZDZB 4KFMA 4DUWA 2VLKE 6CGTA 3O9WB 3O4OB 2GSIB 4IK6A 4QXWA 3SE4A 1SUJA 2R1WA 1EBPA 4BELD 3IGAB 1KYOH 3IE9A 4K9EC 3BYTA 3MXWL 1O9VA 4GRWF 4NN5B 3KYKL 1UZ6E 1OLLA 2VDOB 2ISDA 3ZZLA 5FYKD 2K6ZA 1M1KQ 2DS4A 5AW4B 4KXAA 4A63A 3AT8A 4X6CA 1XX9C 3D9AH 3EJCA 4XP1H 4P2OD 4U3FJ 4O9HL 1A6ZB 4K2UH 4N9GB 2XLLA 2XYBA 1CE1H 3U2IA 2F74B 3PDGA 4GW1A 4AKPA 1SEBB 4F7PB 5JYLA 5I1AA 3VXUD 3H53A 4HAGA 2Q10A 3K8LA 3G04A 3Q48A 4ODBD 3ESPA 3BXNB 2Z7WA 3WLBA 2KUBA 1MJJB 4WVRA 2ZOUA 3T8XA 1WWCA 1AZBA 2WZ0A 1KXVA 3M6DA 1KCUH 3OLEA 1KB9I 1WRGA 1GYAA 1AA0A 3QCUH 5C07E 1RZJL 1SZNA 3EDKA 1IGMH 3ZMRA 5LHDA 3DTXB 3ZK0A 4FFYL 1G4RA 5JDSA 4D3CL 5HYJA 4EQ3A 4KRNA 3NJFA 2LVEA 4QHPA 1ZLVK 4NXKA 2B9BA 5IOKA 1JXKA 4BWNA 1RIUL 1SYSA 2WB1A 3QULA 4Y99C 3HHRB 3I02A 3S6CA 1NFIA 3GXNA 2D0FA 1DQQB 2EDJA 1JPEA 1LTTC 1AH1A 1NFDF 1G1OA 2QGBA 2ZUSA 2XTJC 2TAAA 2WLJA 3IDNB 3POHA 1E5YA 3L9RA 4PMEA 1MCHA 3ZXAC 5C0BB 3BH8A 1VQ9P 2IPUK 1J9CT 2OZ4A 1OFCX 2PTVA 4M5SA 4OSUH 4XWOC 5E00B 3X2QB 1X5JA 2ZNWA 43CAA 4X8GA 4GW4A 1NICA 3CFNA 4HCGA 1M3IA 1VFAA 4YWGL 2P5WA 2NPSC 2VDQL 2FRGP 2BNRD 2HT2D 5C08D 3U4BH 2IC2A 4K71C 3O0RH 4OV5B 1U2YA 1NGQH 1RJCA 1NIBA 3G71P 5I0DA 3QYNA 4HJ0C 3IU3A 4U05A 1WH0A 3GKWH 3S35L 1SQVE 2RH0A 2HKFL 4LCVA 3NCYS 3MODL 3D7PA 4FTDA 4JNXA 3OJ2C 2EVIA 4B6ZA 2VDML 3DGGB 2VJ0A 1N7LA 3BN3B 1K04A 3GXUB 5D71L 4F7TA 4JMNA 2VITB 3L70G 3JZ7A 3OKNB 3U6XS 1K85A 4GW5A 3PPSA 5ANME 3VO0A 1X9QA 1CLYH 3HEIB 1J5IA 2ODHA 5AZ2H 3QDMA 4XBPA 1HIMH 1DUYA 3AGVA 2BSSB 2IMNA 1CI6B 3ZUNC 3GEWB 1KCSH 4KAQH 2BC4A 2L0DA 4KUCF 1OF0A 5DRNA 1G1JA 3Q8AA 3HUSA 3Q2NA 2WQRA 4LLMA 3EBGA 1AXTL 4OLEA 4R3SB 2ZG2A 4AE0A 1LT9B 2ZUTA 3L2MA 3NPZB 4UBDD 4EXKA 2O1AA 2F5AH 3TIDA 1B4TA 2HYNA 1HCYA 2BSEA 1H8SA 1F58L 1SM3H 3NCMA 1KOAA 2IAMD 1KG0A 3CX5E 4PWEA 2YRPA 2CJ3A 3E7KA 3FONA 4MJ6A 1RJYA 4FTVE 4UNTA 3EYOA 5HJBA 5JPMA 1CGUA 3ESNA 3GHGA 3ESMA 1AGEA 5DJZB 3FN9A 2FE0A 5E2TL 1XBDA 4YHOL 1COBA 2DQGH 4ECNA 5I5IA 1T2KD 1F0LA 2VQ1A 1FORL 3T4AA 1MI5B 2A06G 3CQQA 2ENJA 2WXJA 3HI1A 1T5XB 4AZUA 3IDIA 1SRDA 2F19H 4ZT1A 3WOVA 3WFHA 3DX8B 3CSYA 3PHQB 2QRXA 5TE7L 2EADA 1ADWA 3FOMA 5JXEC 2WKLA 3BCCD 2YLKA 4LOFA 5CNHA 5FW8A 1LNUA 2P8LB 4JDTL 1UA7A 4KKPA 4PRNB 1QL1A 1U3HC 5D7LD 3W11C 4NKOA 4JFPA 5DJTB 1WZLA 3SQOH 1T1XB 2CDEB 3R2PA 3H1KE 3KPRD 4AL8H 1NU1G 3LIZL 4XC3H 5D9SA 4OCRL 1QSFE 3W9EA 4GYBA 3TNMB 1A9EB 3LKQB 4UU9B 3PP3K 4WJ5A 4L4TA 3FU3A 4GY4A 5DWUL 3RY6C 5F7WC 2FBRA 2J12B 2DYPD 5IK3A 4LSPL 1MCNA 1TO4A 4QTHB 1Q82Q 1LP9A 1P6FA 2EKJA 1BAFH 2NX5B 1UKSA 2D3NA 2ZKHL 4MJ5B 4D9QE 4IBVA 3QI9A 1ORSB 1BJ1H 3WD5H 4KNQA 2VDKL 4KQ4H 3DV6A 4UV4L 4ZX4A 5F1IA 2DQDH 1S7QB 2BLFA 3UJTH 4DGYL 2XDJA 1QHPA 1F3JA 1IFJA 3IGLA 1G5GA 3I3DA 5FUCC 2H2PC 3WEXA 3H1IE 1N5AB 2M83A 1QSEE 3UJJH 4Q97A 2K7QA 5DJXB 4G7YL 2CO3A 5I1JH 1JWUA 1AD9B 1WUZA 5DFAA 4QMEA 3RL2A 2NY4C 5B39A 2V3EA 1MJUH 4UT9H 1S7UA 3TGUJ 5ESAA 3MRKA 3VXPB 4TL4A 2Q3IA 5A6MA 2OMXA 4FI8A 1KBVA 3SY6A 3EOYG 4I87A 3HB3D 3UPAA 5B7MA 1E4XI 2G30A 5DURD 1JPFB 3G08A 1K5NA 3BVUA 4OV6F 3IM1A 1ZJBA 1AGCB 2VKWA 4MJIE 4OH8B 1A3LH 4PGJA 3OKOA 1R5SA 5HYJD 2VM4A 2EECA 1CTMA 4JO3L 2C9NY 2VLRD 3F85A 1DL7H 3QHFH 4EUPB 4I3SL 1P7HL 1M53A 4N2GA 1TZGL