5AW1B

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 85 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
molecule tags Hydrolase/transport protein
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw1B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw1B02
1OWAA 2P67A 4I6MC 3A2AA 1HUCA 4AUWA 1S9KD 5AVYB 5AW4B 1JUNA 4JYCA 2E42A 5APTA 2Z5IA 1NAFA 2ZXEB 5APUA 3M9BA 3WGUB 3B8EB 2WPSA 4GKGA 4M3LA 5AW6B 3TK1A 3VMZA 2WTYA 3P8MC 3VMXA 5AVZB 3LIDA 1GU4A 2BASA 3P7KA 4I2LC 1X8YA 1YYCA 3L35A 5APQA 5AW1B 1H89A 1CI6A 3M9HA 2XU6A 4AQRD 3HE5A 1GTWA 5AVTB 3VTPC 1SP4A 1GU5A 2JJLA 3T97A 5APSA 4LC1A 3V4QA 1DH3A 4GT1A 3A5TA 1H88A 3KDPB 3O8ZA 2YO2A 2W6AA 2E43A 4DZOA 1HBWA 3LIEA 3MGNA 1CSBA 4XE5B 3WGVB 2R5DA 5AW8B 1H8AA 3A3YB 3NTNA 4RESB 5AVRB 1CZQA 2Q7CA 3NXSA 4AYCA 2C9LY 2WT7A 3TNUA 3M0DA 2VRSA 2YNYA 3TYYA 3A7OA 3SWFA 2YO3A 4C7NA 3L36A 2R5BA 5APXA 2Q5UA 1FAVA 3VMYA 2WWWA 1MUUA 2R3CA 2WPQA 3M91A 2Z5HA 5AVVB 5AVSB 2XZRA 2IPPA 1GK4A 1SLQA 3HE4A 5AVWB 1IO4A 5AW5B 2Q3IA 4C7NB 1GD2E 2QM8A 4B86A 3MD0A 3HTKA 2C9NY 2WPRA 2R32A 5CMZA 5AW3B 3V4WA 3IR9A 3TNUB 1MV8A 5AVXB 5AW9B 1MFZA 5APWA 5APVA 5AVQB 3HE5B 3V5BA 3HE4B 3OAKA 3P32A 1G2CB 4KHXA 3VYIA 2P2UA 3VN0A 3M06A 1S9KE 1GK6A 1T2KC 4C46A 1HWTC 5AW2B 1HJBA 2KP8A 2WT7B 1A02J 1JNMA 5AVUB 4EOTA 2W27A 3L37A 3NFQA 2P7JA 1FOSE 5AW0B 3NMDA 3I5CA 1KQLA 2XV5A 5APYA 1J2JB 4JYBA 1OXZA 2H7HA 1GZLA 4HYTB 2N9BA 3M0AA 1FOSF 2QM7A 3UIAA 3KQGA 1NWQA 1A02F 4RETB 5AW7B 2ZFCA 1T2KD 1CI6B
chains in the Genus database with same CATH superfamily
3G6DH 3C6SA 4GG8B 4UOW0 3MFFB 3TS8A 2A38A 3EO1B 5IQLA 4NKDB 2HLFD 4U33A 2QKIB 4P2RE 2NUTA 5IMOB 5AW4B 2WOBA 1OHQA 2P5PA 2HLOA 2NY1C 2KLVA 3CUPB 1A47A 4LPTA 5EUKB 3ZE1E 2ADIA 2BFVL 2VABA 4JO4L 2K88A 5G4NA 2K3HA 4IK7A 5B7MA 2ITEA 4ODXB 4K2UL 1ZSHA 2VLKB 2X05A 1R75A 2IOOA 3M7FB 2ZXCA 2F53B 3MLYH 1EC5A 4L3AA 2BZDA 3V0AC 4TYUA 3SKOB 3VMXA 1XFPA 5D6DC 4MASA 4MS8C 4M1GH 3MBEA 1OSPH 1U93A 3TL5A 4XX1G 4WEBH 2VL5A 1CI6A 3FT9A 1J11A 3LQZB 1TKWA 2E5EA 1LDSA 4HS6A 5DHMC 1QOKA 1UENA 1FZCC 5D1ZI 3W57A 4HK3J 3TT1L 5AENA 4FJZA 1MFMA 4YZFF 4DKFH 3SDXB 3QJSB 1JD9A 3B9KB 4JQVA 2KQMA 5D7LE 4EN3C 5IGXL 2EH8L 2CUMA 3FB6A 4OQTH 3MUDC 1FNHA 5BXFB 5GZOC 1A6VH 2AJXH 4RGNC 4XAKD 4I2XE 1W2EA 3QAQA 4F5CA 1IGCH 1AZUA 2VISA 1JPFB 1KJ2B 3QNZB 2ZZUT 4ZTPL 2DM4A 4L4VE 1ROWA 5IQ9B 2V3FA 4IRSB 1YHPA 2QQKL 2NNFA 3O8XA 1XF2B 1KPRA 3MRPB 4G8IA 4ZMDA 1U7MA 4HK0A 4JRLA 5EIIA 2CXKA 1YEEH 4WU7A 1NANI 4I88A 2CO2A 1WAEA 3PGCB 3OXSA 3BGMA 2MIZA 2DLGA 2WY3B 4R5XA 4AVHA 4IDLA 3L74E 3OGOE 4JUTA 5CJ5A 4OCSL 3UYRH 3ULVH 3LS5L 5DMKA 1D5IH 5D9SB 5AW3B 2VDKB 3F64A 3NAAL 4K7PX 1G9MH 3S1KA 5CSGA 3DJSA 5G55A 4BCYA 1FC2D 5CLXA 1WBXA 3AREC 5B3SB 3NN8B 3K2MC 2G3AA 4XBGA 5TTRA 3GSRA 3QA3B 2ZXGA 3MFFA 1FO0L 2JJVA 5DUJA 3UIYA 1BJ1J 2UX7A 2ATPB 3NEOA 1P9MC 4OCMC 4U6TA 5CD5D 4PJ8A 5A40E 1HAUA 3NDYE 4PREA 2QADB 4NO2B 2BC4A 1LNUA 3MYZA 1FFPA 3V0JA 4R0LC 6PCYA 3J2PA 2AF2A 3F85A 3P3SA 5FV2A 3RI5K 4UF7C 5JW3H 2WBKA 5C0RL 4HGWA 4KZEH 2GJPA 1ITCA 2YN5A 1PZSA 5FO7B 1L0NK 4OLVL 3VJ6A 1R0AH 1TQTA 1BG9A 1U95B 4XPFH 2WXHA 4I5BA 1XCQB 1ZPUA 5AZEH 2QJKC 3TO4D 2Y0DA 4ZFQA 2BP0B 4OZGF 4HWNA 5CFHA 2G9KA 3RB5A 1L9OA 1OWAA 5FKAA 1JPTL 1IAIH 1QMUA 4FQCH 2X4SA 5JXAL 4PWEA 1JHTA 3RA7L 1WAAF 4QYOA 5DJ8A 4BBWA 2VW6A 4QRQA 1DVZA 5DJ0A 4JPQA 1BD2D 5CKAA 1ZRUA 2OXGA 3MV7E 4Q9RL 4JAMA 2GQHA 1RUQL 3G71P 3NZHL 2IBZD 3VTAA 1A7OL 1ADQL 1JGEB 5F3BA 5C97A 4N8VG 4CBPA 4LCVA 2XV0A 4KUCF 1H89A 1UGNA 1AXSA 2DIAA 2WNWA 5L6YH 2YMOA 4F7MB 3BWSA 2O61A 4HSAC 1W0VA 1JZHA 4RAVB 4X6BB 4HUUB 4GUOA 4W1TA 1SBBA 3OGCA 1IEBA 1JDCA 4KZ0A 1IFPA 4TLKA 1TJXA 4XVUD 4Z76A 1L0NG 2ODHA 2V5YA 3H9HA 2EXTA 1JXDA 1H88A 1ZHKB 3JV6B 1ADWA 4RH4A 2X1QA 3BE1L 2NXYD 1BREA 4GRMB 5DS2A 2B89A 2ZYSA 2BIHA 1TJMA 3C60A 3RVUC 3CD6P 1UKQA 1QEWB 3NIDE 2R0ZH 2JLPA 3BRTB 1B0RA 3INUH 4O2FB 1BX2A 3MLZH 1B4RA 1MCEA 4LT7A 4LHUB 2BHFA 1Z5HA 2PYEA 2JWDA 3J27A 1X7QB 3IVKB 5T3XE 4R4BB 1ZHBA 1MCBA 5E4OA 2OAAA 1AQKH 4PJCB 3TBCA 4TVPH 5DSCB 1VQMP 5INCA 3L71E 2GM4A 1WCQA 5B38B 4AV5A 2HKFL 2MNWA 4OGQC 1BZ9B 2KC0A 2EXWD 1DDHA 3D48R 3F84A 2W1NA 3NVQA 4P59H 3GSWA 1DVXA 4Z95L 3TEYA 5FYKL 1YEIL 1BQHA 3GSXA 3H9SE 3HN8A 3DVFA 5FO2A 3RWJB 3I74A 1ZAGA 4N2CA 2JFCA 4KKLD 1U8PA 3WXVL 2M2DA 2O1KA 5CMZA 4ZMNA 2H32H 4AYGA 2I7SA 2R29A 1NAKL 1FZFA 4JFFB 3ZTNH 4AYEC 3DTDA 4UT6A 1F3JA 4K71C 1CFBA 1N7SB 2H9GA 3BKJL 2HT2D 1BAFL 1CFNB 1PD1A 3NABL 3ZKNC 1MY7A 4NAQA 2FX9H 2RQ8A 1OZHA 4J3OD 3KYQA 2P7TB 3MV01 3MTXA 4DP5X 5JIDA 2CQVA 3Q44A 1JGIA 1M1JA 1WK0A 2FBJH 2BNQE 3MXVL 4JQXA 3VGBA 3D06A 5ID0B 5SWSA 1P9MA 1NKNA 2B14A 3D6GA 4OD2B 3LQAL 4JL1A 5B1CA 5L8KB 5FK9B 4PV1D 4GRWH 1JTHA 4LBEB 3T0AA 1B2YA 1I4FB 1RZFH 2EIKB 3C8KA 4NHUA 4WI0A 3ULUE 1RIUL 4AKPA 5JPMC 4WEMB 4YUEL 3H9SA 1IGTB 4N0UB 4XCNA 3UZQB 3GFUA 3BSHA 4O02H 2MCPH 1WFJA 5BV7C 1HXMA 2QGBA 4OD1L 1ID2A 1SEQL 3UPCA 3V9FA 4BKLA 5I0YA 3P30H 1FNGB 5A7EA 4PLKD 5TQ0H 3H1ZA 1RUKL 5E79E 4PVNA 4E68A 4Z7UB 4DP9X 3G08B 2Z31A 1HYRC 5DQDL 43C9B 3R4DA 4Q6KA 5B4MD 5L6YL 3KPRE 5BOPA 1UM5H 2YEZB 5HHXH 4OQ1A 4G82A 4N2EA 4ELMA 2NOYA 6FABL 2LVEA 3RILA 2WXGA 3VI4A 1AD9B 1U3JA 1SQMA 1VDFA 4WWKC 3B5GA 4K4KA 4DN3L 1FO0B 5KYYB 3SQOL 3RVVC 3QSKB 4C4KT 1VDGA 3CHPA 4K3DL 3H9HB 2W6AA 4PJEA 3IBOA 3K6OA 4EOWL 3K8LA 2IPTH 3VI3E 1JRHL 1G9MC 2WQRA 4F15C 5KJ7C 2JMRA 2D7NA 3X1NA 4WNJA 3HB3C 1KV7A 4FLHA 2YR3A 2QJYB 4IFDK 1HQ4A 4FNLL 3B3IA 3DURB 4H7VA 2ITCA 3GSNH 3PWJA 2OMWB 3QCTL 4FZ8L 4H2AA 5IJKC 3SY0A 4F1SA 2MHAA 3ULSB 1SOXA 4KROD 1IARB 4LLWA 3NJLA 1URQD 5EA0L 1I9JH 4P05A 4G8IB 4BCZA 4C7NB 2NY3C 3HNVH 4KK9C 4M43H 3QPXH 1SQVG 1UB6A 2D73A 3CZFA 2ENQA 1Y8AA 3GMNA 1BX2B 4XB8A 4L8BA 4QGYA 2FBWC 3GG2A 4GEIA 1CGUA 3GHGC 4FQJH 1KN2H 3A23A 1UEYA 2PPDA 4R4ND 4PY7A 4KBPA 1W0WA 2F1AA 4HPOL 3ECBB 5DCCA 2FNWA 4JM2C 2W27A 4GSRA 4XNQA 3FKUS 1CPUA 4A63A 2VN4A 1PZUB 3KPSE 4UV4L 4UDTB 2A73A 1QACA 4UQ3B 4ZD3L 2C9AA 4PRIA 2YSSA 1FPTH 1WE5A 3GS7A 1QEXA 3I75A 4YDVA 1U8PB 1F6FB 3T0EA 4GXUM 5CCGE 1F00I 4CAGA 4NRYA 3GKWH 3MRMB 1PAMA 2BPBA 1E90A 2APBA 3FTUA 4UMGA 1ZV2A 5LXGL 1L0LG 1W15A 1E6OH 1A7PL 3V10A 3B5NC 4R7XA 4NQEB 3WSQH 1X5IA 4GW1B 1YUHB 2PWFA 3X3FL 4X8JA 1IGCL 1F8TL 3ARRA 4UNTA 1S9XA 3IDGA 1VHPA 3WU2E 3P3UA 2C7FA 4EKXA 4GKSA 1S78D 4WNQA 4MCNA 1OE2A 5FKAB 5GS0C 3QULA 1IM9D 1WZ1H 5EIIB 4E41A 1LE9A 2QQKH 4KZCA 5FO8B 1PLCA 5BQ7A 4Q9RH 5IMOA 2AJUH 5ID1B 4GXVL 5LVEA 4GMSL 3SGJC 7TAAA 3JVGA 2V4LA 2YKOA 2WNGA 3CVHL 3KPSA 5D2LE 2AJ3A 4MNHA 3VQMA 5F7NC 1AXIB 3G5ZA 3Q6FA 3TT3L 5IVXB 2X4OA 5GGTA 1F1AA 3B7UX 3QEQE 3NFSH 5F7DB 5L7XH 1RURH 1GSMA 3WEXA 2DDQH 2G4EA 4RFOL 3C6EA 1UZ6E 4UT6H 4WO0A 2ZUQC 1IFHL 2W0FA 1D2PA 4M7JH 4ZDHA 3FJTA 1N59A 1X7SA 1TKWB 2HTLD 3PWPD 5IVXE 1GYCA 4LF3A 1U92A 4KKAD 1NSNH 3MLSL 4N68A 4P2OA 1A1NA 1T20B 4PJEE 5LBSH 2N3JA 2UY7B 4ZXBD 3CC5B 2XX0A 1SFCA 5APXA 2X7LA 3Q1SH 3VB8A 4S2SB 1MIEH 2B2XH 2Q86A 3P02A 3QDGA 4WK4B 2YMXH 3DGGA 5FO9B 5ISZE 1CI5A 1AHWC 4YHYC 2X2JA 4ACTA 4G8GB 3WEOA 1MI5E 4HPYH 3L3JA 3WFZA 4IK6A 1L4AD 4MJHA 3ZL2A 2NY0C 3GC3A 4QOKB 2N1TA 4L0YA 3TYGL 2FUQA 5KUKA 1VFBA 3UG5A 4MRBA 1CBVH 4HOMA 4B86A 3EHBD 3ZHFA 4XTRD 5EBWA 3BVVA 5HI3D 1MCPH 1DSYA 3O4OC 1D9KB 4PS3A 3W37A 3AMLA 3TO2A 3ZE1F 3GK8H 2UZXB 1KILE 1OB1B 1NMBH 1T6WA 2XCMC 3L7EB 4IRZA 1FNEA 2KZKA 2A9ML 5LCVL 1YJDC 4FI6A 3WFDH 3GB7B 2J8OA 5I19H 3BGFB 3CDGA 3RNQA 2ZPKH 4KUZH 1KCUL 3KEDA 1QBAA 1RZIB 4L3FA 2W80C 4X4ZA 2FSEB 3WO4B 2FYVA 4LPYA 3ZX1A 1PDKB 3FFCE 5D7JD 1NOHA 1MIML 1CU4L 3OJMB 1L4AB 3HRNA 2K3TA 2NCMA 4Y2DC 5KYUB 4M1CD 1UT1A 2NNXA 2GUOB 1P7QA 1YO4A 2AI0L 4JM2A 2WGXA 1F4HA 1CICC 2D7TL 2WITA 4YHMH 3N43B 4RIRB 1ML0A 3Q43A 2WLJA 2IBZY 2VLRB 1EFQA 1HNYA 3GXDA 3CLEH 3P9LB 4O58L 4R2GC 1WICA 4UQEA 1L5GB 3RZCB 4L1DA 5I30L 4OUOA 4XHJD 1YMHA 3K6FA 5D9SA 5J6HB 3HTKB 4HWBA 5DVKA 1PX4A 3BDXA 5EULV 1OAYH 1C5CH 1MCWM 2H5UA 1ODUA 5LUMA 2P80D 2PTTB 4K5MA 4R7NA 4A6YB 1YEKH 3P54A 5MERB 4N0UE 4LHUA 1A6WH 1S7VA 3CHRA 1GPOH 4ZK8A 3M9BA 2OQJB 3VWJD 2X1XR 1Q7YQ 4N9OB 1TZGH 2QZQA 1MAKA 3OXRB 2ICWB 3BVNA 1WA1X 1VPCA 1V3MA 1Y18A 2PYED 3DRQA 2GYSA 2XHNA 1JV2A 1UTDA 3CN2A 3VXQA 5IBLD 5CO1A 2KDGA 2EUVA 4L5FE 3LZQA 5E8OA 3DBXB 3VRLE 1HYSC 4XA4A 1G0YR 1H6FA 2X4RB 2YMTA 1ZIAA 1ZS8A 2P24B 1BQHG 2EIJB 3AITA 3OPZL 3TONA 5I1AA 5JQHC 3APDA 5F0JB 2ZYRA 1YECH 3HUJF 4H25A 3GT6A 4FE9A 2EVGA 3EDKA 1EZVE 4RMQA 4UV7L 5LG6A 3VXSD 2HVJB 3HZVB 1IJ9A 3QNXA 3ABKB 3RVUD 1UM6L 3G7TA 1G7LA 4X5PA 3ESUF 2YMXL 1RHZB 4I1RA 4NI3A 3FFCB 2WCSA 4PJXA 2CLRA 2ED9A 2YZ8A 4N0UA 3ZZQA 5I1CL 1J9CT 5ACZB 1IM9A 3VXPB 2XA8H 3QIUD 5C0AD 3VMNA 2KZ1B 5T1MA 3HUSC 4OGAD 4P2AA 3W9EA 1DO6A 1A3LL 4DCQA 1XGTB 1NCWH 3L3IA 3IGUA 1SQPJ 5HJ3B 1ZP0C 1KB5L 5HXMA 1NU1G 1JV5B 1FZCA 3L5XH 1L7IL 1EAPA 4P9HL 4MA8L 4PYGA 5CAYB 1SQPG 1NTMJ 3QXDA 4CVZB 2GIMA 3DJTA 3QC5X 5MI0C 5CJBA 3HG5A 5JOEA 4U1GC 3K2UL 1KTDA 4Q58C 4XOBA 4IKIA 1IFNA 4R9HA 2FJUB 4QOKE 2NNRA 4GDOA 3QUHA 1ND0A 1C5BH 3ARFD 3OAKA 1PG7L 1VEOA 3PREA 4NGHH 4QXUL 5C0CD 5KYNA 2Q2LA 4UB0L 4AIZB 5DK2B 1FL5B 1M7DB 5FV1L 2WT7B 1SY6H 5DHVA 3O45A 2FYUD 3A0BH 4XPGH 2GK2A 5MP6H 3O6FD 1DHKA 4C4KO 5KW9H 2QKSA 2D7TH 4ZAKB 3S48A 5IEKA 4CDHA 2VQUA 3C5SA 4JZJA 4YDJA 4Q0XH 3VXUE 3V4UL 4LLUB 3TZVC 1UEMA 5B38A 4NRZA 2BVPA 2EZ0C 4QAMB 2Z3FA 1QNZH 2E9BA 4GO8A 3AREA 2DQGL 3N9GH 4MLSA 5F1KC 1SFCC 2FX7H 2LAGB 4HJEA 3GXTA 2Q9IA 4YWGL 3P2DA 4KGJA 2V37A 4UUJA 1BGYD 5F7BA 4ZMQA 5I1EH 4B9PA 2G75B 1XCXA 4P5TC 3CU1A 4WW2F 3GBEA 4P4RA 2WD0A 4L8SB 4CC0A 1W2KT 3VM5A 3H1LG 4ZMVA 2MRYA 5CZXC 3TEXA 3P4NA 2OYHB 2BY0A 3I9PA 4G9FB 4HCFA 4D0DB 3IDJA 1E50A 4WK0B 2CUHA 2G5BA 4Y4KC 3O8XD 3CLWA 4MZIA 1A0QL 4X7DC 2ARJB 2CO1A 4NZDA 5F1SA 5I9QB 4X83A 2VZOA 4P2QB 2DBLL 1XIWC 1A6ZB 3GBNH 2I9TA 4TNVK 4HCRL 2N01B 4XP9H 1OGTB 2AXCA 2FJGA 1ZE3C 4JM2D 5KSVB 1AOZA 1R3IH 2R0LH 1YUKB 3CVCA 1SJHB 4XBPA 4EI5B 4QJ5B 2UWJE 1BMZA 3QPXL 1JS4A 2VC2L 3QUML 1E7VA 5EOQL 25C8H 3HUSA 4OZFB 4XOAA 1P5VA 3G04B 3NTCL 1RK0A 2C9UA 3ABLB 3UTQB 1HVVA 3AE9C 3IE4A 4NKDA 4LQ1A 1KEGH 3PE9A 4AYCA 4UT6L 5I76B 1PBYA 1Z66A 4MA3B 3A0OA 1XSJA 4HPOH 3ARDB 3IDYC 1I1CA 3SCMB 5DRNB 4HEPA 1OWWA 1PKOA 2XKUA 4HOWA 4KWUA 4HUWA 4FXKB 3GIVB 1N59B 4G7YH 2Y6TE 3EF4A 3Q1SL 4F8PA 3GIZH 1I8UA 5D7SL 3HS0B 4Q56A 3IN2A 4ZKPA 5CWSB 2KZWA 1K9TA 1CXEA 1NBYB 3B37A 3ILQC 2DIBA 5DQJB 3F6IA 4RAUA 3ARZA 3BJ91 2JDIH 2QPFA 4GAJL 3UYPA 4DGYH 3S35H 1LTJA 1QPXA 1G43A 3LKRA 1XAUA 2JKTM 5A3IC 4BEIA 4QRUA 4RDBA 1HHIA 4ANXA 1HS6A 5FA4A 1NBZB 4L8DA 3KLKA 5KSUA 4CJ0A 1IEHA 3I3BA 3E9TA 3I55P 4R97C 1XGRA 1H6UA 2VDMB 2YIHA 3D69B 5A2KH 1D7CA 5H8DA 2CDEA 2NYYC 4PSPA 1JNHA 3UEZA 3TH3T 5SX5H 5EEWA 1A8JH 1JD7A 1WFMA 2RIKA 3IU3B 1QR1B 3FGAD 1EDYA 2ZPKL 1Y1UA 3RIAF 4OFKA 5E2TH 3NEXA 4NNXA 3CI9A 4KFZC 4Y88A 4IJTA 2HB0A 1CFQA 1Q0XL 4L1BA 3VXSB 1QRKA 1FZJB 2BM3A 4M1DH 1QO3A 5AB0A 2VM4A 4U1HA 2XXCB 1EHNA 2VUYA 3MRHA 4NB7A 4F2EA 2CGRL 1L0LD 1WA0X 1XX9C 3MUY1 3MX0A 43CAB 3STLB 2R0KH 1UB6B 2DDQL 3HC0A 2VWEC 4W9GC 1CL7L 3FF7A 1PKQE 3C5JB 4JFSA 1C7SA 1I1AD 3FUIA 4JFTA 4KHTL 3RL0D 1DR9A 5IFHL 5EZJB 1R34A 3BCFA 2DJMA 2ZXBA 3ZDYE 4TSBH 4AE0A 3K2IA 2CO7A 3CVIH 3GBNL 5D1XA 1EZVG 2BC4B 3QZWB 1PD0A 4JKPL 1YEEL 3HE7A 3KNBA 1IKOP 2R1WA 5I8EB 3OAUL 2X2UA 5DF0A 3CFEA 4JRYE 4LLYB 4P2CG 3OLIA 5H37A 4OB5H 1WFNA 5FGCE 5EU3B 4AGMA 4DGUA 5I18L 1K85A 1Z32X 2PTUA 1CN4A 1IO4C 1C12A 5DMGC 3QORB 1JYXA 4JCMA 3RVTD 5L88H 1O7VA 5I1JL 3GJFA 3NT0A 3D34A 3HN5A 2FGZA 5IJKA 2ICEC 4X7CC 4OFPA 4BWTA 3QWOC 4MCYA 1TVBB 1RURL 4JB9L 1EXUA 4JHAH 1LJMA 3QFDB 1YECL 4BZ2A 2HODB 2ZT9D 1LHZA 3G5VB 3WOVA 1JGDB 4Y1AE 2QPDB 5HGBB 3N41B 5H94B 3U7WH 3VYPA 4A55A 3NP3A 2A6JB 4N2MA 1YEFL 1UJ3B 2Q8BL 3PYCA 3TO4B 1SQPK 3RFZC 3WBDA 2KS1B 2XKSA 4PJFF 4FFYL 1BQLH 4ODHL 3M91A 5MEPA 4EXPX 2FVNA 4FKKA 3LRGA 1ET8A 2YEVB 5GTIE 1AOHA 2XZQL 2YRZA 2OV0A 3W81A 4EI5A 4HC1H 3OD3A 4N0YL 3CFJA 4HX1A 2A4EA 5I8KL 4A66A 2Q3IA 4Y5XB 3W67A 3MRKA 2WP3O 3UH8A 3ZL1A 1TCRB 4H13D 1FAIH 2VM9A 1Y18B 4RBPK 3UJJL 5JUEH 5BZWB 4MX7A 1KIQA 2E76C 3HE5B 2APVA 2DLEA 3NSXA 4PLOB 3VN0A 1S7VB 1ZT4A 1WFOA 4OM0L 3QBTB 3DTXB 3FTWA 3L72J 4H0GA 4H20H 2ZYAA 2OMTB 5AB9A 4XP1L 2BNRA 2OX5B 1I3GH 1I7RA 2HPOA 1HEHC 2NY1D 3HBGA 5CU9A 3U6RA 3IMSA 3L73D 4JHVA 1QBBA 2AHIA 1RZ8B 3SWKA 1F56A 3MJ9A 3VXRA 1D5MA 1PF3A 3FRPG 4BFNA 4BH7A 5EEXA 1G1JA 2YZ1A 3GLZA 2F5AL 2XOTA 3IPFA 3W2DL 2R0KL 2ZAIA 4K5NA 3UIAA 4UT7H 3VXOB 2BWIA 4J3SA 3SE6A 4OVVA 5E6YA 1LO5B 5L2KE 4YBQD 1I1RA 3PWUB 1I7UA 3REVB 3QCVL 5EU7E 1Z9SB 3T6WA 4KAQL 3LPWA 3C6SB 2WXQA 5INDB 5GQBA 4Z18A 1DE4A 5D7KE 4YHKL 1HZLA 1MAML 4J5VA 4PQXA 3AAZB 1J9RA 3WJMA 1CGWA 3APNA 3BUIA 3UX9B 3ESOA 5AB2A 3GB7A 4XPBL 1HK6A 2XQ0A 1K4DA 4CMHB 4HC1A 2RQEA 4TOYH 4KPHL 4LL9A 5KVFH 1AQKL 3P11L 4LEEA 3R7RA 1L0LK 2PPFA 5B39G 5K1VA 4D94A 3VFOB 1OW7A 4IKLA 4JBZA 4B50A 1PNDA 3ABGA 1M3IA 1SS1A 3MIWA 1CE1L 1QEWA 4ZTOL 3MA7A 1AIFA 1YEIH 4HBCL 1EO8L 2WLIA 4NCDA 4U1LB 1JPTH 1NC4B 1CXLA 1XF5B 3TPKA 3O9WC 3B1UA 4UOQA 3AGWA 4N24A 4PGDA 3LIEA 5C0IB 2Z0UA 4QMAA 3IFLH 1WT5A 1BFOB 4HFUH 5LCVA 3IRZA 4S1SH 3LRSB 3GSVB 4LCWD 4B3VA 5J0BA 1A7RH 2OYLA 2EXYC 4JZNA 3T8XA 5BRZE 2VSCA 1NBVH 3DO3A 2J72A 2C3WA 3BATA 1MHPL 1DEEG 5DGQA 1SEBA 2ZOOA 2GUYA 3QIBD 3NIGF 4XNZC 5IB3B 3H42H 2Z31C 2WPQA 4PBVC 2EIBA 2VE6B 3FT2A 3QO0A 4TNVF 2WWMD 3VWJB 1GL4B 1GK4A 5CD5C 1XTMA 4KK6C 1GTNA 4Y89A 5IP4A 4WFHD 4ZW3A 3AXLB 5K5GB 4M5YH 2ZG3A 4WV1C 5JUEL 5CILH 3UJJH 5KVDH 2BXZA 1UXSA 4MLIA 1EFXD 1F4WH 3SYQA 2CO4A 1FO0A 4M7LH 1TTCA 1NTMK 3BLPX 4AYFA 1S7QB 2FSDA 3IRPX 3HBPA 1OTUC 5DWPA 2MCPL 3S34L 3T5WA 3W0WE 1FLRH 5I1EL 2N1KA 4QIRA 3RA7H 3LN9A 2Z65C 1LP1A 1YY8A 2ZCLL 5FGRA 4A2MA 2KBGA 5CGYD 3UTTD 2NNAB 3FT0A 3SDDD 3L37A 3H1IE 3MROA 5BRZA 4N78D 3C9IA 1QL1A 4EVNB 2R1YB 3K0YA 1P5VB 3G04A 2E5YA 2WO4A 2UZIH 3GBLA 4FQPA 1JPSL 3Q1EA 4NO2A 4JDVB 4W9DC 2V17L 5B1AB 1U8HA 3VXME 3LJ3A 4JDZA 4EJ1C 1JCCA 1BFVL 1YEDB 1PCXA 3GRWH 1ZHLB 3WKMH 2GAZA 5EZPA 2BP8B 5IFAH 1LTGC 2EC8A 4I0PA 3DVNA 2UWEE 5CBAB 3B8YA 3T77B 1KN4H 2F8OA 2YGPA 4XCEA 2FR4A 3NN8A 4XGZA 2IALA 1QNZL 2G2RA 5B66E 2LU5A 1GW3A 3IDNB 3BQVA 4FFWD 2VLKE 3U1QA 3H9ZA 4IOIA 4YR6A 2ICWJ 3IFOA 4O5LH 4XNBA 5DR5H 1FN4A 4F9LC 3QUXD 3IFNH 4RGNB 5IM7B 3TFBA 2Y2TA 4FZEH 4AI7A 1X5GA 2WO2B 4TNGA 2NZIA 4AYDC 2VIRB 4IBTA 5L4JA 2E6QA 3TV8A 3NGBC 1LEKB 4FNRA 3TF7C 2A74C 2G75A 3T3PE 4DIXA 1J0IA 3JWNG 1E6JH 1N73A 2QVIA 2QDWA 2DEYX 4OLXH 5TE6L 4PRIB 5G4OA 5L8LB 3VTPC 4NO3A 3WAJA 2ADGA 2IH3B 1VFAB 4UM9B 2DBLH 1E9QA 4YUEH 5EU4B 1ZGLA 3QQDA 4MMYA 3WJMB 2KDYA 2F6AA 2HJFA 4DGVL 3GMPB 4XC1L 3S97C 3KCPB 4ODSL 4BQCA 1G94A 3P0VH 3QEHB 3U4AA 1BAWA 3RUGF 3D85B 3K5SA 5AW8B 4IMLB 2W94A 5EUOE 2WOYA 2NXZD 3WTXA 3R2PA 5AVRB 1PQZA 1FC2C 1W0YT 5I5RA 2PRRA 1WQVT 3ULSA 1B4TA 3AEAC 1T2QL 2FB4L 2OTUB 4GT7A 4H8QA 4KMLB 5IW6A 1G9EA 1NM4A 1KOAA 2DWDB 2QTEA 2BHUA 1I7TA 5I82A 2Y9ZA 4B9FA 4N85A 5E99H 5EZOH 5AOMA 4WNSA 3BUDA 1YJDH 5AVVB 1PKQB 4PJ0H 5FOBA 1CTNA 5CEXA 2XTLA 3CQQA 5GGUA 3JV6A 3PG2A 1EVUA 3A67H 2FYYB 5A2IH 1MRDL 3B6SA 5EV7A 1MVYA 2G3NA 2W65A 3NSYA 4GRWB 5IESH 2H47C 4M43L 1VQOP 2VL5B 5H2BB 5CCKL 4ECNA 2GITB 1CFVH 4ZXBC 1B3JA 1SEQH 4O02B 3OBAA 3RK2D 2NY4C 2CIIB 5I8OL 2NT0A 4G8GD 5EUOA 5FB8A 5I6NA 4QY8A 5EPMA 3UJTH 4HKZH 2JI1A 3GM8A 5T3ZD 4L9LA 3S3CB 1QKZL 4ZKUA 2PO6A 4LHUD 3NH7L 3GRWL 1FE6A 1TVBA 2V5RA 1GXEA 4I85A 3ATEA 4KI5D 4HUWB 4BYHA 4PYHA 3EHBC 2P1YA 3OKMB 3DTXA 3REWA 3V6IA 4APQA 1P6FA 4XNUH 1J1PH 1E8WA 4HCRA 1UC6A 3HI6L 4ELMB 2KL6A 1MLCA 4IRSA 1SQQJ 4GBXA 3OHXB 4G1MA 1OPGL 1LMIA 1A02F 4NDMA 1RZGB 2GJZB 2YOAA 4U3CA 5FDWB 4RZCA 4XN8A 3T0XA 3WIIH 3ZQ9A 4ZPTB 5AAPA 2COQA 5D8JL 2YS4A 4N3TA 4OSUL 3WHE0 3MNDA 4LEXL 2DLTA 3UTZA 1VFAA 1IKFH 4WTQA 4UM9A 2JJTC 1GGBL 2F8XC 1EEQA 4BFBD 5E4AA 5F0MB 3CC2P 3AMKA 2EUWA 4M6NH 1P84E 4O9HH 1S7SB 5K33A 1YNLL 5I23A 2EACA 4Y0GA 2Y22A 3SYOA 3MLSH 5ID0A 4ZFZB 3OJDB 5T3XL 3FO0L 1PQZB 4I1NB 4RQQA 4WHTA 4GNKB 1OAQL 4RZKA 4C8XA 3D12B 4CBZA 2WAHA 5JZ7C 3QK0A 2NZ1A 5EHFA 3E80A 4TT3H 4Q6IA 5F1OB 1OF2A 4N8CL 3GSRB 3QA3A 1XF3A 4K73A 1U9KA 4Z0XB 4E9XA 4NQED 1UH3A 2JE8A 1EJ6A 3C2AL 4OGQB 1A9EB 3HG1B 3A6BL 3KBHE 5T8IA 1M8OB 1JO5A 3ZTDC 2JKIS 3K4ZA 5EBGA 4U1HB 5BS0B 3Q3DA 3SY0B 4Z3IA 3M8OL 1T66D 4NHCH 1CE1H 3PCYA 2NMSA 2ENJA 1SVCP 2O6CA 3FT4B 1KBGL 2CH8A 4E5XG 2Y0SA 5BRPA 2UV3A 4F7CB 3ZQWA 3KPEA 4LOUD 5ITBL 1M9SA 5DVOA 3VVVA 4JLRA 3U6XS 5BCAA 4X6DA 4X9GA 4K71B 1BCCJ 3BN3B 3WIAA 3FOLB 2R3SA 3S3JA 3WMSA 1O7DE 2FYZA 3U4KA 4Q6IC 3NJIA 4KKBC 2DL9A 4Y5VC 2Q8AH 1TU3F 1T6BX 1LP9F 1QW8A 2FYUK 5JQ6H 1KIRB 3D52A 3LNFA 3FUMA 4JFDD 3OVUB 1ZTMA 1SLQA 1JCDA 4PY8I 4IBWA 1R3KA 2UXVA 5AYUH 5BZDB 2DQDH 2Z8SA 1N86A 1KJMB 3RHWF 3H1JG 4XNAA 3MV8E 1NTZD 4OGYL 2ZX6A 4D8OA 1DJZA 3FU7A 5JPMB 2R15A 5CSBA 4UNUA 5TFSH 3BUYA 5FUOH 4W9LC 2BIMA 4WUUD 3V5BA 1UWXK 4WWID 4YBLB 5J6GA 4Q9QL 4PG2A 4A6YH 4X6BA 4P3DB 1HIML 5KYXA 1CFQB 1WBYA 1Q72H 5LCVH 1SOSA 1HH9A 3DV4A 2IPKB 2P58A 3C2SA 2HMIC 2P8LB 1FZKA 2AAVA 3TLRA 4HK3N 3U46B 3VXPA 1QRND 2XG5B 5D72L 4UQBA 3JUYA 4AT6A 2OCFD 3L4TA 3UGEA 4CADA 4B53A 3ARGA 1OPGH 2NXZB 4L9LC 1BCCD 2BK8A 12E8L 5DZOA 3QRGL 5J5EA 1THCA 3QGVA 3BO8B 1L6XA 3CCHB 4PS7A 1KCBA 2GKIA 4HDIB 3HR6A 1CZ8H 1MQKH 2F5AH 3KPSB 1L4IA 3K1KC 5IFAL 3KLHD 1OP4A 4Y4FB 2E4FA 3VWJA 1WJ3A 4WLCA 3OXRA 2ZNWA 1AACA 5TDPB 3RLSA 3OB0K 4AZUA 3P9MA 1RUAH 3VWKB 1GYAA 2EDMA 4UQ9A 4H44B 3V5KA 3LNDA 5T5FA 2W0FB 1CLZL 2WB7A 2VH5H 3FXEA 4P04A 1KSRA 3D3VA 2WTYA 1Z3RA 3E6HA 4H1LG 1DBAL 4GSXA 4I9XA 4AXWB 1BXXA 1KQSO 2H0JA 3DI2B 1YEWA 3LQAC 3FOLA 2Z7ZA 5JIHA 3WCYA 4JO2L 2PR4L 4EN2A 2PXYB 4MQXC 5TD4A 3X14A 3M9HA 2JWYA 3ISYA 2E9IA 5JHDD 4MAUH 3SDDC 3GSOA 5AAWC 5F1NB 5T5NF 1N0LB 5D6CB 2VN3A 4P2RB 2WSEJ 2BMKA 3NZSA 4H5SA 3W9DB 4Y99B 1IGMH 1HOCB 4U6HA 2QR0A 4W80A 4M7LL 3MBXL 1LE5A 3CD4A 3AACA 4EI2A 3CFBA 3U1CA 4H88L 3JZ7A 3TV3L 1AGDA 4I4WB 4AGQA 1DYZA 4Z3EA 5KN5B 1ZHNA 2MOQA 1R4XA 1J0KA 2FIKB 3KPTA 2CKBH 2J25A 2CMRH 2OI9B 1URZA 3M0DA 3P40A 3UZEC 5MENB 2Y7LA 1MN4A 2Q8AL 3BCDA 3Q8FA 3BKMH 2EYSA 5DJAB 4LLVB 4YXDC 1ZPLA 2A83A 1OGAD 4KV5E 3CBRA 3VFMA 2OYHA 4G9FA 5SX4I 4Z78A 5E8NB 3PDOB 4M7ZC 1MHPH 4WEBL 4F27A 3MA9H 4JO3L 1GC1L 4ZX4A 1S7WA 2B39A 5I6OA 1QSED 4M61B 1RY3A 4OTXL 4A39A 4QXGH 4JZJC 2A99A 2DQEL 2O72A 3PRJA 35C8H 4ZI8A 3GF8A 4YFEA 4KK6D 4UTBA 1LMKA 3CBKB 2VDQL 1BCCE 4P5SA 4U1NB 5E6ZA 1KB3A 3IYLW 1QTPA 4U1IA 4A7GF 5KVDE 4DT2A 1CICD 1MNUH 3H6JA 2HUHA 4PLNC 1J05A 1L0QA 1YQ4C 2PW1B 3CCSP 2Y36H 2YK1H 4H1LA 4Z77A 1A9VA 2EADA 2WCPA 2R0ZL 2B7DT 5H35A 3PWLB 3IAGC 3NIGB 5I6KA 3RP1A 3UBHA 1GYVA 3H1LD 1G6VK 4HUXB 1BEXA 1ACYH 3UZVB 2NUPB 2OTPA 2XFGB 3IDXH 4QPEA 1AVYA 1BFSA 4BWUA 4EDWH 5KSBF 1FHGA 4PJIF 4R7LA 2RR3A 3KGTA 4GXUN 3GPEA 1NTZK 3ZKSD 4CVUA 5EUOB 5FB8B 3DOHA 3MV8D 1ZLWK 1NMAL 1SQBD 2WINA 2CNYA 4OZHF 3EJRA 1CFSA 3ROLB 4Z6AT 1FOSF 5EC1B 3F12B 4PWKA 2X1WL 3F62A 1QLEH 3D09A 2QQLL 3DURA 4M6ML 1NOLA 2WSDA 2YXFA 3CZLA 2XVKA 1VQKP 3ARGC 3VXQB 4R8WL 4PD4D 3VDAA 2ZT9B 5F89A 2NYYD 3EGDB 5ENWB 4UU9A 1S46A 4KY2A 4R7DA 2RH0A 2H8PA 4ATTA 1A4KB 1FJ1B 2OFQA 4PJ8B 4PS8A 4AUJA 1NICA 2R83A 5F7DA 3K5BA 3CSTA 2YA1A 2OJEA 3EJQA 4FQ1H 2QVMA 2R69L 4YE4L 1XMEB 3VGHA 4EN3B 1KJVA 3SKUD 2HTLC 1SQQK 2X70A 3GS0A 4FA8A 4JO2H 4UYPA 3UBXB 3DX9A 2R56H 3MLUL 3NFPA 4Z7OB 1RE4C 3O2WH 4YEFA 3GM0A 5E08L 3BXNB 3FT3A 4KMTH 1GTWA 1ZEAL 3DX6B 3RGVA 3CDZB 5JW4R 4DVRH 3KLAA 1H3GA 2QJPC 4IU3A 1L0NE 2WVSA 3SPIA 3GSOB 2Q3EA 3H2WA 3IU4H 1WAPA 2YEZA 2XUWA 4JW3A 3A5TA 3G6EP 5JW4Q 1HBWA 3D2UD 1OZTG 2PO6D 5E6RB 4H8WH 3L6FB 3ET9F 4PGBB 2NX5A 4ZNCD 4ZOEA 4DZBB 4PMEA 1Z9NA 2XQBH 5B22A 5DEFB 1L0YA 1T1YB 1QA9B 3ZOAA 3IGKA 1RUQH 2MOVA 3BWZA 4LARH 1S72P 2ARWA 4H8HA 5GSRA 1OCZB 3U9PL 5HHXL 2EDYA 1CGSL 2XWJB 1K2DB 2DM7A 1GGTA 3TTYA 2BY3A 4QNPF 4K3JL 3V6OA 1Z0MA 4XP6H 4Y2DB 4KZDL 4YZWA 3H1KJ 2YKLH 2FX8L 3GI9H 3ULVF 4IBYA 3HE4A 1T83C 4TUUA 2UWEF 5TE7H 2EVFA 4FABH 5CINL 2RMNA 3M6DA 2CRYA 5IW1A 2C1PB 4R2GB 2IPUG 3GXMA 4NN7C 4ZUWA 2QLYA 2NY2D 2UX6A 5HGHA 3UTSB 4JO8A 5HDOA 2FXMA 3GMNB 5F6IC 3AU1A 2WSCH 3AUVA 5E1AB 3ZTJH 3IVKA 3ARSA 4XHJC 3UTSD 3MZWB 1D5XB 2H6PB 4I87A 5BS0D 4NNYA 3ZMNA 3DK0A 4G11A 2DQJL 1WFUA 4BH8B 5C9KA 3OJAB 2AQNA 4HS8H 5J06A 2AQQA 3UTSE 5CBAA 3CMEP 5J13C 2L7EA 3LZNA 5KS9A 4LSQH 3UJTL 1BQHB 3GSXB 2Z4EA 5DYFA 5LKNA 5A16A 2ZP8A 3BDYL 4YSSA 1N4XH 3IGAB 1BF8A 1QLRA 3FQTA 2R59A 5CEYB 3MZTA 2QQLH 2WTPA 1T0MB 4QHKJ 5EC2B 1J18A 4KU1A 2Q1KA 4Y2OB 4DGYL 4XP9L 1HHKA 4H44D 2H2PC 1DO5A 4LGRB 1I85A 2OYIA 5F1IB 1XCWA 3HI6H 3ML8A 3OSVA 4AZ8A 4I6MC 5TQ2H 5ESAA 2I9LA 1AG6A 1KCSL 2MKWA 5CLWA 2LW3A 1KGIA 4ZO6A 3T0EE 1LDPL 4ZNEE 2MEJB 3RL1B 1A4JA 2IWFA 4PJIB 1ZOYC 4AEFA 1P7KB 4TLFA 1T3JA 4LCYA 2WSKA 2YRBA 2BNQB 1DJSA 4NFCA 5T1LA 5EIQA 3N4XA 2X5PA 4Z7QE 4MXWH 3C8VA 3HD7B 3DHUA 1FGNH 5IHBA 4KH9A 5I73B 1W80A 2OP4L 4PW4A 2HRHA 3ZSTA 4ANKA 3RFZA 2ITFA 3VMAA 5T3XH 3KPQA 3VFGH 4MB4A 1UD5A 2WTOA 2ZXDA 2M3BA 1L0ND 1SM3H 1WIOA 1RZFL 1YG9A 1U95A 1ZY9A 4N8CH 4X50A 5DMKB 3FQUB 3MR9B 2HYMA 1JG9A 4XPAL 3VMPA 1E6OL 1KULA 3QUYA 3JYCA 5D2LA 1G9NH 1QSZA 2DQIH 2AABH 4PRNA 2BHZA 2UY6B 1XIWA 5F7UA 4D0DA 2PWEA 1NA8A 3HS8A 2QQQA 4XNXH 4C4BA 2HN7B 3BZEB 1T1YA 4Q2ZA 1J5HA 3KLHC 4R3SA 4YVUA 4X6DF 3R7QA 2XXFA 1DJXA 2PGDA 1IJDB 2I24N 4WAFA 1SQXE 3L1GA 1UGKA 3ZIMA 3TJHC 3WIHA 1K2DA 4FFVD 2XRAL 1LT9A 5TE7L 2YA0A 4PD4E 1WD8A 3P0YH 4AKOA 3SJVD 4AWJC 1KLFA 5D1ZD 4ONFH 2Y9RT 5D7IE 4DF9A 4DTGL 4ZYKB 4DN3H 5AG8A 1NC2A 2K6WA 3J07A 3WI9A 5INDA 3ARBB 3GBMH 1SQPE 1LWJA 1S9VB 4HIIB 5EF3A 1Q9LA 1H5BB 2A74A 2D7OA 1R19A 1HTYA 1PJ9A 5KSBE 2XDJA 4QRSA 3UTTE 2WJ5A 3SPJA 1BVNT 2YK1L 1BDCA 5IFHH 1IAOB 1B0RB 2NR6A 2VISB 3CN3A 4LXFA 5ICZA 1ZGLM 3W9DA 4RRPM 3MOAH 1L9NA 3WELA 2ED8A 1M1JC 3LH8A 1AQ5A 2JJTA 3EFFK 2HMID 3CK0H 1FJKA 4QO1A 4OZFG 1RZJL 1IKNC 4KDVA 4PVBA 3BGMB 1E4KA 1HX0A 1J8HD 4BFGA 2PMZA 3G6DL 1MLBA 4C4UA 3PL6A 5DZPA 3W68A 1I3RA 3TVMD 5C0JA 2OSLA 2E75B 1E4XH 1NGXB 3Q48A 3BRGC 1YC8A 1OW6A 2YJLA 4M6AA 1QATA 3G5XA 3GWJA 2FBRA 1NMBL 4I3RH 4UCFA 3V2RA 4L1TA 4YPGA 4FLQA 4PCKA 5I1GL 5HYEA 1QSEA 1CL7I 1QFOA 3A4AA 3IJEB 5KJ4A 1S7TA 2L7JA 1KMGA 1Y6KR 3BISA 5KKZC 1PZ2A 3EH4B 4PRHA 4IOFD 4UQ2B 3L3OC 1CB4A 4F15B 4ZMAT 2MTAA 5ADPL 5EWIH 4UINH 4N2DA 1CO1A 2GK0A 5D96B 3KM1A 2R4SL 3L35A 3U82B 3LHAA 2KUBA 3HS0C 4IKJA 2B1HH 1WC7B 4IKKA 5I6XC 1J5DA 1SP4A 1GW0A 2J1YA 1GGIH 3HFFA 4B60A 5TDNB 2GI7A 2ZUTA 4POZC 3T9WA 4G5ZH 4OQTL 2E75D 4OUUA 1FG9C 4N2AA 5JQIB 1IU1A 4PRDB 1TPXB 2GUSA 2IBZG 4XXWA 1XWVA 5D2LF 1MRCL 4L37A 3O81A 1C5CL 4GI9A 5K9QG 1E5BA 1JXFA 5ERWB 1KJ2H 5GJSL 4FFYA 3AQXA 2WXJA 1N73C 3BVWA 3C8HA 4ESKA 1GPOL 1HCZA 3CCJP 1PX3A 5HDRA 3UBGA 3G4SP 4ZAKD 3JYBA 3KGRA 4JRXA 1OGPA 4LSPL 1U57A 4M7KL 4X7TA 1A7RL 3CMGA 5EOCH 2GW5A 2DKMA 4LLAA 5EU7C 1HAWA 1MFBH 4RMRA 5KWYC 3ISRA 5GXBB 4YHOL 1OKEA 3NJHA 2VRQA 1M2VB 1QRNB 4D3CL 1W91A 8FABA 1BJ8A 5E94B 1AKJA 3QUYB 3HMXA 3H2PA 3QDMD 1F3JB 4UT7L 4NSKB 2NXYC 5DJTB 4Z3TA 5IK3A 4IOIB 1E9QB 1ZGLB 1L0LJ 4HWBH 3KDMB 4HG4K 2KMWA 1HOCA 4U6HB 1NEZB 2G30A 4L0ZA 5HYSG 3KJ4C 1LO5A 5ETUB 4IIZA 5FYLD 1YN6B 3P32A 1INDH 3QZWG 3VYIA 4WKZA 1A9BA 3CTTA 4R5VA 2WXIA 1WPCA 4ADGA 2D8KA 4XPBH 1E4WL 4OGXL 3WFHA 4RX4D 3N44F 4MJ6A 3S37X 1LM8V 2EIDA 2FT7A 2FFDA 4NPFX 1CLYL 1JJUA 2DMBA 1AV1A 3MRQA 4XCYA 4XNYL 3RVWD 3BKYL 1GRWA 1NWOA 5KSBA 3NPZB 4IRJB 4FHBD 5KAFH 4AH2A 3CV5A 2X12A 5EBWB 4KT0J 1ETB1 3KXDA 1CDUA 2AEWA 3FAXA 3VFPB 2BVYA 5GRVL 4J6RL 5ALBL 3ARQA 4M00A 1NWQA 2OTJP 2UXTA 3UO8B 3MRCB 1XGZA 4J3WA 5E4EB 1CI6B 2FATL 4UIKL 3P3RA 2WLNA 4H40A 4J3VA 4AEEA 3SGDH 2BZ7A 4YXLH 1B6DA 1WG3A 2ICEB 3FB7B 3FONB 4L5FH 2A9NL 1LTJC 1JRHI 1YEHH 2C7UA 2IQAA 2J71A 3NCYS 5BMFH 3FS9A 1MHHB 5DR5L 3QT2A 5SWZE 1HJBC 5GGSY 3TA3D 1UFUA 3A21A 2ZUQB 1INQB 2IFFH 4KV5F 3QZLA 3LRSA 2YD9A 1KTCA 1UASA 2C9VA 4Z3FA 1KCRL 2F58H 4AW4A 3MREB 4JE0A 3PTZA 1TTRA 3GRBA 3ZO0A 3QISA 5B1BB 1R46A 2YXWA 1FIGH 1ZMEC 2VLLB 4GRWF 5K39B 1J0JA 4XVSL 1TZHA 2APTA 2RFXA 1FF5A 3L9YA 1HCFX 5KAQG 4PCYA 4YHYB 1U3ZA 4MA8H 2WZPA 1U8NA 1XHHA 1YPZF 3LY6A 4HIJA 4X7FC 3O4LD 5JXAH 1S9WB 5EORL 2RBLA 5I1HL 1K05A 4PP2B 4GODA 4NQCB 3VRLF 3K46A 1OVVA 2A45G 2DYPD 3RY4A 4EIUA 1EDLA 1MJJA 3FU8A 2PABA 2IBGA 2JI2A 2YA2A 3B5TA 3O4OB 3ZDXF 1S9XB 3IDGB 1TFHA 3L4ZA 2H88C 2F74A 2VWEE 1Y1DA 3P3YA 1AGCA 5CJXA 4I0PD 2XV6B 3BCCD 1DBML 1X5JA 1YEGL 3LKQB 3TBBA 1G6RL 1EA9C 2H26B 5F9JA 4J1UA 2I85A 5HYSA 4JPWH 5JMRA 4PB0H 5E2JA 3ZE1B 2HG5B 4W9CC 2DQUH 4HF5H 1NCBL 2V9RA 1MH5A 5I74C 1YYLL 3WO4C 4XX5A 2HFTA 3K5RA 2VL4A 3VXTB 3FO9B 4HAGA 4LPXA 1XR8B 2W5PA 1F42A 3DYPA 2VC2H 3QUMH 4TQEH 1NUDA 3QFJD 5TQ2L 1UD3A 3H8NA 1VGEL 1FP5A 2A77H 3K80A 1CURA 3VXNA 3AWFA 2V9QA 1AGEB 2A6IA 4XMLH 1AMYA 3QI9C 4LSRH 4CPGA 1U3YA 4BZYA 5HGDB 4S1DC 3HC2A 4Y1TA 5AYQA 1IZNB 3ZBMA 3PQYD 3UP1A 1RXLA 4OCYL 5IF0B 2NCEA 1VFOA 4QT5A 2WC7A 2IBBA 3MAWA 2YAPA 3QUXB 4FG6C 4RGND 5C92A 1QR1A 2E9JA 5C8JA 1C08B 5GSVA 4QTIH 5L2JA 3D9AL 1KD1Q 3BWAA 3T97B 4QRPB 3E1ZA 1SQVE 2GY5A 1IAKB 3UO1L 5HSFA 1A6AA 1H3UA 4MGXA 4PV9A 4FQHA 3GXPA 2G2RB 1TNMA 4BDVA 2RFXB 4R5TA 5KLVJ 1YN7B 4JPKH 2IH1A 3P9WB 4NUQA 4DHLA 2OMVA 3BT0A 2Y06L 3QFJE 4RX4A 3FTGA 1T2XA 1U91A 4QRFA 1IFDA 2AVFA 3V4PL 1J0ZA 4YGVA 1QL2A 4HMEA 1U8HB 2ODIA 4HFWB 3CQPA 4YSAA 2L7QA 1BW8A 5KVMC 2IANA 4WWOA 4N6QA 3TF5A 4XNUL 3BEWB 1KV4A 3L3HB 1PFCA 1KPUB 5FCUL 3RWGB 4GIFA 2R2EA 5E8DL 5DT1L 3MCKA 3BCCE 1W6LA 2ZSWB 2ICEA 1MCLA 3DYOA 4N0CC 5KYWA 2EO1A 5I1KL 1W72B 1AZRA 2XZCL 3MNMA 3BUPA 1SYSB 1T04A 5F7MC 4KNTA 1F5WA 3GJFB 1WZAA 2H0FA 1YTZT 3CN4A 2HFEA 5HY9A 1Y6NR 1LTBC 5ESAB 5FHBH 3BPOC 3I6KB 3DNKA 2HFFB 4EAEA 4G8EA 4WVZA 1NDGA 3R1GL 4MMZA 4ONHA 1RZIA 4Q4EA 4N2GA 5MI0B 4A6YL 4H0HB 2PXYD 3VAEA 3W11C 3ARFA 5ESQA 4PBDA 3BSZL 5C0GA 2Y9YA 4FZ8H 4BELD 4OCLC 3FL7A 3B2VH 1C5DB 1GJIA 2JSFA 2X4NB 4YXWH 3VMYA 2KHAA 3LIUA 1N3NB 5CEZE 5EFWB 2H9GB 2KLTA 1SQXK 1D9KA 1IBHA 1S4IA 4RMUA 1KWGA 5EU4A 1T1XA 2OL3H 1UA6H 2P8PB 1EXIA 1I1AB 2AV7B 1F13A 4OZGE 5GGRA 2H6PA 1EWHA 2Q2EB 2FLRT 2W9EL 3EYFA 1YMHB 5J6HA 3PABB 4LSUH 4P2RA 5AYUL 3KPMA 3NJVA 3GLEA 2AV1B 1X3DA 3SYPA 3CWBJ 4LSRL 3LEVH 5DJ2A 1QI3A 1M71A 4U3SB 2CA4A 5DC4B 5E7BA 4FFWC 3V95A 4AVKA 1G2CB 1DUZA 5HJBA 2AXTE 4XO8A 3VGEA 4UTAL 3OLDA 4EDXB 2KP8A 2YKPA 4DO6A 2HP4A 3E6HB 2JJWA 2XYCA 5C0CE 1BYNA 2BXYA 4MTMA 5DJDB 3WKPA 3L16A 5CGMA 2WVVB 2FL5B 5GS2H 3EOBB 4L8SC 3CVIL 2YD7A 1Q9WA 2ALWA 2FJFA 5ALCH 1GL2B 4HHAB 2YD3A 5B21A 7PCYA 5I2IB 3CSFA 3GS4A 4AIZA 1JERA 1CYXA 1NCAL 3QS2A 1N0LA 5D6CA 2ZYDA 2YXMA 2XNAA 4ZX3A 3HNVL 4L8DB 4NJAL 1BGYG 2B9BA 4P2QE 1SDAB 1RU9L 2AEFA 1G7HA 3HZYB 1S3KH 3JVFC 1KPUA 3C87A 4Z7UE 1TZAA 1X9RA 1FYTA 3E2HC 4LCWB 3X11A 2OR8A 1RMFL 4KOBA 2H32A 1U58B 2WLYA 2WBWB 2EXWC 2A0LC 4HKJA 5FYLE 2IFGA 4HWZB 1BOYA 1W72A 4YHLH 3AAZA 4EI5C 2LFGA 5DQJA 1LO3L 1YPZB 3C08L 3KL5A 2KSJA 4KI1A 4M9OA 5DRZB 3VX1A 4F7MA 1KYFA 3NK4A 3S35X 3AE7C 3BVDB 5BZZA 4Y2DD 5FW6A 1P4BL 4LCWE 2F53D 3VXSE 2NDFA 4QCIB 3JWOC 4LLQA 3FTZA 2QTVA 3MRHB 4GQ9H 1GOFA 3SQRA 5B7FA 4NS0A 4NO0A 3QH3A 3B7RL 3L3KA 3RX8A 3F83A 3ZIYA 3PGFL 3IDYB 3SCMC 5BV7H 3SDAB 4GSUA 2BCKB 1BPVA 2ZKMX 3AM8C 5FW7A 4G72B 5E5UB 5IJVA 2IH1B 1ZXKA 2ZP9A 1A4BA 2P8PA 5CJ8A 3WN6A 2PYEE 4L75A 5KAFE 1NPJA 2R1XB 4XCYB 4XVUC 2ARJA 5AWNL 4NZRL 4ATWA 2A9AA 1RJYA 5FUOL 1SVFA 3RWFB 4M3HA 4N2BA 5FO7A 1GH7A 4AQAB 1KZQA 4HJJL 4ODBD 3MUZ1 1UWXH 3CDYA 4K8RC 3I3EA 1DN0A 4OM0H 5DI8A 4ETQA 2Y6SD 1WH0A 1N8OE 2YKQA 5CP7B 1KJ2L 2A1WL 5ESQB 3JVGC 4JBSA 4MJ6B 5F7HA 2ADFL 2CKBL 4JM0A 4KKCD 2XETA 3INUL 5B8CB 5HD8C 5EN2B 5C0IA 1FORH 2R2EB 5EU5B 1BBDH 2V33A 2X4SB 1RPQA 1R5LA 3T8XB 4Y9CA 4K55A 1R3KB 3P4OB 3SCMA 2DWSA 4HW6A 3OHXC 5DK2A 3L4UA 1SJHA 2IC2A 4XBPB 3VJ6B 3V4VH 2HG5A 1MZ9A 1CWVA 4LOFA 3H54A 4NUMA 2LLGA 1R5VB 3KXFD 4O00A 2EKJA 4PJCF 1CS6A 2KIKA 4KHXA 5EU3A 2LXCB 4C46A 3OB0H 3F7PC 4PY8J 4KK5C 1EQ7A 3O6KH 3MLRL 4FRWA 5AOIA 3MOBH 2CIKA 3W0WA 4QRTA 3ZKND 5HP5A 3I56P 3M45A 3ES6B 2Q7YB 2N1TC 1J8HE 4E9VA 2EDDA 1OD7A 2DYPB 2I60H 1HHGB 3O2WL 1A7NL 2UZYB 4E5XB 2MSPA 3AT0A 1HINH 4D0CB 1IM3D 3T77A 1I7TB 5CZVH 1KY6A 3TZVA 1TIUA 2AS5M 3GXFA 2AANA 3PGCA 4JDZB 5IJDC 2J5UA 3TWCL 4NCC1 2EO7A 4Z8FH 1RIVL 4NPKA 3QR0A 2BSSB 3QORC 1NDMA 1FFTB 1KGXA 2BJMH 2NY3D 4NZ8A 5E9DB 5I6PA 5B5EE 1BVKA 1HL4A 2YPVA 1GGCL 4Z7UA 5B7EA 2OCCB 3VXRB 3QWOB 3STLA 4M1GL 2QADC 2WP3T 1KIPB 3O45B 4R0LB 5AL0A 3P8MC 1UD4A 4JPSA 3FB7A 3FONA 3IU3A 2NTFB 1OTSC 3GHBH 3L13A 4MD4B 3N7NA 4NYLA 3ZE0F 1JI1A 1QFWL 3RGBA 4OTXH 5L7XL 4OZIF 3JV0A 3MUUA 2ESVD 3VYOA 3NIDB 2OR9H 1KYUA 4ANWA 5GISH 1N10A 1CVSC 2H0EA 3P9MB 4JM4H 1UVQA 2OYIB 5F1IA 1FE8H 5C0DB 5DD1H 4BM7A 4JANA 4OLZL 4Z1PA 2UYLB 3H85A 1HEJC 2Y36L 1ZLUK 5ICYB 1AZNA 3B8SA 3DXAA 1ZA3B 4FZEL 1H9DA 2YUXA 3QUZA 3U7YL 4PJXF 3U36A 5TK2A 2A6DA 3H1JE 2VDRH 3LRKA 3V4PA 4AW7A 4YQXL 1D2OA 3ZL4H 1V7ML 4JFYA 4ZFFA 2IX7C 3MZGB 2CO3A 5CJOL 2F8VA 1HZHL 3QJHA 1MJ8L 3H3BC 5ESVB 5C6WH 2QQNH 3ASNB 2XVBA 1N64L 3CXHI 1TZOA 1LTTC 3IJYA 4C56D 4MJ4A 2FYUG 2E74D 2IPKA 5HVHB 4N0RA 5E1AA 1WMKA 1I75A 2VLRA 2H8PD 4LLYA 1RAMA 1NTME 2WPVB 2EECA 4K3AA 5CCGD 3BFOA 4Z7VF 3HTKA 3WU2H 2BCMA 1QFPA 4FEIA 2IV9A 5KJRL 4HULB 1XO8A 4TNEA 4CJ1A 3QNYA 2ED7A 5KBLA 1JTHB 4LBEA 2PW1A 4H1LB 2P8MA 1FH5L 3PV7A 4WU5A 1ZHBB 3BGAA 4CU8A 1LDPH 4NC0B 4RLDA 2JV6A 4JFXA 2P48B 4OFYA 4LLDA 4EF3A 1CT8A 3AFLA 1HI6B 1YY9D 1WWAX 2DJSA 3T8MA 4WCYH 3L54A 5DHEA 1AMXA 3ZKQD 4U3SA 3D39A 4XHQA 3AXLA 5GRJL 5MERA 4EYYQ 3EYOA 2F5BL 5JIQA 1IL1A 3MRGA 1U3HB 1M05B 5L8JB 2PXYC 3SDYL 2C4FT 2QIWA 3SDXF 4RGNE 3A67L 4DVRL 3ZZLA 4FCHA 5IESL 3IJ7A 5GTHE 1RIVH 3LXAA 4G6KH 3AS0A 3L1EA 1CCZA 3WIFB 1KXTB 4CA4A 4E41E 1S4XA 4GW4B 1A6WL 2JKSA 1L3NA 5FFGA 3IFPA 3S5YA 4GJTB 2HPCA 2DQIL 2VDKH 3WXWH 1XB8A 3SPVA 3VD9A 1F2XK 2V2XA 2WYZA 1WGVA 2NW3B 2R23B 2YQ2A 3L6FA 4MZ2A 4PGBA 1NVOA 3UIZA 2CO6A 2VXSL 1HH0A 3X3FH 3GHEH 3MDJA 1TU2A 2BW5A 3LKOA 3QIWC 4LRNH 2J44A 3VRIA 4XMKL 4WGWB 2D7PA 3FDWA 5EMYA 5E5MA 5HHOB 1WZ1L 4QXVA 2W6BA 3RKDC 4AQRD 3FMGL 4TUJA 5F7AA 4KZDH 1R17A 3FT3B 4JO1H 2D2CB 2Z8RA 3LCYA 5A2CA 3DOSA 3Q6FB 5DJDA 3FRUA 2AKRA 2HLAB 1BQKA 1ZHKA 3EADA 1AKJD 2DH3A 2MCAA 1OE3A 5MENE 5HHOE 4PR5A 2PCFA 3SBWA 5JR1H 1J48A 1CUOA 2X4QA 1L3WA 3QDGE 2UYLA 3ZQXA 1YNLH 5HYJB 2QSCL 3MCKB 1WIUA 4F91B 5ICZB 1HZHH 4FD0A 1ZANL 4JLRB 1SF3A 3TSIA 1KTJA 3P73B 5KEZA 1FH2A 4HJTA 2O6FA 4KRNA 2AERT 3TU6A 1XAKA 4UQ2A 1HNGA 1MWOA 4M4PA 3E8VA 2PLTA 5CCGA 5DU7A 1D5BB 2NYZA 3MRBB 1MCCA 3EBGA 3DGDA 3ULUD 1KNOA 3Q5RA 3JWDH 3WFBL 1OD9A 3CWBD 3H25A 4WWKB 4K8RH 4B9YA 1JE6A 1PZ5B 2W0KA 5I1DB 2D3VA 1R5WA 3KHUA 3DHMA 3KVPA 3N55A 4Y2LA 3OTTA 2ZT9C 4ELKA 5I1LA 3BHBA 2VSKB 3HR5B 1FDMA 2YAEA 5GSRB 1RIHH 1CF8H 5I0VA 4Y9FA 1X5KA 4PLJC 1JPFA 1KJ2A 2M1KA 4EOTA 3IXTA 2HJFB 4WW1B 3SO3B 4PIRF 3TCXA 5FPIA 5LWYH 3VNZA 2X41A 1DLFL 2NPLX 1CXHA 4F7PB 3GINA 3EO0A 4QKXB 3S5LG 1TSHA 4MJ2A 3OR7B 1K8IA 1WBZB 2FJHA 1KT2A 3QZBA 3CU7A 4J8RA 2FIKA 1CU4H 1LO4H 4IDJL 3QEQA 3V2AR 3LKPA 3PAYA 2VNCA 3O3BA 2VZTA 3N1PC 1AHMA 2IGFH 2VN5A 5JHLH 1WV7T 3N91A 2YXVA 4FQQA 4S11A 3IM1A 2BS8A 1P2CB 3KR3L 4NP9A 5ITFB 3A2AA 1G9HA 1COBA 4K5LA 4MJ5A 2B4CC 4FKEA 4KJYA 3FU6A 4P57A 4OKDA 2FFDC 1SDDA 1XR9B 4NZRH 3MCYA 2WQAA 2XPYA 3TA4D 4JFOA 1LD9B 1JGVH 3HS9A 5CEZH 1YI2P 3D07A 4YSPA 2FYUJ 2IYPA 4ETYA 4KOCA 4PJ7E 1OAZL 3IDMA 4GOSA 3T71A 4OFYD 3MBWA 6FABH 2BNUB 3OQ3B 3MTUE 2IZ1A 5C0EB 3HD7A 1P4BH 2AQPA 4XVTH 4P49A 4YS4A 1JPGB 4IJ3C 4AGLA 2DI9A 4X98B 5C9JA 3V5KB 5CIPA 2IWGA 5FWQA 3X14B 3GHBL 3IB4A 1SUJA 3JXAA 2JKJA 3LKRB 1OGAE 1QUPA 3M1BA 4KQ3L 4BXVA 3G3LA 1S7RB 4HV8B 1LLAA 3RL1A 2FSEA 1II4E 1CXIA 1JZIA 1NBYA 4PD4K 5ITBH 3S37H 4WWKA 3RX7A 3B5NB 1CFTB 2YQ3A 4PJ8D 4PJHA 4TQIA 1LP1B 5F6IB 3MKGA 3ZYOA 1XVSA 3MJ8A 5CJXC 5GGVH 4AMXA 1U8LA 3WIHL 3NA9H 1SFCD 3EOAB 3L3DB 3F7RA 1LWUB 2WUBH 1BG1A 4HIQA 5J11B 1SJEB 4O51B 1IVTA 1BQLL 1AXSB 4JHZA 5HHOA 5KJ7A 3NCWA 5J9PB 3PHOA 4UT9A 5IT2H 3BAJA 2DMGA 1T22B 5D70H 5E6SB 3B71A 2VR9A 5DK0B 5JHDE 4EI6B 2NSXA 1WWCA 2ITDA 2MHAB 3H2QA 2C8NA 3QJFA 4AY0A 3VD5A 1D5BA 4GRLC 2O1JA 2KXPB 1SDYA 4N28A 1LGHB 1S7UA 1Z3GL 4OB5L 4KK9D 2YGVA 2PCFB 4DERA 2K6ZA 3SOBH 1OCOB 1UOLA 1HQ4B 1YY8B 2JCCB 1LP9E 4WQOA 5HI5C 5BVJA 2HT4C 1PGJA 3BVNB 1AQMA 2D03L 3NSDA 3T2QA 5E6ID 2H3KA 3L71G 1BVNP 4I3RL 4NQCA 4JG0H 1JWUB 4EUPH 3Q5SA 1H15B 2IAMC 3APFA 1FRGL 3PGDB 5GS1A 3UBXI 2FYYA 3G6JF 2Q0ZX 2ZSVA 2JB5L 2JJUA 3QXUA 3FQXA 2WWMC 3L4CA 1DDHB 3CXHJ 4RWHA 1F02I 3SJVA 1MVUA 4AOFA 1THAA 2NX5B 1KJMA 2TSBA 5DSCA 3CZGA 2EDOA 1GZLA 4LK4A 2APFA 1NGYA 1YNKH 3QO1A 3T6VA 1VL2A 3O41B 5A7BA 1WAAE 2W8ZA 2ENSA 4Q8BA 1RZKH 4J27A 3D6ZA 4F58H 1FAIL 4MAYA 3EKCA 2JTYA 4JHWL 2F19L 1MFNA 2YGOA 1A4AA 3VNYA 5KTEL 3ZDYF 3EDFA 2D9QB 3V6FA 5C6PB 1QLFA 1G1CA 2P5ED 4QRRB 5E8EA 4Q9QH 4POZD 4NKMB 3MACL 2C3XA 2X89D 3KHOA 4WUUE 1SVBA 3TASA 1MY5A 5HYQB 1FDOA 1QP1A 2HJKB 3EO0B 1H3PH 4PV1B 1XCTA 1S8DA 4PUBL 1HTLC 3NCEB 1CFNA 5AYTA 3IWUA 5CN3A 1YJWP 4AM0B 3SJVE 1JY3O 1A8ZA 1KBWA 3QRGH 1T7XA 1KXVC 4Y4KD 5JNYA 1IGML 5LG1A 3P77A 1QLEL 2EAEA 4WB4A 2VAAA 1WTGT 2ATKA 3R4RA 2FECI 4MHHI 5EF0A 3ZR6A 4AEHL 3D2UB 1F1GA 1NAML 2ORBH 3CX5K 3ILDA 2Q6WB 3L71J 5I1IH 4A7PA 4YSOA 2FBOJ 4WF7A 2GTWA 5E0QA 3RTLA 4L3EA 1LT9C 3WGVB 4TKWA 1RUAL 4LZKA 3U1PA 4DZBA 4GSQA 1CZQA 1OGAA 3DUSA 3ARWA 1GC1C 2LGNA 1FNSH 4MB3A 2B77A 4WUUA 1Z9LA 2YNYA 2VOTA 3LIZA 4MQ7A 3VD2A 4MCMA 3S8WA 2O3JA 3T6XA 3X13A 4QYAA 2VDLL 1EGJA 3MLZL 3NYKA 4HP5A 4ZMWA 3QH9A 3ELQA 1WITA 4JQVC 4L4TB 1YEGH 1P7KA 3QJFB 2HRLA 5CUSL 1U92B 2XLLA 4OM1L 5KJ7E 3CWBG 1C16A 3VUAA 3SDCA 1LNQA 4D0BB 3WUUA 5ESVA 3NG5A 2NXZC 4L9LB 4NQXA 4RFEB 3BLKA 3ZR5A 1F45A 1G7JA 1SYSA 2CK0L 5FYJE 1MG3C 2PKDA 5DO8A 3UFIA 4B7LA 2CWRA 1ZMYA 1Y9BA 3FTXA 4JPKL 4N8VB 4ZPVA 3CPLA 2KZIA 4X0NA 4F33B 1UADC 1DD3A 3NSJA 4OQTA 3D2TA 3FB8A 4P4KC 5D7JC 5T3ZL 3T0EC 4APQD 4U3FJ 1KN2L 3LZFL 3FQ2A 2EE9A 5KKZB 1G6RH 1MW2A 3O3AA 1KILB 1BFVH 3MA9L 4JO3H 4LRNL 3WTTA 1UD2A 3HUSB 3D51A 5LWYL 1RCYA 1W0VB 2F58L 2KPWA 4C7RA 3JTBA 4OBRA 5D96C 4ZJ9A 5TGBB 2Y1YA 2JP3A 1QGKB 4LKCB 1PKQA 4I9WE 3O3DB 1U8CA 2N56A 2PW2A 3KL3A 4FQLH 3MVSA 4GS7B 3P9LA 4RMBA 5F0LB 1FI8C 2WZ5A 3WS3A 2W83C 3RZCA 4WI5A 3G3ZA 1HGZA 1F4XH 1N26A 2WXLA 3OZ9H 2ETWA 4HCGA 1EFXA 4LHUG 1BLNB 3OKEA 2AK4B 5SX5K 4BV1A 2QSIA 3HZ3A 1FLRL 1AO7B 1QVOB 3ULUC 3E1RA 3BPCA 1XMWA 4PEEA 3J7HA 3LQMA 2IPUK 2XVGA 4LLMA 2K37A 1U2YA 3OPUA 8PAZA 5J12B 1NC4A 3PF2A 4HJ1A 2HWZH 1XF3B 1TMQA 3DMMA 4KHTH 4YO0B 1HI6A 2E59A 2X3CA 2PCPB 1ZR4A 1T89C 4GRWE 1NCCH 1VADB 4ZAKC 3SQBA 3ARTA 3WHE1 1DIPA 1YRKA 4XNQB 2ZUYA 2OI9C 2FQFA 3DUUA 2R8SL 5LDSA 3MGAA 2CE6A 1Q0YH 2DQUL 1NEZG 2ZG2A 3MRGB 4HF5L 4QRRD 4XVJL 3QUYC 2MMXA 4A37A 1RJLB 4M7ZB 3HCVB 2DS4A 3UC0L 4PTTB 5I5JA 3PUCA 1RK7A 3V6OC 3C5ZA 1T0NB 4ENEC 1XCTB 1IUZA 1ETA1 3W38A 4BFIB 1AQ8A 5FGBA 5FR3A 1KTLA 4YLQT 1N18A 3MNZA 2AXFB 1T5XA 4HJGB 2X4PB 1HHHA 1JSYA 3G5VA 4DKAA 3FH7A 1X4YA 2OZ4L 3W82A 2B1OA 1RPUA 1U6AH 3TURA 3MRLB 1KY7A 3KVDD 3WE1A 1KB5H 1SDDB 2CZNA 1AGDB 4I4WA 2XBDA 5KN5A 2GJ6D 2GAZB 1CDIA 4IRJC 5KVDL 4FFYH 4DCKA 4JEGB 4ZO8A 2ADJB 4OIIL 1DEDA 2GCYA 5F7FA 4P3DA 1OV8A 2B87A 3IF1B 5JHLL 4HUNB 3ATAA 1BPLB 5GGRY 2W9EH 1LO2L 1OVUA 1ETZA 2DKUA 2VITA 4MX7B 3FCSB 2NNCA 3GMLA 4HETA 1KQGB 3C60B 3PWPA 4XPGL 3HG1E 4DO5A 3QIUB 5C0AB 3ARGB 3NH7H 3V0IA 4IQHA 1A5FH 2AQ3A 1JI2A 3B5HA 4N6JA 3FSOA 2FD6H 1NH4A 3ARDC 3HTLX 5D1XE 3C5JA 5GPRA 3L4WA 4FLSA 2J5WA 4PJ8C 4EQ2A 1NTZG 4BE6A 4PJAB 2BERA 1XTCC 2CDFA 4JG5A 3NZ8B 4G5AA 1C16B 2BS71 3L9BA 4JRYA 1GTFA 3W56A 1SQBK 2N7BA 2OQQA 1HHJB 2Y07H 4G6ML 4ZTEA 4HKJB 5MEQA 2ZUSA 4MA3A 3NPSC 3LZLA 3D4CA 5T1KA 3N42F 1PLGL 4KFMA 4M29A 1QUNA 4IEFB 3HAEA 3LNIA 3KCPA 4FEMA 4BZ1A 3RE0A 1DBKH 2W0PA 3T6ZA 2DWTA 3NUKA 3H1LE 4JCWA 5LGJB 4JR9H 4YBQC 4YFLI 1A7BA 5E8PA 4Y2DA 5EH1A 3L71D 2CCWA 4CC4C 4EQ3A 3GSQB 4V1DA 4FL4C 2QJPB 5K1JA 3RVVD 2AK1H 4ALAC 4P4RB 3EOAA 2CR3A 3MUHL 4Y1AA 5LGYA 3HPJB 4EI0A 3SDCC 2AABL 3WENA 4XAWH 5E51A 4EZMA 2O01N 2J88L 1H0TB 2C1OA 1EHAA 1SXBA 2X9WA 3JSSA 1VZGA 4QTHB 1E8XA 4X5XB 3FO2B 4MWFB 3O8XC 1K4DB 1QLFB 4GYBA 4WFHE 3V0HA 4QRRA 1YA5A 4Y2OA 4M9PA 1YAZA 1UD6A 1SM3L 5DS8A 3EXLA 1QSEE 3WFEH 4WUKL 1HHGA 3BWUF 4IL6H 1PZAA 2DQFA 4O2EB 2J6EH 2CRZA 3U0TA 4Y4FD 4PVLA 5IQ7H 3QHFH 3CVHH 3CX5D 1IRAY 5DYOB 4FG2A 4ZQTA 2ZOKB 5DJ6B 4JREB 5BRZD 2YSTA 5AALA 1I9EA 4WTZA 2BDNL 15C8L 2X38A 2EEBA 2WVTA 2IYOA 4XN5A 4DPAX 4AQ1B 2IBZE 1BQUA 2JK5B 2EE3A 5E2UH 3RL2B 1OTSD 5D1ZB 2PAJA 4PRDA 5B66H 4S1SL 4O4YH 2ZAEB 3L75G 2IAND 4Y8DC 4PP1C 3DX7B 4GBXC 1RP8A 4HH8A 3WLWD 3MOAL 3MOQA 2VO5A 3LOWA 3OB8A 3QUXC 2YLHA 3ML9A 2V5MA 4YDMA 1T1ZB 3THML 3EIFA 4NFBA 3D25B 2OYOA 5J13B 4PTTA 3CX5I 5F7WC 1U8IB 3MRIB 4I89A 1NBQA 1U8QA 3HRZC 4U31A 3CLEL 4F8QA 1G9NC 4TSCH 3CQFA 1NBZA 3TM6A 1ZA6A 3RK3B 2NZ9C 3LD8C 2KK7A 5D7KD 4ZMLA 5IROD 4XMTA 3IJSB 3OWRA 3UGXA 2ZWYA 3BH4A 5FO8A 3FN3A 1ET5A 1UJ3C 3CZFB 5ANHA 1UUSA 2Q6QA 2XIIA 5J9PA 4M1DL 1HL9A 3MRFA 4BD4A 4KUZL 3TIDA 1S78C 1TCMA 1SXZA 3PJNA 4LDEB 3O6KL 5J1AA 5ACZA 3SIKA 1PFOA 5IIEA 3L48A 2XV5A 1XXFC 1TQWA 1TYRA 3PPEA 5T1JA 4GAYA 1H8LA 1HDMA 3BYTA 3UYOD 5C0CB 4N3YB 3L70E 4RDQG 4JCLA 4J39A 1ETZB 1NPNA 4PJBB 4PBXA 1MPAL 1TG8A 2WWNA 1CGYA 4W9ZA 1KJVB 1SVZA 5JA9A 5ICYA 3JCUE 2X28A 2ZUWA 4XN2A 3SZ6A 2V4HA 2ADIB 5DZAA 2IDBA 3S6CA 3FU5A 5HHME 4FTDA 3UC2A 2E42A 2ZJSH 2Z5IA 4RISH 1EGJH 5APUA 1URLA 3D0VA 5AOKA 1IGIL 3DJZA 4OF3A 4P46B 5KVEE 2K3RA 3LXBA 3UZEA 1X4ZA 3SGDI 3C09C 5C0DA 3OG4B 4DGIH 1R0AL 1RZJH 3ZZ1A 3T2PA 3SFDC 1NCWL 2VXQH 2WXFA 4KKCC 1KLGB 3RVTC 1DE4B 5IFJB 5IF0A 2BSBA 2X44D 4J4PC 2XIBA 4GFXA 5IW6B 2R2BB 5I17A 4OV5A 4MDIB 1HXYB 4Y1AD 4IGBD 2NW2B 4G80B 1H6TA 4Y5YC 1ZLSH 5HI3C 2P5WE 3BD4A 3NMEA 4M02A 2YD8A 2QSTA 2CNZA 4AQAA 3WO3B 3S9OA 2BP8A 3WS3B 3SWYA 3LEYH 4Y16B 1VF5C 4CMHC 4DPCX 2XPGA 3I9IA 3LHPL 5F2FA 4WU7B 2WWWA 1GS7A 4V2BA 5EN2A 4HSQA 1CLYH 5E70A 4NQEE 6CGTA 5BRZB 4E9YA 4C83B 3W0WB 4F7EB 4XXDB 3TBVA 5IM7A 4HX1B 4XFJA 1M1JB 2GEEA 2Y7MA 5DZVA 1YCSA 4PJCE 3MD0A 1EFXB 3KLQA 4NM4H 2XJKA 3CFKA 3O9WB 5A2AA 5IWLC 1DQIA 1P69B 2E9WA 4C59B 4BKSC 1Y07A 1ES0A 1P84D 1MFZA 3EH2A 5DI8B 3RZCD 3SGKA 3VI4F 3B2UC 2HVBA 2IH8A 4CSZA 2CCLA 3HBZA 2MNJB 5KBKA 1HN1A 4S10A 4JFHD 3IDNA 4X4ME 4FN0A 3RK2C 4FTVD 4AENB 5I66B 2ZYGA 3DRTA 1SXCA 1LK3H 4HWZA 1JB0J 3QZOA 3F6LA 3Q6GL 3SE3A 2VAJA 5K5YA 2LABA 2CHZA 2IWKA 3L5JA 2I25N 1LK2B 3QNFA 1GC1H 5F44A 3L8QA 3VWJC 3ZHDA 1LEGB 5JW4M 3V2QA 1BDYA 2Q86B 3Q05A 2ZXXA 2IDFA 2AJ3B 2VZ1A 3ETBF 1KJ3L 2WXPA 2BRRL 3MRBA 5FYKH 4M93C 2EDEA 4WV1B 3KQGA 3CCQP 3HVDA 4WHDA 5DXWA 4MD0B 2F7PA 4PR5B 4X4KA 4B9ZA 3DPBA 3GJEA 2RB8A 1MCOH 3CX5J 1PLGH 3AB0B 3Q0HA 1Q81Q 2X6CA 4L29A 3CCMP 4ZX5A 1UH2A 2KB7P 2Z7UA 1BYPA 2A3TA 3S88L 4OD1H 3V4VA 2GTZA 3N85L 1CL7H 1QAWA 3VG9B 4UBDC 4JANB 1PMYA 3G5ZB 4KPHH 3KVQA 3MV8B 5AW6B 4X4MA 2XZAL 3BZ4A 1BGXH 4JDTH 5TJHA 3TCLA 2AP2A 1KTRL 1INEH 1PG7X 3HLAA 1NGZB 3GSNL 5DUBA 1FFOB 4QTIL 1WIPA 1YN6A 4HHGA 1NCDL 5HD8D 1V05A 4HBCH 3SGJA 3M7OA 5JW5A 2HT3C 1L9TA 3MJ6A 4FYTA 4S0HA 1WFTA 3JTSB 1WCBA 2CBPA 3RHWK 4AIEA 3CH1B 1JZ4A 2HA1A 3UEQA 3WFHB 3OWEA 2RCSH 1IBGL 4ZBJA 5FKPB 2BCCJ 2AEJA 3LKNB 1A4CA 2BCCG 4TQEL 2O4EA 3STBA 2KI6A 1FBIL 4S2SA 4WHYG 3L7FB 5D4IA 4J4PA 3QW9A 2OYKA 4GT0A 1CGSH 3IDIB 4MMZB 4ONHB 4NRYB 2C0XA 1UATA 3G5YA 3A6OA 1QG3A 3BWUC 4GP8B 4HJIA 4K3JH 4XN9A 1N5YH 3T65A 2AMUA 2HFEB 3OR7A 1YYLH 5DD6A 1P7QB 2XQYA 4LLDB 4LP8A 4FKHA 1QD0A 1ZEAH 2BVPB 3MXVH 4BRYB 3E1F1 3WNJA 2XWXA 5JTWA 2N1TD 5FYJU 3W39B 3TBSB 1I82A 2AGJH 3IMVA 5DJZA 3SO5A 3THMH 3D1MC 3U1AA 3RNQB 1AZCA 4YN3A 1SJMA 3ZKMD 2A77L 4OLWL 1H8NA 3FFDB 3L1OL 5I1HH 2I5YL 4MQXD 5MEOA 2DM2A 2Y0EA 3L81A 4O02L 1M57B 4NDMB 1L7TH 3P30L 4JFYB 4ZFFB 1HJCA 9CGTA 1UACL 5EO9B 4WU5B 3PWNA 3U7AA 4KRLB 4ZOCA 1HWTC 5IY5B 3ALPA 2J1WA 2ED6A 5JIMA 1CFMA 2K6YA 4ZFOA 1FOSE 1Z5YD 3QCTH 4JPWL 2CLRB 2QLVB 2IWEA 3TXAA 3QAZB 2C4FU 1A65A 1K04A 1B90A 1R3JB 1X6LA 2VTFA 2A9BA 1RK1A 5B1JA 3S36L 4GXVH 1OARL 1DQDL 2FLMA 4F8LA 3VXMD 1IGFL 2W65B 1RHFA 4BSWA 5BPPA 4GUCA 3K72B 5CD3B 1PP9J 5JW4N 3ZW3A 1I8KA 1CJYA 1E2VA 2J58A 1JCVA 1HOEA 4P2OB 3JTTB 3R19A 5HVWA 5EDSA 2IAMD 3IJEA 4IS6A 1UWYA 2Y5TA 4MNGE 3NZ8A 4U49A 1G5AA 3AS2A 3GLDA 2IGFL 3ARBA 4UAOB 3POHA 2F54B 3E9UA 4WTZG 3SKNA 1CLCA 1H6EA 3H1KE 4LNRB 5DA4A 4KY1H 5CMAB 1M9WA 1P84K 4QHMA 5BXFA 2GTZB 1J9QA 1NGPH 3DROA 5DEGA 1K5NA 3WL9A 5GSVB 3A6CL 3UP6A 2G3MA 3K4DA 1ZS8B 2YAQA 5I1AB 2VDNL 4MD5A 5DQ9A 5ALCL 3HN3A 1N8RQ 4X8GA 5HHMB 4I2LC 2QGCA 3KL0A 4NWUH 5IROC 2VXTL 3V2PA 3L3KB 5HGDA 3T3MB 1HQRB 3G6JA 1MNNA 4NRZB 1MF2H 4PJ0E 2TRHA 2GC7C 3X3GH 4QCIA 4NKQB 1VIWA 2B8OT 4L1LA 3FTYA 1AC6A 4AG4H 1NLBH 1SN5A 3HFML 1TQSA 4ERSL 2OMUA 1OP5H 1OFCX 4U6VH 2UZYA 4ES8A 1SYVB 4S1QL 4JY6A 3BKCL 2H6OA 4W9FC 2D31A 1GL2D 5KBDA 2WT7A 5MEOB 1X79B 3VVWA 5IMKB 2FO1A 5I19L 5EZIL 2A06E 4NZFA 3MRPA 1SBSH 4XBGB 3A5VA 3MV7A 3PHQB 1A2YB 2CMRL 4NSKA 2OL3L 4PP2A 3SE8H 2YRPA 4JVWA 3WN5A 4X7SH 1UKTA 1CTOA 1IBBA 1YN7A 3BKML 3WJLA 4AYSA 3HKZA 3OKDB 5IT2L 5CEXB 1X44A 4PLJD 4DPRA 5JXEA 1U3HC 4RMSA 3U2IA 1XGUB 2E7LA 1CG9B