3V2PA

Compcc in complex with fatty acids
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
45
structure length
45
Chain Sequence
MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Cartilage Oligomerization matrix protein (coiled-coil domain
publication title The pentameric channel of COMPcc in complex with different fatty acids.
pubmed doi rcsb
source organism Mus musculus
total genus 19
structure length 45
sequence length 45
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3v2pA00
3V2QA 1VDFA 3V2NA 1MZ9A 1FBMA 3V2RA 3V2PA 1DEBA
chains in the Genus database with same CATH superfamily
1FZEA 1JCDA 5TISH 2PGDA 3H1HJ 1NU1J 2Z5HA 3S1KA 3AE8C 1BDDA 4I6MC 1FZBA 1N73B 1QEXA 2QM8A 1LNQA 3HRNA 5CHXA 2E5TA 5M1BA 3AEDC 4HKZH 3H1LE 1W2BO 2P67A 1SQBJ 5APTA 1Q7YQ 2MKVA 3AE4C 3L75D 1VQ4P 5CCGA 3MP7B 3AE1C 1NTZE 1VPCA 5KLVG 1T2KC 4OGQB 3H32B 1ZR4A 2M0BA 4WY4A 2KP8A 3G6EP 1OX3A 4GOEA 4H0LD 1R5LA 3E1RA 1BGYD 3HE5B 5DJUB 3B8EB 1SFCB 3AEGC 4U3FG 1LWUB 2KUBA 1JY3O 4O9BA 3R2PA 1P84E 3FGAD 4EDFA 3VP9A 1G1IA 1VQLP 2YIUB 2QJPB 3NTNA 1OXZA 3GF7A 1VQKP 3C1LA 2J59M 3AE2C 2FYUD 1N7SC 4I2LC 1RY3A 1QLED 2K37A 2WWWA 4RO0A 3WU2E 4C7NB 1FOSE 4H13B 3TNUB 2PP6A 2IZ0A 2E76B 3HD7C 3RK3D 3K5BA 3RBZA 3A0HH 1EZVI 2YKQA 2H89C 3I55P 1PGOA 4C46A 3AE5C 4GIFA 1LGHB 1UIIA 3H1KG 4WY4B 3BRTB 1LP1B 4PJ0H 1WRGA 3D6ZA 2N1TD 5KLIB 1FJKA 5KJ7C 2FFDA 3FXEA 3KPEA 1OVRA 1YJ9P 2BCCD 3CCUP 4H44B 2IX7C 5CJ0A 5KLVE 1OMIA 1JOCA 2B9BA 3T97A 3BASA 1AVYA 1JY2N 3U1AA 1KQFB 1X79B 1J1EC 4D6TJ 4OVNF 3RGUA 2LXBA 3MUDC 1Q82Q 3LW5H 3V5BA 3E7KA 1L0LD 3G9RA 1S5LH 1HF9A 1YTZI 1S3JA 2KK7A 2V4HA 3OA7A 3HE4B 5KAFE 4RJTA 3CXHH 3HTKA 2K3RA 3SWKA 1L0ND 1KYOE 3M9BA 1IK7A 3CCEP 3AE9C 5AW0B 3D71A 3CPWO 4H0LC 3CXHD 2IDBA 3H1JD 1CZQA 4RESB 2BEQD 1S9KE 3L70D 3CCLP 2IZ1A 3E1IA 3M0DA 3L71G 3KZIH 2ZYAA 1VF5B 4TT3H 4KT0J 3G4SP 3SFEC 3A5TA 1NOHA 2AXTE 3H1HD 1NU1D 1FDOA 2N1TA 3L74J 1CI6B 1DEEG 2WT7A 2OTLP 2B88A 1E79H 4XA4A 1SQPG 1HBWA 2RMZA 1LTAC 3OAKA 1OWAA 2QVAA 2VRSA 4BRYA 1VQ6P 1JY3P 3RK3C 2BASA 1SQBD 2JKVA 3NFQA 1RF1B 2WMMA 1MUUA 3U59A 2E43A 2E74C 3Q5RA 1QGKB 3AECC 1K8AQ 2KS1B 1RE3C 3GHGC 1GD2E 4ZKPA 3H1IG 1R8EA 2HR3A 1YQ3C 3GLMA 2FYUK 1LT9C 5KKZB 4W7YA 2JWAA 3CWBG 4WWIA 2KYVA 1SVFA 2QM7A 2K9JB 2J5UA 5APVA 3L75J 2DW3A 1GW3A 4ZKUA 2E75B 5APYA 2P10A 1ZW0A 2H88C 2H8PD 5APXA 3W67A 2NPSC 1ZV8A 3L71E 1GL2C 3A7OA 1QL2A 4PD4E 1EDLA 1LT1A 3OW2O 4BRYB 1TU3F 2OYOA 1EXJA 2CPSA 3O6QA 5AVTB 2IBZD 3KQGA 3JCUH 1JY2P 1PL5A 3USSA 4BWNA 1R5SA 2AEFA 4LC1A 1AV1A 3QH9A 3CCSP 1RH5B 1HTLC 2Q7CA 1KILE 2KZJA 3AE7C 1SQVG 2PFXA 3CC7P 1OVVA 2CK3H 1L0LK 4A7PA 3V2NA 3AE3C 1LTJB 5B5EH 2WTYA 1L4AC 2YO2A 1RQUA 3TDKA 3CI9A 3L72E 1AQTA 2NRGA 2D2CC 4U3FJ 1EZVD 3H1IE 1L0NK 4B86A 2Y9YA 4KJMA 4PV1B 3A0BE 1HJBA 1T2KD 2P58A 3CWBE 1ZMEC 1PPJG 5E79H 3CMEP 1T8ZA 1G2CB 3TGUG 1S72P 2A06G 2Q3IA 3IN6A 2KNCA 1NTKD 1BCCG 1H88A 3O6QB 2QJKB 3L73J 2GM4A 1NKNA 2OTKE 3H1LG 1MZ9A 1M1JA 1N8RQ 2FY8A 4DJGA 2IPPA 5GTIE 2RKLA 2P2UA 1VQMP 5AVVB 1NU1K 3RK2B 1L0LJ 1NTZG 4IL6X 3RL0D 2YXQB 1UIXA 4IOIH 5CJ4A 1H89A 1NAFA 3H1KJ 1N7SD 1FS0E 2JWDA 1AVOA 1SQBK 2OYHC 3HD7D 1SQVE 1VQOP 3O8ZA 5C39A 1Q90D 2B87B 2KXPB 1KILB 2QG4A 4GODA 2O1JA 4GT1A 1FOSF 2OQQA 5AVXB 4IL6E 1VDFA 2W8ZA 2M8RA 3VTPC 1ZRTE 1DD4A 1URQC 5KJ7D 3B5NB 3M0AA 1FAVA 3IF4A 1KN7A 2HFED 1YITP 2HODB 2YO3A 3CX5H 4Y99C 1GDTA 2P7JA 4DT0A 3W68A 4HJGH 4MN4C 1PPJE 1Z56A 3TGUE 4IFMA 2L91A 4U7JA 2XZRA 1X22A 2Q5UA 2A06E 5AVWB 2QRXA 1BCCE 3FX0A 5EFWB 3JSVC 3CX5D 1SQXG 4JYCA 2C9NY 3P7KA 3CMAP 1W2EA 4EOTA 3ZDMA 4OGQC 2HPCB 3V4QA 3A2AA 1M1KQ 3L71J 1Q2NA 2O01J 1JM0A 2P1JA 1SFCC 1X9VA 5AVYB 4L74A 1LWUC 1N7SA 2WPSA 1RF0C 3VMYA 1OZHA 1PP9G 2WSEJ 4WB4A 2V7QJ 2ITAA 3Q3DA 2A45I 3MHVA 1SQPJ 3HD7A 4ZMDA 4ASWA 4W80A 2YIUC 2QJPC 2IBZI 5AW1B 1JY3N 1PZQA 3TSIA 1KORA 4LGDE 1JMMA 1S2EA 2I1JA 1NKZB 1K04A 1KB9H 2Y0EA 3SWFA 1MV8A 3IAOA 1NHLA 3RL0C 5TISE 4K35A 1FZAA 2RH0A 2XNDH 5KJ7A 1DX7A 2E76C 2WPVB 1NTMJ 3BCCG 5CBNA 1FE6A 1KB9D 1U57A 2I8DA 4HB1A 3PJSK 1OW7A 3VMZA 2BCCG 1NTKK 1QX8A 3S4RA 5TJHA 3KXDA 5APWA 2ZFCA 1BE3J 5KLIC 4BXLA 3Q1MA 4U3FD 3MTUE 3MUDA 3EFGA 1SQXE 1BGYE 2E74D 1A02F 2WQYC 3P32A 4H44C 5KAIH 2Y0CA 3S9OA 2ZVNB 4NPEA 3N4XA 1FDMA 5GTHH 2ZT9B 1KYOD 2QJYB 2LR2A 1SQQG 1PGPA 3L73D 2ZVOB 3GW6A 4L73A 2FYZA 1IFNA 1PP9E 2FYUE 3BVHA 2K9YA 1S9KD 1FDIA 1H0TA 3CD6P 3CCQP 3P8CD 2NPSD 4UB6H 1NTKJ 1GL2D 2KB7P 3L70G 1LTGC 3H1KD 1QL1A 3MD0A 1SQVJ 4N6JA 5APUA 1WT6A 2PAJA 1VL2A 1T3UA 3AE6C 2C9LY 3V2QA 1VQ7P 3H1HG 1YI2P 4RKUJ 5L8RJ 1NAYA 3KHUA 3BCCE 2QA4P 1PIXA 3A0HE 2JR8A 2M5AA 1KV4A 2ZXEB 2FFDB 1J1DC 2BCCE 1QVGO 1AA0A 3PLNA 1S5LX 4PJ0E 4YPCA 4R4MA 5AW9B 3T97B 1L4AD 2MJZA 2WSFJ 2AXCA 3U1CA 1Q81Q 1Y9BA 4H0LB 1MKMA 3H1LJ 1VQ5P 1RE3A 3GHGA 2D2CD 2ZXXA 2QE7H 2FXPA 2L5GB 1LT9A 1SQQE 3CX5I 4AQRD 1M8OB 1RF1C 3KDPB 1JUNA 2O01H 1P84I 1S5LE 3HTKB 1L0NE 1NTZJ 2HG5D 1Q86Q 2K1AA 2JO1A 1MFZA 3F5HA 2WSEH 1HWTC 4C7RA 4JYBA 3CXHE 2V7QH 2ZAEB 3L71D 3H1JE 3L72G 1NO4A 4PD4D 1Y47A 5KKZC 1FZFA 2NPSA 5AW5B 1GL2A 3L36A 3L70E 1FZCA 2FXMA 2OTJP 1DIPA 1L2PA 1KTMA 3B4SA 1LTBC 4N3YB 1IC2A 1OIPA 3RK3B 1YJWP 5APQA 5KLVK 2E75C 1SQPD 3H1HE 1NU1E 2KI7B 3PRJA 3Q2YA 3KZIE 2Z5IA 2N1TB 2A45H 2AEMA 1FJPA 2G3AA 2WT7B 2IYOA 2PRRA 4I7ZC 2OYIA 2W6JH 5KTBA 5CCHC 2YMYA 1FZCC 1SS1A 1IFJA 1NTMD 2FXOA 1SQBE 1IK9A 1HUCA 2IFMA 1L4AA 1EDKA 1KB9I 1N86A 1SP4A 2G8YA 2R3CA 4JPZB 3H1ID 5AVZB 1N7LA 1URQD 1YQ4C 3L35A 1G1JA 2J58A 3AEEC 1GMJA 1EZVG 2Q3EA 1BE3D 1IZNB 3IFMA 1JEKA 1U7JA 1LTJC 2OYIC 4D6TG 4Z1MH 5KLVJ 2KLVA 3FWNA 1LTSC 1KYOI 4K3AA 3N7NA 5B66H 1LJ2A 2K88A 1KQGB 4PV1C 1K9MQ 1NH4A 2O3JA 4OGQD 3HUSA 1MFTA 1WMKA 1JTHA 1FC2C 2R44A 4LLHA 2Q1KA 1NGMB 1W5CE 2OARA 5AW4B 1LTIC 1SFCD 3TYYA 3RL0g 1FU1A 1KC8Q 2IBZE 1L4AB 1GK4A 3G71P 1CSBA 1SQVD 4UB8H 3GG2A 2OYHA 4HYTB 1PV3A 1IFPA 4EI2A 4DZOA 3JCUE 3HUSC 4N78D 1HH0A 3H25A 2W90A 3L74G 1VQ9P 2FYNC 4NPDA 1ZRTD 2B89A 2ZYGA 1KQSO 4H13D 1URQA 2HYNA 2HLOA 2E76D 1YIJP 5BVZA 1EZVE 1N73A 1KILC 1PPJD 3CCMP 1IO4A 5B5EE 2R32A 1PFIA 4WY4D 1S1CX 1NJIQ 4D6TE 3VN0A 1J2JB 1S4XA 1A02J 3H1LD 1PGJA 1NWQA 3B5NC 3D6YA 1KMIZ 2Q6QA 1AJYA 3CCJP 1VQ8P 3B71A 2KNCB 4H44D 2LXCB 5E79E 2W6BA 2I1KA 1M1JB 2WVRA 1NTZD 1ZP0C 2OYHB 1RE4C 1N73C 1SQPK 3L75G 1EQ7A 1P84H 2YMKA 4OWFA 1SFCA 2Y0DA 4PD4I 1K73Q 1LWUA 1RF0A 1OW8A 3FXDA 1GK6A 2XDJA 5H2FE 1OVUA 1BGYG 1URQB 1BDCA 3BATA 3L37A 1P84D 1NTMK 3WU2H 2H43A 4Y99B 5APSA 3GF3A 5AW2B 4YTPC 1JB0J 1NYHA 3ABVC 3P8MC 2LKMA 3L74E 4C7NA 1T6AA 4EYYQ 4JBZA 3TNUA 4AUWA 5CBOA 4M3LA 2POHA 4W7ZA 3SFDC 2FYUG 1YTZT 2OGUA 1ZXGA 1VF5D 1GU5A 4ASVA 2WPQA 3BRVB 1LP1A 1GU4A 3CC2P 3I5CA 4TLFA 3PP5A 1SQXD 4EIJA 1IFMA 2R5BA 2FKWB 3CX5E 1D7MA 4H13C 3WMM0 1XTGB 4CPGA 3VMXA 3L72J 3C8VA 5KLVD 1K05A 5CCGC 4GKGA 1USEA 1IJDB 1HGVA 4GDOA 3H1IJ 3L75E 2WSSH 4WY4C 3L73G 5KAFH 1PP9D 5AW7B 2N9YB 3CCVP 1SQVK 3CWBJ 1N2DC 4IFDK 3RL0B 3RBXA 1KYOH 3HE4A 5AVRB 2H7HA 4YXDC 1N7SB 2ZT9C 3A3YB 4Y28J 1VQNP 4L75A 1EDIA 2QJYC 1L0LG 1QVFO 3R4YA 4XFJA 3HD7B 3WUVA 2YNYA 4WVZA 4NPFX 2M3EA 2GUVA 3SSUA 2KZIA 2E75D 4HH2A 4WBAA 1L0NG 3BCCD 3TF5A 2GA1A 3FWLA 3CLQA 2AXTH 3PHLA 1RQVA 2SPZA 3H1JG 1JY2O 2QEXP 1KB9E 1DD3A 4JF7A 5CCHD 1CI6A 3RK3E 2KSJA 1KQLA 4IFFA 4KHXA 4U3FE 3GMAA 1USDA 1DEBA 1NTZK 1KFNA 1J1EB 1NU1G 2FFDC 3EFFK 1GW4A 1SQQD 2WSCJ 2Q9IA 2KIKA 2XV5A 3LIDA 1VF5C 1RF1A 3V2PA 3VYIA 3L73E 5AVUB 2KS1A 2C0XA 1KFMA 3AEAC 1YYCA 5KAIE 3CL3D 3TGUJ 1SQBG 1JCCA 2IYPA 5GTHE 3H6PA 1LTTC 1BCCJ 1BSNA 2JEEA 4PV1D 1L0LE 3LIEA 2N9BA 1M90Q 2K9JA 3P8CE 1H0TB 4XE5B 4YXWH 2KLUA 1J1DB 2W83C 1ZN5A 3H1KE 4R4LA 3MZWB 1VQPP 4PD4H 3AEFC 4DCKA 3V2RA 1RHZB 1HJ0A 3L4FA 1PGQA 1IFDA 2AEJA 3JC22 4UB6E 2Z4EA 2R3SA 3RK2D 2W27A 5K5GB 1IFIA 3MIWA 1H8AA 1SQXK 2JP3A 3M0DC 1JNMA 3TK1A 3VOPA 1NVOA 5CCHA 2M5AB 1KD1Q 3M06A 3QWOC 3MGNA 5AVQB 1NTMG 3VMAA 2A45G 3NMDA 2N1TC 5BU5A 2IBZG 2E74B 1E5WA 2YXRB 1KILD 2C0WA 3WUTA 3GHGB 1BE3G 1LTJA 3WUUA 2NZ2A 3D70A 2GUSA 1LT9B 3A0BH 1M7LA 1CW5A 1M57D 3B5ND 3IR9A 2WZ7A 3L72D 3F89A 3KYQA 3M9HA 1ZR2A 2WPRA 1SQXJ 1BGYJ 2IFNA 2BEZF 3SWYA 4ZNCA 3UIAA 1G2CA 3CWBD 1HVVA 2R5DA 5GTIH 1ZOYC 3PTZA 4I7ZB 2YKOA 4L76A 2NPSB 1GL2B 1FZCB 2M3BA 4OH8B 2O1KA 2XU6A 1SQPE 2YKPA 2O01N 1FZGA 3CC4P 1NTKG 5AW6B 1PP9J 2FYUJ 1EXIA 2ZJSE 5AW3B 1XTCC 2XKMA 2W6AA 3VP8A 4JQ0D 3V4WA 1JO5A 1X8YA 4I1LA 2UWJE 2OYIB 1GZLA 1Y8AA 1NTME 2QJKC 1SQQK 3V6IA 2JDIH 4IL6H 2ZYDA 2B87A 3C9IA 2JJLA 1EDJA 1KILA 5AVSB 1X0TA 2WSCH 3M91A 4D6TD 2D2CB 3RK2C 1BE3E 3BCCJ 4QMAA 1YBKA 1AQ5A 3EQ2A 2BCCJ 3EWKA 1HGZA 3B5NA 1YHQP 1T3JA 3II6A 3PH0A 4DOJA 2KSEA 2QSIA 2WSFH 2HODA 2E5YA 2WITA 3I56P 3NXSA 5H2FH 2E42A 1EC5A 3OJAB 3AEBC 5CCGD 1RE4A 3CXHI 3M9QA 3TGUD 1SLQA 1FBMA 2A06D 3HUSB 2QIWA 1JTHB 1BCCD 1SQQJ 2Y9ZA 2FYNB 5B66E 3LW5J 1GTWA 5DJTB 1L0NJ 1NTKE 2HPCA 1M1JC 1OW6A 1AFOA 2FBWC 2ZT9D 3G3ZA 1YJNP 1M56D 3Q5SA 1KZUB 3L74D 3H1JJ 5CMZA 3H32A 5AW8B 1DH3A 1ZLLA 2CPBA 5BU8B 1BSHA 3L70J 4N78E 1OFCX 4GOFA 3ITKA 3HE5A 2RN0A 4AYCA 4UB8E 3Q5PA 2KOGA 3CCRP 1U7MA 1JMBA 2XNXA
chains in the Genus database with same CATH topology
2WTYA 3KDPB 1L4AC 1JUNA 1FZEA 2YO2A 1JCDA 3CI9A 2O01H 3HTKB 2Z5HA 2HG5D 3HD7B 2YNYA 4I6MC 1FZBA 1MFZA 2WSEH 1L0NK 4B86A 1HWTC 4C7RA 2GUVA 4JYBA 1N73B 2QM8A 3HRNA 4HH2A 4WBAA 5CHXA 1NO4A 1HJBA 1T2KD 1FZFA 2NPSA 5AW5B 3CLQA 1GL2A 1T8ZA 3L36A 1G2CB 2P67A 1FZCA 2FXMA 2Q3IA 1JY2O 5APTA 1H88A 1LTBC 4N3YB 1IC2A 3RK3B 2GM4A 1NKNA 5APQA 1MZ9A 4JF7A 5KLVK 1M1JA 5CCHD 5CCGA 2IPPA 1CI6A 2KSJA 1KQLA 4IFFA 1VPCA 1T2KC 4KHXA 2P2UA 3H32B 1ZR4A 4WY4A 2KP8A 2Z5IA 2N1TB 5AVVB 1NU1K 2A45H 1DEBA 1NTZK 3RK2B 1KFNA 1FJPA 2WT7B 1J1EB 2FFDC 3HE5B 2OYIA 3RL0D 3B8EB 1GW4A 5KTBA 1SFCB 5CJ4A 1H89A 1NAFA 5CCHC 2YMYA 1LWUB 2Q9IA 1FZCC 1N7SD 1IFJA 1JY3O 2XV5A 3LIDA 1IK9A 1RF1A 1HUCA 2IFMA 4O9BA 1L4AA 3R2PA 1N86A 1SP4A 3V2PA 3VYIA 2R3CA 5AVUB 3VP9A 1G1IA 1SQBK 5AVZB 1N7LA 1URQD 2C0XA 1KFMA 3L35A 2OYHC 1YYCA 3HD7D 1G1JA 2J58A 3CL3D 3NTNA 1OXZA 1JCCA 3O8ZA 2J59M 1KILB 3H6PA 1LTTC 1N7SC 2JEEA 2O1JA 4GT1A 4I2LC 1FOSF 1RY3A 3IFMA 1LTJC 3LIEA 5AVXB 2WWWA 1VDFA 2N9BA 2OYIC 4C7NB 1FOSE 3P8CE 2M8RA 3TNUB 3VTPC 4XE5B 2PP6A 1J1DB 1URQC 2KLVA 1ZN5A 5KJ7D 3B5NB 3HD7C 3M0AA 1LTSC 1FAVA 3RK3D 2HFED 3V2RA 2HODB 2YO3A 4Y99C 2YKQA 1GDTA 3N7NA 3L4FA 1IFDA 4C46A 2P7JA 4GIFA 1LGHB 4WY4B 3BRTB 1NH4A 1Z56A 3HUSA 4IFMA 2XZRA 2Z4EA 2Q5UA 1WRGA 2N1TD 1JTHA 5AVWB 3RK2D 2W27A 1FJKA 4LLHA 1IFIA 3MIWA 5KJ7C 1H8AA 1SQXK 2FFDA 2OARA 3KPEA 3M0DC 5AW4B 1LTIC 1JNMA 3TK1A 3VOPA 1SFCD 5CCHA 3TYYA 1FU1A 3M06A 4JYCA 2C9NY 2IX7C 1L4AB 5CJ0A 3P7KA 1GK4A 1W2EA 4EOTA 1JOCA 3T97A 3BASA 3MGNA 5AVQB 1JY2N 1CSBA 2HPCB 3U1AA 3V4QA 2A45G 3A2AA 3NMDA 2N1TC 1X79B 5BU5A 2OYHA 1J1EC 4HYTB 4DZOA 3LW5H 3V5BA 2P1JA 1SFCC 1X9VA 3HUSC 1E5WA 1KILD 1YTZI 2C0WA 4N78D 5AVYB 1LWUC 1N7SA 1HH0A 2WPSA 3GHGB 1RF0C 3VMYA 1LTJA 3OA7A 4WB4A 3HE4B 3HTKA 2GUSA 1LT9B 2A45I 1URQA 1M7LA 2HYNA 1CW5A 2HLOA 3HD7A 3B5ND 3IR9A 4W80A 2WZ7A 3M9BA 5AW1B 5BVZA 1JY3N 3TSIA 1N73A 4LGDE 1JMMA 1KILC 3KYQA 2I1JA 1NKZB 3M9HA 5AW0B 1IO4A 1ZR2A 2R32A 1PFIA 2WPRA 3SWFA 2IFNA 1MV8A 4WY4D 1NHLA 3SWYA 1CZQA 3RL0C 3UIAA 1G2CA 1FZAA 4RESB 3VN0A 1J2JB 1A02J 1HVVA 2R5DA 1S9KE 5KJ7A 1DX7A 2YKOA 1NWQA 3B5NC 2NPSB 3E1IA 1GL2B 3M0DA 1FZCB 2M3BA 4OH8B 2O1KA 2XU6A 3VMZA 1NTKK 3A5TA 1NOHA 2W6BA 2YKPA 1FZGA 2I1KA 1M1JB 5APWA 2N1TA 2ZFCA 2OYHB 5AW6B 1CI6B 1RE4C 1N73C 1SQPK 2WT7A 1EQ7A 3MTUE 3MUDA 4XA4A 3EFGA 5AW3B 1HBWA 1A02F 1SFCA 1XTCC 2XKMA 2W6AA 3VP8A 1LTAC 3OAKA 1LWUA 3V4WA 1JO5A 1OWAA 3P32A 1X8YA 4I1LA 1RF0A 2OYIB 1GK6A 1GZLA 2XDJA 2VRSA 1JY3P 3N4XA 3RK3C 2BASA 1URQB 1SQQK 1FDMA 3BATA 3L37A 3NFQA 1RF1B 1NTMK 1MUUA 3U59A 2H43A 2E43A 4Y99B 5APSA 3C9IA 2JJLA 1KILA 5AW2B 5AVSB 2WSCH 3M91A 3P8MC 2LKMA 3RK2C 1RE3C 2FYZA 3GHGC 1GD2E 1IFNA 3BVHA 4ZKPA 1S9KD 4C7NA 3TNUA 1AQ5A 3EQ2A 4AUWA 2FYUK 4M3LA 1LT9C 1HGZA 2POHA 4W7YA 3B5NA 1T3JA 3P8CD 2NPSD 4W7ZA 3II6A 1GL2D 1YTZT 2KB7P 2KYVA 1LTGC 4DOJA 1SVFA 2QM7A 1QL1A 3MD0A 2WSFH 2HODA 4N6JA 5APVA 5APUA 2WITA 1WT6A 1GW3A 2PAJA 1GU5A 2WPQA 3BRVB 3NXSA 4ZKUA 2E42A 5APYA 1T3UA 1GU4A 2C9LY 3OJAB 3V2QA 5CCGD 2H8PD 1RE4A 3I5CA 4EIJA 3PP5A 3M9QA 1IFMA 5APXA 1SLQA 2NPSC 1ZV8A 1FBMA 1GL2C 2R5BA 3HUSB 3A7OA 1QL2A 1JTHB 2FKWB 2ZXEB 2FFDB 1J1DC 3WMM0 1GTWA 1XTGB 2CPSA 5AVTB 3VMXA 3KQGA 2HPCA 1JY2P 1M1JC 5CCGC 1AFOA 4GKGA 1IJDB 1HGVA 3G3ZA 4LC1A 5AW9B 1KZUB 1L4AD 2MJZA 4WY4C 3U1CA 5CMZA 3H32A 5AW7B 5AW8B 1SQVK 1DH3A 1HTLC 1ZLLA 1N2DC 2CPBA 4IFDK 1RE3A 5BU8B 3GHGA 2Q7CA 4N78E 3RL0B 3HE5A 3HE4A 4AYCA 5AVRB 2H7HA 1L0LK 2KOGA 1N7SB 3A3YB 2L5GB 3V2NA 1LT9A 2XNXA 1LTJB 4AQRD 1RF1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2Q A;  1VDF A;  3V2N A;  1MZ9 A;  1FBM A;  3V2R A;  3V2P A;  1DEB A; 
#chains in the Genus database with same CATH topology
 1FZE A;  1JCD A;  5TIS H;  2PGD A;  3H1H J;  1NU1 J;  2Z5H A;  3S1K A;  3AE8 C;  1BDD A;  4I6M C;  1FZB A;  1N73 B;  1QEX A;  2QM8 A;  1LNQ A;  3HRN A;  5CHX A;  2E5T A;  5M1B A;  3AED C;  4HKZ H;  3H1L E;  1W2B O;  2P67 A;  1SQB J;  5APT A;  1Q7Y Q;  2MKV A;  3AE4 C;  3L75 D;  1VQ4 P;  5CCG A;  3MP7 B;  3AE1 C;  1NTZ E;  1VPC A;  5KLV G;  1T2K C;  4OGQ B;  3H32 B;  1ZR4 A;  2M0B A;  4WY4 A;  2KP8 A;  3G6E P;  1OX3 A;  4GOE A;  4H0L D;  1R5L A;  3E1R A;  1BGY D;  3HE5 B;  5DJU B;  3B8E B;  1SFC B;  3AEG C;  4U3F G;  1LWU B;  2KUB A;  1JY3 O;  4O9B A;  3R2P A;  1P84 E;  3FGA D;  4EDF A;  3VP9 A;  1G1I A;  1VQL P;  2YIU B;  2QJP B;  3NTN A;  1OXZ A;  3GF7 A;  1VQK P;  3C1L A;  2J59 M;  3AE2 C;  2FYU D;  1N7S C;  4I2L C;  1RY3 A;  1QLE D;  2K37 A;  2WWW A;  4RO0 A;  3WU2 E;  4C7N B;  1FOS E;  4H13 B;  3TNU B;  2PP6 A;  2IZ0 A;  2E76 B;  3HD7 C;  3RK3 D;  3K5B A;  3RBZ A;  3A0H H;  1EZV I;  2YKQ A;  2H89 C;  3I55 P;  1PGO A;  4C46 A;  3AE5 C;  4GIF A;  1LGH B;  1UII A;  3H1K G;  4WY4 B;  3BRT B;  1LP1 B;  4PJ0 H;  1WRG A;  3D6Z A;  2N1T D;  5KLI B;  1FJK A;  5KJ7 C;  2FFD A;  3FXE A;  3KPE A;  1OVR A;  1YJ9 P;  2BCC D;  3CCU P;  4H44 B;  2IX7 C;  5CJ0 A;  5KLV E;  1OMI A;  1JOC A;  2B9B A;  3T97 A;  3BAS A;  1AVY A;  1JY2 N;  3U1A A;  1KQF B;  1X79 B;  1J1E C;  4D6T J;  4OVN F;  3RGU A;  2LXB A;  3MUD C;  1Q82 Q;  3LW5 H;  3V5B A;  3E7K A;  1L0L D;  3G9R A;  1S5L H;  1HF9 A;  1YTZ I;  1S3J A;  2KK7 A;  2V4H A;  3OA7 A;  3HE4 B;  5KAF E;  4RJT A;  3CXH H;  3HTK A;  2K3R A;  3SWK A;  1L0N D;  1KYO E;  3M9B A;  1IK7 A;  3CCE P;  3AE9 C;  5AW0 B;  3D71 A;  3CPW O;  4H0L C;  3CXH D;  2IDB A;  3H1J D;  1CZQ A;  4RES B;  2BEQ D;  1S9K E;  3L70 D;  3CCL P;  2IZ1 A;  3E1I A;  3M0D A;  3L71 G;  3KZI H;  2ZYA A;  1VF5 B;  4TT3 H;  4KT0 J;  3G4S P;  3SFE C;  3A5T A;  1NOH A;  2AXT E;  3H1H D;  1NU1 D;  1FDO A;  2N1T A;  3L74 J;  1CI6 B;  1DEE G;  2WT7 A;  2OTL P;  2B88 A;  1E79 H;  4XA4 A;  1SQP G;  1HBW A;  2RMZ A;  1LTA C;  3OAK A;  1OWA A;  2QVA A;  2VRS A;  4BRY A;  1VQ6 P;  1JY3 P;  3RK3 C;  2BAS A;  1SQB D;  2JKV A;  3NFQ A;  1RF1 B;  2WMM A;  1MUU A;  3U59 A;  2E43 A;  2E74 C;  3Q5R A;  1QGK B;  3AEC C;  1K8A Q;  2KS1 B;  1RE3 C;  3GHG C;  1GD2 E;  4ZKP A;  3H1I G;  1R8E A;  2HR3 A;  1YQ3 C;  3GLM A;  2FYU K;  1LT9 C;  5KKZ B;  4W7Y A;  2JWA A;  3CWB G;  4WWI A;  2KYV A;  1SVF A;  2QM7 A;  2K9J B;  2J5U A;  5APV A;  3L75 J;  2DW3 A;  1GW3 A;  4ZKU A;  2E75 B;  5APY A;  2P10 A;  1ZW0 A;  2H88 C;  2H8P D;  5APX A;  3W67 A;  2NPS C;  1ZV8 A;  3L71 E;  1GL2 C;  3A7O A;  1QL2 A;  4PD4 E;  1EDL A;  1LT1 A;  3OW2 O;  4BRY B;  1TU3 F;  2OYO A;  1EXJ A;  2CPS A;  3O6Q A;  5AVT B;  2IBZ D;  3KQG A;  3JCU H;  1JY2 P;  1PL5 A;  3USS A;  4BWN A;  1R5S A;  2AEF A;  4LC1 A;  1AV1 A;  3QH9 A;  3CCS P;  1RH5 B;  1HTL C;  2Q7C A;  1KIL E;  2KZJ A;  3AE7 C;  1SQV G;  2PFX A;  3CC7 P;  1OVV A;  2CK3 H;  1L0L K;  4A7P A;  3V2N A;  3AE3 C;  1LTJ B;  5B5E H;  2WTY A;  1L4A C;  2YO2 A;  1RQU A;  3TDK A;  3CI9 A;  3L72 E;  1AQT A;  2NRG A;  2D2C C;  4U3F J;  1EZV D;  3H1I E;  1L0N K;  4B86 A;  2Y9Y A;  4KJM A;  4PV1 B;  3A0B E;  1HJB A;  1T2K D;  2P58 A;  3CWB E;  1ZME C;  1PPJ G;  5E79 H;  3CME P;  1T8Z A;  1G2C B;  3TGU G;  1S72 P;  2A06 G;  2Q3I A;  3IN6 A;  2KNC A;  1NTK D;  1BCC G;  1H88 A;  3O6Q B;  2QJK B;  3L73 J;  2GM4 A;  1NKN A;  2OTK E;  3H1L G;  1MZ9 A;  1M1J A;  1N8R Q;  2FY8 A;  4DJG A;  2IPP A;  5GTI E;  2RKL A;  2P2U A;  1VQM P;  5AVV B;  1NU1 K;  3RK2 B;  1L0L J;  1NTZ G;  4IL6 X;  3RL0 D;  2YXQ B;  1UIX A;  4IOI H;  5CJ4 A;  1H89 A;  1NAF A;  3H1K J;  1N7S D;  1FS0 E;  2JWD A;  1AVO A;  1SQB K;  2OYH C;  3HD7 D;  1SQV E;  1VQO P;  3O8Z A;  5C39 A;  1Q90 D;  2B87 B;  2KXP B;  1KIL B;  2QG4 A;  4GOD A;  2O1J A;  4GT1 A;  1FOS F;  2OQQ A;  5AVX B;  4IL6 E;  1VDF A;  2W8Z A;  2M8R A;  3VTP C;  1ZRT E;  1DD4 A;  1URQ C;  5KJ7 D;  3B5N B;  3M0A A;  1FAV A;  3IF4 A;  1KN7 A;  2HFE D;  1YIT P;  2HOD B;  2YO3 A;  3CX5 H;  4Y99 C;  1GDT A;  2P7J A;  4DT0 A;  3W68 A;  4HJG H;  4MN4 C;  1PPJ E;  1Z56 A;  3TGU E;  4IFM A;  2L91 A;  4U7J A;  2XZR A;  1X22 A;  2Q5U A;  2A06 E;  5AVW B;  2QRX A;  1BCC E;  3FX0 A;  5EFW B;  3JSV C;  3CX5 D;  1SQX G;  4JYC A;  2C9N Y;  3P7K A;  3CMA P;  1W2E A;  4EOT A;  3ZDM A;  4OGQ C;  2HPC B;  3V4Q A;  3A2A A;  1M1K Q;  3L71 J;  1Q2N A;  2O01 J;  1JM0 A;  2P1J A;  1SFC C;  1X9V A;  5AVY B;  4L74 A;  1LWU C;  1N7S A;  2WPS A;  1RF0 C;  3VMY A;  1OZH A;  1PP9 G;  2WSE J;  4WB4 A;  2V7Q J;  2ITA A;  3Q3D A;  2A45 I;  3MHV A;  1SQP J;  3HD7 A;  4ZMD A;  4ASW A;  4W80 A;  2YIU C;  2QJP C;  2IBZ I;  5AW1 B;  1JY3 N;  1PZQ A;  3TSI A;  1KOR A;  4LGD E;  1JMM A;  1S2E A;  2I1J A;  1NKZ B;  1K04 A;  1KB9 H;  2Y0E A;  3SWF A;  1MV8 A;  3IAO A;  1NHL A;  3RL0 C;  5TIS E;  4K35 A;  1FZA A;  2RH0 A;  2XND H;  5KJ7 A;  1DX7 A;  2E76 C;  2WPV B;  1NTM J;  3BCC G;  5CBN A;  1FE6 A;  1KB9 D;  1U57 A;  2I8D A;  4HB1 A;  3PJS K;  1OW7 A;  3VMZ A;  2BCC G;  1NTK K;  1QX8 A;  3S4R A;  5TJH A;  3KXD A;  5APW A;  2ZFC A;  1BE3 J;  5KLI C;  4BXL A;  3Q1M A;  4U3F D;  3MTU E;  3MUD A;  3EFG A;  1SQX E;  1BGY E;  2E74 D;  1A02 F;  2WQY C;  3P32 A;  4H44 C;  5KAI H;  2Y0C A;  3S9O A;  2ZVN B;  4NPE A;  3N4X A;  1FDM A;  5GTH H;  2ZT9 B;  1KYO D;  2QJY B;  2LR2 A;  1SQQ G;  1PGP A;  3L73 D;  2ZVO B;  3GW6 A;  4L73 A;  2FYZ A;  1IFN A;  1PP9 E;  2FYU E;  3BVH A;  2K9Y A;  1S9K D;  1FDI A;  1H0T A;  3CD6 P;  3CCQ P;  3P8C D;  2NPS D;  4UB6 H;  1NTK J;  1GL2 D;  2KB7 P;  3L70 G;  1LTG C;  3H1K D;  1QL1 A;  3MD0 A;  1SQV J;  4N6J A;  5APU A;  1WT6 A;  2PAJ A;  1VL2 A;  1T3U A;  3AE6 C;  2C9L Y;  3V2Q A;  1VQ7 P;  3H1H G;  1YI2 P;  4RKU J;  5L8R J;  1NAY A;  3KHU A;  3BCC E;  2QA4 P;  1PIX A;  3A0H E;  2JR8 A;  2M5A A;  1KV4 A;  2ZXE B;  2FFD B;  1J1D C;  2BCC E;  1QVG O;  1AA0 A;  3PLN A;  1S5L X;  4PJ0 E;  4YPC A;  4R4M A;  5AW9 B;  3T97 B;  1L4A D;  2MJZ A;  2WSF J;  2AXC A;  3U1C A;  1Q81 Q;  1Y9B A;  4H0L B;  1MKM A;  3H1L J;  1VQ5 P;  1RE3 A;  3GHG A;  2D2C D;  2ZXX A;  2QE7 H;  2FXP A;  2L5G B;  1LT9 A;  1SQQ E;  3CX5 I;  4AQR D;  1M8O B;  1RF1 C;  3KDP B;  1JUN A;  2O01 H;  1P84 I;  1S5L E;  3HTK B;  1L0N E;  1NTZ J;  2HG5 D;  1Q86 Q;  2K1A A;  2JO1 A;  1MFZ A;  3F5H A;  2WSE H;  1HWT C;  4C7R A;  4JYB A;  3CXH E;  2V7Q H;  2ZAE B;  3L71 D;  3H1J E;  3L72 G;  1NO4 A;  4PD4 D;  1Y47 A;  5KKZ C;  1FZF A;  2NPS A;  5AW5 B;  1GL2 A;  3L36 A;  3L70 E;  1FZC A;  2FXM A;  2OTJ P;  1DIP A;  1L2P A;  1KTM A;  3B4S A;  1LTB C;  4N3Y B;  1IC2 A;  1OIP A;  3RK3 B;  1YJW P;  5APQ A;  5KLV K;  2E75 C;  1SQP D;  3H1H E;  1NU1 E;  2KI7 B;  3PRJ A;  3Q2Y A;  3KZI E;  2Z5I A;  2N1T B;  2A45 H;  2AEM A;  1FJP A;  2G3A A;  2WT7 B;  2IYO A;  2PRR A;  4I7Z C;  2OYI A;  2W6J H;  5KTB A;  5CCH C;  2YMY A;  1FZC C;  1SS1 A;  1IFJ A;  1NTM D;  2FXO A;  1SQB E;  1IK9 A;  1HUC A;  2IFM A;  1L4A A;  1EDK A;  1KB9 I;  1N86 A;  1SP4 A;  2G8Y A;  2R3C A;  4JPZ B;  3H1I D;  5AVZ B;  1N7L A;  1URQ D;  1YQ4 C;  3L35 A;  1G1J A;  2J58 A;  3AEE C;  1GMJ A;  1EZV G;  2Q3E A;  1BE3 D;  1IZN B;  3IFM A;  1JEK A;  1U7J A;  1LTJ C;  2OYI C;  4D6T G;  4Z1M H;  5KLV J;  2KLV A;  3FWN A;  1LTS C;  1KYO I;  4K3A A;  3N7N A;  5B66 H;  1LJ2 A;  2K88 A;  1KQG B;  4PV1 C;  1K9M Q;  1NH4 A;  2O3J A;  4OGQ D;  3HUS A;  1MFT A;  1WMK A;  1JTH A;  1FC2 C;  2R44 A;  4LLH A;  2Q1K A;  1NGM B;  1W5C E;  2OAR A;  5AW4 B;  1LTI C;  1SFC D;  3TYY A;  3RL0 g;  1FU1 A;  1KC8 Q;  2IBZ E;  1L4A B;  1GK4 A;  3G71 P;  1CSB A;  1SQV D;  4UB8 H;  3GG2 A;  2OYH A;  4HYT B;  1PV3 A;  1IFP A;  4EI2 A;  4DZO A;  3JCU E;  3HUS C;  4N78 D;  1HH0 A;  3H25 A;  2W90 A;  3L74 G;  1VQ9 P;  2FYN C;  4NPD A;  1ZRT D;  2B89 A;  2ZYG A;  1KQS O;  4H13 D;  1URQ A;  2HYN A;  2HLO A;  2E76 D;  1YIJ P;  5BVZ A;  1EZV E;  1N73 A;  1KIL C;  1PPJ D;  3CCM P;  1IO4 A;  5B5E E;  2R32 A;  1PFI A;  4WY4 D;  1S1C X;  1NJI Q;  4D6T E;  3VN0 A;  1J2J B;  1S4X A;  1A02 J;  3H1L D;  1PGJ A;  1NWQ A;  3B5N C;  3D6Y A;  1KMI Z;  2Q6Q A;  1AJY A;  3CCJ P;  1VQ8 P;  3B71 A;  2KNC B;  4H44 D;  2LXC B;  5E79 E;  2W6B A;  2I1K A;  1M1J B;  2WVR A;  1NTZ D;  1ZP0 C;  2OYH B;  1RE4 C;  1N73 C;  1SQP K;  3L75 G;  1EQ7 A;  1P84 H;  2YMK A;  4OWF A;  1SFC A;  2Y0D A;  4PD4 I;  1K73 Q;  1LWU A;  1RF0 A;  1OW8 A;  3FXD A;  1GK6 A;  2XDJ A;  5H2F E;  1OVU A;  1BGY G;  1URQ B;  1BDC A;  3BAT A;  3L37 A;  1P84 D;  1NTM K;  3WU2 H;  2H43 A;  4Y99 B;  5APS A;  3GF3 A;  5AW2 B;  4YTP C;  1JB0 J;  1NYH A;  3ABV C;  3P8M C;  2LKM A;  3L74 E;  4C7N A;  1T6A A;  4EYY Q;  4JBZ A;  3TNU A;  4AUW A;  5CBO A;  4M3L A;  2POH A;  4W7Z A;  3SFD C;  2FYU G;  1YTZ T;  2OGU A;  1ZXG A;  1VF5 D;  1GU5 A;  4ASV A;  2WPQ A;  3BRV B;  1LP1 A;  1GU4 A;  3CC2 P;  3I5C A;  4TLF A;  3PP5 A;  1SQX D;  4EIJ A;  1IFM A;  2R5B A;  2FKW B;  3CX5 E;  1D7M A;  4H13 C;  3WMM 0;  1XTG B;  4CPG A;  3VMX A;  3L72 J;  3C8V A;  5KLV D;  1K05 A;  5CCG C;  4GKG A;  1USE A;  1IJD B;  1HGV A;  4GDO A;  3H1I J;  3L75 E;  2WSS H;  4WY4 C;  3L73 G;  5KAF H;  1PP9 D;  5AW7 B;  2N9Y B;  3CCV P;  1SQV K;  3CWB J;  1N2D C;  4IFD K;  3RL0 B;  3RBX A;  1KYO H;  3HE4 A;  5AVR B;  2H7H A;  4YXD C;  1N7S B;  2ZT9 C;  3A3Y B;  4Y28 J;  1VQN P;  4L75 A;  1EDI A;  2QJY C;  1L0L G;  1QVF O;  3R4Y A;  4XFJ A;  3HD7 B;  3WUV A;  2YNY A;  4WVZ A;  4NPF X;  2M3E A;  2GUV A;  3SSU A;  2KZI A;  2E75 D;  4HH2 A;  4WBA A;  1L0N G;  3BCC D;  3TF5 A;  2GA1 A;  3FWL A;  3CLQ A;  2AXT H;  3PHL A;  1RQV A;  2SPZ A;  3H1J G;  1JY2 O;  2QEX P;  1KB9 E;  1DD3 A;  4JF7 A;  5CCH D;  1CI6 A;  3RK3 E;  2KSJ A;  1KQL A;  4IFF A;  4KHX A;  4U3F E;  3GMA A;  1USD A;  1DEB A;  1NTZ K;  1KFN A;  1J1E B;  1NU1 G;  2FFD C;  3EFF K;  1GW4 A;  1SQQ D;  2WSC J;  2Q9I A;  2KIK A;  2XV5 A;  3LID A;  1VF5 C;  1RF1 A;  3V2P A;  3VYI A;  3L73 E;  5AVU B;  2KS1 A;  2C0X A;  1KFM A;  3AEA C;  1YYC A;  5KAI E;  3CL3 D;  3TGU J;  1SQB G;  1JCC A;  2IYP A;  5GTH E;  3H6P A;  1LTT C;  1BCC J;  1BSN A;  2JEE A;  4PV1 D;  1L0L E;  3LIE A;  2N9B A;  1M90 Q;  2K9J A;  3P8C E;  1H0T B;  4XE5 B;  4YXW H;  2KLU A;  1J1D B;  2W83 C;  1ZN5 A;  3H1K E;  4R4L A;  3MZW B;  1VQP P;  4PD4 H;  3AEF C;  4DCK A;  3V2R A;  1RHZ B;  1HJ0 A;  3L4F A;  1PGQ A;  1IFD A;  2AEJ A;  3JC2 2;  4UB6 E;  2Z4E A;  2R3S A;  3RK2 D;  2W27 A;  5K5G B;  1IFI A;  3MIW A;  1H8A A;  1SQX K;  2JP3 A;  3M0D C;  1JNM A;  3TK1 A;  3VOP A;  1NVO A;  5CCH A;  2M5A B;  1KD1 Q;  3M06 A;  3QWO C;  3MGN A;  5AVQ B;  1NTM G;  3VMA A;  2A45 G;  3NMD A;  2N1T C;  5BU5 A;  2IBZ G;  2E74 B;  1E5W A;  2YXR B;  1KIL D;  2C0W A;  3WUT A;  3GHG B;  1BE3 G;  1LTJ A;  3WUU A;  2NZ2 A;  3D70 A;  2GUS A;  1LT9 B;  3A0B H;  1M7L A;  1CW5 A;  1M57 D;  3B5N D;  3IR9 A;  2WZ7 A;  3L72 D;  3F89 A;  3KYQ A;  3M9H A;  1ZR2 A;  2WPR A;  1SQX J;  1BGY J;  2IFN A;  2BEZ F;  3SWY A;  4ZNC A;  3UIA A;  1G2C A;  3CWB D;  1HVV A;  2R5D A;  5GTI H;  1ZOY C;  3PTZ A;  4I7Z B;  2YKO A;  4L76 A;  2NPS B;  1GL2 B;  1FZC B;  2M3B A;  4OH8 B;  2O1K A;  2XU6 A;  1SQP E;  2YKP A;  2O01 N;  1FZG A;  3CC4 P;  1NTK G;  5AW6 B;  1PP9 J;  2FYU J;  1EXI A;  2ZJS E;  5AW3 B;  1XTC C;  2XKM A;  2W6A A;  3VP8 A;  4JQ0 D;  3V4W A;  1JO5 A;  1X8Y A;  4I1L A;  2UWJ E;  2OYI B;  1GZL A;  1Y8A A;  1NTM E;  2QJK C;  1SQQ K;  3V6I A;  2JDI H;  4IL6 H;  2ZYD A;  2B87 A;  3C9I A;  2JJL A;  1EDJ A;  1KIL A;  5AVS B;  1X0T A;  2WSC H;  3M91 A;  4D6T D;  2D2C B;  3RK2 C;  1BE3 E;  3BCC J;  4QMA A;  1YBK A;  1AQ5 A;  3EQ2 A;  2BCC J;  3EWK A;  1HGZ A;  3B5N A;  1YHQ P;  1T3J A;  3II6 A;  3PH0 A;  4DOJ A;  2KSE A;  2QSI A;  2WSF H;  2HOD A;  2E5Y A;  2WIT A;  3I56 P;  3NXS A;  5H2F H;  2E42 A;  1EC5 A;  3OJA B;  3AEB C;  5CCG D;  1RE4 A;  3CXH I;  3M9Q A;  3TGU D;  1SLQ A;  1FBM A;  2A06 D;  3HUS B;  2QIW A;  1JTH B;  1BCC D;  1SQQ J;  2Y9Z A;  2FYN B;  5B66 E;  3LW5 J;  1GTW A;  5DJT B;  1L0N J;  1NTK E;  2HPC A;  1M1J C;  1OW6 A;  1AFO A;  2FBW C;  2ZT9 D;  3G3Z A;  1YJN P;  1M56 D;  3Q5S A;  1KZU B;  3L74 D;  3H1J J;  5CMZ A;  3H32 A;  5AW8 B;  1DH3 A;  1ZLL A;  2CPB A;  5BU8 B;  1BSH A;  3L70 J;  4N78 E;  1OFC X;  4GOF A;  3ITK A;  3HE5 A;  2RN0 A;  4AYC A;  4UB8 E;  3Q5P A;  2KOG A;  3CCR P;  1U7M A;  1JMB A;  2XNX A; 
#chains in the Genus database with same CATH homology
 2WTY A;  3KDP B;  1L4A C;  1JUN A;  1FZE A;  2YO2 A;  1JCD A;  3CI9 A;  2O01 H;  3HTK B;  2Z5H A;  2HG5 D;  3HD7 B;  2YNY A;  4I6M C;  1FZB A;  1MFZ A;  2WSE H;  1L0N K;  4B86 A;  1HWT C;  4C7R A;  2GUV A;  4JYB A;  1N73 B;  2QM8 A;  3HRN A;  4HH2 A;  4WBA A;  5CHX A;  1NO4 A;  1HJB A;  1T2K D;  1FZF A;  2NPS A;  5AW5 B;  3CLQ A;  1GL2 A;  1T8Z A;  3L36 A;  1G2C B;  2P67 A;  1FZC A;  2FXM A;  2Q3I A;  1JY2 O;  5APT A;  1H88 A;  1LTB C;  4N3Y B;  1IC2 A;  3RK3 B;  2GM4 A;  1NKN A;  5APQ A;  1MZ9 A;  4JF7 A;  5KLV K;  1M1J A;  5CCH D;  5CCG A;  2IPP A;  1CI6 A;  2KSJ A;  1KQL A;  4IFF A;  1VPC A;  1T2K C;  4KHX A;  2P2U A;  3H32 B;  1ZR4 A;  4WY4 A;  2KP8 A;  2Z5I A;  2N1T B;  5AVV B;  1NU1 K;  2A45 H;  1DEB A;  1NTZ K;  3RK2 B;  1KFN A;  1FJP A;  2WT7 B;  1J1E B;  2FFD C;  3HE5 B;  2OYI A;  3RL0 D;  3B8E B;  1GW4 A;  5KTB A;  1SFC B;  5CJ4 A;  1H89 A;  1NAF A;  5CCH C;  2YMY A;  1LWU B;  2Q9I A;  1FZC C;  1N7S D;  1IFJ A;  1JY3 O;  2XV5 A;  3LID A;  1IK9 A;  1RF1 A;  1HUC A;  2IFM A;  4O9B A;  1L4A A;  3R2P A;  1N86 A;  1SP4 A;  3V2P A;  3VYI A;  2R3C A;  5AVU B;  3VP9 A;  1G1I A;  1SQB K;  5AVZ B;  1N7L A;  1URQ D;  2C0X A;  1KFM A;  3L35 A;  2OYH C;  1YYC A;  3HD7 D;  1G1J A;  2J58 A;  3CL3 D;  3NTN A;  1OXZ A;  1JCC A;  3O8Z A;  2J59 M;  1KIL B;  3H6P A;  1LTT C;  1N7S C;  2JEE A;  2O1J A;  4GT1 A;  4I2L C;  1FOS F;  1RY3 A;  3IFM A;  1LTJ C;  3LIE A;  5AVX B;  2WWW A;  1VDF A;  2N9B A;  2OYI C;  4C7N B;  1FOS E;  3P8C E;  2M8R A;  3TNU B;  3VTP C;  4XE5 B;  2PP6 A;  1J1D B;  1URQ C;  2KLV A;  1ZN5 A;  5KJ7 D;  3B5N B;  3HD7 C;  3M0A A;  1LTS C;  1FAV A;  3RK3 D;  2HFE D;  3V2R A;  2HOD B;  2YO3 A;  4Y99 C;  2YKQ A;  1GDT A;  3N7N A;  3L4F A;  1IFD A;  4C46 A;  2P7J A;  4GIF A;  1LGH B;  4WY4 B;  3BRT B;  1NH4 A;  1Z56 A;  3HUS A;  4IFM A;  2XZR A;  2Z4E A;  2Q5U A;  1WRG A;  2N1T D;  1JTH A;  5AVW B;  3RK2 D;  2W27 A;  1FJK A;  4LLH A;  1IFI A;  3MIW A;  5KJ7 C;  1H8A A;  1SQX K;  2FFD A;  2OAR A;  3KPE A;  3M0D C;  5AW4 B;  1LTI C;  1JNM A;  3TK1 A;  3VOP A;  1SFC D;  5CCH A;  3TYY A;  1FU1 A;  3M06 A;  4JYC A;  2C9N Y;  2IX7 C;  1L4A B;  5CJ0 A;  3P7K A;  1GK4 A;  1W2E A;  4EOT A;  1JOC A;  3T97 A;  3BAS A;  3MGN A;  5AVQ B;  1JY2 N;  1CSB A;  2HPC B;  3U1A A;  3V4Q A;  2A45 G;  3A2A A;  3NMD A;  2N1T C;  1X79 B;  5BU5 A;  2OYH A;  1J1E C;  4HYT B;  4DZO A;  3LW5 H;  3V5B A;  2P1J A;  1SFC C;  1X9V A;  3HUS C;  1E5W A;  1KIL D;  1YTZ I;  2C0W A;  4N78 D;  5AVY B;  1LWU C;  1N7S A;  1HH0 A;  2WPS A;  3GHG B;  1RF0 C;  3VMY A;  1LTJ A;  3OA7 A;  4WB4 A;  3HE4 B;  3HTK A;  2GUS A;  1LT9 B;  2A45 I;  1URQ A;  1M7L A;  2HYN A;  1CW5 A;  2HLO A;  3HD7 A;  3B5N D;  3IR9 A;  4W80 A;  2WZ7 A;  3M9B A;  5AW1 B;  5BVZ A;  1JY3 N;  3TSI A;  1N73 A;  4LGD E;  1JMM A;  1KIL C;  3KYQ A;  2I1J A;  1NKZ B;  3M9H A;  5AW0 B;  1IO4 A;  1ZR2 A;  2R32 A;  1PFI A;  2WPR A;  3SWF A;  2IFN A;  1MV8 A;  4WY4 D;  1NHL A;  3SWY A;  1CZQ A;  3RL0 C;  3UIA A;  1G2C A;  1FZA A;  4RES B;  3VN0 A;  1J2J B;  1A02 J;  1HVV A;  2R5D A;  1S9K E;  5KJ7 A;  1DX7 A;  2YKO A;  1NWQ A;  3B5N C;  2NPS B;  3E1I A;  1GL2 B;  3M0D A;  1FZC B;  2M3B A;  4OH8 B;  2O1K A;  2XU6 A;  3VMZ A;  1NTK K;  3A5T A;  1NOH A;  2W6B A;  2YKP A;  1FZG A;  2I1K A;  1M1J B;  5APW A;  2N1T A;  2ZFC A;  2OYH B;  5AW6 B;  1CI6 B;  1RE4 C;  1N73 C;  1SQP K;  2WT7 A;  1EQ7 A;  3MTU E;  3MUD A;  4XA4 A;  3EFG A;  5AW3 B;  1HBW A;  1A02 F;  1SFC A;  1XTC C;  2XKM A;  2W6A A;  3VP8 A;  1LTA C;  3OAK A;  1LWU A;  3V4W A;  1JO5 A;  1OWA A;  3P32 A;  1X8Y A;  4I1L A;  1RF0 A;  2OYI B;  1GK6 A;  1GZL A;  2XDJ A;  2VRS A;  1JY3 P;  3N4X A;  3RK3 C;  2BAS A;  1URQ B;  1SQQ K;  1FDM A;  3BAT A;  3L37 A;  3NFQ A;  1RF1 B;  1NTM K;  1MUU A;  3U59 A;  2H43 A;  2E43 A;  4Y99 B;  5APS A;  3C9I A;  2JJL A;  1KIL A;  5AW2 B;  5AVS B;  2WSC H;  3M91 A;  3P8M C;  2LKM A;  3RK2 C;  1RE3 C;  2FYZ A;  3GHG C;  1GD2 E;  1IFN A;  3BVH A;  4ZKP A;  1S9K D;  4C7N A;  3TNU A;  1AQ5 A;  3EQ2 A;  4AUW A;  2FYU K;  4M3L A;  1LT9 C;  1HGZ A;  2POH A;  4W7Y A;  3B5N A;  1T3J A;  3P8C D;  2NPS D;  4W7Z A;  3II6 A;  1GL2 D;  1YTZ T;  2KB7 P;  2KYV A;  1LTG C;  4DOJ A;  1SVF A;  2QM7 A;  1QL1 A;  3MD0 A;  2WSF H;  2HOD A;  4N6J A;  5APV A;  5APU A;  2WIT A;  1WT6 A;  1GW3 A;  2PAJ A;  1GU5 A;  2WPQ A;  3BRV B;  3NXS A;  4ZKU A;  2E42 A;  5APY A;  1T3U A;  1GU4 A;  2C9L Y;  3OJA B;  3V2Q A;  5CCG D;  2H8P D;  1RE4 A;  3I5C A;  4EIJ A;  3PP5 A;  3M9Q A;  1IFM A;  5APX A;  1SLQ A;  2NPS C;  1ZV8 A;  1FBM A;  1GL2 C;  2R5B A;  3HUS B;  3A7O A;  1QL2 A;  1JTH B;  2FKW B;  2ZXE B;  2FFD B;  1J1D C;  3WMM 0;  1GTW A;  1XTG B;  2CPS A;  5AVT B;  3VMX A;  3KQG A;  2HPC A;  1JY2 P;  1M1J C;  5CCG C;  1AFO A;  4GKG A;  1IJD B;  1HGV A;  3G3Z A;  4LC1 A;  5AW9 B;  1KZU B;  1L4A D;  2MJZ A;  4WY4 C;  3U1C A;  5CMZ A;  3H32 A;  5AW7 B;  5AW8 B;  1SQV K;  1DH3 A;  1HTL C;  1ZLL A;  1N2D C;  2CPB A;  4IFD K;  1RE3 A;  5BU8 B;  3GHG A;  2Q7C A;  4N78 E;  3RL0 B;  3HE5 A;  3HE4 A;  4AYC A;  5AVR B;  2H7H A;  1L0L K;  2KOG A;  1N7S B;  3A3Y B;  2L5G B;  3V2N A;  1LT9 A;  2XNX A;  1LTJ B;  4AQR D;  1RF1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...