3M0DC

Crystal structure of the traf1:traf2:ciap2 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
FMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords TNF receptor-associated factor 2
publication title Crystal structures of the TRAF2: cIAP2 and the TRAF1: TRAF2: cIAP2 complexes: affinity, specificity, and regulation.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2010-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3m0dC00
3RK2C 1SFCD 2NPSB 3RK2B 3RK3D 2WZ7A 4W7YA 3B5NA 5CCGA 5KJ7A 3B5NC 3KYQA 1KILC 3RL0C 3PP5A 1L4AD 3B5NB 1KILB 3RL0B 4WY4D 3HD7A 5CCHD 3TSIA 1URQD 4WY4C 1GL2A 4WY4B 1GL2C 1SFCA 1JTHA 1SFCC 1N7SD 1URQC 1GL2B 1KILA 1SFCB 3RK3C 2H8PD 4W80A 1JTHB 3RK3B 1N7SC 3HTKB 1N7SB 1L4AC 4LGDE 5CCGD 4WY4A 1L4AB 2PP6A 2N1TD 5CCHA 5CCHC 1URQA 3HD7D 2N1TC 1NHLA 4N78E 2NPSD 3RK2D 1URQB 2N1TB 3M0DC 2M8RA 1N7SA 1L4AA 2HG5D 3B5ND 5KJ7D 2KOGA 1KILD 3RL0D 2HFED 3VOPA 2NPSC 4W7ZA 5CCGC 5KJ7C 2N1TA 1T3JA 2YMYA 4JF7A 1XTGB 3HD7C 4OH8B 1HVVA 2XDJA 2NPSA 3P8CE 1GL2D 3HD7B
chains in the Genus database with same CATH superfamily
2R5BA 3I55P 2FFDC 3CWBJ 1LTTC 2IZ0A 3TGUD 1LNQA 1MFTA 1MKMA 1G1IA 5CCGA 4H13D 4L74A 2KNCA 3RL0C 1X0TA 2KSEA 3F5HA 4N78D 1L0LJ 2OTKE 3G9RA 1NYHA 1AFOA 3RL0g 1KILE 2Q1KA 4N6JA 1CI6B 3LW5H 5AVUB 3BCCG 1BGYD 4UB8H 1M1JC 1JY3N 3H32B 5H2FE 1URQC 3L75E 1JY3O 1T6AA 1LT1A 2Y0CA 1SQPJ 2KK7A 1NAFA 2KIKA 1M90Q 1RF1A 1Q90D 3AEBC 1L4AC 3L70E 1KN7A 3CI9A 2WPVB 2FYNB 3V4WA 1AJYA 2A45I 3AEAC 2KI7B 5C39A 3AE2C 1LWUB 3II6A 1NH4A 2B9BA 2O01H 1MFZA 2QG4A 2W6BA 1LTJC 1BSHA 1Q7YQ 3HE4A 4AYCA 2KP8A 3E1RA 2Y9YA 3L72D 3CWBG 1T3JA 2Q5UA 3B4SA 1T2KC 3Q3DA 3R4YA 2K9JB 3GMAA 4HYTB 3P8CE 3HD7B 3KHUA 3KXDA 1L0LG 1KYOD 3H1IJ 3RK2B 1NU1D 3PH0A 2P10A 3PTZA 1GMJA 1RE3C 3VN0A 5AVQB 2P2UA 3AE5C 3ZDMA 1FU1A 3CXHI 3M9BA 1SQPE 5AW5B 3MP7B 1KB9H 1N73C 2FYUK 1VF5B 2CK3H 2R3SA 5APUA 1JY2N 1GL2A 2J58A 1LT9B 2Q7CA 1USEA 2ZXEB 1P84E 3M9HA 1JY2O 4KT0J 4DCKA 4HKZH 3BRVB 4HH2A 3KPEA 1PPJD 2YO3A 5AVTB 2H8PD 2NZ2A 1PFIA 3GHGB 5B66E 2ITAA 1N7SB 3L4FA 1Q2NA 2IYPA 3L74D 1JNMA 1FZFA 3HD7D 3L73D 1L2PA 4WVZA 3RK2D 2BEZF 2M8RA 4GDOA 2BCCD 2M5AB 4TLFA 4BRYB 1DD4A 3CCJP 1NWQA 3KZIE 1VQ4P 1OVVA 1H8AA 4NPEA 2AXTE 1N2DC 1NJIQ 2Y0DA 4JQ0D 1NTME 4HJGH 3H1IG 1VF5D 1PGJA 2H88C 4I2LC 2M3BA 1FDMA 5KAIH 3BVHA 2HODB 1UIIA 4LC1A 2W8ZA 3H1HJ 1GK4A 2CPBA 2HLOA 3M9QA 2YXQB 4PV1C 2H43A 1ZXGA 2OYIB 4O9BA 3OA7A 1KILB 3S9OA 4H44B 3H1KE 1NVOA 2XNXA 1EZVI 2FXOA 3TNUB 3AE7C 4WY4C 4GOEA 1EDKA 3V2PA 3A0HE 2RH0A 2B87A 4L75A 3A0HH 1LP1B 4WBAA 5APTA 4LLHA 1NTKD 3P8MC 5BU5A 1IK7A 4UB6E 5CCHA 2QJYC 2ZAEB 4YTPC 1L0LK 1URQB 3A7OA 4IFMA 1J2JB 3FWNA 2OYHA 3HE5A 1IJDB 1QEXA 1Z56A 3VMYA 5AW0B 1RE4A 1SQVE 5KJ7D 3A5TA 1KILD 1YBKA 4HB1A 4W7ZA 4PJ0H 3L75D 3H1HG 1SQBJ 2IYOA 1KD1Q 1TU3F 2PRRA 1SQXD 2ZVNB 1NOHA 5KKZB 2C0XA 4KJMA 3L70D 2L91A 1QLED 5AVRB 2OQQA 2QM7A 1SQQE 1RHZB 1GU4A 2PFXA 3PP5A 2W27A 2A06D 5AW2B 3NFQA 5AW6B 1QL2A 3P32A 1G2CA 1URQD 1GTWA 2LXBA 5M1BA 3CC4P 1U7MA 2HPCB 1NKZB 1VQ8P 2YXRB 3HTKB 2QJKB 2E75B 1SVFA 2FYNC 4U3FE 3CCVP 5KLVE 5KAFE 3H6PA 3CCQP 1ZP0C 5KLIB 1LWUC 1NHLA 1EDIA 1S3JA 2N1TB 5TJHA 1HBWA 5KAFH 1BE3J 2QEXP 1S1CX 3CXHD 1DH3A 2FYZA 1KYOI 2R32A 4GKGA 1SQBG 1KORA 3L71E 1YTZT 1GZLA 2KS1B 2QJPC 1H0TA 1P84D 2B89A 3GW6A 4ZKUA 2FXPA 3HD7C 3PJSK 5APVA 1EDLA 3RK2C 2XV5A 1BSNA 1JCCA 1HGZA 2M0BA 1GK6A 4JYBA 1DIPA 3KYQA 1NTZJ 3EFFK 3B5NB 1VQ6P 5CHXA 4GIFA 4Y28J 1VQNP 1X8YA 2OTJP 1RH5B 1VF5C 1QGKB 2W6JH 1LT9C 4NPDA 2UWJE 3C9IA 3ITKA 3MHVA 1HJ0A 1L0NK 4C7RA 4D6TJ 3GHGC 1NTMD 1FJPA 3H1JE 2LR2A 1N7SC 1FZGA 1W2EA 1JMMA 3CX5E 3IAOA 2H7HA 5GTIE 4RKUJ 4EOTA 2Z5IA 1BE3G 2RN0A 1CW5A 5GTIH 2O3JA 5AVVB 2IBZE 2J59M 1JY3P 1Q82Q 2P1JA 3T97A 3CCLP 1ZRTE 1GU5A 3H1KD 3B5ND 2ZYGA 3Q5PA 1LJ2A 5APQA 2HYNA 2FYUE 2QJYB 1Y9BA 5AVXB 1R8EA 2VRSA 1JMBA 2KNCB 1K04A 2WT7A 4B86A 3VP8A 1NTZG 1X79B 3GF7A 3V2RA 1OW7A 3CCEP 4PV1D 4PD4E 3AE9C 5GTHE 1IFNA 5AW1B 1OWAA 4K35A 2WPSA 2OYIC 1KILC 1VPCA 2V4HA 2FY8A 4H44C 3HRNA 4WY4D 4YXDC 4D6TG 2J5UA 4ASWA 3SWYA 1RF1B 2YIUB 2PGDA 1SQVD 1NGMB 3MZWB 1ZLLA 1ZOYC 3EQ2A 1Q81Q 1EXJA 1YJWP 1SFCB 1SQBK 1J1DB 4JYCA 4UB8E 4H0LB 3S1KA 1GD2E 1QVGO 3OW2O 3BCCE 5CCGD 1PL5A 3CC2P 2V7QJ 4ZNCA 2QSIA 3CCMP 3TDKA 1M56D 2E74B 1A02J 1W5CE 1M1KQ 3H1LJ 1SQQD 1BCCJ 1JY2P 3B8EB 1MUUA 2ZFCA 3E7KA 1T3UA 2QA4P 2YO2A 1N8RQ 2JWDA 2O1JA 3M0DA 1KZUB 1IFJA 3WUUA 5TISH 3O6QB 5KKZC 1SFCD 1FZCA 4U3FD 2WZ7A 3CWBE 2A45G 4H0LD 5KLVD 4AUWA 1PGPA 2RKLA 2A45H 3AEDC 2QJPB 1KQGB 1R5SA 2A06G 2JWAA 3I56P 1L0LE 1OX3A 1PP9D 4DJGA 3H32A 1JUNA 3L71D 2AEJA 3CMEP 2FKWB 5CJ0A 2RMZA 1Q86Q 1KB9E 1M7LA 2M3EA 4DZOA 2FXMA 2QJKC 2E75C 2V7QH 3H1LG 2Z4EA 2ZXXA 1BCCG 1J1EB 3EWKA 3HUSA 1AQ5A 1NO4A 1USDA 1EXIA 2QRXA 3L35A 2POHA 1LGHB 1NTZK 5KLIC 4YPCA 1P84I 4ZMDA 3JCUH 2N1TC 1ZMEC 3GLMA 3G6EP 3FXEA 4OGQB 3CXHH 2WQYC 3CCRP 3AEEC 2KZJA 2KZIA 1HWTC 2Q9IA 3A3YB 2K9JA 2DW3A 3H1JD 3GG2A 1H89A 3CX5D 3PLNA 3NXSA 1FDIA 1IO4A 5E79H 3H1IE 1JM0A 2YKQA 3B5NC 3CCUP 3SFEC 1VQKP 1OVRA 4IL6X 1L0NJ 4WB4A 5KAIE 1WRGA 4AQRD 1RF0C 2P7JA 1ZRTD 4R4MA 1JEKA 4XFJA 1KC8Q 2E42A 4IFDK 4OGQD 3U1AA 3WMM0 2ZYDA 1N7SD 3GHGA 1PGQA 3U1CA 4I7ZB 3A2AA 1FBMA 2FYUD 1JTHB 2QM8A 1DEEG 5KTBA 3TGUJ 3HE5B 1EQ7A 1OZHA 1R5LA 4Z1MH 4EDFA 2XU6A 1SQXK 4PD4D 1KQFB 4IFFA 3FX0A 3V5BA 2M5AA 3G71P 3U59A 1DEBA 2GUSA 4BRYA 1KV4A 5AW3B 3AE6C 1MZ9A 2LKMA 3CL3D 3IN6A 3RBZA 1YJ9P 1BGYJ 1FAVA 2IX7C 1EZVG 2HR3A 4ASVA 5APXA 3BRTB 1IFDA 5CCGC 3O8ZA 2K9YA 3QWOC 1FOSE 1GW4A 2YMYA 1L0NE 3B71A 3G3ZA 2XDJA 1OMIA 1L0NG 4PJ0E 3BCCD 5BU8B 1G2CB 1U57A 2QIWA 4H44D 1X9VA 5KJ7A 2OYIA 4IL6H 5B5EE 2CPSA 3H1HE 1CSBA 3K5BA 3I5CA 2E5TA 2YKOA 1RF1C 1YHQP 5B5EH 3CLQA 3L72J 2YIUC 4WWIA 2FFDA 1KQLA 3TGUG 2R5DA 4L76A 3V2QA 3MD0A 1SFCC 1M8OB 1J1DC 1KFNA 2AXCA 1VQMP 4H0LC 1NU1J 1PZQA 2JDIH 1HGVA 2WITA 1M1JA 2E74C 1BGYG 5AVYB 1URQA 3CWBD 3M0AA 4BWNA 2E5YA 1H0TB 5AVWB 1H88A 4I6MC 1L4AA 1K05A 1L0LD 3P8CD 2BASA 2KB7P 2C0WA 3M06A 2ZYAA 2C9NY 2HFED 3VOPA 2IPPA 3BASA 2KLUA 1LTBC 1KB9D 3WU2H 1LTJA 3L74J 1SQBE 1JCDA 3TK1A 1SQPD 1VQ9P 2NPSB 3L73J 4OVNF 4U7JA 3L72G 1FC2C 2BCCJ 3Q1MA 1YIJP 1NKNA 5BVZA 1X22A 1E5WA 1KYOE 3TSIA 1PP9G 3AE3C 1NU1G 3BATA 5AVSB 2I1KA 3PHLA 3D6ZA 1KYOH 1FS0E 1S9KE 1RE3A 2E75D 1PV3A 3OJAB 5AVZB 1J1EC 3T97B 2O01N 1N73A 2PP6A 2N1TD 1KMIZ 2D2CB 2WSEJ 3H1ID 1AA0A 1ZR2A 2W6AA 2NPSD 1PPJG 2H89C 4OGQC 1HF9A 2AEMA 1S5LX 2WT7B 3CX5I 1BE3E 2HG5D 3SSUA 1KFMA 3TF5A 3L74G 1K73Q 4K3AA 1SP4A 2ZJSE 3L36A 1IFMA 3L73G 5EFWB 1GDTA 2W90A 1NTKJ 2IBZI 2BCCG 3IR9A 1FDOA 1FOSF 1RY3A 1PIXA 2G8YA 2W83C 3SWFA 1OIPA 5AW8B 2YNYA 3B5NA 1NTZE 3MUDC 1ZW0A 1VQOP 4XA4A 3H25A 4H13B 1LTIC 1LTSC 3L75J 4PD4I 1GW3A 4I7ZC 1EC5A 4C7NA 1SQXJ 2WWWA 4D6TE 3MGNA 3D71A 2R3CA 3L70J 1D7MA 2IFMA 2WSEH 3WUVA 3RK3E 2WPQA 4WY4A 1RE4C 1VL2A 1K9MQ 1IC2A 4DT0A 2Y0EA 1BDDA 3H1HD 4YXWH 3ABVC 1IZNB 2O1KA 1LTAC 5KLVK 1KQSO 1NAYA 3PRJA 1NTKG 3Q5SA 3HE4B 3CD6P 1FZCB 2E76B 3JSVC 1NU1K 2GA1A 4JPZB 2E43A 3CCSP 2AEFA 5TISE 2BEQD 1RQUA 1AV1A 2KLVA 4R4LA 3L75G 4DOJA 1SQXE 1MV8A 5H2FH 1SQXG 2JKVA 4IOIH 3S4RA 3HUSB 2WMMA 3L70G 1FE6A 1SFCA 5AW9B 1GL2B 5CBOA 2A06E 3NMDA 1VQPP 1JOCA 2XZRA 1CI6A 2E74D 1SQBD 3JC22 2E76D 2JJLA 1LTGC 1WMKA 1AVYA 4NPFX 1KB9I 2KSJA 2YKPA 3H1LE 1BCCE 3C1LA 3AEGC 3FWLA 3JCUE 1NTMJ 1AVOA 3MTUE 5L8RJ 2OARA 1LWUA 1S9KD 1S4XA 1OFCX 3CXHE 3O6QA 3Q5RA 2IZ1A 1XTGB 4OH8B 4M3LA 1GL2D 1HJBA 2NPSC 1SQPG 1T8ZA 5APYA 3VTPC 5K5GB 1YJNP 3OAKA 1DX7A 1Y47A 2WSCJ 3H1KJ 3VMZA 1P84H 3HD7A 1PGOA 5E79E 2Q3EA 5APWA 1BE3D 4I1LA 1U7JA 5B66H 2Q3IA 4Y99B 3R2PA 1XTCC 3AE8C 1NTKK 2B87B 2L5GB 4RO0A 3W67A 3RK3B 3KDPB 4EI2A 2XNDH 2IBZD 2QE7H 1YITP 1N7LA 2D2CC 2JP3A 2I1JA 1YQ4C 2WTYA 1S72P 1LT9A 1YQ3C 2K1AA 2FBWC 3V2NA 3P7KA 2JO1A 3KZIH 3IFMA 2WVRA 1QX8A 1NTMG 4JBZA 1HH0A 4L73A 1N7SA 2AXTH 1K8AQ 3AECC 1NTZD 3KQGA 1SQVJ 3E1IA 2OYHB 1S2EA 5CMZA 2KOGA 2C9LY 2GUVA 1YYCA 4RESB 2Z5HA 3VMAA 1Y8AA 2KUBA 1ZN5A 3GF3A 2K37A 2MKVA 4D6TD 4JF7A 1HVVA 1EZVE 2ZT9B 3FXDA 2B88A 3LIDA 3H1KG 3M91A 2WSCH 3RK3D 1SQQJ 2FFDB 3CPWO 3MIWA 1YI2P 2NRGA 2KXPB 1JO5A 3MUDA 3RL0B 4N3YB 4H13C 2LXCB 1OW8A 3CC7P 2QVAA 2HODA 5CCHD 4GOFA 1SLQA 4IL6E 2P67A 4EYYQ 3AE4C 2K88A 3AE1C 1JTHA 1M1JB 1KILA 3FGAD 4UB6H 2IFNA 4U3FJ 3TNUA 3AEFC 2SPZA 5APSA 1L4AB 5KLVJ 3TGUE 3VP9A 1SQVG 4C46A 2ZT9D 1HTLC 1SQPK 1LP1A 3Q2YA 1FJKA 4N78E 2N9BA 2IDBA 3M0DC 1PP9J 3C8VA 3D70A 1VDFA 1LTJB 3L71J 4ZKPA 1A02F 4GT1A 1FZCC 1BGYE 1UIXA 3RL0D 1AQTA 1CZQA 1WT6A 1YTZI 2E76C 3LIEA 2Q6QA 1FZEA 1SQQG 1N86A 3QH9A 3RBXA 2N9YB 4RJTA 1IFPA 3EFGA 5DJTB 4W7YA 2OYOA 3WU2E 4BXLA 1L4AD 1DD3A 1W2BO 3H1LD 1BCCD 1OVUA 1HUCA 3HUSC 3RGUA 1NTMK 1N73B 3L72E 4U3FG 2MJZA 2OTLP 1GL2C 1SS1A 3V6IA 2XKMA 4KHXA 1FZAA 3H1JJ 5KLVG 3L37A 1M57D 2WSFJ 1PP9E 3TYYA 2K3RA 1VQ7P 1NU1E 3WUTA 2KYVA 2GM4A 5AW7B 1T2KD 3NTNA 3L71G 1OXZA 2HPCA 1VQLP 4TT3H 3HTKA 5DJUB 3W68A 3N7NA 1QVFO 2Y9ZA 3CMAP 1EDJA 3USSA 2FYUJ 4XE5B 4OWFA 3VYIA 1PPJE 1E79H 2N1TA 3V4QA 4A7PA 2G3AA 1QL1A 2NPSA 2WSSH 4CPGA 1RQVA 3L74E 2OGUA 2KS1A 5AW4B 1JB0J 3L73E 2BCCE 4PV1B 4C7NB 1SQVK 3A0BE 3H1JG 4Y99C 3A0BH 4WY4B 3CX5H 2WSFH 1VQ5P 4GODA 3LW5J 3RK3C 4QMAA 4W80A 2JR8A 2D2CD 3IF4A 1IFIA 1IK9A 2IBZG 3BCCJ 3G4SP 1RF0A 1EZVD 4LGDE 2WPRA 1SQQK 3SWKA 5CJ4A 2P58A 2R44A 5CCHC 1KTMA 2FYUG 4EIJA 2YMKA 2OYHC 1ZR4A 1L0ND 2JEEA 5CBNA 2ZVOB 2I8DA 3UIAA 2O01J 1G1JA 4MN4C 1BDCA 1ZV8A 1S5LE 3SFDC 5KJ7C 2PAJA 3F89A 3VMXA 3D6YA 4PD4H 5GTHH 1FZBA 2ZT9C 1S5LH 1OW6A 3N4XA 1NTKE
chains in the Genus database with same CATH topology
3RK2C 2XV5A 1JCCA 1HGZA 2R5BA 1T8ZA 5APYA 3VTPC 2FFDC 1LTTC 5BU8B 1G2CB 1GK6A 3OAKA 4JYBA 1DX7A 1G1IA 5CCGA 1X9VA 5KJ7A 2OYIA 3KYQA 2CPSA 3RL0C 3B5NB 1CSBA 4N78D 5CHXA 3VMZA 4GIFA 3HD7A 3I5CA 1X8YA 2YKOA 1RF1C 3CLQA 1AFOA 5APWA 2FFDA 4N6JA 1CI6B 4I1LA 3LW5H 1LT9C 1KQLA 5AVUB 2Q3IA 1M1JC 2R5DA 1JY3N 3H32B 4Y99B 3C9IA 3V2QA 3MD0A 3R2PA 1SFCC 1L0NK 1URQC 4C7RA 1XTCC 3GHGC 1NTKK 1JY3O 2L5GB 1FJPA 1J1DC 3RK3B 1KFNA 1NAFA 1N7SC 3KDPB 1FZGA 1W2EA 1JMMA 1RF1A 1L4AC 2H7HA 4EOTA 1HGVA 1N7LA 3CI9A 2Z5IA 2I1JA 2WTYA 5APVA 1LT9A 3V4WA 2WITA 1M1JA 2A45I 5AVYB 1URQA 3V2NA 3P7KA 1CW5A 3IFMA 3M0AA 5AVVB 1HH0A 1LWUB 3II6A 2J59M 1JY3P 1NH4A 2P1JA 1N7SA 3T97A 2O01H 1MFZA 5AVWB 1H88A 2W6BA 1LTJC 3KQGA 4I6MC 3E1IA 1L4AA 1GU5A 3HE4A 2OYHB 4AYCA 3P8CD 2BASA 2KP8A 3B5ND 5CMZA 2KB7P 2KOGA 5APQA 2C9LY 2GUVA 2C0WA 3M06A 2C9NY 1YYCA 2HFED 2HYNA 4RESB 3VOPA 2IPPA 2Z5HA 3BASA 5AVXB 1T3JA 2Q5UA 1T2KC 2VRSA 1ZN5A 1LTBC 2WT7A 4B86A 4JF7A 1LTJA 1HVVA 4HYTB 3VP8A 3P8CE 1X79B 1JCDA 3HD7B 3TK1A 3V2RA 3LIDA 2NPSB 3RK2B 3M91A 2WSCH 3RK3D 2FFDB 3MIWA 1IFNA 5AW1B 1RE3C 1OWAA 2WPSA 3VN0A 2OYIC 1JO5A 1KILC 1VPCA 5AVQB 3MUDA 2P2UA 1NKNA 3RL0B 1FU1A 4N3YB 3M9BA 3HRNA 4WY4D 5BVZA 1E5WA 5AW5B 2HODA 5CCHD 3TSIA 1SLQA 1N73C 3SWYA 1RF1B 2FYUK 2P67A 5APUA 1JY2N 1GL2A 2J58A 3BATA 5AVSB 2I1KA 1LT9B 2Q7CA 1JTHA 2ZXEB 1ZLLA 3M9HA 1S9KE 1RE3A 1M1JB 1JY2O 3EQ2A 3BRVB 1KILA 4HH2A 3KPEA 2YO3A 1SFCB 5AVTB 2H8PD 1SQBK 3OJAB 1PFIA 3GHGB 5AVZB 2IFNA 1J1DB 4JYCA 1J1EC 1N7SB 3L4FA 3TNUA 1GD2E 1N73A 5CCGD 5APSA 1L4AB 2PP6A 2N1TD 1JNMA 1FZFA 3VP9A 4C46A 1HTLC 3HD7D 1SQPK 1A02J 1ZR2A 2W6AA 1JY2P 1FJKA 3B8EB 2NPSD 4N78E 3RK2D 2N9BA 3M0DC 2M8RA 1MUUA 2WT7B 2ZFCA 1VDFA 1LTJB 4ZKPA 1NWQA 1A02F 2HG5D 4GT1A 1FZCC 1KFMA 3RL0D 1CZQA 1T3UA 1H8AA 1WT6A 1YTZI 1SP4A 1N2DC 3L36A 3LIEA 1IFMA 2YO2A 1FZEA 2O1JA 3M0DA 1KZUB 1GDTA 1IFJA 1N86A 2M3BA 4I2LC 3IR9A 1FOSF 1RY3A 1FDMA 1SFCD 3BVHA 2HODB 1FZCA 4LC1A 3EFGA 2WZ7A 4W7YA 3SWFA 5AW8B 2YNYA 1GK4A 3B5NA 2A45G 2CPBA 4AUWA 2HLOA 3M9QA 1L4AD 2A45H 2H43A 2OYIB 4O9BA 3OA7A 1KILB 4XA4A 1LTIC 2XNXA 1HUCA 3HUSC 3TNUB 3H32A 1NTMK 4WY4C 1N73B 1LTSC 3V2PA 2MJZA 1JUNA 1GL2C 2XKMA 1GW3A 2FKWB 4KHXA 1FZAA 5CJ0A 4C7NA 3L37A 2WWWA 1M7LA 4DZOA 2FXMA 3MGNA 4WBAA 3TYYA 2R3CA 5APTA 2IFMA 2Z4EA 4LLHA 1J1EB 3HUSA 2WSEH 1AQ5A 3P8MC 5BU5A 1NO4A 2WPQA 4WY4A 1RE4C 2KYVA 2GM4A 5AW7B 3L35A 5CCHA 1T2KD 1IC2A 2POHA 3NTNA 1LGHB 1NTZK 1OXZA 2HPCA 2N1TC 1L0LK 3HTKA 1URQB 3A7OA 3N7NA 4IFMA 1J2JB 2OYHA 3HE5A 2O1KA 1LTAC 1IJDB 5KLVK 1Z56A 3VMYA 5AW0B 1RE4A 5KJ7D 3A5TA 1KILD 3HE4B 1FZCB 4XE5B 1HWTC 3VYIA 2Q9IA 4W7ZA 3A3YB 2N1TA 3V4QA 1NU1K 1QL1A 2NPSA 1H89A 3NXSA 2E43A 1NOHA 2C0XA 1IO4A 5AVRB 5AW4B 2YKQA 2QM7A 3B5NC 1GU4A 3PP5A 2KLVA 4WB4A 4C7NB 4DOJA 2W27A 1WRGA 5AW2B 1SQVK 1MV8A 3NFQA 4AQRD 5AW6B 1RF0C 2P7JA 1QL2A 3P32A 1G2CA 1URQD 3HUSB 1GTWA 4Y99C 2E42A 4IFDK 4WY4B 3U1AA 2WSFH 1SFCA 5AW9B 3WMM0 3GHGA 1N7SD 1GL2B 3U1CA 3A2AA 1FBMA 3RK3C 4W80A 1JTHB 2HPCB 3NMDA 1NKZB 2QM8A 1JOCA 2XZRA 3HTKB 1IFIA 1IK9A 5KTBA 1RF0A 1CI6A 3HE5B 1SVFA 4LGDE 2WPRA 1SQQK 1EQ7A 5CJ4A 2JJLA 1LTGC 5CCHC 2XU6A 1SQXK 3H6PA 4IFFA 3V5BA 1LWUC 1NHLA 3U59A 1DEBA 2GUSA 2N1TB 2KSJA 2YKPA 4EIJA 5AW3B 1HBWA 2OYHC 1MZ9A 2LKMA 1DH3A 3CL3D 1ZR4A 2FYZA 1FAVA 2IX7C 2JEEA 2R32A 4GKGA 3UIAA 1G1JA 5APXA 3BRTB 1IFDA 1YTZT 3MTUE 1ZV8A 1GZLA 2OARA 5CCGC 3O8ZA 5KJ7C 1LWUA 1S9KD 1FOSE 2PAJA 3VMXA 1GW4A 4ZKUA 2YMYA 1FZBA 1XTGB 3HD7C 3G3ZA 4OH8B 2XDJA 4M3LA 3N4XA 1GL2D 1HJBA 2NPSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RK2 C;  1SFC D;  2NPS B;  3RK2 B;  3RK3 D;  2WZ7 A;  4W7Y A;  3B5N A;  5CCG A;  5KJ7 A;  3B5N C;  3KYQ A;  1KIL C;  3RL0 C;  3PP5 A;  1L4A D;  3B5N B;  1KIL B;  3RL0 B;  4WY4 D;  3HD7 A;  5CCH D;  3TSI A;  1URQ D;  4WY4 C;  1GL2 A;  4WY4 B;  1GL2 C;  1SFC A;  1JTH A;  1SFC C;  1N7S D;  1URQ C;  1GL2 B;  1KIL A;  1SFC B;  3RK3 C;  2H8P D;  4W80 A;  1JTH B;  3RK3 B;  1N7S C;  3HTK B;  1N7S B;  1L4A C;  4LGD E;  5CCG D;  4WY4 A;  1L4A B;  2PP6 A;  2N1T D;  5CCH A;  5CCH C;  1URQ A;  3HD7 D;  2N1T C;  1NHL A;  4N78 E;  2NPS D;  3RK2 D;  1URQ B;  2N1T B;  3M0D C;  2M8R A;  1N7S A;  1L4A A;  2HG5 D;  3B5N D;  5KJ7 D;  2KOG A;  1KIL D;  3RL0 D;  2HFE D;  3VOP A;  2NPS C;  4W7Z A;  5CCG C;  5KJ7 C;  2N1T A;  1T3J A;  2YMY A;  4JF7 A;  1XTG B;  3HD7 C;  4OH8 B;  1HVV A;  2XDJ A;  2NPS A;  3P8C E;  1GL2 D;  3HD7 B; 
#chains in the Genus database with same CATH topology
 2R5B A;  3I55 P;  2FFD C;  3CWB J;  1LTT C;  2IZ0 A;  3TGU D;  1LNQ A;  1MFT A;  1MKM A;  1G1I A;  5CCG A;  4H13 D;  4L74 A;  2KNC A;  3RL0 C;  1X0T A;  2KSE A;  3F5H A;  4N78 D;  1L0L J;  2OTK E;  3G9R A;  1NYH A;  1AFO A;  3RL0 g;  1KIL E;  2Q1K A;  4N6J A;  1CI6 B;  3LW5 H;  5AVU B;  3BCC G;  1BGY D;  4UB8 H;  1M1J C;  1JY3 N;  3H32 B;  5H2F E;  1URQ C;  3L75 E;  1JY3 O;  1T6A A;  1LT1 A;  2Y0C A;  1SQP J;  2KK7 A;  1NAF A;  2KIK A;  1M90 Q;  1RF1 A;  1Q90 D;  3AEB C;  1L4A C;  3L70 E;  1KN7 A;  3CI9 A;  2WPV B;  2FYN B;  3V4W A;  1AJY A;  2A45 I;  3AEA C;  2KI7 B;  5C39 A;  3AE2 C;  1LWU B;  3II6 A;  1NH4 A;  2B9B A;  2O01 H;  1MFZ A;  2QG4 A;  2W6B A;  1LTJ C;  1BSH A;  1Q7Y Q;  3HE4 A;  4AYC A;  2KP8 A;  3E1R A;  2Y9Y A;  3L72 D;  3CWB G;  1T3J A;  2Q5U A;  3B4S A;  1T2K C;  3Q3D A;  3R4Y A;  2K9J B;  3GMA A;  4HYT B;  3P8C E;  3HD7 B;  3KHU A;  3KXD A;  1L0L G;  1KYO D;  3H1I J;  3RK2 B;  1NU1 D;  3PH0 A;  2P10 A;  3PTZ A;  1GMJ A;  1RE3 C;  3VN0 A;  5AVQ B;  2P2U A;  3AE5 C;  3ZDM A;  1FU1 A;  3CXH I;  3M9B A;  1SQP E;  5AW5 B;  3MP7 B;  1KB9 H;  1N73 C;  2FYU K;  1VF5 B;  2CK3 H;  2R3S A;  5APU A;  1JY2 N;  1GL2 A;  2J58 A;  1LT9 B;  2Q7C A;  1USE A;  2ZXE B;  1P84 E;  3M9H A;  1JY2 O;  4KT0 J;  4DCK A;  4HKZ H;  3BRV B;  4HH2 A;  3KPE A;  1PPJ D;  2YO3 A;  5AVT B;  2H8P D;  2NZ2 A;  1PFI A;  3GHG B;  5B66 E;  2ITA A;  1N7S B;  3L4F A;  1Q2N A;  2IYP A;  3L74 D;  1JNM A;  1FZF A;  3HD7 D;  3L73 D;  1L2P A;  4WVZ A;  3RK2 D;  2BEZ F;  2M8R A;  4GDO A;  2BCC D;  2M5A B;  4TLF A;  4BRY B;  1DD4 A;  3CCJ P;  1NWQ A;  3KZI E;  1VQ4 P;  1OVV A;  1H8A A;  4NPE A;  2AXT E;  1N2D C;  1NJI Q;  2Y0D A;  4JQ0 D;  1NTM E;  4HJG H;  3H1I G;  1VF5 D;  1PGJ A;  2H88 C;  4I2L C;  2M3B A;  1FDM A;  5KAI H;  3BVH A;  2HOD B;  1UII A;  4LC1 A;  2W8Z A;  3H1H J;  1GK4 A;  2CPB A;  2HLO A;  3M9Q A;  2YXQ B;  4PV1 C;  2H43 A;  1ZXG A;  2OYI B;  4O9B A;  3OA7 A;  1KIL B;  3S9O A;  4H44 B;  3H1K E;  1NVO A;  2XNX A;  1EZV I;  2FXO A;  3TNU B;  3AE7 C;  4WY4 C;  4GOE A;  1EDK A;  3V2P A;  3A0H E;  2RH0 A;  2B87 A;  4L75 A;  3A0H H;  1LP1 B;  4WBA A;  5APT A;  4LLH A;  1NTK D;  3P8M C;  5BU5 A;  1IK7 A;  4UB6 E;  5CCH A;  2QJY C;  2ZAE B;  4YTP C;  1L0L K;  1URQ B;  3A7O A;  4IFM A;  1J2J B;  3FWN A;  2OYH A;  3HE5 A;  1IJD B;  1QEX A;  1Z56 A;  3VMY A;  5AW0 B;  1RE4 A;  1SQV E;  5KJ7 D;  3A5T A;  1KIL D;  1YBK A;  4HB1 A;  4W7Z A;  4PJ0 H;  3L75 D;  3H1H G;  1SQB J;  2IYO A;  1KD1 Q;  1TU3 F;  2PRR A;  1SQX D;  2ZVN B;  1NOH A;  5KKZ B;  2C0X A;  4KJM A;  3L70 D;  2L91 A;  1QLE D;  5AVR B;  2OQQ A;  2QM7 A;  1SQQ E;  1RHZ B;  1GU4 A;  2PFX A;  3PP5 A;  2W27 A;  2A06 D;  5AW2 B;  3NFQ A;  5AW6 B;  1QL2 A;  3P32 A;  1G2C A;  1URQ D;  1GTW A;  2LXB A;  5M1B A;  3CC4 P;  1U7M A;  2HPC B;  1NKZ B;  1VQ8 P;  2YXR B;  3HTK B;  2QJK B;  2E75 B;  1SVF A;  2FYN C;  4U3F E;  3CCV P;  5KLV E;  5KAF E;  3H6P A;  3CCQ P;  1ZP0 C;  5KLI B;  1LWU C;  1NHL A;  1EDI A;  1S3J A;  2N1T B;  5TJH A;  1HBW A;  5KAF H;  1BE3 J;  2QEX P;  1S1C X;  3CXH D;  1DH3 A;  2FYZ A;  1KYO I;  2R32 A;  4GKG A;  1SQB G;  1KOR A;  3L71 E;  1YTZ T;  1GZL A;  2KS1 B;  2QJP C;  1H0T A;  1P84 D;  2B89 A;  3GW6 A;  4ZKU A;  2FXP A;  3HD7 C;  3PJS K;  5APV A;  1EDL A;  3RK2 C;  2XV5 A;  1BSN A;  1JCC A;  1HGZ A;  2M0B A;  1GK6 A;  4JYB A;  1DIP A;  3KYQ A;  1NTZ J;  3EFF K;  3B5N B;  1VQ6 P;  5CHX A;  4GIF A;  4Y28 J;  1VQN P;  1X8Y A;  2OTJ P;  1RH5 B;  1VF5 C;  1QGK B;  2W6J H;  1LT9 C;  4NPD A;  2UWJ E;  3C9I A;  3ITK A;  3MHV A;  1HJ0 A;  1L0N K;  4C7R A;  4D6T J;  3GHG C;  1NTM D;  1FJP A;  3H1J E;  2LR2 A;  1N7S C;  1FZG A;  1W2E A;  1JMM A;  3CX5 E;  3IAO A;  2H7H A;  5GTI E;  4RKU J;  4EOT A;  2Z5I A;  1BE3 G;  2RN0 A;  1CW5 A;  5GTI H;  2O3J A;  5AVV B;  2IBZ E;  2J59 M;  1JY3 P;  1Q82 Q;  2P1J A;  3T97 A;  3CCL P;  1ZRT E;  1GU5 A;  3H1K D;  3B5N D;  2ZYG A;  3Q5P A;  1LJ2 A;  5APQ A;  2HYN A;  2FYU E;  2QJY B;  1Y9B A;  5AVX B;  1R8E A;  2VRS A;  1JMB A;  2KNC B;  1K04 A;  2WT7 A;  4B86 A;  3VP8 A;  1NTZ G;  1X79 B;  3GF7 A;  3V2R A;  1OW7 A;  3CCE P;  4PV1 D;  4PD4 E;  3AE9 C;  5GTH E;  1IFN A;  5AW1 B;  1OWA A;  4K35 A;  2WPS A;  2OYI C;  1KIL C;  1VPC A;  2V4H A;  2FY8 A;  4H44 C;  3HRN A;  4WY4 D;  4YXD C;  4D6T G;  2J5U A;  4ASW A;  3SWY A;  1RF1 B;  2YIU B;  2PGD A;  1SQV D;  1NGM B;  3MZW B;  1ZLL A;  1ZOY C;  3EQ2 A;  1Q81 Q;  1EXJ A;  1YJW P;  1SFC B;  1SQB K;  1J1D B;  4JYC A;  4UB8 E;  4H0L B;  3S1K A;  1GD2 E;  1QVG O;  3OW2 O;  3BCC E;  5CCG D;  1PL5 A;  3CC2 P;  2V7Q J;  4ZNC A;  2QSI A;  3CCM P;  3TDK A;  1M56 D;  2E74 B;  1A02 J;  1W5C E;  1M1K Q;  3H1L J;  1SQQ D;  1BCC J;  1JY2 P;  3B8E B;  1MUU A;  2ZFC A;  3E7K A;  1T3U A;  2QA4 P;  2YO2 A;  1N8R Q;  2JWD A;  2O1J A;  3M0D A;  1KZU B;  1IFJ A;  3WUU A;  5TIS H;  3O6Q B;  5KKZ C;  1SFC D;  1FZC A;  4U3F D;  2WZ7 A;  3CWB E;  2A45 G;  4H0L D;  5KLV D;  4AUW A;  1PGP A;  2RKL A;  2A45 H;  3AED C;  2QJP B;  1KQG B;  1R5S A;  2A06 G;  2JWA A;  3I56 P;  1L0L E;  1OX3 A;  1PP9 D;  4DJG A;  3H32 A;  1JUN A;  3L71 D;  2AEJ A;  3CME P;  2FKW B;  5CJ0 A;  2RMZ A;  1Q86 Q;  1KB9 E;  1M7L A;  2M3E A;  4DZO A;  2FXM A;  2QJK C;  2E75 C;  2V7Q H;  3H1L G;  2Z4E A;  2ZXX A;  1BCC G;  1J1E B;  3EWK A;  3HUS A;  1AQ5 A;  1NO4 A;  1USD A;  1EXI A;  2QRX A;  3L35 A;  2POH A;  1LGH B;  1NTZ K;  5KLI C;  4YPC A;  1P84 I;  4ZMD A;  3JCU H;  2N1T C;  1ZME C;  3GLM A;  3G6E P;  3FXE A;  4OGQ B;  3CXH H;  2WQY C;  3CCR P;  3AEE C;  2KZJ A;  2KZI A;  1HWT C;  2Q9I A;  3A3Y B;  2K9J A;  2DW3 A;  3H1J D;  3GG2 A;  1H89 A;  3CX5 D;  3PLN A;  3NXS A;  1FDI A;  1IO4 A;  5E79 H;  3H1I E;  1JM0 A;  2YKQ A;  3B5N C;  3CCU P;  3SFE C;  1VQK P;  1OVR A;  4IL6 X;  1L0N J;  4WB4 A;  5KAI E;  1WRG A;  4AQR D;  1RF0 C;  2P7J A;  1ZRT D;  4R4M A;  1JEK A;  4XFJ A;  1KC8 Q;  2E42 A;  4IFD K;  4OGQ D;  3U1A A;  3WMM 0;  2ZYD A;  1N7S D;  3GHG A;  1PGQ A;  3U1C A;  4I7Z B;  3A2A A;  1FBM A;  2FYU D;  1JTH B;  2QM8 A;  1DEE G;  5KTB A;  3TGU J;  3HE5 B;  1EQ7 A;  1OZH A;  1R5L A;  4Z1M H;  4EDF A;  2XU6 A;  1SQX K;  4PD4 D;  1KQF B;  4IFF A;  3FX0 A;  3V5B A;  2M5A A;  3G71 P;  3U59 A;  1DEB A;  2GUS A;  4BRY A;  1KV4 A;  5AW3 B;  3AE6 C;  1MZ9 A;  2LKM A;  3CL3 D;  3IN6 A;  3RBZ A;  1YJ9 P;  1BGY J;  1FAV A;  2IX7 C;  1EZV G;  2HR3 A;  4ASV A;  5APX A;  3BRT B;  1IFD A;  5CCG C;  3O8Z A;  2K9Y A;  3QWO C;  1FOS E;  1GW4 A;  2YMY A;  1L0N E;  3B71 A;  3G3Z A;  2XDJ A;  1OMI A;  1L0N G;  4PJ0 E;  3BCC D;  5BU8 B;  1G2C B;  1U57 A;  2QIW A;  4H44 D;  1X9V A;  5KJ7 A;  2OYI A;  4IL6 H;  5B5E E;  2CPS A;  3H1H E;  1CSB A;  3K5B A;  3I5C A;  2E5T A;  2YKO A;  1RF1 C;  1YHQ P;  5B5E H;  3CLQ A;  3L72 J;  2YIU C;  4WWI A;  2FFD A;  1KQL A;  3TGU G;  2R5D A;  4L76 A;  3V2Q A;  3MD0 A;  1SFC C;  1M8O B;  1J1D C;  1KFN A;  2AXC A;  1VQM P;  4H0L C;  1NU1 J;  1PZQ A;  2JDI H;  1HGV A;  2WIT A;  1M1J A;  2E74 C;  1BGY G;  5AVY B;  1URQ A;  3CWB D;  3M0A A;  4BWN A;  2E5Y A;  1H0T B;  5AVW B;  1H88 A;  4I6M C;  1L4A A;  1K05 A;  1L0L D;  3P8C D;  2BAS A;  2KB7 P;  2C0W A;  3M06 A;  2ZYA A;  2C9N Y;  2HFE D;  3VOP A;  2IPP A;  3BAS A;  2KLU A;  1LTB C;  1KB9 D;  3WU2 H;  1LTJ A;  3L74 J;  1SQB E;  1JCD A;  3TK1 A;  1SQP D;  1VQ9 P;  2NPS B;  3L73 J;  4OVN F;  4U7J A;  3L72 G;  1FC2 C;  2BCC J;  3Q1M A;  1YIJ P;  1NKN A;  5BVZ A;  1X22 A;  1E5W A;  1KYO E;  3TSI A;  1PP9 G;  3AE3 C;  1NU1 G;  3BAT A;  5AVS B;  2I1K A;  3PHL A;  3D6Z A;  1KYO H;  1FS0 E;  1S9K E;  1RE3 A;  2E75 D;  1PV3 A;  3OJA B;  5AVZ B;  1J1E C;  3T97 B;  2O01 N;  1N73 A;  2PP6 A;  2N1T D;  1KMI Z;  2D2C B;  2WSE J;  3H1I D;  1AA0 A;  1ZR2 A;  2W6A A;  2NPS D;  1PPJ G;  2H89 C;  4OGQ C;  1HF9 A;  2AEM A;  1S5L X;  2WT7 B;  3CX5 I;  1BE3 E;  2HG5 D;  3SSU A;  1KFM A;  3TF5 A;  3L74 G;  1K73 Q;  4K3A A;  1SP4 A;  2ZJS E;  3L36 A;  1IFM A;  3L73 G;  5EFW B;  1GDT A;  2W90 A;  1NTK J;  2IBZ I;  2BCC G;  3IR9 A;  1FDO A;  1FOS F;  1RY3 A;  1PIX A;  2G8Y A;  2W83 C;  3SWF A;  1OIP A;  5AW8 B;  2YNY A;  3B5N A;  1NTZ E;  3MUD C;  1ZW0 A;  1VQO P;  4XA4 A;  3H25 A;  4H13 B;  1LTI C;  1LTS C;  3L75 J;  4PD4 I;  1GW3 A;  4I7Z C;  1EC5 A;  4C7N A;  1SQX J;  2WWW A;  4D6T E;  3MGN A;  3D71 A;  2R3C A;  3L70 J;  1D7M A;  2IFM A;  2WSE H;  3WUV A;  3RK3 E;  2WPQ A;  4WY4 A;  1RE4 C;  1VL2 A;  1K9M Q;  1IC2 A;  4DT0 A;  2Y0E A;  1BDD A;  3H1H D;  4YXW H;  3ABV C;  1IZN B;  2O1K A;  1LTA C;  5KLV K;  1KQS O;  1NAY A;  3PRJ A;  1NTK G;  3Q5S A;  3HE4 B;  3CD6 P;  1FZC B;  2E76 B;  3JSV C;  1NU1 K;  2GA1 A;  4JPZ B;  2E43 A;  3CCS P;  2AEF A;  5TIS E;  2BEQ D;  1RQU A;  1AV1 A;  2KLV A;  4R4L A;  3L75 G;  4DOJ A;  1SQX E;  1MV8 A;  5H2F H;  1SQX G;  2JKV A;  4IOI H;  3S4R A;  3HUS B;  2WMM A;  3L70 G;  1FE6 A;  1SFC A;  5AW9 B;  1GL2 B;  5CBO A;  2A06 E;  3NMD A;  1VQP P;  1JOC A;  2XZR A;  1CI6 A;  2E74 D;  1SQB D;  3JC2 2;  2E76 D;  2JJL A;  1LTG C;  1WMK A;  1AVY A;  4NPF X;  1KB9 I;  2KSJ A;  2YKP A;  3H1L E;  1BCC E;  3C1L A;  3AEG C;  3FWL A;  3JCU E;  1NTM J;  1AVO A;  3MTU E;  5L8R J;  2OAR A;  1LWU A;  1S9K D;  1S4X A;  1OFC X;  3CXH E;  3O6Q A;  3Q5R A;  2IZ1 A;  1XTG B;  4OH8 B;  4M3L A;  1GL2 D;  1HJB A;  2NPS C;  1SQP G;  1T8Z A;  5APY A;  3VTP C;  5K5G B;  1YJN P;  3OAK A;  1DX7 A;  1Y47 A;  2WSC J;  3H1K J;  3VMZ A;  1P84 H;  3HD7 A;  1PGO A;  5E79 E;  2Q3E A;  5APW A;  1BE3 D;  4I1L A;  1U7J A;  5B66 H;  2Q3I A;  4Y99 B;  3R2P A;  1XTC C;  3AE8 C;  1NTK K;  2B87 B;  2L5G B;  4RO0 A;  3W67 A;  3RK3 B;  3KDP B;  4EI2 A;  2XND H;  2IBZ D;  2QE7 H;  1YIT P;  1N7L A;  2D2C C;  2JP3 A;  2I1J A;  1YQ4 C;  2WTY A;  1S72 P;  1LT9 A;  1YQ3 C;  2K1A A;  2FBW C;  3V2N A;  3P7K A;  2JO1 A;  3KZI H;  3IFM A;  2WVR A;  1QX8 A;  1NTM G;  4JBZ A;  1HH0 A;  4L73 A;  1N7S A;  2AXT H;  1K8A Q;  3AEC C;  1NTZ D;  3KQG A;  1SQV J;  3E1I A;  2OYH B;  1S2E A;  5CMZ A;  2KOG A;  2C9L Y;  2GUV A;  1YYC A;  4RES B;  2Z5H A;  3VMA A;  1Y8A A;  2KUB A;  1ZN5 A;  3GF3 A;  2K37 A;  2MKV A;  4D6T D;  4JF7 A;  1HVV A;  1EZV E;  2ZT9 B;  3FXD A;  2B88 A;  3LID A;  3H1K G;  3M91 A;  2WSC H;  3RK3 D;  1SQQ J;  2FFD B;  3CPW O;  3MIW A;  1YI2 P;  2NRG A;  2KXP B;  1JO5 A;  3MUD A;  3RL0 B;  4N3Y B;  4H13 C;  2LXC B;  1OW8 A;  3CC7 P;  2QVA A;  2HOD A;  5CCH D;  4GOF A;  1SLQ A;  4IL6 E;  2P67 A;  4EYY Q;  3AE4 C;  2K88 A;  3AE1 C;  1JTH A;  1M1J B;  1KIL A;  3FGA D;  4UB6 H;  2IFN A;  4U3F J;  3TNU A;  3AEF C;  2SPZ A;  5APS A;  1L4A B;  5KLV J;  3TGU E;  3VP9 A;  1SQV G;  4C46 A;  2ZT9 D;  1HTL C;  1SQP K;  1LP1 A;  3Q2Y A;  1FJK A;  4N78 E;  2N9B A;  2IDB A;  3M0D C;  1PP9 J;  3C8V A;  3D70 A;  1VDF A;  1LTJ B;  3L71 J;  4ZKP A;  1A02 F;  4GT1 A;  1FZC C;  1BGY E;  1UIX A;  3RL0 D;  1AQT A;  1CZQ A;  1WT6 A;  1YTZ I;  2E76 C;  3LIE A;  2Q6Q A;  1FZE A;  1SQQ G;  1N86 A;  3QH9 A;  3RBX A;  2N9Y B;  4RJT A;  1IFP A;  3EFG A;  5DJT B;  4W7Y A;  2OYO A;  3WU2 E;  4BXL A;  1L4A D;  1DD3 A;  1W2B O;  3H1L D;  1BCC D;  1OVU A;  1HUC A;  3HUS C;  3RGU A;  1NTM K;  1N73 B;  3L72 E;  4U3F G;  2MJZ A;  2OTL P;  1GL2 C;  1SS1 A;  3V6I A;  2XKM A;  4KHX A;  1FZA A;  3H1J J;  5KLV G;  3L37 A;  1M57 D;  2WSF J;  1PP9 E;  3TYY A;  2K3R A;  1VQ7 P;  1NU1 E;  3WUT A;  2KYV A;  2GM4 A;  5AW7 B;  1T2K D;  3NTN A;  3L71 G;  1OXZ A;  2HPC A;  1VQL P;  4TT3 H;  3HTK A;  5DJU B;  3W68 A;  3N7N A;  1QVF O;  2Y9Z A;  3CMA P;  1EDJ A;  3USS A;  2FYU J;  4XE5 B;  4OWF A;  3VYI A;  1PPJ E;  1E79 H;  2N1T A;  3V4Q A;  4A7P A;  2G3A A;  1QL1 A;  2NPS A;  2WSS H;  4CPG A;  1RQV A;  3L74 E;  2OGU A;  2KS1 A;  5AW4 B;  1JB0 J;  3L73 E;  2BCC E;  4PV1 B;  4C7N B;  1SQV K;  3A0B E;  3H1J G;  4Y99 C;  3A0B H;  4WY4 B;  3CX5 H;  2WSF H;  1VQ5 P;  4GOD A;  3LW5 J;  3RK3 C;  4QMA A;  4W80 A;  2JR8 A;  2D2C D;  3IF4 A;  1IFI A;  1IK9 A;  2IBZ G;  3BCC J;  3G4S P;  1RF0 A;  1EZV D;  4LGD E;  2WPR A;  1SQQ K;  3SWK A;  5CJ4 A;  2P58 A;  2R44 A;  5CCH C;  1KTM A;  2FYU G;  4EIJ A;  2YMK A;  2OYH C;  1ZR4 A;  1L0N D;  2JEE A;  5CBN A;  2ZVO B;  2I8D A;  3UIA A;  2O01 J;  1G1J A;  4MN4 C;  1BDC A;  1ZV8 A;  1S5L E;  3SFD C;  5KJ7 C;  2PAJ A;  3F89 A;  3VMX A;  3D6Y A;  4PD4 H;  5GTH H;  1FZB A;  2ZT9 C;  1S5L H;  1OW6 A;  3N4X A;  1NTK E; 
#chains in the Genus database with same CATH homology
 3RK2 C;  2XV5 A;  1JCC A;  1HGZ A;  2R5B A;  1T8Z A;  5APY A;  3VTP C;  2FFD C;  1LTT C;  5BU8 B;  1G2C B;  1GK6 A;  3OAK A;  4JYB A;  1DX7 A;  1G1I A;  5CCG A;  1X9V A;  5KJ7 A;  2OYI A;  3KYQ A;  2CPS A;  3RL0 C;  3B5N B;  1CSB A;  4N78 D;  5CHX A;  3VMZ A;  4GIF A;  3HD7 A;  3I5C A;  1X8Y A;  2YKO A;  1RF1 C;  3CLQ A;  1AFO A;  5APW A;  2FFD A;  4N6J A;  1CI6 B;  4I1L A;  3LW5 H;  1LT9 C;  1KQL A;  5AVU B;  2Q3I A;  1M1J C;  2R5D A;  1JY3 N;  3H32 B;  4Y99 B;  3C9I A;  3V2Q A;  3MD0 A;  3R2P A;  1SFC C;  1L0N K;  1URQ C;  4C7R A;  1XTC C;  3GHG C;  1NTK K;  1JY3 O;  2L5G B;  1FJP A;  1J1D C;  3RK3 B;  1KFN A;  1NAF A;  1N7S C;  3KDP B;  1FZG A;  1W2E A;  1JMM A;  1RF1 A;  1L4A C;  2H7H A;  4EOT A;  1HGV A;  1N7L A;  3CI9 A;  2Z5I A;  2I1J A;  2WTY A;  5APV A;  1LT9 A;  3V4W A;  2WIT A;  1M1J A;  2A45 I;  5AVY B;  1URQ A;  3V2N A;  3P7K A;  1CW5 A;  3IFM A;  3M0A A;  5AVV B;  1HH0 A;  1LWU B;  3II6 A;  2J59 M;  1JY3 P;  1NH4 A;  2P1J A;  1N7S A;  3T97 A;  2O01 H;  1MFZ A;  5AVW B;  1H88 A;  2W6B A;  1LTJ C;  3KQG A;  4I6M C;  3E1I A;  1L4A A;  1GU5 A;  3HE4 A;  2OYH B;  4AYC A;  3P8C D;  2BAS A;  2KP8 A;  3B5N D;  5CMZ A;  2KB7 P;  2KOG A;  5APQ A;  2C9L Y;  2GUV A;  2C0W A;  3M06 A;  2C9N Y;  1YYC A;  2HFE D;  2HYN A;  4RES B;  3VOP A;  2IPP A;  2Z5H A;  3BAS A;  5AVX B;  1T3J A;  2Q5U A;  1T2K C;  2VRS A;  1ZN5 A;  1LTB C;  2WT7 A;  4B86 A;  4JF7 A;  1LTJ A;  1HVV A;  4HYT B;  3VP8 A;  3P8C E;  1X79 B;  1JCD A;  3HD7 B;  3TK1 A;  3V2R A;  3LID A;  2NPS B;  3RK2 B;  3M91 A;  2WSC H;  3RK3 D;  2FFD B;  3MIW A;  1IFN A;  5AW1 B;  1RE3 C;  1OWA A;  2WPS A;  3VN0 A;  2OYI C;  1JO5 A;  1KIL C;  1VPC A;  5AVQ B;  3MUD A;  2P2U A;  1NKN A;  3RL0 B;  1FU1 A;  4N3Y B;  3M9B A;  3HRN A;  4WY4 D;  5BVZ A;  1E5W A;  5AW5 B;  2HOD A;  5CCH D;  3TSI A;  1SLQ A;  1N73 C;  3SWY A;  1RF1 B;  2FYU K;  2P67 A;  5APU A;  1JY2 N;  1GL2 A;  2J58 A;  3BAT A;  5AVS B;  2I1K A;  1LT9 B;  2Q7C A;  1JTH A;  2ZXE B;  1ZLL A;  3M9H A;  1S9K E;  1RE3 A;  1M1J B;  1JY2 O;  3EQ2 A;  3BRV B;  1KIL A;  4HH2 A;  3KPE A;  2YO3 A;  1SFC B;  5AVT B;  2H8P D;  1SQB K;  3OJA B;  1PFI A;  3GHG B;  5AVZ B;  2IFN A;  1J1D B;  4JYC A;  1J1E C;  1N7S B;  3L4F A;  3TNU A;  1GD2 E;  1N73 A;  5CCG D;  5APS A;  1L4A B;  2PP6 A;  2N1T D;  1JNM A;  1FZF A;  3VP9 A;  4C46 A;  1HTL C;  3HD7 D;  1SQP K;  1A02 J;  1ZR2 A;  2W6A A;  1JY2 P;  1FJK A;  3B8E B;  2NPS D;  4N78 E;  3RK2 D;  2N9B A;  3M0D C;  2M8R A;  1MUU A;  2WT7 B;  2ZFC A;  1VDF A;  1LTJ B;  4ZKP A;  1NWQ A;  1A02 F;  2HG5 D;  4GT1 A;  1FZC C;  1KFM A;  3RL0 D;  1CZQ A;  1T3U A;  1H8A A;  1WT6 A;  1YTZ I;  1SP4 A;  1N2D C;  3L36 A;  3LIE A;  1IFM A;  2YO2 A;  1FZE A;  2O1J A;  3M0D A;  1KZU B;  1GDT A;  1IFJ A;  1N86 A;  2M3B A;  4I2L C;  3IR9 A;  1FOS F;  1RY3 A;  1FDM A;  1SFC D;  3BVH A;  2HOD B;  1FZC A;  4LC1 A;  3EFG A;  2WZ7 A;  4W7Y A;  3SWF A;  5AW8 B;  2YNY A;  1GK4 A;  3B5N A;  2A45 G;  2CPB A;  4AUW A;  2HLO A;  3M9Q A;  1L4A D;  2A45 H;  2H43 A;  2OYI B;  4O9B A;  3OA7 A;  1KIL B;  4XA4 A;  1LTI C;  2XNX A;  1HUC A;  3HUS C;  3TNU B;  3H32 A;  1NTM K;  4WY4 C;  1N73 B;  1LTS C;  3V2P A;  2MJZ A;  1JUN A;  1GL2 C;  2XKM A;  1GW3 A;  2FKW B;  4KHX A;  1FZA A;  5CJ0 A;  4C7N A;  3L37 A;  2WWW A;  1M7L A;  4DZO A;  2FXM A;  3MGN A;  4WBA A;  3TYY A;  2R3C A;  5APT A;  2IFM A;  2Z4E A;  4LLH A;  1J1E B;  3HUS A;  2WSE H;  1AQ5 A;  3P8M C;  5BU5 A;  1NO4 A;  2WPQ A;  4WY4 A;  1RE4 C;  2KYV A;  2GM4 A;  5AW7 B;  3L35 A;  5CCH A;  1T2K D;  1IC2 A;  2POH A;  3NTN A;  1LGH B;  1NTZ K;  1OXZ A;  2HPC A;  2N1T C;  1L0L K;  3HTK A;  1URQ B;  3A7O A;  3N7N A;  4IFM A;  1J2J B;  2OYH A;  3HE5 A;  2O1K A;  1LTA C;  1IJD B;  5KLV K;  1Z56 A;  3VMY A;  5AW0 B;  1RE4 A;  5KJ7 D;  3A5T A;  1KIL D;  3HE4 B;  1FZC B;  4XE5 B;  1HWT C;  3VYI A;  2Q9I A;  4W7Z A;  3A3Y B;  2N1T A;  3V4Q A;  1NU1 K;  1QL1 A;  2NPS A;  1H89 A;  3NXS A;  2E43 A;  1NOH A;  2C0X A;  1IO4 A;  5AVR B;  5AW4 B;  2YKQ A;  2QM7 A;  3B5N C;  1GU4 A;  3PP5 A;  2KLV A;  4WB4 A;  4C7N B;  4DOJ A;  2W27 A;  1WRG A;  5AW2 B;  1SQV K;  1MV8 A;  3NFQ A;  4AQR D;  5AW6 B;  1RF0 C;  2P7J A;  1QL2 A;  3P32 A;  1G2C A;  1URQ D;  3HUS B;  1GTW A;  4Y99 C;  2E42 A;  4IFD K;  4WY4 B;  3U1A A;  2WSF H;  1SFC A;  5AW9 B;  3WMM 0;  3GHG A;  1N7S D;  1GL2 B;  3U1C A;  3A2A A;  1FBM A;  3RK3 C;  4W80 A;  1JTH B;  2HPC B;  3NMD A;  1NKZ B;  2QM8 A;  1JOC A;  2XZR A;  3HTK B;  1IFI A;  1IK9 A;  5KTB A;  1RF0 A;  1CI6 A;  3HE5 B;  1SVF A;  4LGD E;  2WPR A;  1SQQ K;  1EQ7 A;  5CJ4 A;  2JJL A;  1LTG C;  5CCH C;  2XU6 A;  1SQX K;  3H6P A;  4IFF A;  3V5B A;  1LWU C;  1NHL A;  3U59 A;  1DEB A;  2GUS A;  2N1T B;  2KSJ A;  2YKP A;  4EIJ A;  5AW3 B;  1HBW A;  2OYH C;  1MZ9 A;  2LKM A;  1DH3 A;  3CL3 D;  1ZR4 A;  2FYZ A;  1FAV A;  2IX7 C;  2JEE A;  2R32 A;  4GKG A;  3UIA A;  1G1J A;  5APX A;  3BRT B;  1IFD A;  1YTZ T;  3MTU E;  1ZV8 A;  1GZL A;  2OAR A;  5CCG C;  3O8Z A;  5KJ7 C;  1LWU A;  1S9K D;  1FOS E;  2PAJ A;  3VMX A;  1GW4 A;  4ZKU A;  2YMY A;  1FZB A;  1XTG B;  3HD7 C;  3G3Z A;  4OH8 B;  2XDJ A;  4M3L A;  3N4X A;  1GL2 D;  1HJB A;  2NPS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...