5AW1B

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 85 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw1B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw1B02
1SP4A 3M0DA 1DH3A 3NXSA 3LIEA 1FOSE 1CSBA 1T2KC 3WGUB 3P8MC 2ZXEB 3KDPB 3M0AA 4LC1A 2Q3IA 3NFQA 5APVA 5AW9B 1J2JB 1JUNA 5AVTB 1FAVA 1GZLA 3V5BA 4AQRD 3VMXA 4B86A 3UIAA 5AW3B 3OAKA 3TK1A 4RESB 2Q5UA 3A7OA 2WPRA 3HE4B 3P7KA 3V4QA 1HJBA 5AW6B 1MUUA 4C7NA 5AVQB 1JNMA 4GKGA 2JJLA 1IO4A 2ZFCA 2Z5HA 5CMZA 2R5BA 4C7NB 2R5DA 3HE5B 2YO2A 4I6MC 4C46A 2IPPA 2W27A 2XV5A 5APXA 3A3YB 2E43A 3VN0A 1CZQA 2VRSA 3VMZA 4DZOA 5APYA 4AYCA 1GD2E 2P2UA 2QM7A 5APTA 5AVSB 3L37A 2R3CA 5AW7B 1KQLA 3VTPC 1S9KD 1GTWA 1NWQA 3KQGA 1T2KD 3M91A 2P67A 3M9HA 1CI6A 3TYYA 1A02J 1NAFA 2C9LY 1H89A 3IR9A 1HWTC 3NMDA 3A5TA 3T97A 2WPQA 5APSA 5AVZB 1X8YA 1H88A 3I5CA 4JYCA 2WPSA 1GK6A 5AVWB 1MFZA 3P32A 3TNUA 1CI6B 4HYTB 2Z5IA 3HE5A 5AVVB 4EOTA 5AW0B 2R32A 5AW5B 3WGVB 1HUCA 5AVYB 3SWFA 2H7HA 5AW4B 3V4WA 1YYCA 4M3LA 1HBWA 2XU6A 2E42A 3M06A 3TNUB 3MD0A 1MV8A 2P7JA 3O8ZA 2YO3A 2YNYA 2WTYA 1OWAA 1H8AA 1FOSF 2KP8A 4JYBA 4RETB 3NTNA 1OXZA 5AVRB 4I2LC 3A2AA 1GU4A 2Q7CA 2N9BA 1A02F 4GT1A 3VYIA 5APQA 1G2CB 3LIDA 3M9BA 4XE5B 5AW2B 1S9KE 1GU5A 5AW8B 5AVUB 5AVXB 2WT7B 5AW1B 1SLQA 2C9NY 5APUA 2W6AA 2BASA 2XZRA 3HE4A 3HTKA 5APWA 1GK4A 4AUWA 3VMYA 2WWWA 4KHXA 2QM8A 3L35A 3B8EB 3L36A 2WT7A 3MGNA
chains in the Genus database with same CATH superfamily
5D96C 1AKJD 2YGNA 3EOAB 1FOSE 1AIZA 1XF5A 3V6OC 4BWTA 3HC3H 3FB8A 1G1OA 4KROD 2P5EE 3MCG1 2CPBA 5E6YA 4TT3H 4N5UA 2C0WA 3DX4A 3GF3A 4EYYQ 4PWFA 4WFHD 2J8HA 5I5MA 4MZRA 5C0JB 5I19L 5L2KD 1BZOA 3GMNB 5EEYA 3MRJA 3TK1A 3HE4B 2H3NB 3V0JA 5BZXA 4BSJA 4JS7A 4X7TA 5HGBA 3V6IA 1CFSA 3I55P 2IPUK 2P8LB 1XGTA 3VD3A 1SQVE 5TDPB 1XF2B 1JWSA 4K7FA 3QRGH 2GJZA 1BWWA 4S0TD 1MG2C 3STBA 4U3FJ 1ZS8A 5EUOE 3D51A 2IFMA 1CFNA 4L4VB 3ZDYE 4UDUB 4ZMQA 3Q44A 4JANB 2DQFA 3QR1A 4XMPH 1SPDA 4HAGA 2GHWB 5A2IH 3MUHL 3C08H 4Z7OF 2EXYC 2ZYRA 2OMNA 3FRUB 3QJFB 3KJ6L 3FOMA 4ZD3L 5C86A 3KWXA 1I9RH 1ZR4A 1EEYB 2WVVB 5DJ6A 1KB5A 4OSUL 3O0RL 5DO2C 5IB4A 4YHLL 1X5ZA 3J8F7 1X4YA 1F3DJ 3M9HA 2FSDA 4YO0A 3Q7JA 3WTWA 5HHOB 4MDIB 3C87A 1B2YA 1NQBA 4O2FB 4N8UA 5CCKH 4BK4A 2DLEA 2WCGA 1ACXA 1KB9I 3EHBC 4PS8A 2YSSA 3RVUC 4RISL 1VQKP 3X3GH 2NQCA 2ZXXA 2PMZA 4YWGL 5I28A 5JW4R 3T4AB 2IH3A 4Y2OB 2E7MA 4IOSD 2OQJB 1J8RA 2EACA 5EZLA 5TTRA 1FF5A 4ZMWA 2E42A 2HTKD 4NO0A 3ZKSD 1DL7H 4U7MA 1BX2A 3PWLB 4DP8X 4ALAC 4P4RB 3X14A 2XI9A 3LKNA 1KV4A 1H0DA 4HOZA 1WA1X 4UU9A 3BKJH 4XNQA 2A3TA 4NPJA 1L6ZA 1QHQA 3SBWC 1XD0A 2Y4SA 4GSRA 1SEQL 3PJSB 3EOBA 4XN2A 4H0GA 4WSGA 4ANKA 2G2RB 4E9SA 3FOMB 1BQHG 1S5LE 1T1XA 2G3XA 4HCRA 5KW9H 1IBHA 2NNFA 4WI3A 3TX4A 3H3BC 2EEAA 4N90E 2DDQL 1ID5I 2P5WB 4MNHB 3GWJA 5I8EB 5E99L 3ARBD 3L36A 1DUZB 1NTKK 3D0VB 4NQEA 1JF5A 5ICZA 3FUNA 3FCBA 1P69B 5AOJA 5TD4A 1QD0A 5A3IC 1CGWA 4ENED 4Q6IC 5CKAA 5LNDA 5KANI 3FT0A 1PD0A 2NOYA 4XODA 3O2DA 2D7NA 2NMSA 1IVTA 2M5AB 2KOGA 3C6LD 4ZAKB 4KTEL 3ARFD 4OVUA 3T8XA 3LNHA 1MCWW 1UATA 1LJMA 2JIXA 1U9KA 3SEPA 1IO4C 4JY6A 4AYEC 4FJZA 4QRPB 5TH2B 4MJJA 3BSGA 1U8NA 4P49A 1UJ3C 3QG7H 5DRNB 5E7BA 5C9JB 1KJ2H 1HYSC 3M7FB 4BFNA 1EDJA 1E0OB 2NY5C 4O00A 5E0FA 1MH5B 2ZG2A 3P9WB 4S1DC 2QVMA 2Y1YA 1F11B 5D2LF 3SN6N 2CCVA 3CPWO 1S3JA 1II4E 5DMKB 2UUDK 3LRSB 4JO4L 4WEUD 3VXMD 5K1JA 4JDTL 4DP5X 1IT9H 5DJAA 1QACA 4LMQE 3IDNB 5D70L 2NY6D 4AT6A 2J6EA 4L75A 2ESVB 2Y1VA 5BZWB 1VQ6P 3CH1B 4DGYL 3FSZA 5F88B 1B0WA 4YE0A 4AGOA 2NCEA 4JRFA 5FA3B 3RL2A 3O8XD 4XOCA 3SHSA 4L4VE 4TQPA 1SVCP 4TUUA 4XFJA 3FFCA 3L3IB 4PY7A 3KNBB 3QDGE 4KK6C 5T1KA 3SDDC 2GEEA 4KNSA 3X3GL 3V6OE 5IK3B 3BVWA 2HFEB 1BGYG 3AADB 4HYTB 4GY4A 5DO8A 5K9KA 4KX9A 4TULL 3RZWA 1NO4A 1CGUA 1KPRA 4G6JH 3RWEB 3QQ3A 2A1WL 3PYCA 4QHUB 4LDEB 5CIPA 1WMKA 1ZE3H 4QTIL 4PS3A 3NSXA 5J6GA 4KZEH 5ESAA 4PJGA 4CL7A 3RIAF 4GUOA 3MA7A 3R2PA 4JPKL 2N59A 2QHRL 1KTKE 1P0SE 4GSDL 4JDZA 1MV8A 1JGIA 2WC7A 5H35A 4W4OC 2NY1D 1ADQA 1MEXH 2VDQH 4QRPD 1F4YL 2H26A 4N85A 4NPDA 1FE8L 2IH1B 1XX9C 2JKLA 4AGLA 3SPHA 2OKMA 3IDUA 2DTML 4JFOA 4U49A 4OJAA 3T8VA 4DAGL 3TS8A 4LFHG 1VQLP 2E56A 1N4XL 4X5XA 2BNRA 5CP7A 4HWNA 1I7TB 1ZSDA 2F53D 1MRFL 2MKWA 3WAKA 1XCTB 4F7MA 1DLHA 1FBIL 1ETZA 4BFEA 3LKOB 3RIFF 5FO9B 1HXKA 1GYVA 4OD1H 3QWRD 2W0LA 1FNGA 4PD4E 5ISZA 2ZT9D 4G1MA 4TS6A 1ACYH 4YPCA 4N24A 2J1ZA 4Z7QF 3QUKA 1SNRA 2UXGA 1DN0A 1DH3A 1M1XA 4RDQG 5HP5A 2W83C 1DUYA 1WAEA 3SDAA 2FNWA 3H42H 4WVRA 1IC1A 2ENYA 1ODUA 2AJYL 3DX7A 4JO1H 2WVRA 4QWWC 4AQEB 5L2KB 4MNGA 4FTVA 2VDMB 4FHBD 1KPUA 1YC7A 4M02A 3Q5SA 5INCA 3QUZB 4FABH 1WZLA 1D5IH 2WSKA 1F97A 3SPVA 4YGVA 1A47A 4XWGH 1NU1K 5DJ8B 3IB4A 2R0WL 3L16A 1HI6A 4TVPL 3NCYP 5GGTH 1S78D 3HD7D 3C5ZA 3QPXL 4IK6A 3AEGC 1ODAA 1J5HA 2FJSA 3FHEA 3HC4H 2D2CD 3EIFA 4LIQE 4F57L 4NNYB 2CLVA 5IM7A 2FY8A 5ETUB 1X7SA 4TVPE 1WAPA 1JPTL 3D1MC 2B1HH 2X4PA 3FJTA 5GTIH 1U8JA 3H42L 5GJTL 1SFDA 5KAIE 1PL3A 1M05A 1U8HA 3V2QA 5GRUH 3ULUL 2YAQA 1AZCA 2EIEA 2IAMA 2PCYA 2CU9A 3JTBA 4WY4D 3MJ9L 3GZPA 1FFQA 3K72B 3UPCA 2WNGA 1N5YH 1L7IL 2VRAA 4EI6A 2H1PH 2GB2A 2HLFC 3QQNA 3QQ9C 4JJHA 2W90A 1W72B 4L9LB 2XJKA 1R5LA 4WNQB 2HG5B 4Y7OC 1ULVA 4A2HA 2C9LY 4OZFA 5A1AA 5D71L 3ZE2F 4L5FH 2PABA 1JEKA 1MFMA 1YN6A 4PVNA 4UT9H 3T77A 3MGTB 3JWDL 4I85A 2GUOA 4N3TA 3RDTB 3ZQWA 4ZMPA 4QOKA 4Y4KB 2JI1A 1Q2NA 4YE4L 5TE6L 4Z7VA 3ME0A 4LSSL 4Z6AT 3VFNA 3D4YA 3V5HA 5E2UH 1VEOA 3BMVA 1NFIB 1QL2A 5C0BD 1MLBA 2XYBA 1D5XA 3GSWB 5E51A 2YHGA 1UVQA 1AGBA 2X0WA 4QRSB 4AI7A 4HPHA 5DD6A 3GXUB 4LHUA 1E2WA 4WEBL 1JGDA 3TJPA 1CG9B 1JFHA 2IQ9H 3FGAD 1WICA 4IIQA 2NY4D 5IWLA 4X98A 3DHJA 5GXBB 4YK4B 5FCUL 3PF2A 5IHZA 2VDRB 2DQJL 1NGPH 2JCCA 4WWOA 2C3VA 3I56P 5CGMA 4OM0H 1IZKA 3L7EB 4YNYB 1MHPH 3LN5A 3B43A 1FWXA 4H8PA 3FN3A 4UQ2A 3IMBA 1L9MA 2H5UA 2UVEA 1E2ZA 1G7IA 4B9KC 2F68X 5FFGA 1AHWA 4P5TA 2XG4A 1PZAA 2V4HA 2JKXA 1FDLL 5HYSG 1QLED 3L70D 1KOAA 2BVQB 1EVUA 2Z9TA 5MI0C 1TQCC 3KPPA 3TBCA 3BVDB 5KJ7C 2R7EA 3IF1B 5GRXG 5BUAA 4BRVA 4X6EB 3D6ZA 1EFXD 2G5BA 1FE6A 1JDCA 1FAVA 4AGPA 1NBYA 1T2XA 1AQDB 1RE4A 1DJYA 1V3KA 3BVNB 3K4AA 4O5LL 4EIUA 4HHGA 3ZQ9A 4GRLA 1JGVL 4GUQA 1X7QB 4ISVA 5AD0B 3GSWA 1FFOA 2E27H 4L2LA 4NZUH 5HY9B 2YPLB 3HZ3A 3IGFA 4WI6A 1XEUA 1F86A 3B2VH 3PQYA 3RFZC 3H1JJ 1BMGA 3C5JB 1MFCL 3HS0B 4H8QA 4ZUVB 3VFSB 1OSPH 1LD9A 1GIGL 3AY4A 1CGTA 3D25A 4WKZB 3KGRA 4WY7L 3TBSA 4NHCH 3MUDA 1QWHA 4WWIA 2ZOUA 1YYML 5JW3H 1HQRB 1T4KA 3CQFA 3HZKB 4XHJD 2XQYG 2COVD 5AWNH 2HFFB 4D0CA 4M6NL 2BJML 2X89A 4JPVL 1OL0A 1W72A 4XCCH 2BY2A 3LRMA 3SOBH 3CC1A 4J2XA 4PRBA 1EFXB 1G9HA 3IJ8A 3S3CB 4EUPA 5C6PB 5CJ0A 2P7TB 4Y1AE 1SEQH 1UWXH 2ADIB 4PJBE 3KWWA 4PR5A 3AE3C 4Y8DC 4PW3A 1HNFA 1QSFB 4HKZA 4YHOH 4NZUL 3WKML 4H20L 1WBZB 1KY6A 4XMUA 1OAXH 1MCLA 4KXCA 4NRXB 4WUUE 5ETUA 3QBTB 1XCQA 4NP4L 4UB0L 5DFVC 1UB5B 5EU6B 1T22B 2EDQA 1G1JA 2WWMC 4IRSD 4L3ED 2E7HA 1OPGH 4WNJA 2C9AA 3MU3A 4PJCE 2EUZA 2QDWA 1ZRUA 4DQAA 3QIUB 2FEEI 4Y2DB 2DQIH 4Y0GA 3QZLA 2CGRH 5EEVA 1ZLLA 3PCYA 4KWUA 4JREC 4PJFB 2XT1B 4L0PB 5GGTA 3SKOA 4EDXA 4MFHA 2BCCJ 3B7RL 1EXIA 2WXQA 4HBCL 1RZ8A 2LOEA 1DVZA 4MNGB 1A7OH 2PYED 2EIMB 3CDYA 1TUPA 1CDYA 2R39A 1RLBA 5JPMA 4HKJA 4JN1H 3ABLB 1EDHA 1CCZA 3DTXA 4OQTA 4W9HC 2YEZB 1K8AQ 4GJTB 3Q2LA 1I4FA 4OSUH 5ISZB 4JZNB 1XB8A 5E2WH 3V0WL 1OXYA 1AZVA 4LPVA 3S8WA 4L74A 2R8SL 1O9ZA 2ATKA 2XFGB 1A4JB 4NN7B 3ZKMC 2NY4B 4Z76A 3GSOA 4HEME 2BNRB 2R9HD 2O6DA 2C26A 1EWHA 4KAQH 4ZG1A 2PO6B 3V8CA 1RHZB 1MNUL 3OB0K 4M7ZC 2YQBA 3ZR5A 5I1GL 3QCUH 4K3EH 3EFFB 2MPAH 3LS5L 4PUBL 1E6OL 4GIAA 5DS2A 1YG9A 2BOBB 3ZHFA 2NY2B 4ECNA 3D71A 5BMFL 4YSTA 1VQ4P 1PDKA 3FZUD 2P5PA 3D25B 3GZQA 3N6YA 1EFQA 2QJYB 4LOEA 1RLWA 4MD5A 5JHLA 3EUDA 1JTHB 2CM6A 3NABH 2FE0A 1U8OB 1N2RA 3DMMB 1PEZA 2NPLX 4XNUL 4LHUG 2OMUA 5CMZA 3PQYE 3QQ3B 3RGHA 4V2CB 1E4HA 1XSJA 5DMGD 3ULUC 4QY8A 3V52L 3BOVA 4P23C 4UBDC 5ANME 5KLIB 1OW0A 4A6YA 1JXJA 4ZQKB 3O6LL 4H40A 4MJID 2VJ8A 2YRBA 1RJZA 5DS1A 4CVZA 3HI5H 1PKQB 5D6DC 2DIEA 2ITDB 4LP8A 1NU1E 2NPSD 2FDBP 3RL1A 5C0DB 3S5LG 2YZ1A 4KY2A 5TPWL 5JXAH 4JLRA 4JR9H 4HZ1A 3G3ZA 5AB9A 1QI3A 2VMJA 2A06G 2OYHC 1WJ3A 1RERA 4ZX5A 3OBAA 4B5EA 3MLXH 1IILE 4P4KA 3HC4L 2AQ1A 3CSFA 5DMYA 3A47A 1TO5A 4AQ1A 1IARB 1YEDA 3ILDA 5ITBH 1RZGA 2NYZA 4YHZL 1G0DA 3JSVC 1UM4H 4Q9CA 4WHDA 1E3FA 2FZ3B 1GOHA 4UM9D 5D7JB 2DWXA 1DQML 1A14H 1RSYA 3CN0A 1BAFH 2FEJA 3W3BA 2DTSA 2A6DB 3L4XA 2POHA 2VZSA 3PIQB 4DPRA 2GJ6D 4ANUA 5C1MB 1JGDB 1AXSA 1LQBC 1TJIH 2VLKA 3QZMA 5K1NA 3DTDA 1UZ6F 3BZFB 3LVTA 3T2PA 3NJFA 2IDFA 2CMRL 3ZY7A 3RWFB 1U33A 1ZVYA 4A2FA 2FO1A 2BC4B 1URQC 3D2UD 2E86A 1P2CB 1JPST 4PD4D 3LH9A 4FRWA 4A63A 2GTWA 3RPBA 4PLKC 4KNTA 1LWHA 1WZAA 2BSTA 4QXUL 2VIRB 5AZUA 4DKDC 4AL8H 5JTWA 3RUGE 2MWCA 4FI7A 4WK0B 3ZRFC 2ZWYA 2M1KA 3RDTA 3NAAL 5B4MD 5J1SC 1WC7B 3FB7B 1XXFC 1FO0A 2RKLA 2DKSA 3T77B 3TIEB 1TDQA 1UCTA 3UZEC 1HSAA 2IYOA 1CW5A 1UASA 5I1JL 1E5UI 5HGDA 2P9RA 2AAVA 5I1HL 3WEOA 2O5NA 4HEMA 1YPZB 4DK5A 3B8EB 1GKOA 1GTNA 3QIBD 1W8EA 3E2HC 1HEZA 1BE3G 3ZE1B 1XTCC 4X5WB 2MJWA 3ESMA 3FCTA 1M8OB 1IC0A 1NEUA 3KPMA 1M6OB 3T2QA 3UYRH 5EZIH 1C8QA 1YMME 3NTCH 1R34A 2CRZA 1E4XI 3K72A 3B5TA 3K8KA 4YLQT 3WKPA 2UY6A 3CHOA 1OSEA 4UU9B 4R4BA 1UA6H 4XMZA 3MBEB 4XNDA 4J3UA 2MKLC 3OMZA 4HKZH 4X6CF 3UTPD 2HKFL 1KILB 1SXSA 2IX7C 2VDQB 1M1JB 3VNYA 4GSDH 2ZPKH 3EJRA 4KU1A 2CLVB 3V0VA 3QIUD 2EIZA 3QHTC 1MQKL 4NQCD 3S96A 3M7OA 3WLBB 5LWYL 4MZIA 4K8RC 3L4CA 4RGMB 5KBDA 3L2LA 2X44D 3VM7A 3B5NA 3IXAA 1XAUA 1IEBA 1U21A 2ZTBA 3DX1A 3VGFA 2IAND 4JRYB 3HUSA 4DP7X 3GNMH 5HHXL 3RWGB 1FHNA 4MDIA 2L7JA 4GRWB 1MJ7H 2PKDA 2KZBA 4L4TE 3SBPA 2IZ0A 1HHKA 4NJAH 3U1SL 4CSZA 2Y9ZA 4JDEA 1JZDC 2JK5B 4LCYB 4I2XA 2C1PA 3I6GA 4NKMA 3QUKB 1QTYT 5ITFA 1FL6A 1NJ9B 4PP2B 4XCNA 4XGZA 3C2SA 1ECZA 1TOXA 1BCIA 4U6VL 3ZYIA 3JWOC 5FO9A 3II3A 4JFQA 4IKKA 1ZPUA 1MVUA 2XZAH 4R8WH 4NN6B 5KBMA 5KSAB 2DWDB 3VXRB 3FU7B 4IBVA 4WHYG 1MWAH 2UXVA 1NAMH 5CZKA 1K85A 3AG4B 1A2YB 2BNRE 4M7LT 2HODB 4ZUTB 3L3HB 1H6FA 1B0RA 4MQTB 4NKDB 2ILLA 2IBZE 5EBLA 4BFOA 3BD4A 4KVPA 4PJIB 1QEXA 1JWSB 1UH3A 5AOZA 4M5TA 3N44B 4FAAB 3ZMRA 3TIDB 4J1UB 5CBAB 2GK2A 1HJBC 1SXBA 1BQLH 2XZCH 2H3KA 2VKXA 1GOGA 5E1AA 3UTOA 3TEZA 4UT7H 2GC7C 3BGMB 2CH8A 3NJGA 4LSUH 3MJ7B 1AD0A 2YMXH 3OAYH 1G4RA 4H88L 3QXUA 4JVWA 4LQ1A 3T2NH 4CC4A 4JQIL 1UOKA 3CZJA 3TFBA 4I13B 3IN0A 4A7QA 3AM8C 3FU3A 3WXVH 4Q14A 4IBQA 5F9WC 1BVLA 3ZT7A 3MHVA 2YC1A 5LBSL 5KVMC 1HKLL 1Z3GL 2NXZD 3OB8A 1E4JA 5AB1A 3B6SB 4R7NB 3BVXA 2FBWC 4RSVA 3BP5B 3AY2A 4FG4A 1AXTL 4R0LA 3LN9A 3QDGA 4JKKA 1U8IB 2DYPB 1RZFL 1M56B 1P6WA 1KUMA 4JN1L 4UV7H 4PRNB 1ZAGA 3CE1A 4MKTA 3DOIA 1IB5A 2D3VA 3CH1A 3IRCA 2IFNA 3FMGH 1J2JB 1N73C 3G6AA 3GMRA 4LLMB 4QJ4B 2WXFA 3UG3A 3F7LA 1FSKB 5AYTA 1OOWA 3NIFF 4L1LA 1RCYA 5HI3D 2WK2A 4D3CL 4UNVA 4YK4C 3L54A 2CUMA 5DFTA 1KJ3H 4WW2C 4XNBA 1K2DA 3RE0A 4LPXA 4B9YA 5I18H 4LL4A 2EDXA 1NEZB 2FGWH 2YXFA 4ONHB 4FE9A 4G5ZH 1SQVG 1X5MA 3JV0A 4QF1B 1QSED 5GRWA 5AUMB 3DDFA 4I9WD 4GG8B 4PG2C 2HSIA 2BVYA 4EEEA 2KZKA 1H5BB 1FVEB 2FO4A 4NQDD 2Y6SC 3GHPA 3VP9A 1QATA 3VN0A 1SHSA 1USZA 2OJEA 3PDOB 4HSAC 4J1UA 4AW7A 5CBAA 5AVSB 4UUJA 4ZAKD 1JZ3A 5BNXD 3L75J 1KIQB 2MQGA 4HKBB 3K2UL 5CJQH 2X41A 4YIQA 4ZMDA 2R3SA 2VXQH 3L3HA 2GJ6B 2HJFA 3X3FH 2HWZH 4LCCC 4EN2A 4J3OC 1TLMA 4KH9A 1AS6A 2M2DA 3ARDA 4KJMA 4HFUL 2ZCZA 4PGEB 1NIEA 3I5CA 4MS6A 3P32A 1FZFA 4N87A 5KOVC 5BXFB 1H3GA 1MJJB 5ITFB 4AGNA 2VITA 5HI5D 4IBLT 5BRZA 1G7QB 2DN7A 2QADD 1OP4A 3QZPA 2B39A 5HDLA 3U0TA 1B3JA 3ZSSA 1I8KA 1PP9G 2BSRB 1BQLL 4IU2B 4UIMB 1BSIA 3FUEA 4E41D 4FYTA 1FVCA 2E7LA 3AACA 3KXDA 4F57H 2AEMA 1B6DA 3QI9B 1IIIA 4GW1B 5DHVB 2BRRL 4D0BA 4R90H 1GRWA 3WCYA 2VDPB 2Y1AA 3F04A 2YUWA 2OQJA 2H0FA 2YD1A 4ZD3H 3TOPA 1K8IA 1TTCA 1RZPA 5SWQA 2CG9X 4FG6D 1IFHH 4FFWD 2DS4A 4UI2A 2YSSB 4XAKD 1MCCA 2PRRA 3MO1B 1YHQP 4FOMA 1VZGA 4W68A 2HVJA 5CCGC 4APQA 4CW1B 3Q5RA 1WEJH 5HD8C 1E30A 5ADPH 4PJBB 1SBSH 4LZKA 2ZG1A 2IVFC 1SQQK 1E7UA 1V7NH 1FBMA 3WLWC 5HGHB 2VSCA 1MUJB 3NPSC 5CD3A 5EORH 1EEYA 2WVVA 4XAWL 2PW2B 4E42B 5I76B 4P2QE 2A9MH 3HMXA 3T4YA 2Q3IA 1M7DB 4JFVA 3NJMA 1UACH 1KEML 1MAJA 1N64L 2NY4C 4NAMA 2V5RA 5DO2D 4NLAA 1AVOA 1F58H 3WFEH 2WSCJ 2B4CL 4PYGA 5IVXF 1IFJA 2YKOA 1NFKA 3HZVB 2XC8A 4N6RA 5JORA 3ZO0A 1UWEL 3X1BA 2JR8A 4HS3A 1D5ZA 4M7JL 4ADIA 4PJ8A 4WU5B 3QQ4A 3VD7A 5F6HI 3KPRB 3EG9B 3RU8L 1PPJD 1MFAH 2RJMA 3UZVA 2W91A 4RA3A 2P8LA 3MRLA 4Y4HD 1OE2A 4QNPF 4UTBA 1CMOA 1BBDL 1ZMEC 3PDGA 5EFIB 3BCCD 3C8HA 5EZJA 3V2PA 2J5UA 1GOFA 3BZFA 3TCLA 2XZQH 4JRXA 1R5IB 1CZQA 3L9RB 5SWZA 1JXGA 1ZLVK 4XBEL 3TJHD 2X0VA 4OTXL 3TFKC 4GG6A 1E6OH 3RY6C 4NOFA 4P5MA 3ILPA 3LQZA 4NWTH 4HCGA 1NCWH 3ZZQA 1CIUA 2DQTH 4HWBA 4YDIL 4I0PA 1QVOB 3JSSA 4I9WE 3TBYA 3O9WB 4WTQA 1S8DB 3REVA 2BNQB 1U4EA 4BXVA 2ICWI 4AQ1B 2CBMA 4S0HA 4WHYH 3U9UB 1C8PA 2IWEA 4AL8L 2HUEA 4IOIB 3L70E 1H88A 1BQRA 1ZVNA 1I82A 3QZNA 1OB1B 4YFLI 5D2LB 1F3DH 2BP5M 3TBVB 3UC0H 4E9QA 3JV6A 4NHUA 3ZTEA 3S9DB 4C56E 3QEGL 4L8BA 4OZ4B 1E65A 3G9RA 3APFA 3WUVA 5E03A 3WFDL 3MLZH 5CEZE 3SYQA 3TPKA 5EC2A 1Q9WA 2DM4A 3MD0A 2BCCD 3FUDA 4GSQA 5GSVA 4AG4H 2BZ7A 4XBGA 2P42B 2YXRB 5E6IB 4QAWA 5CMAA 4M5ZL 4KXZH 4TL5A 3ZTJG 3OJMB 1TQSA 5DQ9B 1S5LX 3P11L 5JA8B 4EI5C 3L1OH 2KZJA 1IBBA 3NOIA 2NNAB 1RZIA 1NTKG 1NGWA 2E5EA 4R90L 4E9LA 2JB5H 1JWMB 5J12C 3ULUD 4WFGD 4N68A 1ZA3A 1S9KE 3K81A 1W72L 1F4WL 1PJ9A 2ZONA 3AC0A 1JTHA 4UQIM 4M43L 5HDBE 1QPPA 1U3HC 1KIRB 1C5DB 2K6YA 3SE9H 2WSFJ 3LKRA 1J0KA 2R1YB 1X5XA 3CMOL 4NQEE 4NZRL 4A2LA 1NCCH 2HKHL 3OL2A 4A6YL 2PPCA 3H1HE 1VA9A 4TSBL 5FC9A 3W38A 3ZIMA 1HWHB 1NZRA 2CNZA 2GCYB 1J5DA 5CD5D 1VFBA 1WQVT 2B9AA 3FC8A 5FO7B 2M3EA 3SOBL 3ULVH 3HN8A 3GRWA 4GMTH 3N42B 3GHGC 1PAZA 4HWEH 3O45A 3MGOB 5HYJE 4UNUA 5C92A 4QHPA 1BSHA 1PG7W 1VPOH 1QR1B 5AW3B 4Y16A 4CSTA 2AEQL 2Y0DA 2N56A 2VOTA 1NCUA 3HIZA 1KB9H 1HF9A 2Y2WA 3RPIB 3N2JA 5EU4B 3TA3C 1S7XB 2XG5B 1FFRA 5T5NF 2ED8A 2QKIB 2BHFA 1H9DA 1TJHH 3RIKA 5EIIA 3BCCJ 2H2SC 4K23L 3F89A 3IU3B 1I1CA 4H1LA 1AGDB 4G42A 4JKPL 2WQUA 1QZNA 4K8RH 1ZLVH 2LGNA 5C2BL 2XV5A 3TYGH 1O7SA 2AXGA 3FQ4A 3G5VA 2G3ZA 3OX8A 2FR4A 5HTSA 4OGYH 5AFAA 1NEPA 5BS0B 5FF6B 3FXEA 5F8RC 3U6RB 3H1JG 4HK0B 4K7PX 1EZSA 5F44A 3VMZA 5A43C 2O5ZH 3GBNL 1NGZB 4OV6F 4RDBA 2VXTL 5IJBC 5INDA 5KTEL 4KJQC 5I73C 1E28A 4GXUN 2Z92A 3HLAB 4K0OA 3HRPA 2O01N 2X6CA 4IBWA 1B4RA 1REIA 4O58H 3H0TA 1NIAA 3TCXA 1RURH 4AVHA 5B66E 1H9VA 3NMDA 3AREA 3QT2A 1AOHA 2X6UA 4ZW3A 5JIPA 4Q74A 4EI5A 1H6EA 3GKWH 5LBSH 4RAVA 3AECC 2QQKH 4NCC2 1WWBX 3EJPA 3VXUA 2YD5A 4ZMXA 1E4XH 3UTPE 3SE8H 2UYLB 4TNVK 3GBNH 1KBGH 3LMJL 2H7HA 1JV5A 1SY6L 4P2QB 3EOYG 4KI1A 2X7LB 4Z77A 5E9DB 1A6AB 3CGTA 3LAFA 3LSOB 2IWKA 1IJNA 1Q1JL 3TYGL 2IBBA 2AJXH 1YEEL 3W37A 4D9LH 1MIEL 1IKNC 3QHZH 3QDHA 3I3DA 3SGJA 2NT1A 3QEQA 3CN4A 4P9HL 3UBXI 2AK1L 3HS0A 4ZUVA 3VFSA 3A2AA 3M8OH 1FZGA 3REWA 3BHBB 2WIIB 4HHAB 1RY3A 2FQFA 2R0LH 3KYNA 4UQAA 4Z7NB 3VRLF 3CN2A 5D1QD 3UJIH 5EC1B 1KJ2B 4XVJH 3O6QB 1CK0L 3D4GA 5D7JD 4Z3JA 1LEIB 3RY6A 3KE0A 3OX8B 1XGUB 2QFPA 2C7UA 2HT4D 1LMIA 1XH3B 2XWTB 1TNMA 1ZHBB 1CE1H 2L04A 2G5BB 1UUSA 3P3SA 5K39A 7CGTA 4H8VA 1NPJA 1OB0A 4R8WL 1JNNH 3WFCL 2K4WA 3BE1L 4J6RL 1EHAA 4I18C 3RGUA 4LLAA 1FU1A 3WE1A 3GBML 4P9MH 1BZ7B 2KH2B 3EO1A 4RDQF 5B8CC 1DEEA 2D4DA 3B71A 5ID0A 4YXHL 3ETBJ 3CX5K 3W39A 4K9EL 4POUB 4ZBJA 4NZ8A 3FS9A 4UQ2B 4E9VA 4DPCX 3LN5B 1H3PL 5JR1L 3F58L 2CO7A 2Z8VC 1HFUA 1NDGA 2M83A 4B3VA 1QNZL 3B2XA 1M3IA 3OB0H 3MNVA 5DVNA 1KXQA 3KBFA 4NERA 2W6BA 4YTPC 1F8TH 2BNQD 4G59C 2ZJSE 4PJEB 4LEOA 2A45H 2OPCA 2LR4A 4G7YH 1CG9A 3CDFA 1TEYA 2VLRB 4ZUSB 2WLIB 4R97B 1BLNB 1Y18B 2BIPA 3OR6A 1FDLH 1PZ5A 2XCMC 1UH4A 3V5HB 4Q0XH 2MNWA 2NY2D 5KVFL 4FP8H 4U1LA 5DJ2A 4U1MB 1MY5A 1WFOA 4G43A 1XR9B 1ZEAH 1CU4H 1G7MA 1I1YA 1VGEL 4M6OH 5J9PA 2PO6D 2EINB 3B9VA 3IAQA 1B0GA 4LCWB 4WFEE 1T89C 2IG2H 2YZ8A 4XXCC 5GSVB 2OV0A 4NWTL 4X80H 1NFAA 1SJMA 3V7AE 1NC4B 3TGUD 5B21A 1OTUD 3AZUA 4RMWA 4XBEH 1CD1A 3EO9H 4NDMA 2A74B 5D2NA 3AE4C 3LIUA 4WEBH 4EI6B 2F9BT 3BP7B 4R96A 3FO0L 1SUJA 5TK4A 1TITA 4XMXA 5SWSE 2WVSA 1J9SA 4MXQD 1PZCA 1XVSA 2CRMA 1A1OA 1GSKA 3Q6FB 3HB3C 3VGGA 3H1HJ 4W81A 5G4MA 5GGSY 4YDKH 4H8UA 2OXGA 1TZGH 1CK0H 2A45G 4HUWA 2LLLA 3MUJA 4KXBA 5JQ6L 3VI4E 2JVUA 3FB6B 4PRPD 2GI7A 4R26L 2YWZA 1LHZA 5EU6D 2HX7A 1NH6A 3GUFA 1HESA 2OULB 2H6UA 3FO0H 3RWHA 3MV7E 2NSXA 2WWWA 2F0CA 5JXED 5INCB 3MTRA 2CJUL 3CFTA 1VQ5P 1AMXA 3NCEB 3CWGA 3H1LD 1I3GL 3IAOA 2XY2A 1KCLA 3X1GA 4RWHA 4DOHB 5E08L 3AQYA 3FU0A 4O9HH 5CILL 4GQRA 1GJWA 4X6CB 4KRLB 4Z78A 4LC1A 4OZGF 4IRZA 1OQOA 5HGBB 2J12B 4KZCA 3JWNC 1RSFA 4QRRE 2YRLA 3N1PC 2AK4D 4MMZA 5BZDB 5DA0B 1U8MA 5F71A 1QEWA 4L3CA 4NNXB 3OG4B 3LKOA 2YEVB 5KUKA 3B7TA 2IOMA 1UKSA 4PH8A 2C4FU 5C3TA 1LWUA 1FZMB 3JVGC 1SFCB 5FYLL 2P43B 4IBYA 4ZPTB 5EOTB 4ODUA 3VDCA 4N90D 3CCSP 1S9YB 2YD8A 3HPJA 2B0SH 2NW2A 3O6LH 1CI3M 5FLUA 3TNNA 1DYZA 2HJLB 1FC2D 4E9RA 1AVYA 3CZGA 4NGHH 3ARBC 2JQMA 1RVFH 3U9WA 4BQCA 4Z3GA 5CU5A 1A7OL 4NNPH 1RQ5A 4NO0D 3CSYA 4ZS7L 2VKWA 1F8TL 1LE9A 1NUDA 5A2CA 3MA7B 5J6HB 2HUHA 2VZTA 5T5FA 4JMNA 12E8L 1N6QL 4XWOC 2OZNA 3V2AR 2FYNC 4ENEC 4O4YL 1WD8A 3LEXA 5I15H 5SWQB 4Z7NE 3ARDC 5FYJL 1R8EA 2QJPC 4GKNA 1KCSH 4JHZA 5DLLA 4PUBH 3L74D 1H3WM 3N85L 3L71J 1NL0H 4K23H 1NA8A 1MFEH 3Q8FA 2FLMA 3HMWL 4OBSA 3R4DA 5I8OH 1TJHL 5EO1A 2E75D 1G43A 2D3NA 5FHAH 5LCVA 3DSNB 1KPVA 4P2OB 2V9TA 5L8KB 1AS7A 3TZVD 5BVPL 5AW5B 1VB9A 4JGNA 2Y6TE 2WB7A 2ZSVB 2FAUA 2HMIC 2JXMA 3ARBA 4CMHB 2HKAA 2CO1A 5D4HA 4ZYKB 4NQED 1QMUA 2MOVA 1S9WA 1UXMA 4JPKH 3FH5A 3O8XB 1N73B 1TEFA 2R15A 2RB8A 4NZTL 4P5KA 2PETA 5D7LD 3KCWA 3RX8A 2XV2A 2JTYA 3V4VH 2GEQA 4PJHB 3MXWL 1OXZA 5AVRB 1K8DB 4XBPB 3WKYA 2NX5A 3OPZH 2YIUB 4X9FA 4ATWA 3WG7B 4N9GA 3VP8A 3DV4A 2KDYA 1L0YA 2JIXD 1ZTXL 1N86A 2KERA 2BS9A 2V3EA 4NQDB 5E2VL 1E8WA 3OGCB 3GEFA 5DMIH 4JY6B 5DFWH 5IEHB 4X83A 2WT7B 5E7FA 2YK1L 5DYOB 2JB6A 4BRYB 2DWEA 2W65B 2ZX8A 3OHMB 4RISH 2DIJA 1DBBL 2VDNH 1CF1A 2OJEB 5C8JB 1SHMA 4QHNA 2FWUA 1E6JH 3KYOA 4XR8C 3UG4A 5CCGA 4APQC 2Y2TA 3UPRB 5IEHA 3LB6C 2ZAIA 3L72G 4JBSA 4IBUA 1SQXJ 3W9DB 5E79E 3AFLA 3UIYA 3DJZA 2V7QH 1CWVA 4XPHL 3QWOB 4FQ1H 1AGCA 4AIZA 1M90Q 2VM3A 4EKXA 5ANMA 4PB0L 4Q9QH 4GI8A 4XMVA 2J8OA 1E43A 4JFFE 1QVFO 1JPGB 5E94A 5AW6B 3O3BA 2YD6A 2F53E 3NG5A 4DOJA 4PTUA 3U1PA 5FOBB 1R3HB 2DYPD 1IQWH 5TDOA 3WFBH 3IDJA 3PJSA 1IE5A 5I5JA 1P7BA 4PI2A 3WTUA 1EANA 3LKPB 2IZ1A 5FDWA 1J8HA 4KHTH 1ADQL 3CD6P 4RLDA 3E38A 3DMMC 1H0DB 4HF5L 3BX7C 3IFPB 3PUUA 3RZCD 3Q8AA 2YFOA 1SQVJ 4ELME 5IROD 3BH9B 5KYWA 1RVFL 4PJ6A 2H6OA 5EZLB 3X13B 3EFOB 4URTB 4MCNA 1JGVH 2ENQA 3DETD 2V6HA 3M46A 5JW4N 3QJXA 4BZ1A 5DR5H 3QZOA 2PUQT 4AV5A 4X7FC 1PV3A 1MHCA 3U4BL 3BH8A 1T21B 5KW9L 3TN0C 1MWAL 3BGMA 5EZOH 1JNJA 2HXAA 5D7KE 2BCMA 3O3AB 1QVGO 1MRDL 3OTTA 2EKSA 3QDJA 5C09E 1DVFB 5DJTB 2W81C 2DY2A 3BP4A 5IQLA 2B4CH 1L0LG 3NCFB 2YAOA 4QHKJ 1FNFA 3MUGA 5CEZH 1GZHA 3GIZH 2GQHA 3CVIL 5KSUA 5BRQA 3ZQXA 4PGBA 4RO0A 5I26A 2BWQA 5CP3H 1S3KL 5KLVG 4MMZB 5LWYH 4XCNB 3CN1A 4XGZB 2ENPA 1OZHA 1IGJA 4ODTL 3CQPA 1X9UA 4OLVL 2IPTH 4AOFA 3KYAA 5BVZA 1SXAA 4NQUA 3B56A 4HUMB 4XPAL 2OSLB 1I7RA 3KLKA 4F3FB 1KYOJ 2G4GA 2B7DT 2O72A 3ARVA 1E5AA 1AFVL 2J5LC 3HHSA 4IRSB 4KJYB 4L3EB 4F7CB 3QDJE 5TISH 4X7TB 5DVKA 5AYUH 1S7WB 5D1ZA 1UXLA 4BRJA 3C9NA 1BFSA 1IEBB 2GSMB 2R4SH 3FT4A 3HKZA 3D3VD 1HHGA 5C07B 4H5SB 3LPGA 1BCCJ 1TZGL 1SEBB 3BYTA 3W0WB 2R23B 1IFIA 3NXSA 2JJTC 2YD9A 1TFHA 4AQAB 4FCAA 1MREH 1EXUB 4YC2B 3M86A 4JGMA 4BFIB 1D6EB 3RKDC 4WFFD 1M1JA 4ZNCD 5IB1A 2D7PA 4XB7A 3H9SA 1N10A 3QO1B 5JIMA 1A1OB 3MUUA 3QFJD 4NBYB 3HE7D 1EO5A 4I89A 2AHIA 1S5HB 3JQOB 1JF1B 2X4NB 3SJVB 4AH2B 1UWFA 5AAMA 3SZKC 2WWOA 4X9YA 2A74A 1FFNB 2R0KL 4KO9A 1FDMA 5EUKA 1DX7A 1XF4A 2W8CA 3D87B 2DYRB 4Q0XL 5TQ2H 1A6WH 1CZ8L 1J05B 1JPTH 4L4VD 4PJDE 1YVLA 1WGOA 5E9AA 2CCLA 3RDJA 4A38A 3L9YA 3PABB 2N1TA 2IALB 2YGQA 1DCEA 3E3QE 4H4NA 3P02A 1NUFA 2ITFA 4XTRD 5T1MA 1OF2A 4L73A 1U3YA 3II1A 3DK0A 4F8PA 4F91B 5E4OA 5IGXL 4U1MA 4YHZH 4YOKA 3V4LA 4NCC1 3PPSA 5CZXC 5H4YA 4GAYB 2GTWB 4WK4B 5C2UB 2WZ0A 3FO1A 3IDIB 3MV8A 1PZ5B 2FK9A 4MBOA 3OR6B 3RWFA 4MA1C 1D9KA 1BGXH 3HKFA 1N0XL 3BQVA 4WV1A 4R7VA 3ZKMD 2QPEB 3EH2A 3LQMA 2GJJA 2R83A 4DKEL 5DVMA 2LHAA 3L08A 3PXLA 5IVOA 3CXHD 4GIFA 1VQMP 1WCQA 4OZHE 3F58H 5CEZL 3SO5A 2Z4TA 1FBIH 2ZXDA 2ZKMX 1NTDA 3CVIH 1KXHA 3SY0A 2NDFA 2R59A 3GUTB 4X7CC 3A24A 3CZFA 5E6RB 1IAOA 4L5FE 1JY3O 2WQRA 2O3JA 4DJGA 3C60B 3QXTA 4MS8C 5EO9B 5EU7C 4RAUB 2K3HA 4JDTH 1M9WA 1PX3A 2DWTA 3KBHE 2VGLM 3MGAA 1CDGA 4H44D 1FGVL 5DJ0B 3TU6A 5DC9B 1Z3GH 2VABB 5CWSB 1WG3A 5E79H 1C5CH 3US0A 1TZIB 2EICA 5C0GB 2GIYA 3US1A 1HH6A 2YBGA 2BCKB 2E5TA 1HK6A 4WWNA 3S5LA 2GUVA 5I82A 4HGMA 1EZVX 3LN4A 2XN9A 1AO7A 4UQ3B 3MRHB 1IAKA 1TTBA 3AXLB 1NMCB 1GCFA 2FKWB 5L8RJ 1WGVA 3HPLB 2W38A 2NNXA 4OLWH 3HHRB 4YHNB 2CR6A 1MLCB 4KAQL 4QYAA 3L1FA 4YDZA 3DGDA 1A7NH 5I73B 2V2WB 5HHME 1NANI 3SE8L 2VTFA 4UQBA 5DT1L 4TUJA 4OUOA 2AQRA 1DVXA 1ZVHA 3GS7A 4RESB 2Q5UA 4P2QD 3RWIA 1ZA6A 5I0DA 2Y7QA 1OKEA 1U2YA 2R56H 1AYRA 1OCRB 4LESA 4KH2A 5IKCA 1BQSA 3MLTA 1NUNB 1X0TA 4KDVA 5KYUB 1H6UA 3ARZA 1OP5H 1VRSA 4FULA 1T3UA 2QTVA 2VERN 1PQZA 3GMAA 2UYLA 4IBSA 3GSOB 4JG5A 4NUMA 4X6FB 4ABQA 3V79C 1OW8A 1MAKA 2A9NL 2JJSC 1MHEA 3S36L 4N26A 4MX7A 4PD4H 3VI3F 1EUUA 4XPHH 2CGRL 2ZJSL 3VFUB 3S7GA 5GS0H 2OYOA 3H1ID 3OLDA 4BBWA 1YSOA 2Z35A 1KT2B 3S37L 5LQBL 5ISZE 4HC1H 2PTUA 4Y5VC 2OMZA 3IVKB 2WXPA 3THML 4D7BA 4OW6A 4N0RA 4MXWH 5KUMA 4F7TA 4Q2ZB 3QISA 4YXKL 3A0BE 1GDTA 3GSQA 3MXWH 4FQLL 3VWKB 4YS4A 1QRKA 5JMRA 3FO9A 3D39D 2F7RA 4ZTEA 2VH5L 4MJIE 3UROR 1XIWA 4QD2E 4E41B 5E5RB 1H89A 3VVVA 5SV4A 1KCUL 4WIQA 3BKYL 2X40A 4L8DB 1ZK9A 1QUPA 4IIQC 4UM8A 1XSKA 5IWLC 3G6JF 1IQDB 1DQJA 3Q2WA 1G6RL 5L0QB 1T20B 3PGFL 4RX4A 5F7DA 3SPCA 3V4VL 1NCBL 2EABA 1FV1A 1OAQL 4OF8A 2WTRA 1DEBA 5DK2A 1YYMH 5JW3L 1IGYB 1AV1A 2IAAC 3H6AA 2E0PA 2D7MA 2XICA 1MCOL 3GIVB 3WNKA 2I27N 1HCYA 2ZP9A 4PJGE 1HGZA 3RPIA 3QORA 4LP4A 1J5IA 3CCLP 4YDVB 5I1LA 1MZZA 4PJ8C 1L9QA 1RJCA 2ADIA 3EGSB 3FT2B 4PR5B 3BW9B 3S1KA 2ZWNA 4HXAL 4OGAD 1X5AA 4K3HA 1SFHA 5DUJA 4HJGA 5K9OA 5D2NE 2ALAA 4XOBA 2MHAB 4I88A 4YSQA 3C75A 3MC0A 2GCYA 4A7SA 4DN4H 3FSAA 1NU1J 4Y7MA 3ECVA 4WI5A 3MRQB 1LO5A 2D2CC 4NOBA 1RPKA 2EXSA 4AVJA 2WZ6A 4HJGH 2HT3D 3QZBA 5CCKL 3QRGL 2YIUC 1W2BO 2R1YA 2P5WE 4OKDA 2Z8SA 5FYJH 3QDMA 2OYKA 3U1AA 4B9PA 3HN3A 3WS3A 2EDYA 2FBJH 1CPUA 1OK0A 1PBYA 3HZMA 3C2AH 3GJFA 2GABA 1EO8H 3KS0H 3MFFB 3RGVB 3RVTC 5JNYB 1JM0A 1A4CA 1QFUL 1UA7A 2VO5A 5CR8A 5SX4H 4ODWA 3NCYS 3HG1E 2IADA 4Y5YA 1RZQA 3WHXA 3RVWC 3NTCL 2E6JA 2H47C 1LDPH 3QIWD 2DQHH 4CUCA 1J8SA 1Y6MR 3VQ1C 1AQDA 1DTUA 3TGUE 2G9HB 3DX9B 2WSEH 2KSJA 2A2QT 3PWNB 3VG9C 4PJAE 3IJHB 1SQBE 1OAZL 4KNQA 2Y5TA 4MB5A 2ZFCA 4KKNA 5BS0D 4N9OB 1C08A 1CFBA 2PW1B 3AE9C 3FULA 3HE6D 3VX0A 2F08A 5D7IE 5LCVL 5FCUH 5HGAA 4PWHA 4TSCL 3JV6B 4UM9A 3GBLA 2FSEB 4WGKA 1HCFX 4IOIA 4CU6A 2X4SB 1XB3A 3ZTCC 3A4DA 4GXFA 1P7KA 4OY9A 2FH8A 3NDYE 2FFDC 4UOQA 6TAAA 4N8VA 1YY9C 4AYGA 2DQTL 2VDOH 3RY5A 5I6KA 1H3VA 4X50A 1OP5K 2H0PA 3U0WL 1MCNA 4MCZB 3RTQA 1XZ0B 3T3ME 3RB7A 1U58B 1RZKH 4UT9L 3S34L 1QX1A 3TT1L 2D31B 3A67L 1X6LA 4H25A 4OGXH 4RQQB 7PCYA 1MWAA 1Q8MA 3T97A 2CLZA 3BO8A 5AVZB 5DEFB 3EADA 2V9QA 4MAYA 5F7LB 1WAAF 5L4JA 2OTUB 5SWZE 1K3IA 2R32A 1C9SA 4JL2A 4YPGB 4XP4L 3DIFB 5H2FH 3LS4L 3UP1A 4NZDA 3ES6B 1IBGH 2G3NA 4CPGA 3O11A 1E9OA 1RP8A 3NFNB 4Y89A 1XH0A 1ZGLB 2X5PA 5JXAL 3PXHA 4ZX3A 3FHQA 1TPXB 4FNSA 2GJ6E 2FHCA 1F18A 3BWZA 1V7MH 3IMTA 1M7DA 1GW0A 3T4YB 5EBWA 5D1XE 2UX6A 3NCMA 3DO7A 4JGUA 3DI3B 3T0EB 1ZP0C 4GAGL 5C0AE 4I87A 2Y24A 3K71B 1HQ4B 3NCXA 4HISA 4CGTA 2IQAA 4PJ5B 3LPWA 4WJ5B 3ALPA 1OM3L 1QUNB 2F54A 4NC2B 5AVUB 5B1AB 1AHWC 3AMLA 3VXSD 1OTSC 1ZLUH 1Z3RA 3TGUJ 1XMWA 3GRGA 1TQBC 5DJDA 5HVFB 2XZRA 5CU9A 2HN7B 4WI2A 4LDOB 1QFUH 3L4UA 2O1KA 3CHPA 4RZCA 4GXVH 2JKRM 4PRID 4APXB 3QUMB 3BUPA 1QW9A 4G6MH 3X11A 4LASH 1YTZT 3HE7B 2FBJL 5D1XA 2OYPA 5B39G 2YD4A 5AW9B 2J72A 2KQNA 1U92A 1I7ZA 1N67A 3NJJA 5LBGA 3VW3H 2VDML 2Q7AA 1G0YR 2W0PA 1FZAA 3BPOB 4D9RE 5FUCE 4LBAA 4I1RA 4YC2C 4QRTB 3EGXB 5IB5A 4XXWC 3MJ8B 1KFAH 1ILUA 1NTZD 5IBLD 4OLXH 4O2CB 1NPUA 1I85C 2G5UA 2ZUSA 5E8NA 3KPLB 5I71C 3ZZLA 1DQLL 1UJTA 3K5SA 4ODXA 4PJDF 1VQPP 4XNZC 3Q06A 3DVGA 3JCUE 2VITB 3CFMA 1S7QA 4GP5B 3RTLA 5LGHH 2NY0C 1ETB1 4ERSL 1XGPB 3DGCR 3O6FD 3ABKB 2K6WA 3OMAB 1BFTA 1XF3A 2OJZL 4M6NH 3QPQD 2RR3A 2J25A 5F7FA 4AIXA 2V3DA 3II2A 1PLAA 1I7TA 4EO5A 4P0DA 4X4YB 2NQDA 5CJQL 1CDJA 2XSKA 4RMQA 1DANU 3T0XA 2JTDA 2AJZB 1K5WA 1BECA 3CC2P 3A23A 3TF4A 4TULH 4GW5A 4G8GA 2GBUA 3PHQA 2H26B 1VQ9P 5CUSH 1HH9B 3PWPB 4Y99B 4FX5A 4IW4C 1GC1H 5ICUA 1KWKA 1T5WA 4P2OC 4ZPVB 5F0LB 5LQBH 2JO1A 1P84D 1L9PA 1U3HA 3HG2A 3TZVB 3CJJA 4CU8A 1JZ7A 1MI5B 4GG8A 4AXWB 4KKAD 5FS5A 5M95B 2GSIA 1KB5L 3GLAA 4J23A 1S6NA 1SY6H 3TA3D 4WF7A 3G5WA 2AJXL 5KYXB 3D07A 4YHOL 1USQA 3QFGA 4D3CH 5FKPB 1AKJA 4Z5RB 1IIKA 1YEEH 2K4AA 5ENWA 1KBGL 1L0XA 3LMJH 5GGSB 4CKVX 5DTFA 3LD8B 2H2PD 1IT9L 1KULA 1S7TB 1KB9E 4BWNA 2RHEA 3BP6A 1NC2A 2IFGA 4MA7L 5T1KB 3U6XS 1UB6A 4RETB 1DJHA 2V2TB 5C0CB 2NY7L 2PTTB 1M1SA 4A2EA 1UM6H 2G75B 1XQ4A 5G4OA 4FKEA 1X6NA 3TN0D 2P5WD 4BSVA 3OKLB 4TLSA 5CXPA 2VC2L 5FM8A 3SDAC 1CICA 4HBCH 2BZDA 1KACB 1AY1L 2XJLA 4PRNA 2ERJB 2JKJA 4IS6B 5IEKA 2WXRA 1TSHA 3V0IA 3MRBA 4B5ZA 1IFDA 1KTCA 1DQTA 3AQZA 1ACCA 3OKNA 4ZPVA 3GSUA 4EZKA 1XGYH 3G6DL 4JFTA 3TFKD 5IG7B 1YPZE 3B6SA 4R7NA 1GZPB 5EU3A 2DBLL 1R3IH 1YQ4C 3T6ZA 3DIVA 2IDBA 2LABA 2YC1B 2G4EA 4PGDA 4ODSH 3FQWB 3D33A 3R7QA 1YJNP 3I9AA 3WN6A 4L1HA 1EMTL 1JE6A 1OTTC 3IGAB 2C7FA 3HI1B 3VI3E 3RWJA 1TXKA 2E7DA 2M5AA 5C08D 3Q2YA 3VMPA 3W2DH 3P7KA 3CLFL 4DT2A 4EZLA 1P5UC 2QFRA 5HHMB 3WTXA 2EDLA 4ZFOL 4ZUUA 5IR1B 4RJTA 2YKLL 3ULVL 5LGHL 1ZT7B 2VWEE 1FN4A 1SQPD 4R7DB 2GC4C 5E5MB 3K2IA 1AVAA 1OAYL 3T04D 5FGCE 3J7HA 2EUXA 1NCCL 3Q3GB 3IE9A 4JCWA 1O9WA 4FXGB 2BNUA 3AQDA 1A6UL 2OJZH 3F8UB 5C0IA 2DOCA 5HHNB 5IBUB 5GRYA 4IKNA 1J1XH 1MCDA 2UX7A 4P3DB 2AQNA 1SJHA 4XC3H 1KB3A 5IBTH 4HUVB 1T1YB 1AE6H 5E08H 1H6TA 2FYUJ 3HR5A 4P4KC 1KZQA 3A4EA 2JK5A 3MA9L 4LCYA 2OTKE 5B22A 1M7XA 4NP9A 2CAKA 2F54E 2VM4A 1QQDA 4LLWB 2WBJD 4Y1AB 1J8KA 2Q2EB 3LRHA 3IDMB 2HN7A 2WKOA 2H8PB 4BHUA 5C0AA 4GT7A 2AJUH 3VFMA 1QSFE 2YD3A 1CDUA 4GLRH 2W9DL 2FECL 5IFAH 2A45I 2IV9A 2AV7B 5B39A 3K0WA 3NJIA 2JJSA 3VH8G 5FO8B 3SKJH 1OX3A 3OR7B 1CR9H 2XWJA 2BHZA 3DHMA 4HH9A 1ZGLP 3MLZL 3WN5A 4WW2B 3FTSA 2MPVA 2WIMA 1BLIA 2P45B 3CBRA 4N28A 3IPEA 1HBWA 2E47A 1LO0L 1IBDA 3HR6A 1UZ8A 5D9SA 4Y5XA 4CC4C 5IY5B 3I6LE 3M6DA 5F9OL 1CXKA 1CL7H 5TQ2L 3JTSB 4PJFE 1MHPL 3T6WA 3QCTL 3RGVD 1JV2A 4TKWA 1QAWA 1F00I 3T6VA 2ZOKA 3KPEA 3GC3A 5L9DH 4Z7OE 1TTFA 2VR3A 1WYJA 4MAUL 1M6OA 4CVUA 3O4OC 1UWGH 5SX5H 5GRVL 1UIXA 3TA4D 2R69H 2Q87A 3A5VA 1HHHA 3DX6B 1RP9A 2VC2B 3DJTA 3KLAB 3T97B 1OP3H 1WS8A 2XV0A 4YDIH 1GK4A 2C9XA 5CLXA 4WTWA 5F1NA 1AR1C 2E9GA 2ZF9A 5F9WB 1IBGL 5BPPA 4FQ2H 2XX1A 4WFED 4OTXH 1QRND 3FSVA 1CF8L 1TU3F 1GC1C 3WGUB 5DUPL 1LTXA 1KNOB 1VKXA 2J21A 4GO6B 2F8IA 3O6ML 1A7PL 4FXKA 3IBEA 1XGTB 4E9YA 1IM9D 1NOFA 4MVBC 3MRMB 1UM4L 4DO4A 1JMBA 1DZBA 4OCYH 4MNQE 1YNKL 3GMNA 3V4QA 4YHYC 2APSA 1RZ7H 2J4WH 2OMBA 3S34H 1BAFL 3QUYD 4PJAA 1UFUA 3QQXA 4AKOA 2ADFH 1LO2L 3P73B 1A21A 1Q94B 3DARA 1D7BA 4FLQA 4S2SB 1E4KA 1SOSA 2MNUA 3EOAA 3KG5A 2YS4A 1SYSA 4AM0B 1BCCD 2FYYA 2PCXA 4FG2A 4FG0A 1GSMA 3QZWB 5DQJA 3F2LA 2FX8H 2PXYB 4U3FG 4ZXBA 3E1ZA 4XAWH 3EXLA 4YXDC 1RK1A 3IS1X 3T3PB 3I75A 3UOAB 4XNXL 2H9GA 3PP3K 1MCSA 4KROC 1FE8H 5DRXA 2J4WL 4Y5VA 3MLRH 1XR8A 1T2JA 5EZOL 4DVBA 2MSPA 3FU9A 2WSSH 4UWQB 1PIXA 4TLTA 4XNUH 5GZOD 1E4WL 1W8OA 5A16A 1QYGL 4R84A 2I85A 4UZUA 4LOFA 1HILB 5EPMB 2N1TE 5LXGL 3ASWA 3PAYA 5I24A 1CLYH 1I8IA 3MV9A 5JHBA 2CDEB 1FLRH 1WFUA 2ZOTA 3S88L 2I07B 2O6EA 2ZKHL 2VLRE 3ZPDA 3DXAE 3EF4A 1VGKA 5E6ZA 2JF1A 1YNTB 2FWOA 1YBKA 5A2AA 3R06B 1YYCA 2VZVA 3L3JB 3U9PL 2NZ9D 4JFXA 2WVTA 4W9FC 1UCBH 4G6AC 3BW9A 2PPAA 3WSQH 4IEFA 1T80A 1NHLA 1TQTA 2AABL 2VLJA 3O2DL 4JZJB 1D2OA 1MIEH 4YDVA 4CKQA 4U1SA 4DKAA 2WTYA 5ESQB 4AJYV 5C09B 5IBTL 2A38A 4WI7A 3B9DA 4P04A 4PS4L 2TSBA 5IHUH 1M7IA 1ITBB 5ADOH 3EYUH 3KS0J 1W0VA 1A6UH 2OYMA 2VZ1A 3GPEA 4K7PL 4UV4L 2XPYA 3C5ZD 3KZ8A 4MMYA 1QHOA 3P3TA 4ALAL 4MYWB 1AKPA 2Z31D 4Z7UA 4HWZA 1Q9KA 4HAFA 2P47B 4L23A 4MSWB 1MVYA 1NWOA 4EVNA 2IXQB 4JHUA 3O3EB 2KLSA 3VWKA 1R46A 1GHFH 4D9RD 4AYBA 3D2UB 5C97A 1FIEA 3QJSB 1G5AA 2IH9A 4I2XE 2XX0A 1E8ZA 3MODH 1UXWA 4ELMF 1S7RB 1BEXA 5GQBA 3FRPA 1DL7L 1OCOB 3NN8B 4K2UH 4PIBA 4NZJA 5MI0B 1JZFA 4A7TA 1I1RA 4AW4A 4BKTC 2QADB 4FMFA 3GSNB 3SE4C 2DD8L 1BIHA 5M1BA 4D9LL 4P2YA 4Y4FC 2OMXA 4LXFA 4XH2B 2EE0A 1ZY9A 2V2XA 5L0QC 1N7SD 4RGND 1W0VB 3CHRA 1JGUH 5T3XD 3RQ3A 2D4FA 1EHNA 3H9YA 4WHCA 4ZFOA 4P99A 5C09A 2DLFL 1RF1B 2VW6A 3H1JD 2DJ4A 3CDZA 3KDMA 4TUJB 2VLJB 3KWWB 1G7JB 4FJYA 2DI8A 2ADGB 3U7WL 4IOIH 4ELKA 1YEIH 4QJ3B 4X5QA 5HJ3A 3MNZA 2E9BA 4QRAA 4NO5A 3QWOC 2FGZA 1LDSA 1A9BA 2JSFA 3B2UC 1THCA 1QI4A 3COOA 4M9PA 1U57A 2FH6A 3INOA 4PTTA 3VTTA 2YMXL 4Q4EA 4DFIA 1KMGA 4UQ3A 2CWRA 25C8H 4AIOA 5DD0H 1Z9OA 4E2OA 2VM9A 1KLUA 1PZDA 2O5ZL 2BCKA 1AR1B 4L76A 2WPQA 5HPMB 2X12A 2O4EA 3ARRA 2ZXAA 1BA9A 4QT5B 4WKZA 2BNQE 4O4YH 4XMLH 3V6BR 3VW3L 1F02I 3ARUA 4ZUWA 2ADJA 5C2BH 5DJ0A 4YL9A 1M57B 3RUGA 3DECA 1B4LA 1LP9B 4GAFB 3ZDXB 4ZZFA 5IUCA 2IAMC 1NINA 2Y23A 1PPIA 1NTZE 5MEQB 4R4FH 2BCCG 1XB6A 1CB4A 2YPLA 3RRQA 4OIIH 3GJEA 2JJWA 1D3CA 2GTQA 1AY1H 3L70J 2C34A 3Q2CA 3KPSD 3E6HB 1FNEB 2Y36L 1NLBL 2EZ0C 2AEQH 1U8QB 3BVNA 5D1ZI 3D48R 2JLPA 3KCPA 1D7DA 3FUKA 4K55A 4CVXA 1QLEL 3GD1C 5C07D 4HWEL 4NKIL 4R83A 3FN0L 5I17B 2FNBA 4ZX6A 3HG3A 1J1EC 1Y07A 1IKFL 3NFPA 4OCXL 4IU3B 1OARL 2XQYA 5JPNC 3HUJA 3CX5H 2WPVB 4PV8B 3S3DB 4AJ0A 2IQ9L 2E9JA 4LBEA 4OH2A 4OJDH 1DVFC 1LT9A 4MWFA 3MV8B 4HS8H 2XQYK 1BBJA 3N42F 5HDBB 4PJAF 1NGPL 3MX0B 2EUWA 2ESVE 4L0YA 1JYWA 3HG5A 1Z5HA 2ZSWB 3QUZC 4OCNC 2R0ZL 4OI7A 3CFUA 1YUHA 2WGXA 4OZHB 2GW5A 5JHDD 4UIKL 1P1ZA 3S3PA 3V5DB 3FTYA 4QO1B 2OP4L 4OLYL 3C8VA 3VH8A 2GBTA 2L4OA 1ORSB 2Z93A 1SN0A 2ZCHL 4Y2DC 5ECGA 3WJMB 5F1NB 2IALA 3BIKA 4XP1H 3WNIA 1JTOA 1B4JL 4X7SL 4GS7B 5FGRA 3L73D 3ULVD 5M94B 4R2GC 1FL3B 3WJJC 2Q20A 2KSEA 4XMKH 1AQ5A 2GG1A 3FW6A 3P3RA 4N2BA 5IW3A 1HL8A 3ISRA 1NFIA 3KL0A 3OKDB 3JC22 3F83A 3U25A 3RVVD 4JQIA 4C55A 4LT7A 1X5HA 4PD4K 1DJSA 1JXKA 4M62H 3WEMA 2ERJC 3M07A 3SJVA 2R5DA 4YXWH 3FTGB 2YPLE 4R7XA 5DZAA 3MCKA 4XNMA 5T33H 2O6PA 3IJYB 3B2MA 2WMPA 3B7YA 4BUQA 4BA0A 35C8L 3PWVA 3D18B 4OZGE 3O2VL 4N1HB 5K69A 3DGGA 4HJ0D 1RH5B 2EDKA 4W6WB 4FYQA 4OZFB 3VJ6B 1WBYB 5H94B 5GIRA 2R3CA 3Q13A 2C9RA 2L7UA 1I1AD 3L5XH 4ODHL 4LCUB 3O4LE 3OZ9H 4UOW0 3GBEA 2R51A 5K9QI 1UT1A 3SCMA 3ZTDC 3OXSB 5I6OA 3AE2C 2Z1PA 3D85B 2JCWA 3K1KC 5CINH 5CZVH 2DLGA 3MRDA 2BP3A 1NMAH 2QVIA 4GXUM 2DBJA 1W0WB 3U4AA 4JDVA 2IAMB 2IDTA 5AVWB 1H8OA 4F9LC 1KYOD 1D5IL 1NM9A 3ZLQC 5LAPA 2AEPL 2H32B 2ZQKA 2QVAA 4YSPA 1SVFA 2QVFB 2E46A 5IW1A 3U83A 1AP2B 1KYOH 1CGSL 1E40A 4YUEL 4M62L 1DE4A 4HJIA 4WU7B 1OLZA 2KLVA 5ICYB 1M7UA 4JPIB 5D1QB 1L6XA 5I6LA 4M1CD 32C2A 3K8MA 1UWEH 3IJSB 3SZ6A 1CN4A 2X1WL 2OL3H 5DJ8A 1ZCRA 3OV6A 2QE7H 4JQ0D 3SDYL 3QRBA 4FXGA 4K3JH 4A2DA 4H0IA 3EO0B 4M8QA 2QZ5A 1G5GA 2V4LA 3N0AA 1MRCH 3P1VA 3LKQB 3U30B 3CFDA 4X0KA 4DGVL 3OLEA 1ZT7A 4XE5B 2HVKA 4U7KA 1B2WL 1EBPA 2OYHB 1WLHA 3KVQA 5J1AB 2BY1A 2C9NY 2X4QB 3VDBA 5GS1A 2JI2A 4F24A 2PP7A 3RZCC 4N0UA 3GIZL 4Z3FA 4MXVE 4HGKC 4NIYE 5ABAA 1ETZB 1BVNT 1CL7I 5A2KH 4N1CA 4GKLA 2DKUA 5TQ0L 3TEWA 1EXJA 2G2NA 3FQWA 3TO2A 1KIUA 4E9XA 4B60A 2WBJB 4Y1AD 2OJ1A 4R7LA 2YA2A 3SDCA 3F7YB 3TEXA 4GOSA 4FZ8H 3UG5A 4PB9H 3TEYA 4TUKH 1IL1B 2YUVA 1PNDA 3DPDA 3KGUA 3E0GA 1R5SA 1KGWA 1ZT1B 2NXYD 2WINA 3IPFA 4XP5L 4YAQB 3SIKA 2APBA 2C4FT 3MRBB 4PJ0E 3ECUA 1WFMA 5CCJA 5LDSA 2Y0EA 1BZ9B 1CQKA 5LAXA 2KPNA 3AB0C 4UTBL 1P1VA 5ICXB 1CICB 4Z95L 4CMHC 3D5OF 5FYJU 1FNHA 1T7WA 3EYSH 3WUWG 1EZVI 5DHYB 1FHGA 2MMXA 3BKMH 4YZWA 3S4SA 3FOLB 3M8OL 4MAZA 5KJ4A 2QQNH 4P59H 4GODA 3CFBB 2Y69B 4FQQA 4QYOA 4Y9EA 4YQXL 3KHUA 3CAFA 2BVPA 2QSVA 4EZJA 1SFCD 3I9PA 5DTFB 4GP8B 4PQXA 4U6XA 3WENA 1PEWA 3MRCB 4OV5A 1AKJB 5CFHA 3UTZB 2XPGB 43CAB 5C08B 4WO4B 2OLDA 5SWSD 4PBDA 4L1TA 5F3HA 3B34A 2X6VA 4DTGL 4P5TC 3I9IA 1KJ2L 3P9LB 4PCSA 1INDH 4MHHI 1NMBL 5D2LE 3NIGE 4PD4J 3N9GL 3IDNA 3D30A 1W16A 5F1IB 1IC2A 3IFOB 3QH3A 1G6RH 4M61A 3TSIA 3QS3A 3A0BH 2XYCA 3VFPB 1Q82Q 1ASQA 3I6KA 2E4FA 1RIHL 1OPGL 3VYOA 4K71C 3HE5A 4K5NA 3PWJB 4OFDA 2UZYB 3QIUC 4AV0A 5E4EC 1ZGLM 1KTLB 1L0NK 4PRPB 1E2VA 1J7VR 1FG9C 3CCUP 1AH1A 1NTME 2CDFB 2VAAB 3FTUA 2VQ4A 4U3SA 1V55B 1ZKAA 4I5BA 3ISYA 4K94H 1Z9SB 4RFOL 5F1KC 2VDKL 3F7PC 1TJMA 3DVGB 3VXMA 4HQQH 4HMCA 1VPOL 1CYXA 2IBZI 2Q5BA 3KPLA 4OT1H 2CPCA 3LZLA 2UWEB 3LV3B 4U6YB 5ISZD 4OV5B 4BXSV 4L0ZA 5T1LA 4NQEB 4H0LB 1DJXA 3WEXB 4NQCA 4YBQC 3T0BA 1J9CT 1QR4A 3JZ7A 4JPVH 4KKPA 3W9EA 1VIWA 4U6TA 4NHCL 2XWEA 1JGUL 1KCWA 1TT6A 1MCJA 3SFDC 1MW3A 5KBNC 1XD1A 2NUTB 1CBJA 1T1XB 2D0HA 4JFEB 3ROLA 3LEXB 4Q89A 4ADJA 5DHYA 5CZXD 1MCKA 3FONB 1RJYA 1UZ6E 1WCBB 5IROA 1XGQA 3FFDB 1NUGA 2EH7L 1EJ6A 1PSKL 3FQUB 1OGAD 1HGVA 1MFUA 3QO0B 4U31A 3ZT5A 1RIVL 1HL4A 1F56A 1QFPA 2WLZA 1KB9J 1I85A 4I77H 1FCCA 5E8PB 2Q76B 3VSVA 3EJSA 1ROCA 5KYYA 2OXHA 2AXCA 1KCVH 4G1EA 2B4CC 1JRHI 2NW2B 1IC4H 2CPSA 2VISA 5GS0L 2BW4A 1VF5C 4ZPTA 2CO6B 2C3GA 2CO4A 4EN3C 2VJ0A 3HS9A 3QJZA 4H0LD 3FU5A 2YA0A 3JV5A 1BXXA 1TZAA 1HWGB 2VW4A 3JYCA 4BDVA 1A7BA 1QEWB 4L3CB 4NNXA 5BW7C 3KPRD 3O41A 2L8AA 4UDTA 5KLVK 1EEQA 1ZGLA 5G2NA 1L9OA 4MS8D 4Z7WA 4LVHC 4FL4C 3D0LB 2BY0A 4ATTA 4GOFA 3KYMA 4HWBL 2W0FA 4K3GA 2YEQA 2WZ5A 1OFCX 1YNLL 3NPSB 4W70A 1A0QH 2Z31C 3LZFH 4WLCA 4K15A 1WPCA 4XP6L 4PLOB 2HLAA 3CUPB 5DDHB 1A8JH 4B9ZA 1L0ND 1CYWA 1DBJL 3EBIA 1I3GH 1N3NB 3BI9X 5CEZD 3D08A 2ZT9C 1X8YA 1PP9J 1QPKA 3ILQC 1OTSD 2DQFB 1SQBJ 4JANA 3AS0A 3BH4A 4ODBD 4CN4A 1E90A 3SBQA 1IGMH 2F5AH 2JJVA 4WU7A 5D7KD 3ARFB 4XP4H 35C8H 4LLDA 4IOFD 2ORBL 2IFFL 1SQPG 3GK8L 3LNIA 2Q6WB 4CSPA 4U1GB 4XX1E 1U8LB 3VB9A 3QJTB 1AQKL 2ADFL 5MEOB 3QYNA 5CJ4A 2F5BL 5F70A 1HEHC 3H4FA 1N5AB 4JPSA 4JO8A 1SQQJ 4W9CC 4W4OA 2XZQL 2QGCA 2Y06L 3MRDB 1KV7A 1O5PA 2WQ8A 3ZMEA 2R2HA 3S4SG 5HYJA 3V5KB 3X1FA 4CMMB 3D85A 1UWXK 5KEZA 5DFAA 3DSFH 3QFJA 3MYJA 3KLSA 4MJIB 4Z7AA 1JDDA 5E6SB 5EMYA 2VQ1A 1PG7H 4YH6A 2M8XA 3DROB 3K6NA 5LN4A 2VDRL 4A1RA 4S1QL 1F3JA 2ORBH 3U1QA 3GYRA 3HE6B 4NPYB 3VXNB 4WB4A 3G5XB 1CE6B 1NCTA 4W1TA 5CJ5A 2KZ1B 3U79A 3BD3A 4Z7QE 3ASOB 1R17A 3AAZB 1WRFA 5T8IA 3WHXB 3C09B 3RNKA 3ZN6A 2EYTA 1BF5A 3PV6B 2A0LC 5DJ2B 4KK9D 3LRLA 1X5FA 1F5WA 4GFTB 1T1ZA 4HS6B 5D72H 5B1KA 3P8MC 4G9FA 2A4CA 1JF6A 2D7TL 2HFGH 1DLFH 4EJ1C 1O0VA 3FB5B 1JFQL 1Q1PA 3TC9A 3CXHI 1HC1A 4ES8A 3DRQB 5KSBA 1DO6A 2P3YA 5KLVD 5JZ7D 1NGYA 2GKIA 2N01B 5J06A 1DQDH 4L8CB 4X9HA 2QMKA 1P7QB 4U3HA 3RX7A 1C7SA 2Z5HA 1MF2L 1P4LB 1FPTL 1XT5A 4WDIA 5FUOL 5HVHB 2VXQA 4Y5YC 4LCWD 3WS6C 1PY0A 1J1EB 1DQMH 3DUHA 5DURB 3QUXA 2E6QA 5IQ9B 1BBJB 5GGQH 2I9TA 4AM0Q 4ZDHB 2CHXA 2CJ3A 1LK3L 2QGEA 4JVUA 4X8JA 4LBEB 5I1LB 1AE6L 2Z6FA 2BRRH 1FDIA 5JYMA 2XWXA 1OAJA 4MJHA 3HG1B 2WUBH 2G0KA 1XHHA 1Z5LA 2YR3A 1GS7A 1IGYA 4JNXA 3VA6A 1L0NJ 1KYFA 3GXMA 4MAYC 4NO3B 3BE1H 2HH0H 4J6RH 1Y6KR 1LL1A 2P67A 1EA9C 1J1PH 4U1IA 4WWKA 4TQHA 5F9OH 4CDGC 1FG2B 2HT3C 4B9GA 3GB7B 1MRFH 1JPSL 3BAYA 4AY0A 5EF1A 3CMGA 1RPQA 4N3YB 2AJSH 4J3OF 1IBYA 1NBVH 4ZFFA 3AEBC 1YNTF 2Q7YA 2WQYC 3ZU8A 5LKNA 4OU3A 1R3JB 3HW7A 1E7VA 3GSQB 1K6QH 2VXUH 5AVVB 1J87A 1QFWM 2ZXCA 4E9WA 5KTBA 1QASA 1OAQH 3IAGC 2H0JA 3R19A 4FQXD 2FFDA 3LYRA 1ZOYC 3QUMH 3Q1SL 3RVWD 5I1KL 4Y4HC 4QT5A 4K3AA 4BFGA 3L75D 3STZB 4Z7NF 4LK4A 1LGHB 5KJ7D 1P6FA 3IWUA 1IC5H 5D5MA 2UZIL 4F15C 4XVJL 5CNHA 2DZEA 4Y19B 4AQZA 1AC0A 4NUQA 5D1QE 2G60H 5T3XE 1KIPA 1MY7A 4R5TA 5I0XA 4P2QA 4XVTH 3K2KA 1T89A 1ZHLB 3GMMB 2BIIA 2FQDA 1OAXL 5ERWA 2HLFD 1IEAA 1U42A 1J1XL 4WQOA 3HJ0A 5AW8B 3M17A 4AEIL 2X89D 5L6YH 1AQTA 1E27A 1M2VB 3G6DH 3OAZH 1KY7A 1URLA 4LSQH 2FJGB 4NC1C 4NQSA 1N70A 1YNLH 3FQXA 3DMMD 3C5SA 1MCFA 4FQJH 2DMKA 2X9XA 3NCJH 4XPBL 3BRGC 1NSNH 1GZQB 4X9BA 1RUPL 3IXTA 4A37A 1IEAB 5BV7H 1S5LH 2X2HA 4YHNA 3JTTA 4Z0XB 3KDPB 1FYTE 4P2RD 3AXLA 2EZ0D 4UV7L 4CNIA 2I7SA 4N78E 3QA3B 1A4KA 1TQUA 3F65A 1JCKA 1IX2A 1D5BB 2N1TC 1U8PB 5M7QA 3CCMP 4YSEA 4BWUA 3EDDA 1L4AC 2JMRA 3GJFK 2WPRA 1IKOP 2P1YA 4PU2A 3D39A 5FKAB 4I4WB 1YMMD 4J2QA 4TLKA 3PHOB 4A7VA 1X5JA 2UY7A 5JOEA 5AEAA 1FAIL 2XZCL 5EIIB 5HHQB 3PGCA 2OMTB 4NAQA 4KPHL 3EJZD 3BLPX 4PIRF 4HF5H 4X5PA 4JQIH 2ZUUA 3ORJA 5CJXC 1HSBB 4X4XA 2YAPA 1F2XK 4X6DB 2PWDA 1QR1A 1C7TA 3MOBL 5ALCH 3OQRA 4KI5E 3UAAA 3GLMA 5C07E 1T66C 2DPKA 2IMMA 1YCSA 3O2WL 3STLA 5IFJB 3FTWA 4FZ8L 2GFBB 1VACB 1FGNL 2NY3D 4ZI8A 2EQDA 1HTLC 4ERSH 1HZHL 4AMKL 3PS6A 4DP2X 3CX5E 4ICWA 3T0WA 3VD9A 4HAKA 5HI3C 3BN9D 4WV1B 5FIEA 4O51A 4Z1MH 3QJQB 4LCIL 4NKQB 3FTVA 1D9KB 1M57D 3RVVC 2ARJA 4HIJB 3MIWA 4L8SC 3NRFA 4XO5A 3IJ7A 3H53A 4OF6A 2CLRA 3ZE2B 1YNTA 4N2MA 4RFOH 4B95C 3ATDA 1DQLH 3QI9C 2V37A 1P4LA 4X9IA 4OUUA 3E6FB 1FVDB 1W91A 4HIXH 3V4VA 1HZLA 1PKQE 5DQ9A 5IMKB 2CGYA 5D7IA 3QAZC 4M6ML 2ZOLA 3QFDB 1ORQB 3T4AC 3T65B 1J9RA 5CMAB 5E6IA 2N1TB 4PSPA 2YAHA 1GZHC 2QBWA 2F1EA 2WZPA 3GPSA 4IRJA 3UBXA 3MODL 3WEBA 5IMMA 1EZLA 3D34A 1COBA 3GM0A 4HKXB 4G9FE 1QABA 2BSED 5DD1H 3IS0X 2DQCL 2HKFH 3AREC 4XPTL 3G6JA 3D06A 1D7FA 1A8ZA 5D2LA 1HTYA 2FJFA 4JY4A 4CC0A 4OCWL 1P4IL 1RK1B 1S5HA 4OGZA 3AAZA 5C0RH 1SUHA 3ARWA 5G5DA 3VXTA 2PXYA 1Q9OA 5CBEB 3ARGB 2EC9T 1NM4A 5EDSA 1L0LK 1PF3A 2FYYB 4XHQA 4X42A 4WI0B 1G7PA 5AZEL 5CCHE 5I1CH 3JXAA 4GNKB 5IMOB 2E76D 1FNAA 5C7XH 2AJSL 2HCZX 2EEDA 5I1AB 1L4AB 1Q0XL 2HLEB 3P30H 1WK0A 2V5SA 4KXAA 4U1GC 4UQDA 5DEGB 3J27A 3S35H 3L95A 4BK5C 3V9CA 5DHDA 3WNJA 4GUPA 4I18B 4PJXA 4C54A 5KS9B 4XNYH 3P3UA 4XAKE 1BG9A 1V54B 4OQTL 2HRPH 3CLEL 3HG1D 4WW2F 1DDHA 1S9VA 2CIKA 2TSAA 2VLKD 3CXFA 5CJOL 2F7IA 5CAYB 2OSLA 1EJ8A 3CSGA 4HLJA 4P2RE 4WU5A 1EHKB 1F13A 3NGBB 5CKGA 3ZR6A 4OB5H 4C7NB 1IFRA 3AS2A 5JORB 3OLGA 5F7WC 1KTDB 3WY4A 5D1QC 2BVEA 4AX3A 3UYOD 1A9EB 2ITAA 1R9FA 3K91A 4ELMB 3P8CE 2VSKB 4BZ1H 3PXJA 5LG6A 1TTAA 2BEZF 3QA3A 5D8JL 1GD2E 2HFGL 2QIWA 2LU3A 3L7FB 2A06E 4MKMA 3N50A 1DP0A 2Y7MA 3FSWA 4PRHE 3QEQD 2X2IA 1J5OH 4GRMB 5DJCA 1FZJB 2AQ3A 5T5FH 1A6ZB 4AYFB 1OCWL 1XBDA 2COQA 2LLNA 3U0WH 5HGHA 3SDXF 1PTZA 4HSCX 4WHTA 4B50A 5B8CB 1R6VA 3L3KB 1ZJAA 4BQ8A 1VL2A 4H44C 1JNHB 3EH3B 2XXMB 5ACLA 1YJWP 3QXDA 3W0WD 4OZIA 2Y1ZA 4OH8B 1T21A 4Y5XB 1LWJA 3TNUA 1YEKL 2A9ML 3MOQA 5FECA 1LTJB 3VRJB 4B7LA 4Y2LA 1PL5A 3LY6A 1XH2A 3SWFA 1IKFH 2X4OB 3WN5B 4KMTL 3U36A 5E9DE 3RA7H 5LNGA 5FO8A 1G6RA 5L7XH 5PAZA 1P84E 4ASWA 2UZPA 1THAA 3OAUL 3DVNA 4R97C 2H8PA 4ZMLA 4V1DD 1OWAA 4S1SL 3G4SP 1A7PH 2OS7A 3OWRA 3QQDA 2WSCH 3B5ND 4DVRL 4M48H 3GLZA 1GW6A 2RTTA 3K6DA 1ND0B 4QRRD 2JNZA 2PCPB 2O61B 3R0MA 3KW7A 2NPSC 1XGQB 3CX5I 3FFDA 4J3XA 3HNTL 2NSQA 4XNZB 2MPAL 3LS5H 3TESA 3FU8A 2XN1A 1RK0A 4Y8AA 4QAMB 4QXGH 3M45A 2LV4A 3O3BB 4LGRB 1VENA 1WS7A 4GP4B 3SPIA 4PGEA 5DD5H 1OCCB 2AK1H 2PO6C 5JDJA 4HCRL 5AKSA 5JDSA 1MDTA 3QUYB 1A65A 3BWAA 1UWGL 5I1CL 3A4AA 5CN2A 4EUPG 2VCOA 1B6UA 5T1LB 3LPPA 3RDTC 4AIZB 4CGUB 1LP9E 1CLOH 1W0YT 3BSZL 4LAQL 2CBPA 3WJLC 3ZDXE 4K94C 5C7XL 1G7HA 3MYZA 4JFFD 1AJ7H 2A73A 4FGMA 2QJKC 5E6UB 3VXMB 3WFBL 1CU4L 4D6TJ 1VGEH 3ASNB 1NJIQ 2BOCA 2R8SH 1MFVA 1UEMA 5G55A 3U1CA 3PGFH 4WFGE 5KG9B 1KN2L 1URZA 2F7QA 4QHLA 1ILSA 2CR0A 5IJVA 1YEWA 3RK2C 5C3LD 3KLHD 3U7YL 1IGIH 4LKCA 4P23B 2V5MA 1SYVA 1U3HD 2R1XB 2DQCH 2R29A 5FFOA 3HAEA 4NUJB 4G6JL 3JWOH 4U1HA 5FWQA 3T0EC 2AP2A 4GQZA 5JIQA 1SQXK 2F53B 3UBXG 3QUGA 2EDRA 3EWKA 5F9JB 3GSUB 4P5KB 1RUAL 3BCCG 2DQEH 1NFDE 4NM4H 4N8CH 4YL4A 1FNSH 5H2FE 3L3DA 1BFOB 1XGRB 1BXVA 1KILD 3KWTA 4QRUB 4NZFA 5I9QC 3DV6B 3VWJD 2D7QA 5D7LE 3ARQA 2VNCA 3N06B 2XIIA 2X4TB 4WO4A 1PY4A 2NXZC 3WY1A 1G9ML 4YLCA 3HUJE 3DSNA 1X9RA 1ED3A 3TN0A 1P4BH 4H20H 1S7TA 3BP6B 3CFIC 2VL5A 2VZ3A 5EUOF 1ZLSH 1TR7A 4ZMOA 4QYOB 1NCBH 3V4PB 3UP6A 4Z5RA 4GKNB 4OT1L 3DROA 2EYRA 2FEEL 5L88H 4N5ED 3BUBA 2YRPA 3MLWL 4MVBD 4XN4A 2IGFL 3ECBA 4OKVA 4N25A 3RVTD 2ZVOB 2X3CA 1B0IA 3HS0C 4M3KB 4HJSA 3MCLH 1G9MH 3BJ91 4OLWL 1FFPA 1MFCH 3TIDA 1T5WB 3MBEC 1WA2X 1QSEA 2E4TA 3O4OB 5BZZA 4TUOB 2KP8A 1U8LA 5CP3A 1V8HA 5DT1H 1NTKD 1GU4A 3QE5A 5EBLB 3O4LB 3UAEA 1MELA 5EUOB 1GYAA 1X9VA 5DD5L 1J1DB 5EOTA 2BPBA 4YSUA 1A2YA 3V2RA 2TRYA 4BD4A 3N4XA 3MR9A 3B2UD 2PR4L 3FYEB 4D0DA 1MCRA 3VXRA 1HNGA 4BH7A 1HT6A 4UILL 3L72J 4V1DE 4UNIA 3UZQA 4FDWA 4P48A 1T7XA 3MROB 4N0UE 3AUWB 3GXIA 2AVFA 2VR8A 2FT6A 3PP4H 4J3BA 3S3JA 1OOAA 1WO2A 2E7CA 2HLAB 3CUPA 5DD3L 4GKSA 4ZS7H 4WFFE 2DM2A 2K3RA 2B0SL 2FX7H 2GBAA 3ROOB 4KQ3H 3QB7C 2E75B 1DFXA 4JDEB 2EH8H 1CSBA 4P2CG 3QP3A 4PB9L 5E8NB 4TNWF 3ALXA 3FQNB 4PJ7E 1IC7L 1WTGT 3NFQA