3M0DC

Crystal structure of the traf1:traf2:ciap2 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
b'FMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TNF receptor-associated factor 2
publication title Crystal structures of the TRAF2: cIAP2 and the TRAF1: TRAF2: cIAP2 complexes: affinity, specificity, and regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 28
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2010-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3m0dC00
3HD7A 3RL0C 3TSIA 3RK2C 1SFCD 1L4AB 2PP6A 1SFCA 2N1TB 1SFCC 3M0DC 2M8RA 1L4AA 1JTHA 3RL0B 1T3JA 2NPSB 3RK2B 5KJ7D 1URQD 1HVVA 1XTGB 3HTKB 1SFCB 4WY4D 1URQA 5KJ7C 1URQC 3RK3B 4WY4A 3B5NC 1JTHB 4WY4C 1GL2D 4W7ZA 1N7SD 1GL2A 1GL2C 1URQB 1N7SA 2H8PD 1N7SC 4WY4B 3B5ND 4JF7A 5KJ7A 1NHLA 1GL2B 3B5NA 4W7YA 1N7SB 3P8CE 3PP5A 4OH8B 4LGDE 5CCHD 2NPSD 3HD7D 2WZ7A 1KILD 5CCHC 3B5NB 3KYQA 2HFED 2NPSC 1KILA 3HD7C 1KILC 3RK3D 1L4AD 4N78E 5CCGD 2N1TD 3RK3C 4W80A 2XDJA 3VOPA 5CCGA 1L4AC 2N1TA 2YMYA 3HD7B 1KILB 5CCGC 2N1TC 3RL0D 3RK2D 2HG5D 5CCHA 2KOGA 2NPSA
chains in the Genus database with same CATH superfamily
3HD7A 1Q86Q 3V2PA 1KYOI 2LXBA 2FYNB 4OGQB 1S1CX 2BCCJ 4WWIA 4KHXA 1JY3O 2QIWA 2Q5UA 1Q82Q 3H1KD 4BRYB 2IX7C 1YIJP 1X9VA 5APYA 4H44D 2JP3A 2IBZI 1FAVA 4WB4A 4HB1A 1SQXD 1FOSF 1YQ3C 1RQVA 1OVVA 1IFMA 4PD4I 4EDFA 2WSSH 3H1KG 4PJ0H 1RE4A 5K5GB 2P1JA 3EWKA 3FWLA 2QM7A 2P10A 1SQXG 1OX3A 2OYIC 2JWDA 1S3JA 2KNCB 2FFDC 3G71P 4U3FD 4D6TE 3SFEC 1X8YA 5BVZA 2OTJP 2M5AA 3PRJA 5AVVB 5B5EH 1DD3A 2W27A 1KILA 1LTBC 4U3FG 2HYNA 1T2KD 2ZVOB 1RF0A 3VYIA 2OYHA 3AEGC 1RQUA 2N1TD 3I5CA 1IZNB 2KZIA 4A7PA 1KQSO 3V6IA 4MN4C 1SQQK 1YJ9P 3VP8A 3M9QA 3AEDC 1Q90D 2Z5IA 4JYCA 1W2BO 2R3SA 3H1IJ 1NTZD 2IYPA 1VF5C 1JCDA 4HKZH 4H0LB 4KT0J 3SWFA 4JPZB 1NTZG 1SQBE 1SQQJ 1FBMA 2PFXA 1P84D 1ZW0A 2WMMA 2E43A 2M0BA 1GL2C 2JDIH 3II6A 2JO1A 3Q5SA 1JO5A 2ZFCA 3TGUJ 3K5BA 4H44B 2RH0A 1YYCA 3L36A 3IAOA 2H89C 3D70A 5CBOA 3ZDMA 3Q3DA 4ZKPA 1JY2N 3TDKA 1IFDA 1TU3F 4XA4A 3T97B 3D6YA 1LNQA 2SPZA 3HE5B 3L74D 4GKGA 1FS0E 5APWA 1FDMA 1J1EB 2A45G 5AW4B 2IFNA 4TLFA 1ZXGA 3AE8C 3L74G 1AVYA 3CXHD 3BATA 3PH0A 2PAJA 1RF1B 2PP6A 2N1TB 1KB9H 3SWKA 1FDIA 3Q1MA 5GTHE 1T3JA 2XU6A 3L75D 1RE3C 1CI6B 1XTGB 4YXWH 1PV3A 2QJPC 1WT6A 3LW5J 5CBNA 3L75G 4W7ZA 3L35A 4D6TJ 5AVTB 3ABVC 2ITAA 3CCRP 4L76A 2IZ1A 1NYHA 3F89A 3CX5I 1AJYA 4I1LA 1M1JC 1P84H 2K9JA 1AV1A 3MP7B 2JKVA 3BASA 1VDFA 4LGDE 1NTMD 5KAFE 4C7NB 2MJZA 1NU1D 5CCHC 2E74D 3BRTB 3H1JE 1SQBK 2FXMA 3RGUA 4DZOA 1HF9A 2Z4EA 1NTMG 3V4QA 3Q5RA 2E75C 2BEZF 2FYUJ 1L0LD 2FXPA 1NU1G 2POHA 2WSCJ 1JY2O 1QX8A 1FDOA 4U7JA 1HH0A 1L0LG 1M56D 3TNUB 1HGZA 1SFCC 3GG2A 2V7QJ 2IBZG 1X79B 3W67A 4HJGH 5APSA 1LT9C 5AVWB 1PP9E 1URQA 1OWAA 2HLOA 1K05A 1CI6A 1VQ4P 3HE4B 4WY4A 2YIUC 3L71E 5AVXB 1FZBA 2KXPB 1EZVD 5TISE 1GZLA 1N7SA 2YO3A 3H1JD 5EFWB 2OYOA 3V2NA 4NPDA 3CCJP 3MZWB 3CCSP 1JM0A 3BRVB 3IF4A 2WT7B 1EZVG 2BCCE 1JY2P 3H1JG 2KZJA 5APUA 1KILD 1M7LA 3VN0A 3FWNA 1Y47A 5GTIH 1ZP0C 4L74A 1GK4A 3EQ2A 2Q3IA 2Y0CA 4IL6H 3CCEP 4L73A 4IL6X 1EDKA 3AE9C 2I1JA 1YQ4C 2ZT9D 4GDOA 4GODA 4K3AA 1P84I 4R4LA 5CCGC 3RL0D 2YKOA 2Q6QA 2E74B 1VQKP 1FZEA 3MD0A 1VQ6P 1X0TA 1KYOH 1PPJE 5AW7B 1FOSE 2PGDA 3RL0g 1JY3N 1Q2NA 2NPSB 2A45I 1J1DB 1R5SA 5AVQB 3A0HH 1Q7YQ 3A5TA 3P7KA 3VP9A 3RBXA 3C1LA 2FKWB 1RHZB 1VQMP 1JMBA 4RESB 2P7JA 1CZQA 1NAYA 3HE4A 2Y9ZA 1LP1A 1FC2C 3CPWO 2H8PD 2D2CC 1G1JA 2OYIA 1WMKA 1D7MA 1N73C 2FFDA 3CXHI 3RBZA 2G8YA 2Y0EA 2B88A 4DCKA 3P8CD 3AE3C 3JSVC 1BGYJ 3G3ZA 2OTLP 3A0BE 3L70E 2JEEA 4R4MA 1SQQE 3H1LE 2ZYGA 2C0WA 1LT1A 4N78E 5KLIC 1LTTC 3F5HA 4AYCA 2K9YA 2AXTH 4Y99C 1KILB 4GOEA 3S4RA 3CMEP 3OW2O 1NGMB 2NRGA 2OYHB 1IFNA 3KHUA 3CD6P 1PP9J 3JCUH 1K04A 2JJLA 3AEBC 1VQ9P 2OTKE 4JQ0D 1BDDA 3S1KA 2ZT9B 2QG4A 3L71J 3RL0B 3AE2C 2A06D 2M3BA 2L91A 2YXQB 3CWBE 1L0NE 3P8MC 5AVRB 1YJNP 1SQVJ 2JWAA 1IJDB 3H1ID 2QE7H 1MUUA 4C46A 3SFDC 1L2PA 4WBAA 1SLQA 2A06G 2J5UA 1GL2A 1G1IA 1MV8A 2ZAEB 1W5CE 4RO0A 3LIEA 1YI2P 1A02F 3A3YB 2W6JH 3H1IG 4JF7A 2W90A 1SQQD 2CK3H 4OVNF 5KKZC 1SQPE 4JYBA 2RMZA 4GOFA 5BU8B 3TGUD 3O6QB 1SQQG 1S2EA 3M06A 1N86A 1R5LA 2R3CA 1L4AD 3JC22 2QJYB 3TGUG 1LTSC 2ZXXA 3U59A 1X22A 2K3RA 1M1KQ 3I56P 1EZVI 1YHQP 1DEBA 5CHXA 2AEJA 1JEKA 4PV1D 2BEQD 1JY3P 2WSEH 2Y9YA 2KYVA 3VMAA 3L72E 2LR2A 5KJ7D 1URQD 1BSNA 4WY4D 1EXIA 2XKMA 3RK3B 1FZFA 4BWNA 1S4XA 1ZN5A 1MFTA 2FYUE 3H32B 1JCCA 4B86A 1N7SD 3CX5H 5TJHA 3GHGB 5KLVE 2BASA 1AQ5A 1OFCX 1T8ZA 1GK6A 4BXLA 4HYTB 2QM8A 1M1JA 5AW0B 3L70J 2OGUA 4GT1A 1LTJC 4W7YA 3H1LJ 4D6TD 1S5LH 5APQA 3AE5C 2Q7CA 5APVA 1L0NK 3WUVA 1VQOP 4IFMA 3HUSC 2WVRA 5AW5B 4H13D 2NPSC 2K9JB 3HD7C 4D6TG 3O6QA 1KQFB 3BCCE 1SQXJ 3AECC 3QH9A 1FZAA 2KSEA 4DOJA 1NTKE 2K1AA 2ZYDA 3RK2C 3E1RA 2QA4P 1SQPK 3CWBJ 1L0NJ 1USDA 1L4AB 2Q1KA 1SFCA 3G4SP 1FZCC 1BCCJ 1OW8A 1AQTA 5E79H 3USSA 4EOTA 1BE3E 2V4HA 1KMIZ 1LT9A 5GTIE 2E5YA 4LC1A 1IC2A 5H2FH 1SQBD 3M91A 4PV1B 3PHLA 3SSUA 5CJ4A 1SQPJ 2DW3A 1GW3A 1XTCC 1OIPA 1URQB 3H32A 4WY4B 1KYOE 3U1CA 1SQBG 3GHGA 1LWUC 3R4YA 5DJTB 3B5NA 1AFOA 3AEAC 2O01H 1Y9BA 1IFJA 1N7SB 3V5BA 2QJKB 3S9OA 1PZQA 3MTUE 2HR3A 4QMAA 1PGQA 3FX0A 3V2QA 2H43A 3EFGA 1H0TA 1YBKA 1GTWA 2E76C 4NPFX 2FYUK 2ZVNB 4PD4E 4EIJA 2JR8A 5KLVK 2O1KA 2WTYA 5CCGA 3C8VA 3L72J 3IR9A 2FYNC 4OGQC 4H13B 2ZYAA 3HRNA 1KV4A 2QSIA 1DX7A 1QLED 4M3LA 1VF5D 1IO4A 2A45H 2Q9IA 1BGYE 1L4AA 3FGAD 1LTIC 2N9BA 1K73Q 2Q3EA 5KLVJ 1M90Q 1W2EA 3WUUA 3L73E 2CPBA 3H1HE 1ZRTE 3B8EB 2PRRA 1NH4A 1GL2D 3QWOC 2IPPA 3IFMA 2IDBA 2AXTE 1NTKK 3GF7A 1UIIA 3CC2P 3CXHH 1EDLA 1N73A 4N3YB 2Z5HA 5KJ7A 1YJWP 2WITA 1K9MQ 4IFDK 1LP1B 4Y28J 3FXEA 3PP5A 3BCCJ 3PTZA 3ITKA 2OYIB 3LIDA 2FFDB 3L75J 2E42A 1QL2A 3MIWA 5KAIE 1NOHA 2HFED 2FY8A 3AE7C 1NTKJ 1SQVE 1EXJA 3NFQA 2XNXA 1VQPP 3MHVA 3KZIH 1ZR4A 1VQ7P 3RK3C 5APTA 1BGYD 3VOPA 2YMYA 1G2CA 1FU1A 2OARA 4WVZA 1BE3J 2RKLA 1FJPA 2HODA 4EI2A 4H0LC 1YITP 2R44A 1BGYG 4O9BA 2G3AA 3M0DC 1KTMA 2R5BA 1NTMJ 1Q81Q 4PJ0E 5AVYB 1JMMA 5APXA 4OWFA 1PP9D 2HPCA 1DH3A 2KIKA 1VF5B 1IFPA 5B66H 3L71D 4ASWA 3BVHA 4H44C 2L5GB 5GTHH 2KS1A 3MGNA 4GIFA 1PP9G 2H88C 3CCMP 3G6EP 1FZGA 5AVUB 5B5EE 3L71G 3TF5A 5AW3B 2O3JA 3D6ZA 1GL2B 1H88A 1M8OB 3VMYA 2BCCD 1J1EC 3CL3D 5CCHD 1OMIA 2WSFH 2K88A 3MUDC 4XE5B 1U7MA 3U1AA 3KQGA 3C9IA 2E75D 4CPGA 2BCCG 3AE6C 2B89A 3CCLP 5BU5A 1DD4A 2K37A 4XFJA 1T2KC 5KAFH 1N7LA 2AEFA 1RF1C 3CX5E 2N1TC 4I7ZB 3L4FA 4I2LC 3WU2H 1SFCD 2O1JA 3CC7P 1PPJD 3L73J 3HTKA 2B9BA 3H1HJ 1JNMA 1HGVA 2M8RA 1JTHA 3E7KA 1JUNA 1SQVK 3H1KE 1GW4A 1PPJG 1R8EA 2AEMA 4L75A 4UB8H 1BDCA 2W83C 1SVFA 4ZKUA 1SQXE 1PGOA 2RN0A 3M0AA 3I55P 3H25A 2QJPB 2LXCB 2XNDH 3B5ND 1NKNA 3V2RA 1ZLLA 3B4SA 1HUCA 4U3FE 1BCCE 2KLVA 4DT0A 2YNYA 1S9KE 5E79E 5TISH 1EDJA 4YXDC 1M1JB 2KK7A 3L70D 1QL1A 3H1LD 4RKUJ 1GDTA 2WPSA 5H2FE 4N78D 5CCGD 1LTGC 1KB9E 4W80A 3TYYA 1VQ5P 1CW5A 1WRGA 3L70G 2B87A 1FJKA 3OAKA 1A02J 3H1LG 2E75B 1HTLC 4IFFA 1SP4A 2FXOA 1FZCA 3VTPC 1DEEG 2XZRA 1NTZE 1M57D 1OW6A 3SWYA 1OZHA 1VL2A 1SFCB 2XV5A 3CWBD 1L0ND 2E5TA 1BCCD 1KFNA 1P84E 1H8AA 5AW9B 1S9KD 3AE4C 1LT9B 3KDPB 2D2CD 3NTNA 2WSEJ 1RE3A 3CWBG 1L0NG 4N6JA 2YIUB 1QGKB 3V4WA 3CCVP 2WWWA 1BCCG 1LWUA 2N9YB 4ZNCA 1GMJA 2Y0DA 1DIPA 3KPEA 3GLMA 1KB9D 1SQPD 5M1BA 2NZ2A 5AVZB 2P67A 3PJSK 3B5NB 4LLHA 4UB6H 1SQXK 3L74E 1NKZB 1SQPG 3E1IA 2UWJE 3CMAP 2E74C 2I1KA 2C9LY 2I8DA 4K35A 1S5LX 1PGJA 4KJMA 1H0TB 2YKPA 3A0BH 5CCHA 3CXHE 2IYOA 3H6PA 1YTZI 3H1KJ 1SS1A 1J1DC 4BRYA 2KP8A 1NO4A 3AE1C 3G9RA 1H89A 3L72D 3L75E 1K8AQ 1LJ2A 1EQ7A 1NAFA 4AUWA 4AQRD 4EYYQ 5AW8B 4TT3H 1Z56A 3L72G 2FBWC 3R2PA 2KNCA 1YTZT 3KZIE 3O8ZA 1HJBA 4U3FJ 2FYUD 2R5DA 1CSBA 2GUSA 1T3UA 1MKMA 5KLVD 1T6AA 1RE4C 4DJGA 3WMM0 3CI9A 4I7ZC 2FYUG 1NTZK 4IL6E 3UIAA 1AA0A 1USEA 2H7HA 5KLVG 2WPQA 2D2CB 1NTME 1N73B 2YO2A 1KORA 1U7JA 3IN6A 1IK9A 1NU1E 4YPCA 1KILC 1GD2E 1MFZA 4ZMDA 1RF0C 5B66E 3BCCD 2OYHC 2WPVB 1L0LE 2IFMA 2O01J 1NTZJ 1N2DC 1J2JB 2ZT9C 1NTKD 2IBZE 3LW5H 3RL0C 5KLIB 1HBWA 3A0HE 3VMXA 3BCCG 4Y99B 2O01N 1G2CB 2P2UA 1NJIQ 3Q2YA 3M0DA 1E5WA 1KQLA 1S72P 3GW6A 1BE3D 1NTKG 5KTBA 2HODB 2QRXA 1RH5B 1HVVA 1GU5A 3PLNA 4HH2A 1JB0J 2C0XA 1BE3G 1ZMEC 1QVFO 3B71A 1AVOA 3FXDA 1EZVE 2HPCB 1KZUB 4C7RA 1KYOD 1OVRA 3WU2E 2KS1B 3L74J 3T97A 1JOCA 3HE5A 3KXDA 5AW1B 1MZ9A 2WSCH 1KD1Q 3MUDA 2ZJSE 2NPSD 5AVSB 3HD7D 1KILE 2WZ7A 2QJYC 2IBZD 5KKZB 4NPEA 3M9BA 4UB8E 2YMKA 1PIXA 4PD4D 3JCUE 3W68A 3P32A 1SQBJ 2V7QH 1RF1A 2J58A 2N1TA 3RK2D 1HJ0A 2IZ0A 2W6BA 2KOGA 1HWTC 4ASVA 3L37A 3TSIA 3EFFK 1U57A 1PFIA 1NTMK 2QEXP 1NU1K 1KB9I 1FE6A 3HTKB 3OA7A 3GHGC 5L8RJ 4Z1MH 1OVUA 3L73D 1QEXA 3H1HD 1ZRTD 4IOIH 3GMAA 3B5NC 1L0LK 1JTHB 1NWQA 1VPCA 4I6MC 2ZXEB 2W8ZA 1BSHA 2OQQA 2MKVA 3L73G 3CCQP 3H1HG 3N7NA 1OW7A 4C7NA 1NU1J 5CMZA 1NHLA 2GM4A 1GU4A 3P8CE 1UIXA 3Q5PA 1LGHB 1L0LJ 5CJ0A 2E76D 1N8RQ 2WPRA 3WUTA 1VQLP 1LTJB 3KYQA 1ZOYC 1SQVD 1EDIA 3A2AA 2KUBA 3VMZA 3HUSB 2GA1A 2YXRB 2C9NY 5DJUB 1LTAC 4OGQD 1PL5A 1VQ8P 1L4AC 3HD7B 3TNUA 3CC4P 3D71A 2R32A 5AW6B 2WSFJ 1SQVG 3CLQA 2KB7P 4PD4H 1IFIA 1RY3A 3RK3E 2KSJA 4YTPC 1PGPA 2AXCA 1KN7A 1IK7A 3OJAB 2J59M 2B87B 4PV1C 1E79H 3RK2B 2A06E 3NXSA 4RJTA 1FZCB 4UB6E 3H1JJ 1Y8AA 1URQC 5KJ7C 3H1IE 4WY4C 2M3EA 3AEEC 1ZV8A 1S5LE 2QVAA 3N4XA 3TK1A 2WT7A 3A7OA 1N7SC 1VQNP 4JBZA 5AW2B 2QJKC 5C39A 1EC5A 1NVOA 2KLUA 2GUVA 2W6AA 2M5AB 2YKQA 2FYZA 4OH8B 1LWUB 1KFMA 1ZR2A 1QVGO 3TGUE 2LKMA 3M9HA 2WQYC 3RK3D 3NMDA 2CPSA 4H13C 1LTJA 2VRSA 2P58A 1KC8Q 3CCUP 2XDJA 1OXZA 2E76B 3AEFC 3CX5D 2HG5D 1KQGB 3HUSA 5KAIH 4H0LD 2KI7B 3GF3A 2NPSA
chains in the Genus database with same CATH topology
3H6PA 1YTZI 3HD7A 3HRNA 3V2PA 1J1DC 5AW7B 1FOSE 1DX7A 4M3LA 1IO4A 2A45H 2KP8A 1NO4A 1JY3N 2Q9IA 1H89A 1L4AA 4KHXA 1LTIC 1JY3O 2N9BA 2NPSB 2A45I 1J1DB 1EQ7A 2Q5UA 1NAFA 1W2EA 2IX7C 5AVQB 1X9VA 4AUWA 4AQRD 5APYA 2CPBA 3A5TA 1FAVA 3B8EB 3P7KA 4WB4A 5AW8B 1Z56A 1NH4A 3VP9A 1GL2D 1FOSF 3R2PA 2FKWB 1YTZT 3O8ZA 1HJBA 2IPPA 1IFMA 4RESB 3IFMA 2P7JA 1CZQA 2R5DA 1CSBA 3HE4A 2GUSA 1T3UA 1NTKK 1RE4A 1RE4C 2P1JA 2H8PD 2QM7A 1N73A 1G1JA 2OYIA 4N3YB 1N73C 2FFDA 3WMM0 2OYIC 2Z5HA 5KJ7A 2FFDC 3CI9A 1NTZK 3UIAA 2WITA 4IFDK 2H7HA 3P8CD 3PP5A 2WPQA 1N73B 2YO2A 2OYIB 1X8YA 5BVZA 3LIDA 2FFDB 3G3ZA 2E42A 1QL2A 1IK9A 5AVVB 3MIWA 1NOHA 2W27A 2HFED 1KILA 1LTBC 2JEEA 2HYNA 3NFQA 1KILC 1GD2E 1T2KD 1MFZA 3VYIA 1RF0A 2XNXA 2C0WA 1RF0C 4N78E 2OYHA 1ZR4A 2N1TD 3I5CA 2OYHC 3RK3C 1LTTC 5APTA 4AYCA 2IFMA 3VOPA 2YMYA 1G2CA 1FU1A 4Y99C 1N2DC 1KILB 1J2JB 2OARA 1SQQK 3LW5H 3VP8A 1FJPA 3M9QA 3RL0C 2OYHB 1HBWA 1IFNA 2HODA 3VMXA 2Z5IA 2JJLA 4JYCA 4Y99B 1G2CB 2P2UA 3M0DA 4O9BA 3M0DC 1E5WA 1KQLA 3RL0B 1JCDA 2R5BA 5KTBA 2HODB 2M3BA 1JMMA 5AVYB 1HVVA 5APXA 1GU5A 3SWFA 3P8MC 2HPCA 5AVRB 1DH3A 4HH2A 1IJDB 1FBMA 1MUUA 2C0XA 3BVHA 4C46A 2L5GB 4WBAA 2E43A 1SLQA 1GL2A 1G1IA 3MGNA 1MV8A 4GIFA 1GL2C 3II6A 2HPCB 3LIEA 1KZUB 1A02F 1FZGA 1JO5A 3A3YB 2ZFCA 4C7RA 5AVUB 4JF7A 1YYCA 5AW3B 3L36A 3T97A 1JOCA 1GL2B 1H88A 3VMYA 3HE5A 5AW1B 1MZ9A 2WSCH 1J1EC 3CL3D 1JY2N 4ZKPA 5CCHD 4JYBA 2WSFH 1IFDA 3MUDA 2NPSD 5AVSB 5BU8B 3HD7D 2WZ7A 4XE5B 4XA4A 3U1AA 3KQGA 3C9IA 3M9BA 3HE5B 4GKGA 3M06A 5APWA 1FDMA 1J1EB 2A45G 1N86A 2R3CA 5AW4B 1L4AD 3P32A 5BU5A 1T2KC 1N7LA 1RF1A 2IFNA 2J58A 1RF1C 2N1TA 1LTSC 3U59A 2N1TC 3RK2D 2W6BA 2KOGA 1HWTC 3BATA 3L4FA 4I2LC 3L37A 3TSIA 1SFCD 1DEBA 2PAJA 2O1JA 5CHXA 1PFIA 1RF1B 2PP6A 3HTKA 1NTMK 2N1TB 1JNMA 1JY3P 2WSEH 2KYVA 1HGVA 2M8RA 1NU1K 1JTHA 1T3JA 2XU6A 1JUNA 1RE3C 1CI6B 1URQD 5KJ7D 1SQVK 1GW4A 1XTGB 3HTKB 3OA7A 4WY4D 2XKMA 3GHGC 3RK3B 1FZFA 1WT6A 1SVFA 4ZKUA 3B5NC 1L0LK 1JTHB 1NWQA 1VPCA 1ZN5A 4I6MC 4W7ZA 2ZXEB 3H32B 3L35A 1JCCA 3M0AA 4B86A 1N7SD 5AVTB 3GHGB 2BASA 1AQ5A 1T8ZA 3N7NA 1GK6A 4C7NA 3B5ND 1NKNA 4I1LA 3V2RA 1ZLLA 4HYTB 5CMZA 1NHLA 2QM8A 1M1JA 5AW0B 2GM4A 1GU4A 1HUCA 1M1JC 2KLVA 4GT1A 1LTJC 4W7YA 2YNYA 1S9KE 3BASA 3P8CE 1VDFA 1LGHB 4LGDE 5APQA 2Q7CA 5APVA 4C7NB 5CJ0A 2MJZA 1L0NK 2WPRA 4IFMA 1M1JB 3HUSC 5CCHC 1LTJB 3BRTB 5AW5B 3KYQA 1SQBK 2NPSC 3HD7C 2FXMA 1QL1A 3A2AA 3VMZA 1GDTA 2WPSA 4DZOA 2Z4EA 3V4QA 4N78D 5CCGD 1LTGC 3HUSB 2C9NY 4W80A 1LTAC 3TYYA 1FZAA 1L4AC 2POHA 1CW5A 3HD7B 1WRGA 3TNUA 1JY2O 2R32A 5AW6B 4DOJA 3CLQA 1FJKA 3OAKA 1A02J 1HTLC 2KB7P 4IFFA 3RK2C 1SP4A 1SQPK 1IFIA 1RY3A 2KSJA 1L4AB 1HH0A 1FZCA 1SFCA 3OJAB 3VTPC 1FZCC 3TNUB 1HGZA 1SFCC 2J59M 2XZRA 4EOTA 3RK2B 3SWYA 1X79B 3NXSA 5APSA 1LT9A 1FZCB 1LT9C 1SFCB 2XV5A 5AVWB 1URQA 1OWAA 4LC1A 2HLOA 5KJ7C 1URQC 1CI6A 1IC2A 3HE4B 4WY4A 3M91A 4WY4C 1KFNA 1ZV8A 5AW9B 1H8AA 5CJ4A 5AVXB 1S9KD 1FZBA 3N4XA 1LT9B 3KDPB 1GW3A 3TK1A 1XTCC 3NTNA 2WT7A 1URQB 1RE3A 1GZLA 1N7SA 4N6JA 3H32A 3A7OA 1N7SC 3V4WA 2YO3A 2WWWA 4WY4B 5AW2B 3U1CA 1LWUA 3GHGA 1LWUC 2GUVA 3V2NA 2W6AA 3B5NA 1AFOA 2O01H 3BRVB 2YKQA 3KPEA 1IFJA 2WT7B 1N7SB 3V5BA 2FYZA 4OH8B 1JY2P 3MTUE 1LWUB 1KFMA 1ZR2A 5APUA 1KILD 1M7LA 5AVZB 3VN0A 2P67A 3V2QA 2LKMA 2H43A 3B5NB 3EFGA 4LLHA 3M9HA 1SQXK 1GK4A 3EQ2A 1GTWA 2Q3IA 1NKZB 3RK3D 2FYUK 3NMDA 3E1IA 2I1KA 4EIJA 2CPSA 1LTJA 2C9LY 2VRSA 2I1JA 5KLVK 2O1KA 2XDJA 1OXZA 2WTYA 5CCGA 5CCGC 3RL0D 3IR9A 2YKOA 2HG5D 2YKPA 3HUSA 5CCHA 1FZEA 3MD0A 2NPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HD7 A;  3RL0 C;  3TSI A;  3RK2 C;  1SFC D;  1L4A B;  2PP6 A;  1SFC A;  2N1T B;  1SFC C;  3M0D C;  2M8R A;  1L4A A;  1JTH A;  3RL0 B;  1T3J A;  2NPS B;  3RK2 B;  5KJ7 D;  1URQ D;  1HVV A;  1XTG B;  3HTK B;  1SFC B;  4WY4 D;  1URQ A;  5KJ7 C;  1URQ C;  3RK3 B;  4WY4 A;  3B5N C;  1JTH B;  4WY4 C;  1GL2 D;  4W7Z A;  1N7S D;  1GL2 A;  1GL2 C;  1URQ B;  1N7S A;  2H8P D;  1N7S C;  4WY4 B;  3B5N D;  4JF7 A;  5KJ7 A;  1NHL A;  1GL2 B;  3B5N A;  4W7Y A;  1N7S B;  3P8C E;  3PP5 A;  4OH8 B;  4LGD E;  5CCH D;  2NPS D;  3HD7 D;  2WZ7 A;  1KIL D;  5CCH C;  3B5N B;  3KYQ A;  2HFE D;  2NPS C;  1KIL A;  3HD7 C;  1KIL C;  3RK3 D;  1L4A D;  4N78 E;  5CCG D;  2N1T D;  3RK3 C;  4W80 A;  2XDJ A;  3VOP A;  5CCG A;  1L4A C;  2N1T A;  2YMY A;  3HD7 B;  1KIL B;  5CCG C;  2N1T C;  3RL0 D;  3RK2 D;  2HG5 D;  5CCH A;  2KOG A;  2NPS A; 
#chains in the Genus database with same CATH topology
 3HD7 A;  1Q86 Q;  3V2P A;  1KYO I;  2LXB A;  2FYN B;  4OGQ B;  1S1C X;  2BCC J;  4WWI A;  4KHX A;  1JY3 O;  2QIW A;  2Q5U A;  1Q82 Q;  3H1K D;  4BRY B;  2IX7 C;  1YIJ P;  1X9V A;  5APY A;  4H44 D;  2JP3 A;  2IBZ I;  1FAV A;  4WB4 A;  4HB1 A;  1SQX D;  1FOS F;  1YQ3 C;  1RQV A;  1OVV A;  1IFM A;  4PD4 I;  4EDF A;  2WSS H;  3H1K G;  4PJ0 H;  1RE4 A;  5K5G B;  2P1J A;  3EWK A;  3FWL A;  2QM7 A;  2P10 A;  1SQX G;  1OX3 A;  2OYI C;  2JWD A;  1S3J A;  2KNC B;  2FFD C;  3G71 P;  4U3F D;  4D6T E;  3SFE C;  1X8Y A;  5BVZ A;  2OTJ P;  2M5A A;  3PRJ A;  5AVV B;  5B5E H;  1DD3 A;  2W27 A;  1KIL A;  1LTB C;  4U3F G;  2HYN A;  1T2K D;  2ZVO B;  1RF0 A;  3VYI A;  2OYH A;  3AEG C;  1RQU A;  2N1T D;  3I5C A;  1IZN B;  2KZI A;  4A7P A;  1KQS O;  3V6I A;  4MN4 C;  1SQQ K;  1YJ9 P;  3VP8 A;  3M9Q A;  3AED C;  1Q90 D;  2Z5I A;  4JYC A;  1W2B O;  2R3S A;  3H1I J;  1NTZ D;  2IYP A;  1VF5 C;  1JCD A;  4HKZ H;  4H0L B;  4KT0 J;  3SWF A;  4JPZ B;  1NTZ G;  1SQB E;  1SQQ J;  1FBM A;  2PFX A;  1P84 D;  1ZW0 A;  2WMM A;  2E43 A;  2M0B A;  1GL2 C;  2JDI H;  3II6 A;  2JO1 A;  3Q5S A;  1JO5 A;  2ZFC A;  3TGU J;  3K5B A;  4H44 B;  2RH0 A;  1YYC A;  3L36 A;  3IAO A;  2H89 C;  3D70 A;  5CBO A;  3ZDM A;  3Q3D A;  4ZKP A;  1JY2 N;  3TDK A;  1IFD A;  1TU3 F;  4XA4 A;  3T97 B;  3D6Y A;  1LNQ A;  2SPZ A;  3HE5 B;  3L74 D;  4GKG A;  1FS0 E;  5APW A;  1FDM A;  1J1E B;  2A45 G;  5AW4 B;  2IFN A;  4TLF A;  1ZXG A;  3AE8 C;  3L74 G;  1AVY A;  3CXH D;  3BAT A;  3PH0 A;  2PAJ A;  1RF1 B;  2PP6 A;  2N1T B;  1KB9 H;  3SWK A;  1FDI A;  3Q1M A;  5GTH E;  1T3J A;  2XU6 A;  3L75 D;  1RE3 C;  1CI6 B;  1XTG B;  4YXW H;  1PV3 A;  2QJP C;  1WT6 A;  3LW5 J;  5CBN A;  3L75 G;  4W7Z A;  3L35 A;  4D6T J;  5AVT B;  3ABV C;  2ITA A;  3CCR P;  4L76 A;  2IZ1 A;  1NYH A;  3F89 A;  3CX5 I;  1AJY A;  4I1L A;  1M1J C;  1P84 H;  2K9J A;  1AV1 A;  3MP7 B;  2JKV A;  3BAS A;  1VDF A;  4LGD E;  1NTM D;  5KAF E;  4C7N B;  2MJZ A;  1NU1 D;  5CCH C;  2E74 D;  3BRT B;  3H1J E;  1SQB K;  2FXM A;  3RGU A;  4DZO A;  1HF9 A;  2Z4E A;  1NTM G;  3V4Q A;  3Q5R A;  2E75 C;  2BEZ F;  2FYU J;  1L0L D;  2FXP A;  1NU1 G;  2POH A;  2WSC J;  1JY2 O;  1QX8 A;  1FDO A;  4U7J A;  1HH0 A;  1L0L G;  1M56 D;  3TNU B;  1HGZ A;  1SFC C;  3GG2 A;  2V7Q J;  2IBZ G;  1X79 B;  3W67 A;  4HJG H;  5APS A;  1LT9 C;  5AVW B;  1PP9 E;  1URQ A;  1OWA A;  2HLO A;  1K05 A;  1CI6 A;  1VQ4 P;  3HE4 B;  4WY4 A;  2YIU C;  3L71 E;  5AVX B;  1FZB A;  2KXP B;  1EZV D;  5TIS E;  1GZL A;  1N7S A;  2YO3 A;  3H1J D;  5EFW B;  2OYO A;  3V2N A;  4NPD A;  3CCJ P;  3MZW B;  3CCS P;  1JM0 A;  3BRV B;  3IF4 A;  2WT7 B;  1EZV G;  2BCC E;  1JY2 P;  3H1J G;  2KZJ A;  5APU A;  1KIL D;  1M7L A;  3VN0 A;  3FWN A;  1Y47 A;  5GTI H;  1ZP0 C;  4L74 A;  1GK4 A;  3EQ2 A;  2Q3I A;  2Y0C A;  4IL6 H;  3CCE P;  4L73 A;  4IL6 X;  1EDK A;  3AE9 C;  2I1J A;  1YQ4 C;  2ZT9 D;  4GDO A;  4GOD A;  4K3A A;  1P84 I;  4R4L A;  5CCG C;  3RL0 D;  2YKO A;  2Q6Q A;  2E74 B;  1VQK P;  1FZE A;  3MD0 A;  1VQ6 P;  1X0T A;  1KYO H;  1PPJ E;  5AW7 B;  1FOS E;  2PGD A;  3RL0 g;  1JY3 N;  1Q2N A;  2NPS B;  2A45 I;  1J1D B;  1R5S A;  5AVQ B;  3A0H H;  1Q7Y Q;  3A5T A;  3P7K A;  3VP9 A;  3RBX A;  3C1L A;  2FKW B;  1RHZ B;  1VQM P;  1JMB A;  4RES B;  2P7J A;  1CZQ A;  1NAY A;  3HE4 A;  2Y9Z A;  1LP1 A;  1FC2 C;  3CPW O;  2H8P D;  2D2C C;  1G1J A;  2OYI A;  1WMK A;  1D7M A;  1N73 C;  2FFD A;  3CXH I;  3RBZ A;  2G8Y A;  2Y0E A;  2B88 A;  4DCK A;  3P8C D;  3AE3 C;  3JSV C;  1BGY J;  3G3Z A;  2OTL P;  3A0B E;  3L70 E;  2JEE A;  4R4M A;  1SQQ E;  3H1L E;  2ZYG A;  2C0W A;  1LT1 A;  4N78 E;  5KLI C;  1LTT C;  3F5H A;  4AYC A;  2K9Y A;  2AXT H;  4Y99 C;  1KIL B;  4GOE A;  3S4R A;  3CME P;  3OW2 O;  1NGM B;  2NRG A;  2OYH B;  1IFN A;  3KHU A;  3CD6 P;  1PP9 J;  3JCU H;  1K04 A;  2JJL A;  3AEB C;  1VQ9 P;  2OTK E;  4JQ0 D;  1BDD A;  3S1K A;  2ZT9 B;  2QG4 A;  3L71 J;  3RL0 B;  3AE2 C;  2A06 D;  2M3B A;  2L91 A;  2YXQ B;  3CWB E;  1L0N E;  3P8M C;  5AVR B;  1YJN P;  1SQV J;  2JWA A;  1IJD B;  3H1I D;  2QE7 H;  1MUU A;  4C46 A;  3SFD C;  1L2P A;  4WBA A;  1SLQ A;  2A06 G;  2J5U A;  1GL2 A;  1G1I A;  1MV8 A;  2ZAE B;  1W5C E;  4RO0 A;  3LIE A;  1YI2 P;  1A02 F;  3A3Y B;  2W6J H;  3H1I G;  4JF7 A;  2W90 A;  1SQQ D;  2CK3 H;  4OVN F;  5KKZ C;  1SQP E;  4JYB A;  2RMZ A;  4GOF A;  5BU8 B;  3TGU D;  3O6Q B;  1SQQ G;  1S2E A;  3M06 A;  1N86 A;  1R5L A;  2R3C A;  1L4A D;  3JC2 2;  2QJY B;  3TGU G;  1LTS C;  2ZXX A;  3U59 A;  1X22 A;  2K3R A;  1M1K Q;  3I56 P;  1EZV I;  1YHQ P;  1DEB A;  5CHX A;  2AEJ A;  1JEK A;  4PV1 D;  2BEQ D;  1JY3 P;  2WSE H;  2Y9Y A;  2KYV A;  3VMA A;  3L72 E;  2LR2 A;  5KJ7 D;  1URQ D;  1BSN A;  4WY4 D;  1EXI A;  2XKM A;  3RK3 B;  1FZF A;  4BWN A;  1S4X A;  1ZN5 A;  1MFT A;  2FYU E;  3H32 B;  1JCC A;  4B86 A;  1N7S D;  3CX5 H;  5TJH A;  3GHG B;  5KLV E;  2BAS A;  1AQ5 A;  1OFC X;  1T8Z A;  1GK6 A;  4BXL A;  4HYT B;  2QM8 A;  1M1J A;  5AW0 B;  3L70 J;  2OGU A;  4GT1 A;  1LTJ C;  4W7Y A;  3H1L J;  4D6T D;  1S5L H;  5APQ A;  3AE5 C;  2Q7C A;  5APV A;  1L0N K;  3WUV A;  1VQO P;  4IFM A;  3HUS C;  2WVR A;  5AW5 B;  4H13 D;  2NPS C;  2K9J B;  3HD7 C;  4D6T G;  3O6Q A;  1KQF B;  3BCC E;  1SQX J;  3AEC C;  3QH9 A;  1FZA A;  2KSE A;  4DOJ A;  1NTK E;  2K1A A;  2ZYD A;  3RK2 C;  3E1R A;  2QA4 P;  1SQP K;  3CWB J;  1L0N J;  1USD A;  1L4A B;  2Q1K A;  1SFC A;  3G4S P;  1FZC C;  1BCC J;  1OW8 A;  1AQT A;  5E79 H;  3USS A;  4EOT A;  1BE3 E;  2V4H A;  1KMI Z;  1LT9 A;  5GTI E;  2E5Y A;  4LC1 A;  1IC2 A;  5H2F H;  1SQB D;  3M91 A;  4PV1 B;  3PHL A;  3SSU A;  5CJ4 A;  1SQP J;  2DW3 A;  1GW3 A;  1XTC C;  1OIP A;  1URQ B;  3H32 A;  4WY4 B;  1KYO E;  3U1C A;  1SQB G;  3GHG A;  1LWU C;  3R4Y A;  5DJT B;  3B5N A;  1AFO A;  3AEA C;  2O01 H;  1Y9B A;  1IFJ A;  1N7S B;  3V5B A;  2QJK B;  3S9O A;  1PZQ A;  3MTU E;  2HR3 A;  4QMA A;  1PGQ A;  3FX0 A;  3V2Q A;  2H43 A;  3EFG A;  1H0T A;  1YBK A;  1GTW A;  2E76 C;  4NPF X;  2FYU K;  2ZVN B;  4PD4 E;  4EIJ A;  2JR8 A;  5KLV K;  2O1K A;  2WTY A;  5CCG A;  3C8V A;  3L72 J;  3IR9 A;  2FYN C;  4OGQ C;  4H13 B;  2ZYA A;  3HRN A;  1KV4 A;  2QSI A;  1DX7 A;  1QLE D;  4M3L A;  1VF5 D;  1IO4 A;  2A45 H;  2Q9I A;  1BGY E;  1L4A A;  3FGA D;  1LTI C;  2N9B A;  1K73 Q;  2Q3E A;  5KLV J;  1M90 Q;  1W2E A;  3WUU A;  3L73 E;  2CPB A;  3H1H E;  1ZRT E;  3B8E B;  2PRR A;  1NH4 A;  1GL2 D;  3QWO C;  2IPP A;  3IFM A;  2IDB A;  2AXT E;  1NTK K;  3GF7 A;  1UII A;  3CC2 P;  3CXH H;  1EDL A;  1N73 A;  4N3Y B;  2Z5H A;  5KJ7 A;  1YJW P;  2WIT A;  1K9M Q;  4IFD K;  1LP1 B;  4Y28 J;  3FXE A;  3PP5 A;  3BCC J;  3PTZ A;  3ITK A;  2OYI B;  3LID A;  2FFD B;  3L75 J;  2E42 A;  1QL2 A;  3MIW A;  5KAI E;  1NOH A;  2HFE D;  2FY8 A;  3AE7 C;  1NTK J;  1SQV E;  1EXJ A;  3NFQ A;  2XNX A;  1VQP P;  3MHV A;  3KZI H;  1ZR4 A;  1VQ7 P;  3RK3 C;  5APT A;  1BGY D;  3VOP A;  2YMY A;  1G2C A;  1FU1 A;  2OAR A;  4WVZ A;  1BE3 J;  2RKL A;  1FJP A;  2HOD A;  4EI2 A;  4H0L C;  1YIT P;  2R44 A;  1BGY G;  4O9B A;  2G3A A;  3M0D C;  1KTM A;  2R5B A;  1NTM J;  1Q81 Q;  4PJ0 E;  5AVY B;  1JMM A;  5APX A;  4OWF A;  1PP9 D;  2HPC A;  1DH3 A;  2KIK A;  1VF5 B;  1IFP A;  5B66 H;  3L71 D;  4ASW A;  3BVH A;  4H44 C;  2L5G B;  5GTH H;  2KS1 A;  3MGN A;  4GIF A;  1PP9 G;  2H88 C;  3CCM P;  3G6E P;  1FZG A;  5AVU B;  5B5E E;  3L71 G;  3TF5 A;  5AW3 B;  2O3J A;  3D6Z A;  1GL2 B;  1H88 A;  1M8O B;  3VMY A;  2BCC D;  1J1E C;  3CL3 D;  5CCH D;  1OMI A;  2WSF H;  2K88 A;  3MUD C;  4XE5 B;  1U7M A;  3U1A A;  3KQG A;  3C9I A;  2E75 D;  4CPG A;  2BCC G;  3AE6 C;  2B89 A;  3CCL P;  5BU5 A;  1DD4 A;  2K37 A;  4XFJ A;  1T2K C;  5KAF H;  1N7L A;  2AEF A;  1RF1 C;  3CX5 E;  2N1T C;  4I7Z B;  3L4F A;  4I2L C;  3WU2 H;  1SFC D;  2O1J A;  3CC7 P;  1PPJ D;  3L73 J;  3HTK A;  2B9B A;  3H1H J;  1JNM A;  1HGV A;  2M8R A;  1JTH A;  3E7K A;  1JUN A;  1SQV K;  3H1K E;  1GW4 A;  1PPJ G;  1R8E A;  2AEM A;  4L75 A;  4UB8 H;  1BDC A;  2W83 C;  1SVF A;  4ZKU A;  1SQX E;  1PGO A;  2RN0 A;  3M0A A;  3I55 P;  3H25 A;  2QJP B;  2LXC B;  2XND H;  3B5N D;  1NKN A;  3V2R A;  1ZLL A;  3B4S A;  1HUC A;  4U3F E;  1BCC E;  2KLV A;  4DT0 A;  2YNY A;  1S9K E;  5E79 E;  5TIS H;  1EDJ A;  4YXD C;  1M1J B;  2KK7 A;  3L70 D;  1QL1 A;  3H1L D;  4RKU J;  1GDT A;  2WPS A;  5H2F E;  4N78 D;  5CCG D;  1LTG C;  1KB9 E;  4W80 A;  3TYY A;  1VQ5 P;  1CW5 A;  1WRG A;  3L70 G;  2B87 A;  1FJK A;  3OAK A;  1A02 J;  3H1L G;  2E75 B;  1HTL C;  4IFF A;  1SP4 A;  2FXO A;  1FZC A;  3VTP C;  1DEE G;  2XZR A;  1NTZ E;  1M57 D;  1OW6 A;  3SWY A;  1OZH A;  1VL2 A;  1SFC B;  2XV5 A;  3CWB D;  1L0N D;  2E5T A;  1BCC D;  1KFN A;  1P84 E;  1H8A A;  5AW9 B;  1S9K D;  3AE4 C;  1LT9 B;  3KDP B;  2D2C D;  3NTN A;  2WSE J;  1RE3 A;  3CWB G;  1L0N G;  4N6J A;  2YIU B;  1QGK B;  3V4W A;  3CCV P;  2WWW A;  1BCC G;  1LWU A;  2N9Y B;  4ZNC A;  1GMJ A;  2Y0D A;  1DIP A;  3KPE A;  3GLM A;  1KB9 D;  1SQP D;  5M1B A;  2NZ2 A;  5AVZ B;  2P67 A;  3PJS K;  3B5N B;  4LLH A;  4UB6 H;  1SQX K;  3L74 E;  1NKZ B;  1SQP G;  3E1I A;  2UWJ E;  3CMA P;  2E74 C;  2I1K A;  2C9L Y;  2I8D A;  4K35 A;  1S5L X;  1PGJ A;  4KJM A;  1H0T B;  2YKP A;  3A0B H;  5CCH A;  3CXH E;  2IYO A;  3H6P A;  1YTZ I;  3H1K J;  1SS1 A;  1J1D C;  4BRY A;  2KP8 A;  1NO4 A;  3AE1 C;  3G9R A;  1H89 A;  3L72 D;  3L75 E;  1K8A Q;  1LJ2 A;  1EQ7 A;  1NAF A;  4AUW A;  4AQR D;  4EYY Q;  5AW8 B;  4TT3 H;  1Z56 A;  3L72 G;  2FBW C;  3R2P A;  2KNC A;  1YTZ T;  3KZI E;  3O8Z A;  1HJB A;  4U3F J;  2FYU D;  2R5D A;  1CSB A;  2GUS A;  1T3U A;  1MKM A;  5KLV D;  1T6A A;  1RE4 C;  4DJG A;  3WMM 0;  3CI9 A;  4I7Z C;  2FYU G;  1NTZ K;  4IL6 E;  3UIA A;  1AA0 A;  1USE A;  2H7H A;  5KLV G;  2WPQ A;  2D2C B;  1NTM E;  1N73 B;  2YO2 A;  1KOR A;  1U7J A;  3IN6 A;  1IK9 A;  1NU1 E;  4YPC A;  1KIL C;  1GD2 E;  1MFZ A;  4ZMD A;  1RF0 C;  5B66 E;  3BCC D;  2OYH C;  2WPV B;  1L0L E;  2IFM A;  2O01 J;  1NTZ J;  1N2D C;  1J2J B;  2ZT9 C;  1NTK D;  2IBZ E;  3LW5 H;  3RL0 C;  5KLI B;  1HBW A;  3A0H E;  3VMX A;  3BCC G;  4Y99 B;  2O01 N;  1G2C B;  2P2U A;  1NJI Q;  3Q2Y A;  3M0D A;  1E5W A;  1KQL A;  1S72 P;  3GW6 A;  1BE3 D;  1NTK G;  5KTB A;  2HOD B;  2QRX A;  1RH5 B;  1HVV A;  1GU5 A;  3PLN A;  4HH2 A;  1JB0 J;  2C0X A;  1BE3 G;  1ZME C;  1QVF O;  3B71 A;  1AVO A;  3FXD A;  1EZV E;  2HPC B;  1KZU B;  4C7R A;  1KYO D;  1OVR A;  3WU2 E;  2KS1 B;  3L74 J;  3T97 A;  1JOC A;  3HE5 A;  3KXD A;  5AW1 B;  1MZ9 A;  2WSC H;  1KD1 Q;  3MUD A;  2ZJS E;  2NPS D;  5AVS B;  3HD7 D;  1KIL E;  2WZ7 A;  2QJY C;  2IBZ D;  5KKZ B;  4NPE A;  3M9B A;  4UB8 E;  2YMK A;  1PIX A;  4PD4 D;  3JCU E;  3W68 A;  3P32 A;  1SQB J;  2V7Q H;  1RF1 A;  2J58 A;  2N1T A;  3RK2 D;  1HJ0 A;  2IZ0 A;  2W6B A;  2KOG A;  1HWT C;  4ASV A;  3L37 A;  3TSI A;  3EFF K;  1U57 A;  1PFI A;  1NTM K;  2QEX P;  1NU1 K;  1KB9 I;  1FE6 A;  3HTK B;  3OA7 A;  3GHG C;  5L8R J;  4Z1M H;  1OVU A;  3L73 D;  1QEX A;  3H1H D;  1ZRT D;  4IOI H;  3GMA A;  3B5N C;  1L0L K;  1JTH B;  1NWQ A;  1VPC A;  4I6M C;  2ZXE B;  2W8Z A;  1BSH A;  2OQQ A;  2MKV A;  3L73 G;  3CCQ P;  3H1H G;  3N7N A;  1OW7 A;  4C7N A;  1NU1 J;  5CMZ A;  1NHL A;  2GM4 A;  1GU4 A;  3P8C E;  1UIX A;  3Q5P A;  1LGH B;  1L0L J;  5CJ0 A;  2E76 D;  1N8R Q;  2WPR A;  3WUT A;  1VQL P;  1LTJ B;  3KYQ A;  1ZOY C;  1SQV D;  1EDI A;  3A2A A;  2KUB A;  3VMZ A;  3HUS B;  2GA1 A;  2YXR B;  2C9N Y;  5DJU B;  1LTA C;  4OGQ D;  1PL5 A;  1VQ8 P;  1L4A C;  3HD7 B;  3TNU A;  3CC4 P;  3D71 A;  2R32 A;  5AW6 B;  2WSF J;  1SQV G;  3CLQ A;  2KB7 P;  4PD4 H;  1IFI A;  1RY3 A;  3RK3 E;  2KSJ A;  4YTP C;  1PGP A;  2AXC A;  1KN7 A;  1IK7 A;  3OJA B;  2J59 M;  2B87 B;  4PV1 C;  1E79 H;  3RK2 B;  2A06 E;  3NXS A;  4RJT A;  1FZC B;  4UB6 E;  3H1J J;  1Y8A A;  1URQ C;  5KJ7 C;  3H1I E;  4WY4 C;  2M3E A;  3AEE C;  1ZV8 A;  1S5L E;  2QVA A;  3N4X A;  3TK1 A;  2WT7 A;  3A7O A;  1N7S C;  1VQN P;  4JBZ A;  5AW2 B;  2QJK C;  5C39 A;  1EC5 A;  1NVO A;  2KLU A;  2GUV A;  2W6A A;  2M5A B;  2YKQ A;  2FYZ A;  4OH8 B;  1LWU B;  1KFM A;  1ZR2 A;  1QVG O;  3TGU E;  2LKM A;  3M9H A;  2WQY C;  3RK3 D;  3NMD A;  2CPS A;  4H13 C;  1LTJ A;  2VRS A;  2P58 A;  1KC8 Q;  3CCU P;  2XDJ A;  1OXZ A;  2E76 B;  3AEF C;  3CX5 D;  2HG5 D;  1KQG B;  3HUS A;  5KAI H;  4H0L D;  2KI7 B;  3GF3 A;  2NPS A; 
#chains in the Genus database with same CATH homology
 3H6P A;  1YTZ I;  3HD7 A;  3HRN A;  3V2P A;  1J1D C;  5AW7 B;  1FOS E;  1DX7 A;  4M3L A;  1IO4 A;  2A45 H;  2KP8 A;  1NO4 A;  1JY3 N;  2Q9I A;  1H89 A;  1L4A A;  4KHX A;  1LTI C;  1JY3 O;  2N9B A;  2NPS B;  2A45 I;  1J1D B;  1EQ7 A;  2Q5U A;  1NAF A;  1W2E A;  2IX7 C;  5AVQ B;  1X9V A;  4AUW A;  4AQR D;  5APY A;  2CPB A;  3A5T A;  1FAV A;  3B8E B;  3P7K A;  4WB4 A;  5AW8 B;  1Z56 A;  1NH4 A;  3VP9 A;  1GL2 D;  1FOS F;  3R2P A;  2FKW B;  1YTZ T;  3O8Z A;  1HJB A;  2IPP A;  1IFM A;  4RES B;  3IFM A;  2P7J A;  1CZQ A;  2R5D A;  1CSB A;  3HE4 A;  2GUS A;  1T3U A;  1NTK K;  1RE4 A;  1RE4 C;  2P1J A;  2H8P D;  2QM7 A;  1N73 A;  1G1J A;  2OYI A;  4N3Y B;  1N73 C;  2FFD A;  3WMM 0;  2OYI C;  2Z5H A;  5KJ7 A;  2FFD C;  3CI9 A;  1NTZ K;  3UIA A;  2WIT A;  4IFD K;  2H7H A;  3P8C D;  3PP5 A;  2WPQ A;  1N73 B;  2YO2 A;  2OYI B;  1X8Y A;  5BVZ A;  3LID A;  2FFD B;  3G3Z A;  2E42 A;  1QL2 A;  1IK9 A;  5AVV B;  3MIW A;  1NOH A;  2W27 A;  2HFE D;  1KIL A;  1LTB C;  2JEE A;  2HYN A;  3NFQ A;  1KIL C;  1GD2 E;  1T2K D;  1MFZ A;  3VYI A;  1RF0 A;  2XNX A;  2C0W A;  1RF0 C;  4N78 E;  2OYH A;  1ZR4 A;  2N1T D;  3I5C A;  2OYH C;  3RK3 C;  1LTT C;  5APT A;  4AYC A;  2IFM A;  3VOP A;  2YMY A;  1G2C A;  1FU1 A;  4Y99 C;  1N2D C;  1KIL B;  1J2J B;  2OAR A;  1SQQ K;  3LW5 H;  3VP8 A;  1FJP A;  3M9Q A;  3RL0 C;  2OYH B;  1HBW A;  1IFN A;  2HOD A;  3VMX A;  2Z5I A;  2JJL A;  4JYC A;  4Y99 B;  1G2C B;  2P2U A;  3M0D A;  4O9B A;  3M0D C;  1E5W A;  1KQL A;  3RL0 B;  1JCD A;  2R5B A;  5KTB A;  2HOD B;  2M3B A;  1JMM A;  5AVY B;  1HVV A;  5APX A;  1GU5 A;  3SWF A;  3P8M C;  2HPC A;  5AVR B;  1DH3 A;  4HH2 A;  1IJD B;  1FBM A;  1MUU A;  2C0X A;  3BVH A;  4C46 A;  2L5G B;  4WBA A;  2E43 A;  1SLQ A;  1GL2 A;  1G1I A;  3MGN A;  1MV8 A;  4GIF A;  1GL2 C;  3II6 A;  2HPC B;  3LIE A;  1KZU B;  1A02 F;  1FZG A;  1JO5 A;  3A3Y B;  2ZFC A;  4C7R A;  5AVU B;  4JF7 A;  1YYC A;  5AW3 B;  3L36 A;  3T97 A;  1JOC A;  1GL2 B;  1H88 A;  3VMY A;  3HE5 A;  5AW1 B;  1MZ9 A;  2WSC H;  1J1E C;  3CL3 D;  1JY2 N;  4ZKP A;  5CCH D;  4JYB A;  2WSF H;  1IFD A;  3MUD A;  2NPS D;  5AVS B;  5BU8 B;  3HD7 D;  2WZ7 A;  4XE5 B;  4XA4 A;  3U1A A;  3KQG A;  3C9I A;  3M9B A;  3HE5 B;  4GKG A;  3M06 A;  5APW A;  1FDM A;  1J1E B;  2A45 G;  1N86 A;  2R3C A;  5AW4 B;  1L4A D;  3P32 A;  5BU5 A;  1T2K C;  1N7L A;  1RF1 A;  2IFN A;  2J58 A;  1RF1 C;  2N1T A;  1LTS C;  3U59 A;  2N1T C;  3RK2 D;  2W6B A;  2KOG A;  1HWT C;  3BAT A;  3L4F A;  4I2L C;  3L37 A;  3TSI A;  1SFC D;  1DEB A;  2PAJ A;  2O1J A;  5CHX A;  1PFI A;  1RF1 B;  2PP6 A;  3HTK A;  1NTM K;  2N1T B;  1JNM A;  1JY3 P;  2WSE H;  2KYV A;  1HGV A;  2M8R A;  1NU1 K;  1JTH A;  1T3J A;  2XU6 A;  1JUN A;  1RE3 C;  1CI6 B;  1URQ D;  5KJ7 D;  1SQV K;  1GW4 A;  1XTG B;  3HTK B;  3OA7 A;  4WY4 D;  2XKM A;  3GHG C;  3RK3 B;  1FZF A;  1WT6 A;  1SVF A;  4ZKU A;  3B5N C;  1L0L K;  1JTH B;  1NWQ A;  1VPC A;  1ZN5 A;  4I6M C;  4W7Z A;  2ZXE B;  3H32 B;  3L35 A;  1JCC A;  3M0A A;  4B86 A;  1N7S D;  5AVT B;  3GHG B;  2BAS A;  1AQ5 A;  1T8Z A;  3N7N A;  1GK6 A;  4C7N A;  3B5N D;  1NKN A;  4I1L A;  3V2R A;  1ZLL A;  4HYT B;  5CMZ A;  1NHL A;  2QM8 A;  1M1J A;  5AW0 B;  2GM4 A;  1GU4 A;  1HUC A;  1M1J C;  2KLV A;  4GT1 A;  1LTJ C;  4W7Y A;  2YNY A;  1S9K E;  3BAS A;  3P8C E;  1VDF A;  1LGH B;  4LGD E;  5APQ A;  2Q7C A;  5APV A;  4C7N B;  5CJ0 A;  2MJZ A;  1L0N K;  2WPR A;  4IFM A;  1M1J B;  3HUS C;  5CCH C;  1LTJ B;  3BRT B;  5AW5 B;  3KYQ A;  1SQB K;  2NPS C;  3HD7 C;  2FXM A;  1QL1 A;  3A2A A;  3VMZ A;  1GDT A;  2WPS A;  4DZO A;  2Z4E A;  3V4Q A;  4N78 D;  5CCG D;  1LTG C;  3HUS B;  2C9N Y;  4W80 A;  1LTA C;  3TYY A;  1FZA A;  1L4A C;  2POH A;  1CW5 A;  3HD7 B;  1WRG A;  3TNU A;  1JY2 O;  2R32 A;  5AW6 B;  4DOJ A;  3CLQ A;  1FJK A;  3OAK A;  1A02 J;  1HTL C;  2KB7 P;  4IFF A;  3RK2 C;  1SP4 A;  1SQP K;  1IFI A;  1RY3 A;  2KSJ A;  1L4A B;  1HH0 A;  1FZC A;  1SFC A;  3OJA B;  3VTP C;  1FZC C;  3TNU B;  1HGZ A;  1SFC C;  2J59 M;  2XZR A;  4EOT A;  3RK2 B;  3SWY A;  1X79 B;  3NXS A;  5APS A;  1LT9 A;  1FZC B;  1LT9 C;  1SFC B;  2XV5 A;  5AVW B;  1URQ A;  1OWA A;  4LC1 A;  2HLO A;  5KJ7 C;  1URQ C;  1CI6 A;  1IC2 A;  3HE4 B;  4WY4 A;  3M91 A;  4WY4 C;  1KFN A;  1ZV8 A;  5AW9 B;  1H8A A;  5CJ4 A;  5AVX B;  1S9K D;  1FZB A;  3N4X A;  1LT9 B;  3KDP B;  1GW3 A;  3TK1 A;  1XTC C;  3NTN A;  2WT7 A;  1URQ B;  1RE3 A;  1GZL A;  1N7S A;  4N6J A;  3H32 A;  3A7O A;  1N7S C;  3V4W A;  2YO3 A;  2WWW A;  4WY4 B;  5AW2 B;  3U1C A;  1LWU A;  3GHG A;  1LWU C;  2GUV A;  3V2N A;  2W6A A;  3B5N A;  1AFO A;  2O01 H;  3BRV B;  2YKQ A;  3KPE A;  1IFJ A;  2WT7 B;  1N7S B;  3V5B A;  2FYZ A;  4OH8 B;  1JY2 P;  3MTU E;  1LWU B;  1KFM A;  1ZR2 A;  5APU A;  1KIL D;  1M7L A;  5AVZ B;  3VN0 A;  2P67 A;  3V2Q A;  2LKM A;  2H43 A;  3B5N B;  3EFG A;  4LLH A;  3M9H A;  1SQX K;  1GK4 A;  3EQ2 A;  1GTW A;  2Q3I A;  1NKZ B;  3RK3 D;  2FYU K;  3NMD A;  3E1I A;  2I1K A;  4EIJ A;  2CPS A;  1LTJ A;  2C9L Y;  2VRS A;  2I1J A;  5KLV K;  2O1K A;  2XDJ A;  1OXZ A;  2WTY A;  5CCG A;  5CCG C;  3RL0 D;  3IR9 A;  2YKO A;  2HG5 D;  2YKP A;  3HUS A;  5CCH A;  1FZE A;  3MD0 A;  2NPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...