3V2PA

Compcc in complex with fatty acids
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
45
structure length
45
Chain Sequence
b'MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cartilage Oligomerization matrix protein (coiled-coil domain
publication title The pentameric channel of COMPcc in complex with different fatty acids.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 19
structure length 45
sequence length 45
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3v2pA00
3V2NA 3V2PA 3V2RA 1VDFA 1MZ9A 1DEBA 1FBMA 3V2QA
chains in the Genus database with same CATH superfamily
5KAFH 1PPJG 3L75J 3VMAA 1VQKP 1KYOD 2D2CC 4HKZH 3H1LJ 1S4XA 2W83C 1EXIA 2IZ1A 2NZ2A 1FU1A 4H13C 5AVTB 1DEBA 5GTHH 2Q5UA 1N73B 1S1CX 2FYUG 1H8AA 2BCCJ 3HD7C 1KILA 1PGOA 1FAVA 1GL2D 1EDJA 1XTGB 3CWBE 3H32A 4GODA 1FZAA 3CCEP 1YITP 1SQXD 2A45G 2HODB 4BRYA 4U3FJ 2Q7CA 2QVAA 1GDTA 4GIFA 2P58A 1NTZK 2WSFH 2LR2A 3CCSP 3SWFA 1BGYJ 3BCCG 2WTYA 2OYOA 2E5TA 1ZMEC 4PD4E 1GK6A 2KS1A 2K1AA 1URQC 1LT9A 4I7ZC 4XE5B 3RL0D 5APQA 5CJ0A 1ZN5A 2FFDC 3V6IA 3MUDA 1L0LD 1JY2P 4R4LA 3T97A 2Z5IA 3CX5I 1S5LX 1E5WA 4IL6X 4UB6H 1Q82Q 4Z1MH 4OH8B 1Q81Q 4ASWA 3B71A 3L71J 3HTKA 1NU1G 4ASVA 4H44C 4EYYQ 1PV3A 2PP6A 1U7MA 3I55P 2OGUA 2H8PD 2YNYA 1R8EA 2OTLP 2N1TD 2M8RA 1SQQG 1KILB 2QJKC 1PP9J 4Y99B 2JR8A 3G6EP 1GK4A 4H0LB 3TDKA 1VQ9P 3SFDC 3A3YB 3H32B 4DOJA 2HR3A 2OARA 3NTNA 5EFWB 3EFFK 1QVGO 4PD4H 2Y0CA 3E7KA 3QWOC 1YJWP 1OX3A 4AYCA 3CMEP 3AE1C 4BRYB 3Q5PA 2ZVNB 2KUBA 4KJMA 1RQUA 1GL2A 4I2LC 2K9YA 3P7KA 2NPSD 2O3JA 3I5CA 2XU6A 1SQBJ 5DJTB 3AE3C 1VQLP 2QG4A 2C0WA 4WY4D 2KS1B 3I56P 1AQ5A 1BE3D 3KDPB 5KJ7C 2GUSA 3ITKA 1SVFA 5AVRB 2C9LY 4U3FE 3G4SP 2OTKE 3T97B 1LTGC 1IJDB 1BGYE 4DJGA 4IFDK 1JO5A 4AUWA 1Y9BA 2WWWA 4TLFA 1KB9D 3H1IJ 3TNUA 4CPGA 1L0NK 2YIUB 1FZEA 3HUSC 3VP8A 3HTKB 2O01J 3U59A 1L0LG 1RE3A 4W7ZA 2RN0A 2E76B 2CPBA 3M9BA 4IOIH 1NWQA 2IBZD 3AE7C 1NVOA 3L73D 3II6A 3H1HD 4JBZA 4IFMA 1N7LA 1Z56A 4W7YA 3L71E 1PFIA 2AXTE 3NXSA 1PZQA 1EDIA 1SQPG 2N1TA 1J1DC 4PD4I 3CCLP 3PH0A 3TF5A 2QA4P 1GL2B 2B89A 3OA7A 2E74D 3S4RA 3OAKA 1FZCC 5KLVE 3H25A 1Q2NA 3IF4A 4WBAA 2YO2A 1VF5D 2QJPB 2IFNA 1A02F 2LKMA 2KI7B 2NPSA 1J1EC 1NTMK 4L74A 1SQBE 4HYTB 1RE4C 4WWIA 2JWDA 1VQ6P 4WY4A 3TNUB 2FBWC 3L74D 1NAYA 3V2QA 1IFDA 2AXTH 1SP4A 1KN7A 2P1JA 1N7SC 2ZAEB 1NU1J 2W27A 3E1IA 1KQFB 1S9KE 3RL0g 4DZOA 1RF1C 4WVZA 3M0DC 3CXHD 1QX8A 3H1IE 1HJBA 3SWYA 1XTCC 3KQGA 2P7JA 1WT6A 1KV4A 2QJYB 2HG5D 4L76A 1PPJE 4ZNCA 2K3RA 1GMJA 3P8CD 2IBZG 3PP5A 4HH2A 3F5HA 2N1TB 3L73G 1S3JA 3H1HG 2J58A 2RH0A 1BCCJ 2KIKA 1SFCD 1KILE 5CCHD 2FYUE 3G71P 1LWUC 3HD7D 1N2DC 1S5LE 2FY8A 2GM4A 4IL6E 2E75D 4PJ0E 4A7PA 1SQXJ 1KC8Q 5KLIB 4PV1C 3HE5A 2R5BA 2PRRA 1E79H 2ZT9C 1G1IA 1LP1A 2A06D 1JNMA 1EZVE 4I6MC 1M1JC 3GMAA 2NPSB 2M3BA 2OYIC 1MKMA 1N8RQ 1L4AC 2JKVA 3M0AA 1QGKB 1VQ8P 4WY4B 5KAIE 2WVRA 1TU3F 3BCCE 5AW8B 3E1RA 1DH3A 2Q1KA 2HYNA 1IFMA 1L0LJ 4JQ0D 1P84E 2O1JA 2KP8A 3CCQP 2L91A 3EWKA 3S9OA 4L75A 1NHLA 2FYZA 3TGUE 3M9QA 5CCGD 1K8AQ 1RF0C 3WUTA 4IL6H 2E42A 3R2PA 4LLHA 1MUUA 4YXWH 3Q5SA 1NU1E 1U57A 4EIJA 5AVQB 1YJ9P 3LW5J 2KXPB 5KLVK 3P32A 4DT0A 1LGHB 1N73C 1LTJA 1SQQE 5B66E 2I1JA 5E79H 1KYOE 1LNQA 1YIJP 3HE5B 3WMM0 2IYOA 1LP1B 3CX5H 1MZ9A 4IFFA 3AE2C 1SFCA 2Z5HA 5CCHA 1KTMA 2POHA 2AEJA 1VQPP 5TISH 2E74B 2WT7A 4GKGA 3SSUA 3FXDA 2SPZA 1T2KC 4EOTA 4K35A 3WUVA 2QEXP 1R5SA 1VF5B 5APTA 1BE3J 1IO4A 2KYVA 2A06G 4UB8E 1OZHA 4C46A 1JEKA 3CL3D 1BCCD 3CPWO 1KMIZ 1S2EA 1NTKJ 2W90A 2ZYGA 1UIXA 3AEAC 3RK3B 1FBMA 2WSEH 3AEFC 4RO0A 1T8ZA 1JB0J 4D6TD 1LTAC 3BRTB 4YXDC 1M7LA 2W6JH 4M3LA 1DD3A 3H1KD 2UWJE 2FYUK 1GZLA 3JCUE 4OGQD 3L73J 1OW7A 4JYBA 3H1HJ 5CCGA 1LTJB 1FZFA 1L0ND 1EZVI 1AA0A 1K05A 1KILC 2A45I 4YTPC 3A0HH 4Y99C 3A0BE 2FXMA 4H0LC 1JTHB 4I1LA 4KHXA 3L35A 1SFCB 1SQPE 3S1KA 3CCRP 1X8YA 5L8RJ 2E75B 1CI6A 3K5BA 2WT7B 1NKNA 5APVA 1ZV8A 1P84I 2FXOA 2P10A 3UIAA 1QVFO 2KLVA 2NRGA 3KZIE 3JC22 1JM0A 1SLQA 2N9YB 4PD4D 2P67A 1T3JA 1FDIA 1SQVK 2BASA 2ZXXA 2VRSA 3L70D 1BDDA 1QEXA 3L75E 3MUDC 3LIDA 1BSNA 3H1LE 3L74J 5AW0B 3HRNA 1AVYA 2JEEA 1BCCG 1YHQP 3VMYA 1A02J 2YIUC 2QSIA 1SQQK 1J2JB 1KYOI 5APWA 2BCCE 1NTMD 3VN0A 1GW3A 2E76C 1SQXG 2AEMA 1HUCA 1RY3A 2HFED 3VYIA 1T3UA 3Q5RA 3BASA 1KB9E 3CCMP 2KZIA 1OVRA 1WRGA 4LC1A 2KB7P 1LT9B 3H1KG 4N78D 3FX0A 2WZ7A 3CC7P 2L5GB 2V7QH 1Q86Q 5AW6B 2R3SA 3CC2P 2B87A 1NOHA 3H6PA 2IBZE 1NTKD 1X9VA 3MHVA 1KZUB 3G3ZA 2R32A 3PRJA 1L0NG 2MJZA 3L73E 4GOFA 5GTIE 3KPEA 5APXA 4BWNA 1CW5A 1KORA 3BVHA 2R44A 1YTZT 2MKVA 1GL2C 3CD6P 4L73A 1NYHA 2XV5A 3ABVC 2GA1A 4PV1D 2QE7H 3TYYA 2QJPC 2IX7C 1FOSE 4XA4A 2J5UA 5AVWB 1T6AA 1OXZA 2Y9ZA 1ZR4A 1VDFA 1M57D 4N3YB 2R5DA 2W8ZA 4GDOA 2R3CA 3EQ2A 1U7JA 4O9BA 3SWKA 3OW2O 3L70G 1NTZJ 1AJYA 1PP9E 1RE3C 2OYHA 1FZGA 2G8YA 1VQ7P 1JOCA 3RK3E 2Q3EA 1AV1A 1CZQA 1SQPK 2JP3A 3B5ND 1KFNA 4OGQB 1NTMG 2O01N 1W2EA 5BU8B 2QJYC 2B87B 5AW1B 1YBKA 2WPQA 2DW3A 4YPCA 3CXHE 3RK2D 2N1TC 1BE3G 4RKUJ 1USDA 1EC5A 3RL0B 3AEDC 2FYNB 2H43A 2FKWB 1NTKG 4RJTA 2C0XA 1S72P 4B86A 1VQ5P 4EI2A 5KLIC 3U1AA 3FGAD 3GLMA 2M5AA 5KLVD 3GHGA 1H0TA 1AFOA 2RKLA 1M8OB 1GU4A 2NPSC 1OMIA 1FJPA 2M0BA 1AQTA 2D2CD 3CCVP 4W80A 4WY4C 1W2BO 1JY3N 4JPZB 2YO3A 2A06E 2QIWA 2N9BA 1KB9I 5AVXB 1MV8A 3AE9C 4H13D 5M1BA 2KSJA 3RBZA 2OYHB 2XDJA 2Q6QA 3O6QA 2WPVB 3MIWA 1JMMA 2QRXA 4D6TJ 2WSFJ 5H2FE 2IBZI 1NGMB 4ZKPA 1N86A 1KQSO 1PIXA 3M9HA 3KYQA 5AW3B 2PAJA 5AW4B 3H1KJ 2ZFCA 2YMYA 3VMZA 1NAFA 3FXEA 1CSBA 2W6AA 1L2PA 1IK7A 1L0NJ 3B4SA 3B5NA 2Y9YA 3ZDMA 3AE4C 2FYUD 1URQD 2O01H 3AE8C 2HPCA 1YQ3C 5BVZA 4H0LD 3IN6A 1NTZD 5KTBA 1IFIA 1MFZA 2M5AB 3GHGB 1H0TB 1JY3O 3L74G 1GW4A 1EZVD 3FWNA 4BXLA 1HWTC 1S5LH 3MP7B 1ZRTD 3AEEC 2E74C 3BRVB 4PJ0H 1AVOA 2H89C 5H2FH 5KAFE 3FWLA 5KKZB 3BATA 4HB1A 2KZJA 5KLVG 1EXJA 3O8ZA 4H44D 1VF5C 3BCCD 3P8MC 2CK3H 5GTHE 3CX5D 2A45H 3L72D 2JDIH 3O6QB 3TSIA 2Z4EA 5APUA 3L70J 5AVSB 1K9MQ 3A2AA 2XZRA 5KAIH 3RK3C 3CXHI 1IFPA 2W6BA 2P2UA 1SQBK 3TGUD 2GUVA 3JSVC 5APYA 1BCCE 3VP9A 2YKOA 5CBOA 1JY2N 1SQVD 1NTMJ 1OW6A 3AE6C 3HD7A 1P84H 3H1JD 5DJUB 1VQOP 1DD4A 4KT0J 5AVVB 1SQXE 3PLNA 3B5NB 1JCCA 3D6ZA 3Q3DA 3EFGA 4NPDA 1LTJC 2QM8A 1QL1A 2J59M 2HPCB 3CI9A 1SQQD 5KJ7D 3C9IA 1KQGB 1ZOYC 3RK2B 1ZW0A 2I8DA 4OWFA 3Q2YA 5CBNA 5AVYB 1G1JA 1X22A 1L0NE 1LTSC 1SFCC 5CCHC 5B66H 2XNXA 4UB6E 1URQA 3N7NA 1KYOH 2E75C 3G9RA 1NJIQ 3NMDA 1NTZG 1HBWA 1WMKA 3V5BA 1L0LE 2RMZA 3L36A 2FFDA 1IC2A 2ZXEB 5APSA 1EZVG 2JO1A 3W68A 4R4MA 1IFJA 3IFMA 1JY2O 2AXCA 1VL2A 3CCJP 5AVUB 2D2CB 3N4XA 2WMMA 4UB8H 2IPPA 4H13B 3CWBD 3L72G 2KNCA 1HGZA 3D70A 3HD7B 3V4QA 3L70E 5B5EE 1ZLLA 4C7RA 3W67A 1G2CA 2CPSA 2H88C 2WPSA 2OTJP 3LIEA 3TGUG 1USEA 5CCGC 2IZ0A 1K04A 1Y47A 1SQVG 1LT9C 3H1JG 3VTPC 3D71A 3JCUH 1NTME 2JJLA 3M91A 1RH5B 3D6YA 1QL2A 3KHUA 1KFMA 2E5YA 1NU1K 1BE3E 4N78E 1SQPD 1Q90D 1PGQA 1OFCX 1URQB 1JMBA 4I7ZB 5KJ7A 3KXDA 3A0BH 2KK7A 3V4WA 1N7SD 1HF9A 1NTKE 2FFDB 5KLVJ 3RGUA 3QH9A 3AEBC 4D6TG 1BSHA 3LW5H 2WSCH 1YI2P 1FJKA 2Q3IA 1FZBA 1Q7YQ 1LT1A 5B5EH 2K88A 1KQLA 3HUSA 5AW7B 1K73Q 1FE6A 2XNDH 3GG2A 4H44B 2Q9IA 3L75D 2KNCB 1OW8A 1W5CE 3H1LD 3KZIH 1SQXK 3H1HE 3MZWB 2QJKB 4N6JA 3MTUE 2O1KA 1CI6B 3R4YA 2YKPA 5C39A 1G2CB 1YJNP 2BCCD 2OQQA 1ZXGA 3CWBG 3NFQA 3A5TA 3USSA 3CCUP 1YYCA 3PTZA 1M90Q 4U7JA 4MN4C 2ZT9D 1YTZI 2KLUA 3HE4A 1GTWA 4OGQC 2G3AA 3C1LA 2WPRA 1JCDA 2KOGA 3IAOA 1GD2E 1NH4A 4U3FD 1IZNB 2Y0EA 1L4AD 1HH0A 1L0LK 1FZCA 1KB9H 1LTBC 1FOSF 3SFEC 3TK1A 2K9JA 1BGYD 2FYUJ 5AVZB 3RL0C 2JWAA 2FYNC 4LGDE 1H88A 3A7OA 4NPFX 3C8VA 1VQNP 5GTIH 1RE4A 2H7HA 3L74E 2B9BA 3OJAB 1VPCA 1RHZB 3HUSB 4DCKA 1ZR2A 4RESB 1N7SA 3L71D 1X79B 3BCCJ 5CJ4A 3WU2E 2QM7A 1RF1A 3L72J 5CHXA 3M0DA 2ZYDA 3VMXA 5CMZA 1HGVA 2V4HA 1JUNA 2B88A 2OYHC 3CLQA 1HJ0A 2WITA 2KSEA 5TJHA 1R5LA 3L75G 1PP9D 3V2RA 1EQ7A 1SS1A 2FXPA 3P8CE 2YKQA 3H1LG 3RK3D 3TGUJ 1HTLC 3AE5C 2AEFA 1UIIA 2ZVOB 1J1DB 1H89A 3HE4B 1SQVJ 4AQRD 1NO4A 3H1JJ 1QLED 2BCCG 3B8EB 3U1CA 1EDKA 3MD0A 4C7NA 1LWUA 4WB4A 1DX7A 1FZCB 2YMKA 4JF7A 3GW6A 1T2KD 1NTKK 2WSEJ 3L4FA 2K9JB 3F89A 1LTTC 1SQBD 1OVVA 1SQQJ 1OVUA 3GF3A 4XFJA 1GU5A 1FDOA 1M1JA 4U3FG 5AW9B 2E43A 3VOPA 1M56D 1J1EB 3CXHH 2OYIA 2XKMA 1RQVA 3WU2H 1L4AA 3GHGC 1BGYG 1EDLA 1FC2C 1LTIC 4OVNF 1S9KD 3AECC 2YXQB 3V2NA 3V2PA 2BEQD 2ITAA 1FS0E 1D7MA 1N7SB 2ZYAA 4QMAA 3H1ID 5AW2B 2IYPA 1NTZE 2I1KA 1VQ4P 5KKZC 1PPJD 1PL5A 2IDBA 1RF1B 2WQYC 5K5GB 1PGJA 2K37A 2PGDA 1KD1Q 1ZRTE 4GOEA 1RF0A 3WUUA 1Y8AA 3L71G 1KILD 5E79E 3CMAP 1FDMA 3CWBJ 3PHLA 1IFNA 2IFMA 3CX5E 3L72E 3M06A 3MGNA 1PGPA 1N73A 1PP9G 4C7NB 1LWUB 4ZKUA 5TISE 4PV1B 2C9NY 2Y0DA 2ZJSE 2ZT9B 4ZMDA 4JYCA 1IK9A 3B5NC 4Y28J 1SQVE 1M1JB 1X0TA 1JY3P 3H1JE 2OYIB 2HODA 2LXCB 3CC4P 1L4AB 2YXRB 4GT1A 3RBXA 3RK2C 1SQBG 1ZP0C 1P84D 1OIPA 1OWAA 4TT3H 3IR9A 1SQPJ 2WSCJ 2M3EA 3L37A 2LXBA 4EDFA 2WSSH 3PJSK 2BEZF 3Q1MA 1YQ4C 2PFXA 2V7QJ 1BDCA 2HLOA 1DEEG 4K3AA 1JTHA 4NPEA 1M1KQ 5BU5A 3GF7A 1NKZB 1NU1D 4D6TE 2E76D 4HJGH 1DIPA 1HVVA 3H1IG 5AW5B 1LJ2A 3AEGC 3H1KE 1VQMP 3A0HE 1MFTA
chains in the Genus database with same CATH topology
1FZGA 1G1IA 4N78E 1JOCA 1JNMA 4I6MC 1URQB 1M1JC 5KJ7A 3V4WA 2NPSB 1FU1A 5AVTB 1DEBA 2M3BA 2OYIC 1N7SD 2Q5UA 1N73B 1CZQA 2FFDB 1L4AC 1SQPK 3M0AA 3B5ND 1KFNA 1H8AA 4WY4B 3HD7C 1KILA 1W2EA 3LW5H 5BU8B 2WSCH 1FAVA 5AW1B 1GL2D 5AW8B 2WPQA 1FJKA 1DH3A 1XTGB 2Q3IA 1FZBA 3H32A 1FZAA 3RK2D 1KQLA 2HYNA 2N1TC 3HUSA 1IFMA 5AW7B 2O1JA 2KP8A 3RL0B 2Q9IA 2A45G 2HODB 2H43A 2Q7CA 1NHLA 2FYZA 1GDTA 2FKWB 1SQXK 3M9QA 4GIFA 5CCGD 2C0XA 1NTZK 1RF0C 3MTUE 4N6JA 2WSFH 2O1KA 1CI6B 4B86A 3U1AA 2E42A 3SWFA 2WTYA 3R2PA 2YKPA 1G2CB 3GHGA 4LLHA 1MUUA 1AFOA 1GK6A 3A5TA 3NFQA 1URQC 1LT9A 4XE5B 3RL0D 1GU4A 1YYCA 4EIJA 5AVQB 2NPSC 5APQA 5CJ0A 5KLVK 3P32A 1FJPA 1YTZI 1LGHB 1ZN5A 1N73C 1LTJA 2FFDC 3HE4A 1GTWA 3MUDA 1JY2P 2I1JA 4W80A 4WY4C 1JY3N 3T97A 2YO3A 2Z5IA 2WPRA 2N9BA 1JCDA 2KOGA 5AVXB 1MV8A 1GD2E 1E5WA 1NH4A 3HE5B 2KSJA 3WMM0 2OYHB 4OH8B 2XDJA 1L4AD 1HH0A 1L0LK 1FZCA 1MZ9A 1LTBC 4IFFA 1FOSF 3TK1A 3HTKA 3MIWA 1SFCA 1JMMA 2Z5HA 5CCHA 5AVZB 3RL0C 2PP6A 2POHA 2OYHA 4ZKPA 1N86A 4LGDE 1H88A 2H8PD 3A7OA 2YNYA 2WT7A 4GKGA 3M9HA 3KYQA 2N1TD 5AW3B 1T2KC 2PAJA 2M8RA 4EOTA 5AW4B 1KILB 2ZFCA 5APTA 4Y99B 1IO4A 2KYVA 2YMYA 3VMZA 1RE4A 4C46A 2H7HA 1GK4A 3OJAB 1VPCA 1NAFA 3A3YB 3H32B 3CL3D 4DOJA 2OARA 1CSBA 3NTNA 2W6AA 3HUSB 1ZR2A 4RESB 1N7SA 3B5NA 4AYCA 3RK3B 1FBMA 1X79B 2WSEH 5CJ4A 1T8ZA 2O01H 1URQD 2QM7A 1RF1A 2HPCA 1LTAC 5CHXA 3M0DA 1GL2A 4I2LC 3VMXA 5BVZA 3BRTB 3P7KA 5CMZA 1HGVA 2NPSD 3I5CA 2XU6A 5KTBA 1IFIA 1M7LA 4M3LA 1MFZA 1JUNA 3GHGB 2OYHC 3CLQA 1JY3O 2WITA 2FYUK 1GZLA 2C0WA 4WY4D 3V2RA 1AQ5A 1EQ7A 3P8CE 2YKQA 3KDPB 5KJ7C 1GW4A 2GUSA 1HWTC 1SVFA 5AVRB 3RK3D 1HTLC 4JYBA 2C9LY 5CCGA 3BRVB 1J1DB 1LTJB 1H89A 3HE4B 1FZFA 3BATA 4AQRD 1NO4A 3O8ZA 1KILC 2A45I 3B8EB 3U1CA 3MD0A 1LTGC 4Y99C 1IJDB 4C7NA 1LWUA 4IFDK 4WB4A 2FXMA 1JO5A 4AUWA 1JTHB 3P8MC 2WWWA 1DX7A 4I1LA 1FZCB 2A45H 3TNUA 4JF7A 1L0NK 3TSIA 1T2KD 4KHXA 2Z4EA 1NTKK 3L35A 1FZEA 3HUSC 3L4FA 5APUA 5AVSB 3VP8A 3HTKB 3A2AA 1LTTC 3U59A 1SFCB 1RE3A 2XZRA 4W7ZA 1X8YA 3RK3C 2CPBA 3M9BA 1NWQA 1CI6A 2WT7B 1GU5A 1NKNA 1M1JA 5APVA 2W6BA 5AW9B 2E43A 2P2UA 1SQBK 3VOPA 1ZV8A 3II6A 2GUVA 1J1EB 2OYIA 2XKMA 5APYA 3VP9A 4IFMA 3UIAA 1L4AA 1N7LA 2YKOA 1JY2N 3GHGC 1Z56A 1LTIC 1S9KD 4W7YA 2KLVA 3HD7A 1PFIA 3V2NA 3V2PA 3NXSA 1SLQA 2P67A 5AVVB 1T3JA 1N7SB 5AW2B 1SQVK 3B5NB 2BASA 1JCCA 2N1TA 2I1KA 3EFGA 2VRSA 1J1DC 1LTJC 2QM8A 3LIDA 1QL1A 1RF1B 2J59M 2HPCB 3CI9A 1GL2B 5KJ7D 3OA7A 3C9IA 5AW0B 3HRNA 2JEEA 3RK2B 3OAKA 1FZCC 3VMYA 1RF0A 5AVYB 1A02J 1G1JA 1SQQK 1KILD 1J2JB 1LTSC 5APWA 4WBAA 1SFCC 2YO2A 2IFNA 5CCHC 1FDMA 3VN0A 2XNXA 1GW3A 1A02F 1IFNA 1HUCA 1URQA 2IFMA 1RY3A 2HFED 2LKMA 3N7NA 3NMDA 3VYIA 1T3UA 1HBWA 3BASA 3M06A 2NPSA 3V5BA 1WRGA 3MGNA 4LC1A 2KB7P 1LT9B 1J1EC 1NTMK 4N78D 1N73A 3L36A 2WZ7A 4C7NB 4HYTB 1RE4C 1LWUB 2FFDA 1IC2A 2L5GB 2ZXEB 4ZKUA 4WY4A 5APSA 3TNUB 5AW6B 3V2QA 1IFJA 1IFDA 1NOHA 3H6PA 3IFMA 2C9NY 1X9VA 1KZUB 3G3ZA 2R32A 1SP4A 1JY2O 2P1JA 1N7SC 2MJZA 4JYCA 1IK9A 3KPEA 5APXA 3B5NC 5AVUB 1CW5A 3N4XA 2W27A 3BVHA 3E1IA 1M1JB 1S9KE 1YTZT 4DZOA 1RF1C 1JY3P 2IPPA 3M0DC 1GL2C 2OYIB 2HODA 1HGZA 2XV5A 1L4AB 4GT1A 3RK2C 1OWAA 1HJBA 3HD7B 3SWYA 1XTCC 3KQGA 2P7JA 3IR9A 3V4QA 1WT6A 3TYYA 1ZLLA 3L37A 2HG5D 4C7RA 1G2CA 2CPSA 2IX7C 2WPSA 3P8CD 3PP5A 1FOSE 4XA4A 4HH2A 3LIEA 5AVWB 2N1TB 1OXZA 5CCGC 2J58A 1ZR4A 2HLOA 1VDFA 1JTHA 1SFCD 4N3YB 1LT9C 2R5DA 5BU5A 5CCHD 1NKZB 2R3CA 3VTPC 1LWUC 3HD7D 1N2DC 3EQ2A 2GM4A 2JJLA 3M91A 4O9BA 1HVVA 5AW5B 1QL2A 3HE5A 2R5BA 1KFMA 1NU1K 1RE3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2N A;  3V2P A;  3V2R A;  1VDF A;  1MZ9 A;  1DEB A;  1FBM A;  3V2Q A; 
#chains in the Genus database with same CATH topology
 5KAF H;  1PPJ G;  3L75 J;  3VMA A;  1VQK P;  1KYO D;  2D2C C;  4HKZ H;  3H1L J;  1S4X A;  2W83 C;  1EXI A;  2IZ1 A;  2NZ2 A;  1FU1 A;  4H13 C;  5AVT B;  1DEB A;  5GTH H;  2Q5U A;  1N73 B;  1S1C X;  2FYU G;  1H8A A;  2BCC J;  3HD7 C;  1KIL A;  1PGO A;  1FAV A;  1GL2 D;  1EDJ A;  1XTG B;  3CWB E;  3H32 A;  4GOD A;  1FZA A;  3CCE P;  1YIT P;  1SQX D;  2A45 G;  2HOD B;  4BRY A;  4U3F J;  2Q7C A;  2QVA A;  1GDT A;  4GIF A;  2P58 A;  1NTZ K;  2WSF H;  2LR2 A;  3CCS P;  3SWF A;  1BGY J;  3BCC G;  2WTY A;  2OYO A;  2E5T A;  1ZME C;  4PD4 E;  1GK6 A;  2KS1 A;  2K1A A;  1URQ C;  1LT9 A;  4I7Z C;  4XE5 B;  3RL0 D;  5APQ A;  5CJ0 A;  1ZN5 A;  2FFD C;  3V6I A;  3MUD A;  1L0L D;  1JY2 P;  4R4L A;  3T97 A;  2Z5I A;  3CX5 I;  1S5L X;  1E5W A;  4IL6 X;  4UB6 H;  1Q82 Q;  4Z1M H;  4OH8 B;  1Q81 Q;  4ASW A;  3B71 A;  3L71 J;  3HTK A;  1NU1 G;  4ASV A;  4H44 C;  4EYY Q;  1PV3 A;  2PP6 A;  1U7M A;  3I55 P;  2OGU A;  2H8P D;  2YNY A;  1R8E A;  2OTL P;  2N1T D;  2M8R A;  1SQQ G;  1KIL B;  2QJK C;  1PP9 J;  4Y99 B;  2JR8 A;  3G6E P;  1GK4 A;  4H0L B;  3TDK A;  1VQ9 P;  3SFD C;  3A3Y B;  3H32 B;  4DOJ A;  2HR3 A;  2OAR A;  3NTN A;  5EFW B;  3EFF K;  1QVG O;  4PD4 H;  2Y0C A;  3E7K A;  3QWO C;  1YJW P;  1OX3 A;  4AYC A;  3CME P;  3AE1 C;  4BRY B;  3Q5P A;  2ZVN B;  2KUB A;  4KJM A;  1RQU A;  1GL2 A;  4I2L C;  2K9Y A;  3P7K A;  2NPS D;  2O3J A;  3I5C A;  2XU6 A;  1SQB J;  5DJT B;  3AE3 C;  1VQL P;  2QG4 A;  2C0W A;  4WY4 D;  2KS1 B;  3I56 P;  1AQ5 A;  1BE3 D;  3KDP B;  5KJ7 C;  2GUS A;  3ITK A;  1SVF A;  5AVR B;  2C9L Y;  4U3F E;  3G4S P;  2OTK E;  3T97 B;  1LTG C;  1IJD B;  1BGY E;  4DJG A;  4IFD K;  1JO5 A;  4AUW A;  1Y9B A;  2WWW A;  4TLF A;  1KB9 D;  3H1I J;  3TNU A;  4CPG A;  1L0N K;  2YIU B;  1FZE A;  3HUS C;  3VP8 A;  3HTK B;  2O01 J;  3U59 A;  1L0L G;  1RE3 A;  4W7Z A;  2RN0 A;  2E76 B;  2CPB A;  3M9B A;  4IOI H;  1NWQ A;  2IBZ D;  3AE7 C;  1NVO A;  3L73 D;  3II6 A;  3H1H D;  4JBZ A;  4IFM A;  1N7L A;  1Z56 A;  4W7Y A;  3L71 E;  1PFI A;  2AXT E;  3NXS A;  1PZQ A;  1EDI A;  1SQP G;  2N1T A;  1J1D C;  4PD4 I;  3CCL P;  3PH0 A;  3TF5 A;  2QA4 P;  1GL2 B;  2B89 A;  3OA7 A;  2E74 D;  3S4R A;  3OAK A;  1FZC C;  5KLV E;  3H25 A;  1Q2N A;  3IF4 A;  4WBA A;  2YO2 A;  1VF5 D;  2QJP B;  2IFN A;  1A02 F;  2LKM A;  2KI7 B;  2NPS A;  1J1E C;  1NTM K;  4L74 A;  1SQB E;  4HYT B;  1RE4 C;  4WWI A;  2JWD A;  1VQ6 P;  4WY4 A;  3TNU B;  2FBW C;  3L74 D;  1NAY A;  3V2Q A;  1IFD A;  2AXT H;  1SP4 A;  1KN7 A;  2P1J A;  1N7S C;  2ZAE B;  1NU1 J;  2W27 A;  3E1I A;  1KQF B;  1S9K E;  3RL0 g;  4DZO A;  1RF1 C;  4WVZ A;  3M0D C;  3CXH D;  1QX8 A;  3H1I E;  1HJB A;  3SWY A;  1XTC C;  3KQG A;  2P7J A;  1WT6 A;  1KV4 A;  2QJY B;  2HG5 D;  4L76 A;  1PPJ E;  4ZNC A;  2K3R A;  1GMJ A;  3P8C D;  2IBZ G;  3PP5 A;  4HH2 A;  3F5H A;  2N1T B;  3L73 G;  1S3J A;  3H1H G;  2J58 A;  2RH0 A;  1BCC J;  2KIK A;  1SFC D;  1KIL E;  5CCH D;  2FYU E;  3G71 P;  1LWU C;  3HD7 D;  1N2D C;  1S5L E;  2FY8 A;  2GM4 A;  4IL6 E;  2E75 D;  4PJ0 E;  4A7P A;  1SQX J;  1KC8 Q;  5KLI B;  4PV1 C;  3HE5 A;  2R5B A;  2PRR A;  1E79 H;  2ZT9 C;  1G1I A;  1LP1 A;  2A06 D;  1JNM A;  1EZV E;  4I6M C;  1M1J C;  3GMA A;  2NPS B;  2M3B A;  2OYI C;  1MKM A;  1N8R Q;  1L4A C;  2JKV A;  3M0A A;  1QGK B;  1VQ8 P;  4WY4 B;  5KAI E;  2WVR A;  1TU3 F;  3BCC E;  5AW8 B;  3E1R A;  1DH3 A;  2Q1K A;  2HYN A;  1IFM A;  1L0L J;  4JQ0 D;  1P84 E;  2O1J A;  2KP8 A;  3CCQ P;  2L91 A;  3EWK A;  3S9O A;  4L75 A;  1NHL A;  2FYZ A;  3TGU E;  3M9Q A;  5CCG D;  1K8A Q;  1RF0 C;  3WUT A;  4IL6 H;  2E42 A;  3R2P A;  4LLH A;  1MUU A;  4YXW H;  3Q5S A;  1NU1 E;  1U57 A;  4EIJ A;  5AVQ B;  1YJ9 P;  3LW5 J;  2KXP B;  5KLV K;  3P32 A;  4DT0 A;  1LGH B;  1N73 C;  1LTJ A;  1SQQ E;  5B66 E;  2I1J A;  5E79 H;  1KYO E;  1LNQ A;  1YIJ P;  3HE5 B;  3WMM 0;  2IYO A;  1LP1 B;  3CX5 H;  1MZ9 A;  4IFF A;  3AE2 C;  1SFC A;  2Z5H A;  5CCH A;  1KTM A;  2POH A;  2AEJ A;  1VQP P;  5TIS H;  2E74 B;  2WT7 A;  4GKG A;  3SSU A;  3FXD A;  2SPZ A;  1T2K C;  4EOT A;  4K35 A;  3WUV A;  2QEX P;  1R5S A;  1VF5 B;  5APT A;  1BE3 J;  1IO4 A;  2KYV A;  2A06 G;  4UB8 E;  1OZH A;  4C46 A;  1JEK A;  3CL3 D;  1BCC D;  3CPW O;  1KMI Z;  1S2E A;  1NTK J;  2W90 A;  2ZYG A;  1UIX A;  3AEA C;  3RK3 B;  1FBM A;  2WSE H;  3AEF C;  4RO0 A;  1T8Z A;  1JB0 J;  4D6T D;  1LTA C;  3BRT B;  4YXD C;  1M7L A;  2W6J H;  4M3L A;  1DD3 A;  3H1K D;  2UWJ E;  2FYU K;  1GZL A;  3JCU E;  4OGQ D;  3L73 J;  1OW7 A;  4JYB A;  3H1H J;  5CCG A;  1LTJ B;  1FZF A;  1L0N D;  1EZV I;  1AA0 A;  1K05 A;  1KIL C;  2A45 I;  4YTP C;  3A0H H;  4Y99 C;  3A0B E;  2FXM A;  4H0L C;  1JTH B;  4I1L A;  4KHX A;  3L35 A;  1SFC B;  1SQP E;  3S1K A;  3CCR P;  1X8Y A;  5L8R J;  2E75 B;  1CI6 A;  3K5B A;  2WT7 B;  1NKN A;  5APV A;  1ZV8 A;  1P84 I;  2FXO A;  2P10 A;  3UIA A;  1QVF O;  2KLV A;  2NRG A;  3KZI E;  3JC2 2;  1JM0 A;  1SLQ A;  2N9Y B;  4PD4 D;  2P67 A;  1T3J A;  1FDI A;  1SQV K;  2BAS A;  2ZXX A;  2VRS A;  3L70 D;  1BDD A;  1QEX A;  3L75 E;  3MUD C;  3LID A;  1BSN A;  3H1L E;  3L74 J;  5AW0 B;  3HRN A;  1AVY A;  2JEE A;  1BCC G;  1YHQ P;  3VMY A;  1A02 J;  2YIU C;  2QSI A;  1SQQ K;  1J2J B;  1KYO I;  5APW A;  2BCC E;  1NTM D;  3VN0 A;  1GW3 A;  2E76 C;  1SQX G;  2AEM A;  1HUC A;  1RY3 A;  2HFE D;  3VYI A;  1T3U A;  3Q5R A;  3BAS A;  1KB9 E;  3CCM P;  2KZI A;  1OVR A;  1WRG A;  4LC1 A;  2KB7 P;  1LT9 B;  3H1K G;  4N78 D;  3FX0 A;  2WZ7 A;  3CC7 P;  2L5G B;  2V7Q H;  1Q86 Q;  5AW6 B;  2R3S A;  3CC2 P;  2B87 A;  1NOH A;  3H6P A;  2IBZ E;  1NTK D;  1X9V A;  3MHV A;  1KZU B;  3G3Z A;  2R32 A;  3PRJ A;  1L0N G;  2MJZ A;  3L73 E;  4GOF A;  5GTI E;  3KPE A;  5APX A;  4BWN A;  1CW5 A;  1KOR A;  3BVH A;  2R44 A;  1YTZ T;  2MKV A;  1GL2 C;  3CD6 P;  4L73 A;  1NYH A;  2XV5 A;  3ABV C;  2GA1 A;  4PV1 D;  2QE7 H;  3TYY A;  2QJP C;  2IX7 C;  1FOS E;  4XA4 A;  2J5U A;  5AVW B;  1T6A A;  1OXZ A;  2Y9Z A;  1ZR4 A;  1VDF A;  1M57 D;  4N3Y B;  2R5D A;  2W8Z A;  4GDO A;  2R3C A;  3EQ2 A;  1U7J A;  4O9B A;  3SWK A;  3OW2 O;  3L70 G;  1NTZ J;  1AJY A;  1PP9 E;  1RE3 C;  2OYH A;  1FZG A;  2G8Y A;  1VQ7 P;  1JOC A;  3RK3 E;  2Q3E A;  1AV1 A;  1CZQ A;  1SQP K;  2JP3 A;  3B5N D;  1KFN A;  4OGQ B;  1NTM G;  2O01 N;  1W2E A;  5BU8 B;  2QJY C;  2B87 B;  5AW1 B;  1YBK A;  2WPQ A;  2DW3 A;  4YPC A;  3CXH E;  3RK2 D;  2N1T C;  1BE3 G;  4RKU J;  1USD A;  1EC5 A;  3RL0 B;  3AED C;  2FYN B;  2H43 A;  2FKW B;  1NTK G;  4RJT A;  2C0X A;  1S72 P;  4B86 A;  1VQ5 P;  4EI2 A;  5KLI C;  3U1A A;  3FGA D;  3GLM A;  2M5A A;  5KLV D;  3GHG A;  1H0T A;  1AFO A;  2RKL A;  1M8O B;  1GU4 A;  2NPS C;  1OMI A;  1FJP A;  2M0B A;  1AQT A;  2D2C D;  3CCV P;  4W80 A;  4WY4 C;  1W2B O;  1JY3 N;  4JPZ B;  2YO3 A;  2A06 E;  2QIW A;  2N9B A;  1KB9 I;  5AVX B;  1MV8 A;  3AE9 C;  4H13 D;  5M1B A;  2KSJ A;  3RBZ A;  2OYH B;  2XDJ A;  2Q6Q A;  3O6Q A;  2WPV B;  3MIW A;  1JMM A;  2QRX A;  4D6T J;  2WSF J;  5H2F E;  2IBZ I;  1NGM B;  4ZKP A;  1N86 A;  1KQS O;  1PIX A;  3M9H A;  3KYQ A;  5AW3 B;  2PAJ A;  5AW4 B;  3H1K J;  2ZFC A;  2YMY A;  3VMZ A;  1NAF A;  3FXE A;  1CSB A;  2W6A A;  1L2P A;  1IK7 A;  1L0N J;  3B4S A;  3B5N A;  2Y9Y A;  3ZDM A;  3AE4 C;  2FYU D;  1URQ D;  2O01 H;  3AE8 C;  2HPC A;  1YQ3 C;  5BVZ A;  4H0L D;  3IN6 A;  1NTZ D;  5KTB A;  1IFI A;  1MFZ A;  2M5A B;  3GHG B;  1H0T B;  1JY3 O;  3L74 G;  1GW4 A;  1EZV D;  3FWN A;  4BXL A;  1HWT C;  1S5L H;  3MP7 B;  1ZRT D;  3AEE C;  2E74 C;  3BRV B;  4PJ0 H;  1AVO A;  2H89 C;  5H2F H;  5KAF E;  3FWL A;  5KKZ B;  3BAT A;  4HB1 A;  2KZJ A;  5KLV G;  1EXJ A;  3O8Z A;  4H44 D;  1VF5 C;  3BCC D;  3P8M C;  2CK3 H;  5GTH E;  3CX5 D;  2A45 H;  3L72 D;  2JDI H;  3O6Q B;  3TSI A;  2Z4E A;  5APU A;  3L70 J;  5AVS B;  1K9M Q;  3A2A A;  2XZR A;  5KAI H;  3RK3 C;  3CXH I;  1IFP A;  2W6B A;  2P2U A;  1SQB K;  3TGU D;  2GUV A;  3JSV C;  5APY A;  1BCC E;  3VP9 A;  2YKO A;  5CBO A;  1JY2 N;  1SQV D;  1NTM J;  1OW6 A;  3AE6 C;  3HD7 A;  1P84 H;  3H1J D;  5DJU B;  1VQO P;  1DD4 A;  4KT0 J;  5AVV B;  1SQX E;  3PLN A;  3B5N B;  1JCC A;  3D6Z A;  3Q3D A;  3EFG A;  4NPD A;  1LTJ C;  2QM8 A;  1QL1 A;  2J59 M;  2HPC B;  3CI9 A;  1SQQ D;  5KJ7 D;  3C9I A;  1KQG B;  1ZOY C;  3RK2 B;  1ZW0 A;  2I8D A;  4OWF A;  3Q2Y A;  5CBN A;  5AVY B;  1G1J A;  1X22 A;  1L0N E;  1LTS C;  1SFC C;  5CCH C;  5B66 H;  2XNX A;  4UB6 E;  1URQ A;  3N7N A;  1KYO H;  2E75 C;  3G9R A;  1NJI Q;  3NMD A;  1NTZ G;  1HBW A;  1WMK A;  3V5B A;  1L0L E;  2RMZ A;  3L36 A;  2FFD A;  1IC2 A;  2ZXE B;  5APS A;  1EZV G;  2JO1 A;  3W68 A;  4R4M A;  1IFJ A;  3IFM A;  1JY2 O;  2AXC A;  1VL2 A;  3CCJ P;  5AVU B;  2D2C B;  3N4X A;  2WMM A;  4UB8 H;  2IPP A;  4H13 B;  3CWB D;  3L72 G;  2KNC A;  1HGZ A;  3D70 A;  3HD7 B;  3V4Q A;  3L70 E;  5B5E E;  1ZLL A;  4C7R A;  3W67 A;  1G2C A;  2CPS A;  2H88 C;  2WPS A;  2OTJ P;  3LIE A;  3TGU G;  1USE A;  5CCG C;  2IZ0 A;  1K04 A;  1Y47 A;  1SQV G;  1LT9 C;  3H1J G;  3VTP C;  3D71 A;  3JCU H;  1NTM E;  2JJL A;  3M91 A;  1RH5 B;  3D6Y A;  1QL2 A;  3KHU A;  1KFM A;  2E5Y A;  1NU1 K;  1BE3 E;  4N78 E;  1SQP D;  1Q90 D;  1PGQ A;  1OFC X;  1URQ B;  1JMB A;  4I7Z B;  5KJ7 A;  3KXD A;  3A0B H;  2KK7 A;  3V4W A;  1N7S D;  1HF9 A;  1NTK E;  2FFD B;  5KLV J;  3RGU A;  3QH9 A;  3AEB C;  4D6T G;  1BSH A;  3LW5 H;  2WSC H;  1YI2 P;  1FJK A;  2Q3I A;  1FZB A;  1Q7Y Q;  1LT1 A;  5B5E H;  2K88 A;  1KQL A;  3HUS A;  5AW7 B;  1K73 Q;  1FE6 A;  2XND H;  3GG2 A;  4H44 B;  2Q9I A;  3L75 D;  2KNC B;  1OW8 A;  1W5C E;  3H1L D;  3KZI H;  1SQX K;  3H1H E;  3MZW B;  2QJK B;  4N6J A;  3MTU E;  2O1K A;  1CI6 B;  3R4Y A;  2YKP A;  5C39 A;  1G2C B;  1YJN P;  2BCC D;  2OQQ A;  1ZXG A;  3CWB G;  3NFQ A;  3A5T A;  3USS A;  3CCU P;  1YYC A;  3PTZ A;  1M90 Q;  4U7J A;  4MN4 C;  2ZT9 D;  1YTZ I;  2KLU A;  3HE4 A;  1GTW A;  4OGQ C;  2G3A A;  3C1L A;  2WPR A;  1JCD A;  2KOG A;  3IAO A;  1GD2 E;  1NH4 A;  4U3F D;  1IZN B;  2Y0E A;  1L4A D;  1HH0 A;  1L0L K;  1FZC A;  1KB9 H;  1LTB C;  1FOS F;  3SFE C;  3TK1 A;  2K9J A;  1BGY D;  2FYU J;  5AVZ B;  3RL0 C;  2JWA A;  2FYN C;  4LGD E;  1H88 A;  3A7O A;  4NPF X;  3C8V A;  1VQN P;  5GTI H;  1RE4 A;  2H7H A;  3L74 E;  2B9B A;  3OJA B;  1VPC A;  1RHZ B;  3HUS B;  4DCK A;  1ZR2 A;  4RES B;  1N7S A;  3L71 D;  1X79 B;  3BCC J;  5CJ4 A;  3WU2 E;  2QM7 A;  1RF1 A;  3L72 J;  5CHX A;  3M0D A;  2ZYD A;  3VMX A;  5CMZ A;  1HGV A;  2V4H A;  1JUN A;  2B88 A;  2OYH C;  3CLQ A;  1HJ0 A;  2WIT A;  2KSE A;  5TJH A;  1R5L A;  3L75 G;  1PP9 D;  3V2R A;  1EQ7 A;  1SS1 A;  2FXP A;  3P8C E;  2YKQ A;  3H1L G;  3RK3 D;  3TGU J;  1HTL C;  3AE5 C;  2AEF A;  1UII A;  2ZVO B;  1J1D B;  1H89 A;  3HE4 B;  1SQV J;  4AQR D;  1NO4 A;  3H1J J;  1QLE D;  2BCC G;  3B8E B;  3U1C A;  1EDK A;  3MD0 A;  4C7N A;  1LWU A;  4WB4 A;  1DX7 A;  1FZC B;  2YMK A;  4JF7 A;  3GW6 A;  1T2K D;  1NTK K;  2WSE J;  3L4F A;  2K9J B;  3F89 A;  1LTT C;  1SQB D;  1OVV A;  1SQQ J;  1OVU A;  3GF3 A;  4XFJ A;  1GU5 A;  1FDO A;  1M1J A;  4U3F G;  5AW9 B;  2E43 A;  3VOP A;  1M56 D;  1J1E B;  3CXH H;  2OYI A;  2XKM A;  1RQV A;  3WU2 H;  1L4A A;  3GHG C;  1BGY G;  1EDL A;  1FC2 C;  1LTI C;  4OVN F;  1S9K D;  3AEC C;  2YXQ B;  3V2N A;  3V2P A;  2BEQ D;  2ITA A;  1FS0 E;  1D7M A;  1N7S B;  2ZYA A;  4QMA A;  3H1I D;  5AW2 B;  2IYP A;  1NTZ E;  2I1K A;  1VQ4 P;  5KKZ C;  1PPJ D;  1PL5 A;  2IDB A;  1RF1 B;  2WQY C;  5K5G B;  1PGJ A;  2K37 A;  2PGD A;  1KD1 Q;  1ZRT E;  4GOE A;  1RF0 A;  3WUU A;  1Y8A A;  3L71 G;  1KIL D;  5E79 E;  3CMA P;  1FDM A;  3CWB J;  3PHL A;  1IFN A;  2IFM A;  3CX5 E;  3L72 E;  3M06 A;  3MGN A;  1PGP A;  1N73 A;  1PP9 G;  4C7N B;  1LWU B;  4ZKU A;  5TIS E;  4PV1 B;  2C9N Y;  2Y0D A;  2ZJS E;  2ZT9 B;  4ZMD A;  4JYC A;  1IK9 A;  3B5N C;  4Y28 J;  1SQV E;  1M1J B;  1X0T A;  1JY3 P;  3H1J E;  2OYI B;  2HOD A;  2LXC B;  3CC4 P;  1L4A B;  2YXR B;  4GT1 A;  3RBX A;  3RK2 C;  1SQB G;  1ZP0 C;  1P84 D;  1OIP A;  1OWA A;  4TT3 H;  3IR9 A;  1SQP J;  2WSC J;  2M3E A;  3L37 A;  2LXB A;  4EDF A;  2WSS H;  3PJS K;  2BEZ F;  3Q1M A;  1YQ4 C;  2PFX A;  2V7Q J;  1BDC A;  2HLO A;  1DEE G;  4K3A A;  1JTH A;  4NPE A;  1M1K Q;  5BU5 A;  3GF7 A;  1NKZ B;  1NU1 D;  4D6T E;  2E76 D;  4HJG H;  1DIP A;  1HVV A;  3H1I G;  5AW5 B;  1LJ2 A;  3AEG C;  3H1K E;  1VQM P;  3A0H E;  1MFT A; 
#chains in the Genus database with same CATH homology
 1FZG A;  1G1I A;  4N78 E;  1JOC A;  1JNM A;  4I6M C;  1URQ B;  1M1J C;  5KJ7 A;  3V4W A;  2NPS B;  1FU1 A;  5AVT B;  1DEB A;  2M3B A;  2OYI C;  1N7S D;  2Q5U A;  1N73 B;  1CZQ A;  2FFD B;  1L4A C;  1SQP K;  3M0A A;  3B5N D;  1KFN A;  1H8A A;  4WY4 B;  3HD7 C;  1KIL A;  1W2E A;  3LW5 H;  5BU8 B;  2WSC H;  1FAV A;  5AW1 B;  1GL2 D;  5AW8 B;  2WPQ A;  1FJK A;  1DH3 A;  1XTG B;  2Q3I A;  1FZB A;  3H32 A;  1FZA A;  3RK2 D;  1KQL A;  2HYN A;  2N1T C;  3HUS A;  1IFM A;  5AW7 B;  2O1J A;  2KP8 A;  3RL0 B;  2Q9I A;  2A45 G;  2HOD B;  2H43 A;  2Q7C A;  1NHL A;  2FYZ A;  1GDT A;  2FKW B;  1SQX K;  3M9Q A;  4GIF A;  5CCG D;  2C0X A;  1NTZ K;  1RF0 C;  3MTU E;  4N6J A;  2WSF H;  2O1K A;  1CI6 B;  4B86 A;  3U1A A;  2E42 A;  3SWF A;  2WTY A;  3R2P A;  2YKP A;  1G2C B;  3GHG A;  4LLH A;  1MUU A;  1AFO A;  1GK6 A;  3A5T A;  3NFQ A;  1URQ C;  1LT9 A;  4XE5 B;  3RL0 D;  1GU4 A;  1YYC A;  4EIJ A;  5AVQ B;  2NPS C;  5APQ A;  5CJ0 A;  5KLV K;  3P32 A;  1FJP A;  1YTZ I;  1LGH B;  1ZN5 A;  1N73 C;  1LTJ A;  2FFD C;  3HE4 A;  1GTW A;  3MUD A;  1JY2 P;  2I1J A;  4W80 A;  4WY4 C;  1JY3 N;  3T97 A;  2YO3 A;  2Z5I A;  2WPR A;  2N9B A;  1JCD A;  2KOG A;  5AVX B;  1MV8 A;  1GD2 E;  1E5W A;  1NH4 A;  3HE5 B;  2KSJ A;  3WMM 0;  2OYH B;  4OH8 B;  2XDJ A;  1L4A D;  1HH0 A;  1L0L K;  1FZC A;  1MZ9 A;  1LTB C;  4IFF A;  1FOS F;  3TK1 A;  3HTK A;  3MIW A;  1SFC A;  1JMM A;  2Z5H A;  5CCH A;  5AVZ B;  3RL0 C;  2PP6 A;  2POH A;  2OYH A;  4ZKP A;  1N86 A;  4LGD E;  1H88 A;  2H8P D;  3A7O A;  2YNY A;  2WT7 A;  4GKG A;  3M9H A;  3KYQ A;  2N1T D;  5AW3 B;  1T2K C;  2PAJ A;  2M8R A;  4EOT A;  5AW4 B;  1KIL B;  2ZFC A;  5APT A;  4Y99 B;  1IO4 A;  2KYV A;  2YMY A;  3VMZ A;  1RE4 A;  4C46 A;  2H7H A;  1GK4 A;  3OJA B;  1VPC A;  1NAF A;  3A3Y B;  3H32 B;  3CL3 D;  4DOJ A;  2OAR A;  1CSB A;  3NTN A;  2W6A A;  3HUS B;  1ZR2 A;  4RES B;  1N7S A;  3B5N A;  4AYC A;  3RK3 B;  1FBM A;  1X79 B;  2WSE H;  5CJ4 A;  1T8Z A;  2O01 H;  1URQ D;  2QM7 A;  1RF1 A;  2HPC A;  1LTA C;  5CHX A;  3M0D A;  1GL2 A;  4I2L C;  3VMX A;  5BVZ A;  3BRT B;  3P7K A;  5CMZ A;  1HGV A;  2NPS D;  3I5C A;  2XU6 A;  5KTB A;  1IFI A;  1M7L A;  4M3L A;  1MFZ A;  1JUN A;  3GHG B;  2OYH C;  3CLQ A;  1JY3 O;  2WIT A;  2FYU K;  1GZL A;  2C0W A;  4WY4 D;  3V2R A;  1AQ5 A;  1EQ7 A;  3P8C E;  2YKQ A;  3KDP B;  5KJ7 C;  1GW4 A;  2GUS A;  1HWT C;  1SVF A;  5AVR B;  3RK3 D;  1HTL C;  4JYB A;  2C9L Y;  5CCG A;  3BRV B;  1J1D B;  1LTJ B;  1H89 A;  3HE4 B;  1FZF A;  3BAT A;  4AQR D;  1NO4 A;  3O8Z A;  1KIL C;  2A45 I;  3B8E B;  3U1C A;  3MD0 A;  1LTG C;  4Y99 C;  1IJD B;  4C7N A;  1LWU A;  4IFD K;  4WB4 A;  2FXM A;  1JO5 A;  4AUW A;  1JTH B;  3P8M C;  2WWW A;  1DX7 A;  4I1L A;  1FZC B;  2A45 H;  3TNU A;  4JF7 A;  1L0N K;  3TSI A;  1T2K D;  4KHX A;  2Z4E A;  1NTK K;  3L35 A;  1FZE A;  3HUS C;  3L4F A;  5APU A;  5AVS B;  3VP8 A;  3HTK B;  3A2A A;  1LTT C;  3U59 A;  1SFC B;  1RE3 A;  2XZR A;  4W7Z A;  1X8Y A;  3RK3 C;  2CPB A;  3M9B A;  1NWQ A;  1CI6 A;  2WT7 B;  1GU5 A;  1NKN A;  1M1J A;  5APV A;  2W6B A;  5AW9 B;  2E43 A;  2P2U A;  1SQB K;  3VOP A;  1ZV8 A;  3II6 A;  2GUV A;  1J1E B;  2OYI A;  2XKM A;  5APY A;  3VP9 A;  4IFM A;  3UIA A;  1L4A A;  1N7L A;  2YKO A;  1JY2 N;  3GHG C;  1Z56 A;  1LTI C;  1S9K D;  4W7Y A;  2KLV A;  3HD7 A;  1PFI A;  3V2N A;  3V2P A;  3NXS A;  1SLQ A;  2P67 A;  5AVV B;  1T3J A;  1N7S B;  5AW2 B;  1SQV K;  3B5N B;  2BAS A;  1JCC A;  2N1T A;  2I1K A;  3EFG A;  2VRS A;  1J1D C;  1LTJ C;  2QM8 A;  3LID A;  1QL1 A;  1RF1 B;  2J59 M;  2HPC B;  3CI9 A;  1GL2 B;  5KJ7 D;  3OA7 A;  3C9I A;  5AW0 B;  3HRN A;  2JEE A;  3RK2 B;  3OAK A;  1FZC C;  3VMY A;  1RF0 A;  5AVY B;  1A02 J;  1G1J A;  1SQQ K;  1KIL D;  1J2J B;  1LTS C;  5APW A;  4WBA A;  1SFC C;  2YO2 A;  2IFN A;  5CCH C;  1FDM A;  3VN0 A;  2XNX A;  1GW3 A;  1A02 F;  1IFN A;  1HUC A;  1URQ A;  2IFM A;  1RY3 A;  2HFE D;  2LKM A;  3N7N A;  3NMD A;  3VYI A;  1T3U A;  1HBW A;  3BAS A;  3M06 A;  2NPS A;  3V5B A;  1WRG A;  3MGN A;  4LC1 A;  2KB7 P;  1LT9 B;  1J1E C;  1NTM K;  4N78 D;  1N73 A;  3L36 A;  2WZ7 A;  4C7N B;  4HYT B;  1RE4 C;  1LWU B;  2FFD A;  1IC2 A;  2L5G B;  2ZXE B;  4ZKU A;  4WY4 A;  5APS A;  3TNU B;  5AW6 B;  3V2Q A;  1IFJ A;  1IFD A;  1NOH A;  3H6P A;  3IFM A;  2C9N Y;  1X9V A;  1KZU B;  3G3Z A;  2R32 A;  1SP4 A;  1JY2 O;  2P1J A;  1N7S C;  2MJZ A;  4JYC A;  1IK9 A;  3KPE A;  5APX A;  3B5N C;  5AVU B;  1CW5 A;  3N4X A;  2W27 A;  3BVH A;  3E1I A;  1M1J B;  1S9K E;  1YTZ T;  4DZO A;  1RF1 C;  1JY3 P;  2IPP A;  3M0D C;  1GL2 C;  2OYI B;  2HOD A;  1HGZ A;  2XV5 A;  1L4A B;  4GT1 A;  3RK2 C;  1OWA A;  1HJB A;  3HD7 B;  3SWY A;  1XTC C;  3KQG A;  2P7J A;  3IR9 A;  3V4Q A;  1WT6 A;  3TYY A;  1ZLL A;  3L37 A;  2HG5 D;  4C7R A;  1G2C A;  2CPS A;  2IX7 C;  2WPS A;  3P8C D;  3PP5 A;  1FOS E;  4XA4 A;  4HH2 A;  3LIE A;  5AVW B;  2N1T B;  1OXZ A;  5CCG C;  2J58 A;  1ZR4 A;  2HLO A;  1VDF A;  1JTH A;  1SFC D;  4N3Y B;  1LT9 C;  2R5D A;  5BU5 A;  5CCH D;  1NKZ B;  2R3C A;  3VTP C;  1LWU C;  3HD7 D;  1N2D C;  3EQ2 A;  2GM4 A;  2JJL A;  3M91 A;  4O9B A;  1HVV A;  5AW5 B;  1QL2 A;  3HE5 A;  2R5B A;  1KFM A;  1NU1 K;  1RE3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...