3M0DC

Crystal structure of the traf1:traf2:ciap2 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
FMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of the TRAF2: cIAP2 and the TRAF1: TRAF2: cIAP2 complexes: affinity, specificity, and regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords TNF receptor-associated factor 2
total genus 28
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2010-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3m0dC00
1JTHA 2NPSB 4WY4B 1N7SA 1URQB 1SFCD 3RK2C 1SFCC 3RK2B 1L4AB 1XTGB 3RK3C 4OH8B 1GL2D 2NPSC 3VOPA 3HD7C 1N7SC 4N78E 5CCGD 4W80A 5CCHD 1L4AD 1T3JA 5CCGA 3KYQA 5CCHA 5KJ7A 3TSIA 1SFCB 3B5NC 4JF7A 4W7YA 1GL2C 2NPSD 3PP5A 4LGDE 3RL0D 3RL0B 2HG5D 1KILA 3RL0C 2KOGA 4WY4A 2XDJA 2N1TC 1URQC 3HD7B 3RK3D 2HFED 1KILB 2N1TA 4WY4C 1KILC 1L4AC 3B5NB 1GL2A 1L4AA 1GL2B 5KJ7C 3P8CE 2H8PD 3RK2D 1URQA 3HTKB 1HVVA 1NHLA 3HD7A 3B5ND 2NPSA 1JTHB 1URQD 2WZ7A 3B5NA 4WY4D 2M8RA 4W7ZA 2YMYA 1KILD 5KJ7D 1N7SD 3RK3B 3HD7D 2N1TD 5CCHC 1SFCA 5CCGC 2N1TB 3M0DC 2PP6A 1N7SB
chains in the Genus database with same CATH superfamily
1GZLA 1NTZJ 1SQBE 2GUSA 1L0LE 4OGQD 3H1JG 4H44B 2WITA 4WVZA 3BCCG 1GW4A 1RH5B 1RF1B 1LGHB 3MIWA 2R3SA 5KLIB 3AEFC 1PZQA 2QSIA 4KHXA 2KS1B 5APTA 5KLVE 3KPEA 3R2PA 1RF1C 2BCCJ 3Q5RA 5K5GB 1H8AA 3GMAA 2GA1A 2QIWA 4LC1A 2O01N 3AE2C 1IFMA 2R3CA 3FGAD 1G1JA 3JC22 2XZRA 3F89A 1YYCA 1NVOA 3AEBC 2WSEJ 3RK2B 3I5CA 2R5DA 2Z5HA 3AEGC 1L4AB 2JR8A 3GHGC 1SQQD 1N86A 4H0LD 3PLNA 3AECC 4AYCA 1G2CB 1SS1A 2WMMA 3WU2E 1SQQG 2JP3A 4RESB 1OMIA 2ZYGA 4UB6E 3H1LD 1LT9A 2JWAA 1OW7A 1ZW0A 4YXDC 2O01J 1PFIA 1NU1K 2NZ2A 2M5AB 3HD7C 4N78E 2FYUE 2NRGA 4NPDA 4QMAA 4W80A 2E74B 4GODA 3PTZA 1HBWA 3G6EP 1NTMD 2WVRA 2YIUB 3FWNA 4PD4H 2OYHA 1LNQA 1PV3A 2BEQD 2YKPA 3AE9C 1NTZK 3L72J 1SQBJ 5AW5B 1G2CA 2QM7A 2PRRA 4UB8H 1ZRTD 1L0LD 1SVFA 3WUVA 1P84E 2O1KA 1OW8A 2H88C 3H1LE 1N8RQ 1JY2P 3TSIA 1OX3A 2V4HA 2KIKA 1LWUC 2B9BA 1LTJA 1MFZA 3A2AA 3H1HJ 3KDPB 4HYTB 4RKUJ 3S9OA 3TYYA 1Q81Q 3CD6P 4JF7A 2XV5A 3CX5I 1LJ2A 2WPQA 2ZYAA 3TGUG 2IBZI 2ZT9D 4H44D 1BCCG 2Y9ZA 1SLQA 1K9MQ 3L74D 1M1KQ 2JKVA 4LGDE 1TU3F 3RL0D 4ZKPA 1PPJG 3RL0B 1FJPA 1LT1A 3A7OA 1EXJA 2IZ0A 4I7ZB 1NKNA 1FJKA 2ZT9B 2QE7H 3CCRP 1M1JA 1J2JB 1K05A 3L37A 2WSEH 1NH4A 2Z5IA 1URQC 2RH0A 5AVVB 1VQ8P 1VQLP 1JCCA 3L75G 2HFED 1KFNA 5CBNA 1NYHA 3A0HH 3CX5E 5B66H 1N2DC 1FS0E 1JB0J 1OFCX 1KB9D 5B5EE 2FXMA 1Q90D 1RF0A 1FE6A 3CWBD 2P7JA 1FDOA 3L70E 4N6JA 1N73A 3JCUE 2ZJSE 3AE1C 2E76B 1IJDB 3A0BE 1NTME 3EFFK 4GKGA 5E79E 1PGOA 3A3YB 3SFDC 3V2QA 1GU5A 3AEDC 1H88A 2E74D 3AE4C 3Q5PA 1LWUB 1GL2A 1NAFA 2GM4A 4D6TD 1L4AA 3EFGA 3C1LA 3JSVC 4JBZA 4ASVA 1IC2A 3O6QA 3A5TA 2A06D 2BASA 1K04A 1KYOE 4H0LB 2W6BA 3HE5A 2IFMA 4PD4E 3TK1A 3CWBJ 4ASWA 3SFEC 3JCUH 3KXDA 5AVQB 4H0LC 3RK2D 1JO5A 2K88A 2A45H 1K73Q 3CC2P 1Y8AA 5KKZC 3L73J 5AVSB 2QJYC 1HVVA 1NHLA 2Q6QA 2NPSA 1KB9I 5AW0B 4A7PA 3G9RA 5TJHA 1HF9A 3O8ZA 2E5YA 2E42A 2YXRB 2HR3A 5GTHH 1KILE 1T2KD 1DH3A 1KTMA 2K37A 5APUA 3I56P 3D71A 2B88A 3BRTB 1NTKD 1KZUB 3L70J 4LLHA 5CMZA 1J1EB 3V4WA 1FZAA 3Q5SA 5AW2B 1FAVA 3BATA 2HPCA 1N7SD 1HJBA 2WPSA 2H43A 1S1CX 3EQ2A 3II6A 1FZCC 2D2CD 3TDKA 3UIAA 2YXQB 1FZFA 1SFCA 2FKWB 1EZVE 4YXWH 1VQ9P 2KK7A 5GTIH 2VRSA 2FFDC 2WT7A 3I55P 1S5LX 5L8RJ 3B71A 5CJ4A 3KQGA 2WT7B 4BRYA 1OW6A 3Q1MA 1EC5A 1YJWP 1GTWA 3H1LJ 3CWBE 5KKZB 1URQB 3G3ZA 1SFCD 3CCSP 2FFDA 1GMJA 5KAFE 2N9BA 5KTBA 5APWA 3RK2C 5AW9B 2HPCB 4Y28J 1J1DB 2W27A 1SFCC 3L73E 3EWKA 1FZCA 2P1JA 2LXCB 4C7NB 1KYOD 5AVZB 2JO1A 4IFFA 4R4LA 1QVGO 4Y99C 1CI6B 1XTGB 2QRXA 5AVUB 1RHZB 4B86A 1PP9G 1RE4C 1XTCC 1SQPG 3L72G 1NTZG 3H1HD 3PRJA 4WWIA 1GL2D 4D6TG 4EDFA 2J5UA 3TF5A 1SQVD 4PD4I 1YI2P 3CC7P 2P10A 2NPSC 3V6IA 1SQBK 3LIDA 3VOPA 1N7SC 4Y99B 3TNUB 1KC8Q 3H1IG 1NTZD 3H1HG 4OWFA 5KLVG 4PJ0H 5TISE 5CCHD 2D2CC 1Y9BA 5B5EH 1ZOYC 1JMBA 1EDLA 3WUTA 3SWYA 1NTMJ 3TGUJ 3HE5B 2ZVOB 1JNMA 2JEEA 1SQVJ 2V7QH 3CMEP 2Q9IA 1Z56A 2XNDH 4L73A 3U59A 1PIXA 1SQVK 3MP7B 5AVRB 3MZWB 1WRGA 1YTZT 3L71D 5M1BA 1OVVA 1SFCB 1CZQA 3CWBG 3B5NC 4I6MC 5AW7B 3BVHA 1GL2C 2SPZA 1L0NK 2FYNB 2RKLA 4HB1A 5AW8B 4EYYQ 2NPSD 1L2PA 3PP5A 2KXPB 2AXTE 1JEKA 3WMM0 3H1KD 2K9JB 1K8AQ 1YIJP 1KQSO 3VMXA 2H7HA 4JQ0D 1Q2NA 2POHA 3L71G 2O1JA 1QL2A 3HD7B 2N9YB 1BE3E 1M1JB 3USSA 3CCUP 2IDBA 1BSHA 3BCCE 3P8MC 1BE3G 2Q1KA 2YIUC 1ZRTE 4MN4C 2WSFJ 2M3BA 4N3YB 1X8YA 2KLVA 4PJ0E 5AVYB 3CX5D 2IBZD 3MD0A 1FDIA 2YO2A 1E79H 1GU4A 2O3JA 5BVZA 1X79B 1YJ9P 2FYUD 1SQVG 5GTHE 2HODA 5H2FE 1YITP 4IL6X 1NWQA 1GL2B 1LWUA 1KORA 1CSBA 1VQPP 2K3RA 3L4FA 3T97A 3G4SP 2A45G 1YQ3C 3NFQA 1JCDA 1DD3A 2CK3H 2KNCA 2B89A 3GG2A 1ZP0C 2ZT9C 4PV1D 1N7LA 3VP9A 1UIIA 1NU1E 2H8PD 3D6YA 1S5LH 3TNUA 3SWFA 1X0TA 2M5AA 3C9IA 4BXLA 2LR2A 1MZ9A 4XA4A 1JOCA 2IBZG 1HGVA 2J59M 3HTKB 1LTAC 4DZOA 3CXHH 2FYZA 1KYOH 1S72P 1YQ4C 3HD7A 3LW5J 2E75B 1GW3A 1BE3D 1JTHB 3B5ND 1FU1A 4M3LA 2FYUG 1LT9C 1P84I 1MV8A 1URQD 2P2UA 1EZVI 2Y0CA 1EDIA 3BCCD 3R4YA 5H2FH 2H89C 3BASA 4BWNA 3MGNA 1NTKK 3B5NA 3B8EB 1DX7A 4IOIH 2O01H 2WPRA 5C39A 3GLMA 4I2LC 2OARA 3N4XA 5AW3B 3RK3B 1FOSE 2C9LY 2YKOA 1OXZA 1KB9E 3RBXA 3CCMP 2QA4P 1LTJB 2KS1A 1VQOP 2FYNC 1IFJA 3GW6A 5B66E 1FBMA 1RF1A 1GK6A 4BRYB 3TGUE 4H13D 1SQVE 4U3FG 1SQXE 1VPCA 1JTHA 2OQQA 4IFMA 4I7ZC 4WY4B 1YHQP 1BGYD 1ZN5A 5CBOA 1L0NG 1N7SA 1PGQA 1VF5B 3ABVC 3L74G 3ZDMA 1YJNP 1Q7YQ 3CCLP 1RE3A 2AXCA 3U1CA 2K1AA 1PP9E 1VQMP 3QH9A 4K35A 1VF5C 2L5GB 5APVA 1NGMB 2K9YA 1EDJA 1RE4A 3CXHI 1BSNA 3U1AA 3RK3E 1AV1A 1OVRA 2FFDB 1EXIA 3IN6A 2IZ1A 2KYVA 1KD1Q 2W8ZA 3H1JE 2WSCH 1DEEG 3H1IE 1NJIQ 4WBAA 1CW5A 4PV1C 2G3AA 1IK9A 2HODB 1JY2N 2KZIA 3IFMA 4KT0J 4EIJA 1ZV8A 5KLVK 2DW3A 1Q86Q 3RK3C 1AVOA 2BCCG 1DEBA 4OH8B 4C7RA 1LTSC 5KLVD 2R32A 1AJYA 1BE3J 1BCCJ 3CXHE 1L0LK 2QJKB 2I1KA 3BCCJ 3IR9A 2FY8A 4NPEA 2B87B 5EFWB 2Y0DA 2Y9YA 2AEJA 5CJ0A 3BRVB 1LP1A 2WQYC 1L4AD 2C0WA 3M91A 5KLIC 4O9BA 1T3JA 2FBWC 3VN0A 3FXDA 2Q5UA 3WU2H 1KQFB 1PGJA 1SQXK 1USEA 1L0ND 3M06A 1HTLC 2K9JA 2XU6A 3CXHD 1GK4A 2Z4EA 2HYNA 1DIPA 4U3FD 1FC2C 2IPPA 2IYPA 4DOJA 3L71J 4GDOA 5APSA 1SQQK 3GHGB 3C8VA 4PD4D 1ZR4A 4H13C 1VF5D 1IK7A 2A06E 2E5TA 3L75E 4ZNCA 4XFJA 1HH0A 4OGQB 1R8EA 1M90Q 2OTKE 1NU1J 3AE8C 3H1JD 4H13B 1NTKE 3TGUD 1IO4A 2P58A 3M9BA 3VMYA 2OYOA 1EZVG 1EZVD 1NTKG 1NTMK 3MUDC 1Y47A 3NMDA 5APYA 2YNYA 2ZVNB 1A02J 1GD2E 2XDJA 3VP8A 1R5SA 2W6AA 1AA0A 1E5WA 1SP4A 1NOHA 1OIPA 2P67A 4L76A 3H32A 3RK3D 1KILB 2N1TA 1LP1B 1S9KD 1KQLA 4WY4C 2LXBA 4AUWA 3N7NA 1FZEA 2B87A 1KILC 4HJGH 1MUUA 2YKQA 3SWKA 1L4AC 1NO4A 1R5LA 1PL5A 1SQXD 2A45I 2E75D 3B5NB 1SQQJ 3AEAC 3O6QB 3M0AA 4XE5B 5AW4B 1ZR2A 2QVAA 3KZIH 2GUVA 2C9NY 1T3UA 3F5HA 3QWOC 2MJZA 3L70G 1SQXJ 1AVYA 3AE5C 1UIXA 1EDKA 4PV1B 2WWWA 3CPWO 1N73C 4JYCA 5KJ7C 1RF0C 2OYHB 3VMZA 1WT6A 3L75J 2FYUK 1OZHA 4NPFX 1SQBG 2M0BA 1PP9J 1HJ0A 3L35A 5AVTB 3V5BA 1URQA 2QJKC 1U57A 2KNCB 3HE4B 4D6TE 1M1JC 1AQ5A 1ZXGA 2KSJA 2CPBA 3H1JJ 3OAKA 1ZMEC 3H1IJ 3CCQP 3LW5H 3CC4P 1DD4A 1X9VA 2KLUA 2FXPA 2RN0A 3FWLA 2WZ7A 3L75D 5AW6B 4GIFA 4GOFA 4N78D 1QGKB 3P32A 4TT3H 1PPJE 3CMAP 1LTGC 2WSCJ 4OVNF 4WY4D 2M8RA 1BDDA 4W7ZA 2YMYA 1VQNP 1BCCE 1LTJC 3L74E 5KJ7D 3W67A 1H0TB 3HD7D 5KAFH 1M57D 1JM0A 2BEZF 5CHXA 3AE6C 3RBZA 2ZXXA 1SQQE 3VTPC 2UWJE 1LTTC 3M9HA 2QM8A 2J58A 2KUBA 2N1TB 3E1RA 3L73D 3M0DC 1BGYE 4IL6E 4R4MA 4YTPC 1JUNA 2QJPC 3MTUE 1VQKP 2W6JH 2NPSB 1PPJD 1W2BO 3KHUA 1S9KE 2OTLP 2YO3A 1WMKA 1QLED 3OJAB 4ZKUA 1BCCD 3CL3D 2E75C 3HTKA 3NXSA 4HKZH 5KAIE 4YPCA 3S4RA 3V2PA 3VMAA 4EI2A 5TISH 3HUSB 2WSSH 3AE7C 1KMIZ 1VDFA 2KSEA 3L71E 3M0DA 5APXA 1NTMG 3G71P 2QEXP 3CCVP 1YTZI 1LT9B 2JJLA 4D6TJ 3GHGA 2OYHC 1VQ5P 1L0LG 3E1IA 3CLQA 1NU1D 1NAYA 1AQTA 3PJSK 1NTKJ 2QG4A 3H1KE 2ZYDA 3H1LG 4KJMA 3CCJP 1GDTA 3K5BA 1SQPD 1USDA 3D70A 1HGZA 3Q3DA 1M8OB 3L70D 3NTNA 1D7MA 1FZGA 1BDCA 1MFTA 4U3FJ 1ZLLA 1T6AA 4JYBA 4L75A 3RGUA 2Q7CA 1L0NJ 1W5CE 2AEMA 2C0XA 3IAOA 4TLFA 1N73B 3D6ZA 5CCGD 1S5LE 1SQXG 2QJPB 1M56D 1X22A 1LTBC 4ZMDA 4C46A 1T8ZA 1BGYJ 1FOSF 1LTIC 1VQ7P 2IBZE 1QX8A 3ITKA 4UB6H 2E74C 5APQA 3P8CD 3KYQA 5CCGA 1NU1G 2V7QJ 3HUSC 1OWAA 1S2EA 3GF7A 4RJTA 3B4SA 5CCHA 5KJ7A 1CI6A 2MKVA 1H89A 1QVFO 1RQUA 4JPZB 3MHVA 2OYIA 4IFDK 1QL1A 3FXEA 5KLVJ 1P84D 1PGPA 1IFDA 2BCCE 1FZCB 2FXOA 1SQPK 2IX7C 1QEXA 2OTJP 5E79H 4W7YA 1JY3P 1HUCA 2LKMA 2YMKA 1KFMA 3Q2YA 5BU8B 1A02F 1H0TA 2WSFH 1JY3N 2HG5D 5BU5A 2IFNA 3CI9A 5KAIH 2CPSA 4EOTA 1KILA 3CX5H 4H44C 3CCEP 1FDMA 4HH2A 2AEFA 4U7JA 3H1KG 3RL0C 2KOGA 1T2KC 2D2CB 4WY4A 3RL0g 3IF4A 1VL2A 2N1TC 3OA7A 5AW1B 3V2NA 4AQRD 5GTIE 2QJYB 2XNXA 3HE4A 3GF3A 1MKMA 3OW2O 2ZAEB 3VYIA 1VQ4P 3WUUA 3MUDA 4L74A 2I8DA 1G1IA 1JY2O 2JDIH 2W90A 2ZFCA 2WPVB 3L74J 1W2EA 2KP8A 2PAJA 2OGUA 3H6PA 2RMZA 1SQPJ 3L72E 1HWTC 2E76C 3L36A 3H25A 2OYIB 1S4XA 4K3AA 4DT0A 1J1EC 2A06G 2Q3IA 5DJTB 1P84H 3PHLA 2BCCD 3H1HE 1NTZE 2JWDA 2XKMA 4UB8E 4C7NA 2E43A 1L0LJ 4Z1MH 1RQVA 3H1ID 1SQBD 2G8YA 4RO0A 3A0BH 4DCKA 1VQ6P 1KV4A 4I1LA 1NKZB 2W83C 1Q82Q 1EQ7A 5AVWB 1JMMA 1RY3A 2PGDA 3E7KA 3P8CE 4DJGA 2KI7B 3L72D 2Q3EA 1PP9D 4GT1A 3A0HE 1IZNB 3H32B 1AFOA 1OVUA 3T97B 2I1JA 2ITAA 1KQGB 1M7LA 1U7JA 3LIEA 1IFIA 3V4QA 1J1DC 3H1KJ 2WTYA 2E76D 3AEEC 1BGYG 3KZIE 1JY3O 4IL6H 3HRNA 4WB4A 2AXTH 4GOEA 2Y0EA 3V2RA 1KB9H 2ZXEB 2HLOA 4U3FE 1KILD 3L73G 1FZBA 3P7KA 1IFPA 3PH0A 5DJUB 1L0NE 2OYIC 2R5BA 1U7MA 2N1TD 3AE3C 3M9QA 3SSUA 4CPGA 2FYUJ 2L91A 1S3JA 1SQPE 1YBKA 3HUSA 5AVXB 2KB7P 3S1KA 3W68A 5CCGC 5CCHC 1KYOI 1KN7A 2KZJA 4OGQC 2PP6A 2M3EA 1N7SB 2PFXA 2R44A 1IFNA 3FX0A 2IYOA 1RE3C
chains in the Genus database with same CATH topology
1GZLA 2GUSA 2WITA 1GW4A 1RF1B 1LGHB 3MIWA 4KHXA 5APTA 3KPEA 3R2PA 1RF1C 1H8AA 4LC1A 1IFMA 2R3CA 1G1JA 2XZRA 1YYCA 3RK2B 3I5CA 2R5DA 2Z5HA 1L4AB 3GHGC 1N86A 4AYCA 1G2CB 4RESB 1LT9A 1PFIA 1NU1K 3HD7C 4N78E 4W80A 1HBWA 2OYHA 2YKPA 1NTZK 5AW5B 1G2CA 2QM7A 1SVFA 2O1KA 1JY2P 3TSIA 3A2AA 1LWUC 3KDPB 1LTJA 1MFZA 4HYTB 3TYYA 4JF7A 2XV5A 2WPQA 1SLQA 4LGDE 3RL0D 4ZKPA 3RL0B 1FJPA 3A7OA 1NKNA 1FJKA 1M1JA 1J2JB 3L37A 2WSEH 1NH4A 2Z5IA 1URQC 5AVVB 1JCCA 2HFED 1KFNA 1N2DC 2FXMA 1RF0A 2P7JA 4N6JA 1N73A 1IJDB 4GKGA 3A3YB 3V2QA 1GU5A 1LWUB 1GL2A 1NAFA 2GM4A 1L4AA 3EFGA 1IC2A 3A5TA 2BASA 2W6BA 3HE5A 2IFMA 3TK1A 5AVQB 3RK2D 1JO5A 2A45H 5AVSB 1HVVA 1NHLA 2NPSA 5AW0B 3O8ZA 2E42A 1DH3A 1T2KD 5APUA 3BRTB 5CMZA 1KZUB 3V4WA 4LLHA 1J1EB 1FZAA 5AW2B 1FAVA 3BATA 2HPCA 1N7SD 1HJBA 2WPSA 2H43A 3EQ2A 3II6A 1FZCC 3UIAA 1FZFA 1SFCA 2FKWB 2VRSA 2FFDC 2WT7A 5CJ4A 3KQGA 2WT7B 1GTWA 1URQB 3G3ZA 1SFCD 2FFDA 5KTBA 2N9BA 5APWA 3RK2C 5AW9B 2HPCB 1J1DB 2W27A 1SFCC 1FZCA 2P1JA 4C7NB 5AVZB 4IFFA 4Y99C 1CI6B 1XTGB 5AVUB 4B86A 1RE4C 1XTCC 1IO4A 1GL2D 2NPSC 1SQBK 3LIDA 3VOPA 1N7SC 4Y99B 3TNUB 2FFDB 5CCHD 3SWYA 3HE5B 2JEEA 2Q9IA 1Z56A 3U59A 1SQVK 5AVRB 1WRGA 1YTZT 1SFCB 1CZQA 4I6MC 3B5NC 5AW7B 3BVHA 1GL2C 1L0NK 5AW8B 2NPSD 3PP5A 3WMM0 3VMXA 2H7HA 2POHA 2O1JA 3HD7B 1QL2A 1M1JB 3P8MC 4N3YB 2M3BA 5AVYB 1X8YA 2KLVA 3MD0A 2YO2A 1GU4A 5BVZA 1X79B 2HODA 1NWQA 1GL2B 1LWUA 1CSBA 3L4FA 3T97A 2A45G 3NFQA 1JCDA 3VP9A 1N7LA 2H8PD 3TNUA 3SWFA 2OYHC 3C9IA 4XA4A 1MZ9A 1JOCA 1HGVA 2J59M 3HTKB 1LTAC 4DZOA 2FYZA 3HD7A 1T2KC 4M3LA 3B5ND 1GW3A 1JTHB 1FU1A 1LT9C 1MV8A 1URQD 2P2UA 3BASA 3MGNA 1NTKK 3B5NA 3B8EB 1DX7A 2O01H 2WPRA 4I2LC 2OARA 3N4XA 5AW3B 3RK3B 1FOSE 2C9LY 2YKOA 1OXZA 1LTJB 1IFJA 1FBMA 1RF1A 1GK6A 1VPCA 1JTHA 4IFMA 4WY4B 1ZN5A 1N7SA 1RE3A 3U1CA 5APVA 2L5GB 1RE4A 3U1AA 2KYVA 2WSCH 4WBAA 1CW5A 1IK9A 2HODB 1JY2N 3IFMA 4EIJA 1ZV8A 5KLVK 3RK3C 4C7RA 1DEBA 4OH8B 1LTSC 2R32A 1L0LK 2I1KA 3IR9A 5CJ0A 3BRVB 3M91A 1L4AD 2C0WA 4O9BA 1T3JA 3VN0A 2Q5UA 1SQXK 2Z4EA 3M06A 1HTLC 2XU6A 1GK4A 2HYNA 2IPPA 4DOJA 1ZR4A 5APSA 1SQQK 3GHGB 1HH0A 3M9BA 3VMYA 1H88A 1NTMK 5APYA 3NMDA 2YNYA 1A02J 1GD2E 2XDJA 3VP8A 2W6AA 1E5WA 1SP4A 1NOHA 2P67A 3RK3D 3H32A 1KILB 2N1TA 1S9KD 1KQLA 4WY4C 4AUWA 3N7NA 1FZEA 1KILC 1MUUA 2YKQA 1L4AC 1NO4A 2A45I 5AW4B 3B5NB 4XE5B 1ZR2A 3M0AA 2GUVA 2C9NY 1T3UA 2MJZA 1N73C 2WWWA 4JYCA 5KJ7C 1RF0C 2OYHB 3VMZA 1WT6A 2FYUK 5AVTB 3L35A 3V5BA 1URQA 3HE4B 1M1JC 1AQ5A 2KSJA 2CPBA 3OAKA 3LW5H 1X9VA 2WZ7A 5AW6B 4GIFA 4N78D 3P32A 1LTGC 4WY4D 2M8RA 4W7ZA 2YMYA 1LTJC 5KJ7D 3HD7D 5CHXA 3VTPC 1LTTC 3M9HA 2QM8A 2J58A 2N1TB 1JUNA 3M0DC 3MTUE 2NPSB 1S9KE 2YO3A 3OJAB 4ZKUA 3CL3D 3HTKA 3NXSA 3V2PA 3HUSB 1VDFA 5APXA 3M0DA 1YTZI 1LT9B 2JJLA 3GHGA 3E1IA 3CLQA 1GDTA 1HGZA 1FZGA 3NTNA 1ZLLA 4JYBA 2Q7CA 2C0XA 1N73B 5CCGD 1LTBC 4C46A 1T8ZA 1FOSF 1LTIC 5APQA 3P8CD 3KYQA 5CCGA 3HUSC 1OWAA 5CCHA 5KJ7A 1H89A 1CI6A 2OYIA 4IFDK 1QL1A 1IFDA 1FZCB 1SQPK 2IX7C 4W7YA 1JY3P 1HUCA 2LKMA 1KFMA 5BU8B 1A02F 2WSFH 1JY3N 2HG5D 5BU5A 2IFNA 3CI9A 1FDMA 2CPSA 4EOTA 1KILA 4HH2A 3RL0C 2KOGA 4WY4A 3OA7A 2N1TC 5AW1B 3V2NA 4AQRD 2XNXA 3HE4A 3VYIA 3MUDA 1G1IA 1JY2O 2ZFCA 1W2EA 2KP8A 2PAJA 3H6PA 1HWTC 3L36A 2OYIB 1J1EC 2Q3IA 2E43A 2XKMA 4C7NA 4I1LA 1NKZB 1EQ7A 5AVWB 1JMMA 1RY3A 3P8CE 4GT1A 3H32B 1AFOA 2I1JA 1M7LA 3LIEA 1IFIA 3V4QA 1J1DC 2WTYA 1JY3O 3HRNA 4WB4A 3V2RA 2ZXEB 2HLOA 1KILD 3P7KA 1FZBA 2OYIC 2R5BA 2N1TD 3M9QA 5AVXB 5CCHC 3HUSA 2KB7P 5CCGC 2PP6A 1N7SB 1JNMA 1IFNA 1RE3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTH A;  2NPS B;  4WY4 B;  1N7S A;  1URQ B;  1SFC D;  3RK2 C;  1SFC C;  3RK2 B;  1L4A B;  1XTG B;  3RK3 C;  4OH8 B;  1GL2 D;  2NPS C;  3VOP A;  3HD7 C;  1N7S C;  4N78 E;  5CCG D;  4W80 A;  5CCH D;  1L4A D;  1T3J A;  5CCG A;  3KYQ A;  5CCH A;  5KJ7 A;  3TSI A;  1SFC B;  3B5N C;  4JF7 A;  4W7Y A;  1GL2 C;  2NPS D;  3PP5 A;  4LGD E;  3RL0 D;  3RL0 B;  2HG5 D;  1KIL A;  3RL0 C;  2KOG A;  4WY4 A;  2XDJ A;  2N1T C;  1URQ C;  3HD7 B;  3RK3 D;  2HFE D;  1KIL B;  2N1T A;  4WY4 C;  1KIL C;  1L4A C;  3B5N B;  1GL2 A;  1L4A A;  1GL2 B;  5KJ7 C;  3P8C E;  2H8P D;  3RK2 D;  1URQ A;  3HTK B;  1HVV A;  1NHL A;  3HD7 A;  3B5N D;  2NPS A;  1JTH B;  1URQ D;  2WZ7 A;  3B5N A;  4WY4 D;  2M8R A;  4W7Z A;  2YMY A;  1KIL D;  5KJ7 D;  1N7S D;  3RK3 B;  3HD7 D;  2N1T D;  5CCH C;  1SFC A;  5CCG C;  2N1T B;  3M0D C;  2PP6 A;  1N7S B; 
#chains in the Genus database with same CATH topology
 1GZL A;  1NTZ J;  1SQB E;  2GUS A;  1L0L E;  4OGQ D;  3H1J G;  4H44 B;  2WIT A;  4WVZ A;  3BCC G;  1GW4 A;  1RH5 B;  1RF1 B;  1LGH B;  3MIW A;  2R3S A;  5KLI B;  3AEF C;  1PZQ A;  2QSI A;  4KHX A;  2KS1 B;  5APT A;  5KLV E;  3KPE A;  3R2P A;  1RF1 C;  2BCC J;  3Q5R A;  5K5G B;  1H8A A;  3GMA A;  2GA1 A;  2QIW A;  4LC1 A;  2O01 N;  3AE2 C;  1IFM A;  2R3C A;  3FGA D;  1G1J A;  3JC2 2;  2XZR A;  3F89 A;  1YYC A;  1NVO A;  3AEB C;  2WSE J;  3RK2 B;  3I5C A;  2R5D A;  2Z5H A;  3AEG C;  1L4A B;  2JR8 A;  3GHG C;  1SQQ D;  1N86 A;  4H0L D;  3PLN A;  3AEC C;  4AYC A;  1G2C B;  1SS1 A;  2WMM A;  3WU2 E;  1SQQ G;  2JP3 A;  4RES B;  1OMI A;  2ZYG A;  4UB6 E;  3H1L D;  1LT9 A;  2JWA A;  1OW7 A;  1ZW0 A;  4YXD C;  2O01 J;  1PFI A;  1NU1 K;  2NZ2 A;  2M5A B;  3HD7 C;  4N78 E;  2FYU E;  2NRG A;  4NPD A;  4QMA A;  4W80 A;  2E74 B;  4GOD A;  3PTZ A;  1HBW A;  3G6E P;  1NTM D;  2WVR A;  2YIU B;  3FWN A;  4PD4 H;  2OYH A;  1LNQ A;  1PV3 A;  2BEQ D;  2YKP A;  3AE9 C;  1NTZ K;  3L72 J;  1SQB J;  5AW5 B;  1G2C A;  2QM7 A;  2PRR A;  4UB8 H;  1ZRT D;  1L0L D;  1SVF A;  3WUV A;  1P84 E;  2O1K A;  1OW8 A;  2H88 C;  3H1L E;  1N8R Q;  1JY2 P;  3TSI A;  1OX3 A;  2V4H A;  2KIK A;  1LWU C;  2B9B A;  1LTJ A;  1MFZ A;  3A2A A;  3H1H J;  3KDP B;  4HYT B;  4RKU J;  3S9O A;  3TYY A;  1Q81 Q;  3CD6 P;  4JF7 A;  2XV5 A;  3CX5 I;  1LJ2 A;  2WPQ A;  2ZYA A;  3TGU G;  2IBZ I;  2ZT9 D;  4H44 D;  1BCC G;  2Y9Z A;  1SLQ A;  1K9M Q;  3L74 D;  1M1K Q;  2JKV A;  4LGD E;  1TU3 F;  3RL0 D;  4ZKP A;  1PPJ G;  3RL0 B;  1FJP A;  1LT1 A;  3A7O A;  1EXJ A;  2IZ0 A;  4I7Z B;  1NKN A;  1FJK A;  2ZT9 B;  2QE7 H;  3CCR P;  1M1J A;  1J2J B;  1K05 A;  3L37 A;  2WSE H;  1NH4 A;  2Z5I A;  1URQ C;  2RH0 A;  5AVV B;  1VQ8 P;  1VQL P;  1JCC A;  3L75 G;  2HFE D;  1KFN A;  5CBN A;  1NYH A;  3A0H H;  3CX5 E;  5B66 H;  1N2D C;  1FS0 E;  1JB0 J;  1OFC X;  1KB9 D;  5B5E E;  2FXM A;  1Q90 D;  1RF0 A;  1FE6 A;  3CWB D;  2P7J A;  1FDO A;  3L70 E;  4N6J A;  1N73 A;  3JCU E;  2ZJS E;  3AE1 C;  2E76 B;  1IJD B;  3A0B E;  1NTM E;  3EFF K;  4GKG A;  5E79 E;  1PGO A;  3A3Y B;  3SFD C;  3V2Q A;  1GU5 A;  3AED C;  1H88 A;  2E74 D;  3AE4 C;  3Q5P A;  1LWU B;  1GL2 A;  1NAF A;  2GM4 A;  4D6T D;  1L4A A;  3EFG A;  3C1L A;  3JSV C;  4JBZ A;  4ASV A;  1IC2 A;  3O6Q A;  3A5T A;  2A06 D;  2BAS A;  1K04 A;  1KYO E;  4H0L B;  2W6B A;  3HE5 A;  2IFM A;  4PD4 E;  3TK1 A;  3CWB J;  4ASW A;  3SFE C;  3JCU H;  3KXD A;  5AVQ B;  4H0L C;  3RK2 D;  1JO5 A;  2K88 A;  2A45 H;  1K73 Q;  3CC2 P;  1Y8A A;  5KKZ C;  3L73 J;  5AVS B;  2QJY C;  1HVV A;  1NHL A;  2Q6Q A;  2NPS A;  1KB9 I;  5AW0 B;  4A7P A;  3G9R A;  5TJH A;  1HF9 A;  3O8Z A;  2E5Y A;  2E42 A;  2YXR B;  2HR3 A;  5GTH H;  1KIL E;  1T2K D;  1DH3 A;  1KTM A;  2K37 A;  5APU A;  3I56 P;  3D71 A;  2B88 A;  3BRT B;  1NTK D;  1KZU B;  3L70 J;  4LLH A;  5CMZ A;  1J1E B;  3V4W A;  1FZA A;  3Q5S A;  5AW2 B;  1FAV A;  3BAT A;  2HPC A;  1N7S D;  1HJB A;  2WPS A;  2H43 A;  1S1C X;  3EQ2 A;  3II6 A;  1FZC C;  2D2C D;  3TDK A;  3UIA A;  2YXQ B;  1FZF A;  1SFC A;  2FKW B;  1EZV E;  4YXW H;  1VQ9 P;  2KK7 A;  5GTI H;  2VRS A;  2FFD C;  2WT7 A;  3I55 P;  1S5L X;  5L8R J;  3B71 A;  5CJ4 A;  3KQG A;  2WT7 B;  4BRY A;  1OW6 A;  3Q1M A;  1EC5 A;  1YJW P;  1GTW A;  3H1L J;  3CWB E;  5KKZ B;  1URQ B;  3G3Z A;  1SFC D;  3CCS P;  2FFD A;  1GMJ A;  5KAF E;  2N9B A;  5KTB A;  5APW A;  3RK2 C;  5AW9 B;  2HPC B;  4Y28 J;  1J1D B;  2W27 A;  1SFC C;  3L73 E;  3EWK A;  1FZC A;  2P1J A;  2LXC B;  4C7N B;  1KYO D;  5AVZ B;  2JO1 A;  4IFF A;  4R4L A;  1QVG O;  4Y99 C;  1CI6 B;  1XTG B;  2QRX A;  5AVU B;  1RHZ B;  4B86 A;  1PP9 G;  1RE4 C;  1XTC C;  1SQP G;  3L72 G;  1NTZ G;  3H1H D;  3PRJ A;  4WWI A;  1GL2 D;  4D6T G;  4EDF A;  2J5U A;  3TF5 A;  1SQV D;  4PD4 I;  1YI2 P;  3CC7 P;  2P10 A;  2NPS C;  3V6I A;  1SQB K;  3LID A;  3VOP A;  1N7S C;  4Y99 B;  3TNU B;  1KC8 Q;  3H1I G;  1NTZ D;  3H1H G;  4OWF A;  5KLV G;  4PJ0 H;  5TIS E;  5CCH D;  2D2C C;  1Y9B A;  5B5E H;  1ZOY C;  1JMB A;  1EDL A;  3WUT A;  3SWY A;  1NTM J;  3TGU J;  3HE5 B;  2ZVO B;  1JNM A;  2JEE A;  1SQV J;  2V7Q H;  3CME P;  2Q9I A;  1Z56 A;  2XND H;  4L73 A;  3U59 A;  1PIX A;  1SQV K;  3MP7 B;  5AVR B;  3MZW B;  1WRG A;  1YTZ T;  3L71 D;  5M1B A;  1OVV A;  1SFC B;  1CZQ A;  3CWB G;  3B5N C;  4I6M C;  5AW7 B;  3BVH A;  1GL2 C;  2SPZ A;  1L0N K;  2FYN B;  2RKL A;  4HB1 A;  5AW8 B;  4EYY Q;  2NPS D;  1L2P A;  3PP5 A;  2KXP B;  2AXT E;  1JEK A;  3WMM 0;  3H1K D;  2K9J B;  1K8A Q;  1YIJ P;  1KQS O;  3VMX A;  2H7H A;  4JQ0 D;  1Q2N A;  2POH A;  3L71 G;  2O1J A;  1QL2 A;  3HD7 B;  2N9Y B;  1BE3 E;  1M1J B;  3USS A;  3CCU P;  2IDB A;  1BSH A;  3BCC E;  3P8M C;  1BE3 G;  2Q1K A;  2YIU C;  1ZRT E;  4MN4 C;  2WSF J;  2M3B A;  4N3Y B;  1X8Y A;  2KLV A;  4PJ0 E;  5AVY B;  3CX5 D;  2IBZ D;  3MD0 A;  1FDI A;  2YO2 A;  1E79 H;  1GU4 A;  2O3J A;  5BVZ A;  1X79 B;  1YJ9 P;  2FYU D;  1SQV G;  5GTH E;  2HOD A;  5H2F E;  1YIT P;  4IL6 X;  1NWQ A;  1GL2 B;  1LWU A;  1KOR A;  1CSB A;  1VQP P;  2K3R A;  3L4F A;  3T97 A;  3G4S P;  2A45 G;  1YQ3 C;  3NFQ A;  1JCD A;  1DD3 A;  2CK3 H;  2KNC A;  2B89 A;  3GG2 A;  1ZP0 C;  2ZT9 C;  4PV1 D;  1N7L A;  3VP9 A;  1UII A;  1NU1 E;  2H8P D;  3D6Y A;  1S5L H;  3TNU A;  3SWF A;  1X0T A;  2M5A A;  3C9I A;  4BXL A;  2LR2 A;  1MZ9 A;  4XA4 A;  1JOC A;  2IBZ G;  1HGV A;  2J59 M;  3HTK B;  1LTA C;  4DZO A;  3CXH H;  2FYZ A;  1KYO H;  1S72 P;  1YQ4 C;  3HD7 A;  3LW5 J;  2E75 B;  1GW3 A;  1BE3 D;  1JTH B;  3B5N D;  1FU1 A;  4M3L A;  2FYU G;  1LT9 C;  1P84 I;  1MV8 A;  1URQ D;  2P2U A;  1EZV I;  2Y0C A;  1EDI A;  3BCC D;  3R4Y A;  5H2F H;  2H89 C;  3BAS A;  4BWN A;  3MGN A;  1NTK K;  3B5N A;  3B8E B;  1DX7 A;  4IOI H;  2O01 H;  2WPR A;  5C39 A;  3GLM A;  4I2L C;  2OAR A;  3N4X A;  5AW3 B;  3RK3 B;  1FOS E;  2C9L Y;  2YKO A;  1OXZ A;  1KB9 E;  3RBX A;  3CCM P;  2QA4 P;  1LTJ B;  2KS1 A;  1VQO P;  2FYN C;  1IFJ A;  3GW6 A;  5B66 E;  1FBM A;  1RF1 A;  1GK6 A;  4BRY B;  3TGU E;  4H13 D;  1SQV E;  4U3F G;  1SQX E;  1VPC A;  1JTH A;  2OQQ A;  4IFM A;  4I7Z C;  4WY4 B;  1YHQ P;  1BGY D;  1ZN5 A;  5CBO A;  1L0N G;  1N7S A;  1PGQ A;  1VF5 B;  3ABV C;  3L74 G;  3ZDM A;  1YJN P;  1Q7Y Q;  3CCL P;  1RE3 A;  2AXC A;  3U1C A;  2K1A A;  1PP9 E;  1VQM P;  3QH9 A;  4K35 A;  1VF5 C;  2L5G B;  5APV A;  1NGM B;  2K9Y A;  1EDJ A;  1RE4 A;  3CXH I;  1BSN A;  3U1A A;  3RK3 E;  1AV1 A;  1OVR A;  2FFD B;  1EXI A;  3IN6 A;  2IZ1 A;  2KYV A;  1KD1 Q;  2W8Z A;  3H1J E;  2WSC H;  1DEE G;  3H1I E;  1NJI Q;  4WBA A;  1CW5 A;  4PV1 C;  2G3A A;  1IK9 A;  2HOD B;  1JY2 N;  2KZI A;  3IFM A;  4KT0 J;  4EIJ A;  1ZV8 A;  5KLV K;  2DW3 A;  1Q86 Q;  3RK3 C;  1AVO A;  2BCC G;  1DEB A;  4OH8 B;  4C7R A;  1LTS C;  5KLV D;  2R32 A;  1AJY A;  1BE3 J;  1BCC J;  3CXH E;  1L0L K;  2QJK B;  2I1K A;  3BCC J;  3IR9 A;  2FY8 A;  4NPE A;  2B87 B;  5EFW B;  2Y0D A;  2Y9Y A;  2AEJ A;  5CJ0 A;  3BRV B;  1LP1 A;  2WQY C;  1L4A D;  2C0W A;  3M91 A;  5KLI C;  4O9B A;  1T3J A;  2FBW C;  3VN0 A;  3FXD A;  2Q5U A;  3WU2 H;  1KQF B;  1PGJ A;  1SQX K;  1USE A;  1L0N D;  3M06 A;  1HTL C;  2K9J A;  2XU6 A;  3CXH D;  1GK4 A;  2Z4E A;  2HYN A;  1DIP A;  4U3F D;  1FC2 C;  2IPP A;  2IYP A;  4DOJ A;  3L71 J;  4GDO A;  5APS A;  1SQQ K;  3GHG B;  3C8V A;  4PD4 D;  1ZR4 A;  4H13 C;  1VF5 D;  1IK7 A;  2A06 E;  2E5T A;  3L75 E;  4ZNC A;  4XFJ A;  1HH0 A;  4OGQ B;  1R8E A;  1M90 Q;  2OTK E;  1NU1 J;  3AE8 C;  3H1J D;  4H13 B;  1NTK E;  3TGU D;  1IO4 A;  2P58 A;  3M9B A;  3VMY A;  2OYO A;  1EZV G;  1EZV D;  1NTK G;  1NTM K;  3MUD C;  1Y47 A;  3NMD A;  5APY A;  2YNY A;  2ZVN B;  1A02 J;  1GD2 E;  2XDJ A;  3VP8 A;  1R5S A;  2W6A A;  1AA0 A;  1E5W A;  1SP4 A;  1NOH A;  1OIP A;  2P67 A;  4L76 A;  3H32 A;  3RK3 D;  1KIL B;  2N1T A;  1LP1 B;  1S9K D;  1KQL A;  4WY4 C;  2LXB A;  4AUW A;  3N7N A;  1FZE A;  2B87 A;  1KIL C;  4HJG H;  1MUU A;  2YKQ A;  3SWK A;  1L4A C;  1NO4 A;  1R5L A;  1PL5 A;  1SQX D;  2A45 I;  2E75 D;  3B5N B;  1SQQ J;  3AEA C;  3O6Q B;  3M0A A;  4XE5 B;  5AW4 B;  1ZR2 A;  2QVA A;  3KZI H;  2GUV A;  2C9N Y;  1T3U A;  3F5H A;  3QWO C;  2MJZ A;  3L70 G;  1SQX J;  1AVY A;  3AE5 C;  1UIX A;  1EDK A;  4PV1 B;  2WWW A;  3CPW O;  1N73 C;  4JYC A;  5KJ7 C;  1RF0 C;  2OYH B;  3VMZ A;  1WT6 A;  3L75 J;  2FYU K;  1OZH A;  4NPF X;  1SQB G;  2M0B A;  1PP9 J;  1HJ0 A;  3L35 A;  5AVT B;  3V5B A;  1URQ A;  2QJK C;  1U57 A;  2KNC B;  3HE4 B;  4D6T E;  1M1J C;  1AQ5 A;  1ZXG A;  2KSJ A;  2CPB A;  3H1J J;  3OAK A;  1ZME C;  3H1I J;  3CCQ P;  3LW5 H;  3CC4 P;  1DD4 A;  1X9V A;  2KLU A;  2FXP A;  2RN0 A;  3FWL A;  2WZ7 A;  3L75 D;  5AW6 B;  4GIF A;  4GOF A;  4N78 D;  1QGK B;  3P32 A;  4TT3 H;  1PPJ E;  3CMA P;  1LTG C;  2WSC J;  4OVN F;  4WY4 D;  2M8R A;  1BDD A;  4W7Z A;  2YMY A;  1VQN P;  1BCC E;  1LTJ C;  3L74 E;  5KJ7 D;  3W67 A;  1H0T B;  3HD7 D;  5KAF H;  1M57 D;  1JM0 A;  2BEZ F;  5CHX A;  3AE6 C;  3RBZ A;  2ZXX A;  1SQQ E;  3VTP C;  2UWJ E;  1LTT C;  3M9H A;  2QM8 A;  2J58 A;  2KUB A;  2N1T B;  3E1R A;  3L73 D;  3M0D C;  1BGY E;  4IL6 E;  4R4M A;  4YTP C;  1JUN A;  2QJP C;  3MTU E;  1VQK P;  2W6J H;  2NPS B;  1PPJ D;  1W2B O;  3KHU A;  1S9K E;  2OTL P;  2YO3 A;  1WMK A;  1QLE D;  3OJA B;  4ZKU A;  1BCC D;  3CL3 D;  2E75 C;  3HTK A;  3NXS A;  4HKZ H;  5KAI E;  4YPC A;  3S4R A;  3V2P A;  3VMA A;  4EI2 A;  5TIS H;  3HUS B;  2WSS H;  3AE7 C;  1KMI Z;  1VDF A;  2KSE A;  3L71 E;  3M0D A;  5APX A;  1NTM G;  3G71 P;  2QEX P;  3CCV P;  1YTZ I;  1LT9 B;  2JJL A;  4D6T J;  3GHG A;  2OYH C;  1VQ5 P;  1L0L G;  3E1I A;  3CLQ A;  1NU1 D;  1NAY A;  1AQT A;  3PJS K;  1NTK J;  2QG4 A;  3H1K E;  2ZYD A;  3H1L G;  4KJM A;  3CCJ P;  1GDT A;  3K5B A;  1SQP D;  1USD A;  3D70 A;  1HGZ A;  3Q3D A;  1M8O B;  3L70 D;  3NTN A;  1D7M A;  1FZG A;  1BDC A;  1MFT A;  4U3F J;  1ZLL A;  1T6A A;  4JYB A;  4L75 A;  3RGU A;  2Q7C A;  1L0N J;  1W5C E;  2AEM A;  2C0X A;  3IAO A;  4TLF A;  1N73 B;  3D6Z A;  5CCG D;  1S5L E;  1SQX G;  2QJP B;  1M56 D;  1X22 A;  1LTB C;  4ZMD A;  4C46 A;  1T8Z A;  1BGY J;  1FOS F;  1LTI C;  1VQ7 P;  2IBZ E;  1QX8 A;  3ITK A;  4UB6 H;  2E74 C;  5APQ A;  3P8C D;  3KYQ A;  5CCG A;  1NU1 G;  2V7Q J;  3HUS C;  1OWA A;  1S2E A;  3GF7 A;  4RJT A;  3B4S A;  5CCH A;  5KJ7 A;  1CI6 A;  2MKV A;  1H89 A;  1QVF O;  1RQU A;  4JPZ B;  3MHV A;  2OYI A;  4IFD K;  1QL1 A;  3FXE A;  5KLV J;  1P84 D;  1PGP A;  1IFD A;  2BCC E;  1FZC B;  2FXO A;  1SQP K;  2IX7 C;  1QEX A;  2OTJ P;  5E79 H;  4W7Y A;  1JY3 P;  1HUC A;  2LKM A;  2YMK A;  1KFM A;  3Q2Y A;  5BU8 B;  1A02 F;  1H0T A;  2WSF H;  1JY3 N;  2HG5 D;  5BU5 A;  2IFN A;  3CI9 A;  5KAI H;  2CPS A;  4EOT A;  1KIL A;  3CX5 H;  4H44 C;  3CCE P;  1FDM A;  4HH2 A;  2AEF A;  4U7J A;  3H1K G;  3RL0 C;  2KOG A;  1T2K C;  2D2C B;  4WY4 A;  3RL0 g;  3IF4 A;  1VL2 A;  2N1T C;  3OA7 A;  5AW1 B;  3V2N A;  4AQR D;  5GTI E;  2QJY B;  2XNX A;  3HE4 A;  3GF3 A;  1MKM A;  3OW2 O;  2ZAE B;  3VYI A;  1VQ4 P;  3WUU A;  3MUD A;  4L74 A;  2I8D A;  1G1I A;  1JY2 O;  2JDI H;  2W90 A;  2ZFC A;  2WPV B;  3L74 J;  1W2E A;  2KP8 A;  2PAJ A;  2OGU A;  3H6P A;  2RMZ A;  1SQP J;  3L72 E;  1HWT C;  2E76 C;  3L36 A;  3H25 A;  2OYI B;  1S4X A;  4K3A A;  4DT0 A;  1J1E C;  2A06 G;  2Q3I A;  5DJT B;  1P84 H;  3PHL A;  2BCC D;  3H1H E;  1NTZ E;  2JWD A;  2XKM A;  4UB8 E;  4C7N A;  2E43 A;  1L0L J;  4Z1M H;  1RQV A;  3H1I D;  1SQB D;  2G8Y A;  4RO0 A;  3A0B H;  4DCK A;  1VQ6 P;  1KV4 A;  4I1L A;  1NKZ B;  2W83 C;  1Q82 Q;  1EQ7 A;  5AVW B;  1JMM A;  1RY3 A;  2PGD A;  3E7K A;  3P8C E;  4DJG A;  2KI7 B;  3L72 D;  2Q3E A;  1PP9 D;  4GT1 A;  3A0H E;  1IZN B;  3H32 B;  1AFO A;  1OVU A;  3T97 B;  2I1J A;  2ITA A;  1KQG B;  1M7L A;  1U7J A;  3LIE A;  1IFI A;  3V4Q A;  1J1D C;  3H1K J;  2WTY A;  2E76 D;  3AEE C;  1BGY G;  3KZI E;  1JY3 O;  4IL6 H;  3HRN A;  4WB4 A;  2AXT H;  4GOE A;  2Y0E A;  3V2R A;  1KB9 H;  2ZXE B;  2HLO A;  4U3F E;  1KIL D;  3L73 G;  1FZB A;  3P7K A;  1IFP A;  3PH0 A;  5DJU B;  1L0N E;  2OYI C;  2R5B A;  1U7M A;  2N1T D;  3AE3 C;  3M9Q A;  3SSU A;  4CPG A;  2FYU J;  2L91 A;  1S3J A;  1SQP E;  1YBK A;  3HUS A;  5AVX B;  2KB7 P;  3S1K A;  3W68 A;  5CCG C;  5CCH C;  1KYO I;  1KN7 A;  2KZJ A;  4OGQ C;  2PP6 A;  2M3E A;  1N7S B;  2PFX A;  2R44 A;  1IFN A;  3FX0 A;  2IYO A;  1RE3 C; 
#chains in the Genus database with same CATH homology
 1GZL A;  2GUS A;  2WIT A;  1GW4 A;  1RF1 B;  1LGH B;  3MIW A;  4KHX A;  5APT A;  3KPE A;  3R2P A;  1RF1 C;  1H8A A;  4LC1 A;  1IFM A;  2R3C A;  1G1J A;  2XZR A;  1YYC A;  3RK2 B;  3I5C A;  2R5D A;  2Z5H A;  1L4A B;  3GHG C;  1N86 A;  4AYC A;  1G2C B;  4RES B;  1LT9 A;  1PFI A;  1NU1 K;  3HD7 C;  4N78 E;  4W80 A;  1HBW A;  2OYH A;  2YKP A;  1NTZ K;  5AW5 B;  1G2C A;  2QM7 A;  1SVF A;  2O1K A;  1JY2 P;  3TSI A;  3A2A A;  1LWU C;  3KDP B;  1LTJ A;  1MFZ A;  4HYT B;  3TYY A;  4JF7 A;  2XV5 A;  2WPQ A;  1SLQ A;  4LGD E;  3RL0 D;  4ZKP A;  3RL0 B;  1FJP A;  3A7O A;  1NKN A;  1FJK A;  1M1J A;  1J2J B;  3L37 A;  2WSE H;  1NH4 A;  2Z5I A;  1URQ C;  5AVV B;  1JCC A;  2HFE D;  1KFN A;  1N2D C;  2FXM A;  1RF0 A;  2P7J A;  4N6J A;  1N73 A;  1IJD B;  4GKG A;  3A3Y B;  3V2Q A;  1GU5 A;  1LWU B;  1GL2 A;  1NAF A;  2GM4 A;  1L4A A;  3EFG A;  1IC2 A;  3A5T A;  2BAS A;  2W6B A;  3HE5 A;  2IFM A;  3TK1 A;  5AVQ B;  3RK2 D;  1JO5 A;  2A45 H;  5AVS B;  1HVV A;  1NHL A;  2NPS A;  5AW0 B;  3O8Z A;  2E42 A;  1DH3 A;  1T2K D;  5APU A;  3BRT B;  5CMZ A;  1KZU B;  3V4W A;  4LLH A;  1J1E B;  1FZA A;  5AW2 B;  1FAV A;  3BAT A;  2HPC A;  1N7S D;  1HJB A;  2WPS A;  2H43 A;  3EQ2 A;  3II6 A;  1FZC C;  3UIA A;  1FZF A;  1SFC A;  2FKW B;  2VRS A;  2FFD C;  2WT7 A;  5CJ4 A;  3KQG A;  2WT7 B;  1GTW A;  1URQ B;  3G3Z A;  1SFC D;  2FFD A;  5KTB A;  2N9B A;  5APW A;  3RK2 C;  5AW9 B;  2HPC B;  1J1D B;  2W27 A;  1SFC C;  1FZC A;  2P1J A;  4C7N B;  5AVZ B;  4IFF A;  4Y99 C;  1CI6 B;  1XTG B;  5AVU B;  4B86 A;  1RE4 C;  1XTC C;  1IO4 A;  1GL2 D;  2NPS C;  1SQB K;  3LID A;  3VOP A;  1N7S C;  4Y99 B;  3TNU B;  2FFD B;  5CCH D;  3SWY A;  3HE5 B;  2JEE A;  2Q9I A;  1Z56 A;  3U59 A;  1SQV K;  5AVR B;  1WRG A;  1YTZ T;  1SFC B;  1CZQ A;  4I6M C;  3B5N C;  5AW7 B;  3BVH A;  1GL2 C;  1L0N K;  5AW8 B;  2NPS D;  3PP5 A;  3WMM 0;  3VMX A;  2H7H A;  2POH A;  2O1J A;  3HD7 B;  1QL2 A;  1M1J B;  3P8M C;  4N3Y B;  2M3B A;  5AVY B;  1X8Y A;  2KLV A;  3MD0 A;  2YO2 A;  1GU4 A;  5BVZ A;  1X79 B;  2HOD A;  1NWQ A;  1GL2 B;  1LWU A;  1CSB A;  3L4F A;  3T97 A;  2A45 G;  3NFQ A;  1JCD A;  3VP9 A;  1N7L A;  2H8P D;  3TNU A;  3SWF A;  2OYH C;  3C9I A;  4XA4 A;  1MZ9 A;  1JOC A;  1HGV A;  2J59 M;  3HTK B;  1LTA C;  4DZO A;  2FYZ A;  3HD7 A;  1T2K C;  4M3L A;  3B5N D;  1GW3 A;  1JTH B;  1FU1 A;  1LT9 C;  1MV8 A;  1URQ D;  2P2U A;  3BAS A;  3MGN A;  1NTK K;  3B5N A;  3B8E B;  1DX7 A;  2O01 H;  2WPR A;  4I2L C;  2OAR A;  3N4X A;  5AW3 B;  3RK3 B;  1FOS E;  2C9L Y;  2YKO A;  1OXZ A;  1LTJ B;  1IFJ A;  1FBM A;  1RF1 A;  1GK6 A;  1VPC A;  1JTH A;  4IFM A;  4WY4 B;  1ZN5 A;  1N7S A;  1RE3 A;  3U1C A;  5APV A;  2L5G B;  1RE4 A;  3U1A A;  2KYV A;  2WSC H;  4WBA A;  1CW5 A;  1IK9 A;  2HOD B;  1JY2 N;  3IFM A;  4EIJ A;  1ZV8 A;  5KLV K;  3RK3 C;  4C7R A;  1DEB A;  4OH8 B;  1LTS C;  2R32 A;  1L0L K;  2I1K A;  3IR9 A;  5CJ0 A;  3BRV B;  3M91 A;  1L4A D;  2C0W A;  4O9B A;  1T3J A;  3VN0 A;  2Q5U A;  1SQX K;  2Z4E A;  3M06 A;  1HTL C;  2XU6 A;  1GK4 A;  2HYN A;  2IPP A;  4DOJ A;  1ZR4 A;  5APS A;  1SQQ K;  3GHG B;  1HH0 A;  3M9B A;  3VMY A;  1H88 A;  1NTM K;  5APY A;  3NMD A;  2YNY A;  1A02 J;  1GD2 E;  2XDJ A;  3VP8 A;  2W6A A;  1E5W A;  1SP4 A;  1NOH A;  2P67 A;  3RK3 D;  3H32 A;  1KIL B;  2N1T A;  1S9K D;  1KQL A;  4WY4 C;  4AUW A;  3N7N A;  1FZE A;  1KIL C;  1MUU A;  2YKQ A;  1L4A C;  1NO4 A;  2A45 I;  5AW4 B;  3B5N B;  4XE5 B;  1ZR2 A;  3M0A A;  2GUV A;  2C9N Y;  1T3U A;  2MJZ A;  1N73 C;  2WWW A;  4JYC A;  5KJ7 C;  1RF0 C;  2OYH B;  3VMZ A;  1WT6 A;  2FYU K;  5AVT B;  3L35 A;  3V5B A;  1URQ A;  3HE4 B;  1M1J C;  1AQ5 A;  2KSJ A;  2CPB A;  3OAK A;  3LW5 H;  1X9V A;  2WZ7 A;  5AW6 B;  4GIF A;  4N78 D;  3P32 A;  1LTG C;  4WY4 D;  2M8R A;  4W7Z A;  2YMY A;  1LTJ C;  5KJ7 D;  3HD7 D;  5CHX A;  3VTP C;  1LTT C;  3M9H A;  2QM8 A;  2J58 A;  2N1T B;  1JUN A;  3M0D C;  3MTU E;  2NPS B;  1S9K E;  2YO3 A;  3OJA B;  4ZKU A;  3CL3 D;  3HTK A;  3NXS A;  3V2P A;  3HUS B;  1VDF A;  5APX A;  3M0D A;  1YTZ I;  1LT9 B;  2JJL A;  3GHG A;  3E1I A;  3CLQ A;  1GDT A;  1HGZ A;  1FZG A;  3NTN A;  1ZLL A;  4JYB A;  2Q7C A;  2C0X A;  1N73 B;  5CCG D;  1LTB C;  4C46 A;  1T8Z A;  1FOS F;  1LTI C;  5APQ A;  3P8C D;  3KYQ A;  5CCG A;  3HUS C;  1OWA A;  5CCH A;  5KJ7 A;  1H89 A;  1CI6 A;  2OYI A;  4IFD K;  1QL1 A;  1IFD A;  1FZC B;  1SQP K;  2IX7 C;  4W7Y A;  1JY3 P;  1HUC A;  2LKM A;  1KFM A;  5BU8 B;  1A02 F;  2WSF H;  1JY3 N;  2HG5 D;  5BU5 A;  2IFN A;  3CI9 A;  1FDM A;  2CPS A;  4EOT A;  1KIL A;  4HH2 A;  3RL0 C;  2KOG A;  4WY4 A;  3OA7 A;  2N1T C;  5AW1 B;  3V2N A;  4AQR D;  2XNX A;  3HE4 A;  3VYI A;  3MUD A;  1G1I A;  1JY2 O;  2ZFC A;  1W2E A;  2KP8 A;  2PAJ A;  3H6P A;  1HWT C;  3L36 A;  2OYI B;  1J1E C;  2Q3I A;  2E43 A;  2XKM A;  4C7N A;  4I1L A;  1NKZ B;  1EQ7 A;  5AVW B;  1JMM A;  1RY3 A;  3P8C E;  4GT1 A;  3H32 B;  1AFO A;  2I1J A;  1M7L A;  3LIE A;  1IFI A;  3V4Q A;  1J1D C;  2WTY A;  1JY3 O;  3HRN A;  4WB4 A;  3V2R A;  2ZXE B;  2HLO A;  1KIL D;  3P7K A;  1FZB A;  2OYI C;  2R5B A;  2N1T D;  3M9Q A;  5AVX B;  5CCH C;  3HUS A;  2KB7 P;  5CCG C;  2PP6 A;  1N7S B;  1JNM A;  1IFN A;  1RE3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...