3H1KG

Chicken cytochrome bc1 complex with zn++ and an iodinated derivative of kresoxim-methyl bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Crystallographic location of two Zn(2+)-binding sites in the avian cytochrome bc(1) complex
pubmed rcsb
molecule tags Oxidoreductase
total genus 19
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3h1kG00
3L72G 1SQBG 1NTKG 1SQXG 2A06G 3H1HG 2FYUG 1L0NG 5KLVG 1NTZG 3L75G 1PP9G 1NTMG 2BCCG 1P84H 3H1JG 1SQQG 2IBZG 3L74G 1NU1G 1PPJG 3CX5H 3CWBG 3H1LG 3L71G 3CXHH 1SQVG 4PD4H 1KYOH 1BE3G 3L73G 3TGUG 1KB9H 3BCCG 1EZVG 1SQPG 4D6TG 1L0LG 3H1KG 3L70G 1BCCG 4U3FG 1BGYG 3H1IG
chains in the Genus database with same CATH superfamily
1L0NJ 2P67A 3F89A 3ZDMA 1AFOA 3L74G 2M3EA 3HUSA 2GM4A 3IF4A 1NHLA 3O6QA 2B89A 2QJPC 3H1IG 5CCGA 4LC1A 1LJ2A 1GU5A 1PGQA 1KFNA 3CL3D 2Y0DA 3GLMA 1QLED 2Q5UA 2E76D 1A02F 2QA4P 1LT1A 3RK2C 1IFJA 1H89A 4IL6H 1VF5D 1NTKG 5TISH 1KILD 2BCCJ 3RBXA 4OGQD 1YITP 4HYTB 3NFQA 2LXCB 1HF9A 1ZRTD 3EWKA 1KILE 1NTKE 5AW5B 2GUVA 1ZXGA 2YO3A 2KS1A 1GU4A 3SWYA 2QJYB 3RL0D 4ZKUA 5KLVJ 3PTZA 4GOEA 3KZIE 5AW4B 1ZRTE 2WSEH 1H0TB 4OWFA 1CSBA 3SWKA 1KV4A 3H6PA 1NTMD 3BCCE 2Z4EA 1PPJG 3G9RA 3K5BA 3HD7D 1SQBE 3P7KA 1JTHB 1QVGO 1NTME 3KYQA 4N6JA 3H1HJ 1BSNA 3CCVP 4WY4A 1PPJE 2K3RA 5GTHH 1JY2O 1SFCB 4RO0A 1PFIA 4PJ0H 2H8PD 5APTA 1L2PA 4HKZH 1BDDA 5AVUB 2H43A 3OAKA 1PP9E 1N73C 3CX5I 2Y0CA 4AUWA 2AXTE 3G71P 1W2EA 3LIDA 3AEBC 1FS0E 4GOFA 3RGUA 3WUUA 1X79B 1KB9D 2E74C 3VN0A 2YNYA 1LTSC 1PGPA 3H1IJ 1YTZI 2K9JA 3A0HH 2W6JH 1KB9E 1IK7A 2RH0A 2OYHA 1KQLA 3CPWO 1XTCC 4PV1D 1N7SB 3P8MC 1OW6A 1R8EA 3CX5H 1QGKB 3L71D 2RMZA 3O6QB 2KNCA 3CMAP 1EDIA 3MUDA 2ZVOB 2XU6A 5TJHA 1NTKJ 5EFWB 3AEFC 1RE3A 1JCDA 3MZWB 3AE6C 3G6EP 1Y8AA 2PFXA 1HGZA 1AQ5A 3BCCJ 4IL6E 2NPSD 5E79H 3TGUD 5TISE 1X9VA 4HH2A 1SQBJ 1Y9BA 3F5HA 3PP5A 3V2NA 4Y99B 1S9KE 1VQ8P 2RN0A 4KJMA 1FOSF 4IL6X 3V6IA 4JYBA 5M1BA 4YXWH 1K8AQ 2K9YA 4IOIH 1PP9J 3GHGA 2WPRA 3B5NA 2YMKA 1SP4A 2OYIA 1KYOD 2ZFCA 2G8YA 4H13B 1LWUA 3IR9A 1Y47A 1RHZB 3A0BH 3V2RA 3NTNA 3LW5H 1NWQA 3E1IA 3U1AA 1K05A 4H0LD 1IFPA 2E75B 4AYCA 1KILA 1MUUA 2M3BA 2MKVA 2WT7A 2B87A 1S1CX 3A7OA 3MD0A 3AEDC 2WITA 2O1JA 2WMMA 2YIUB 4JBZA 3R4YA 1GW4A 3OA7A 2A06G 3CD6P 2I1KA 3W68A 2YKOA 1RF0A 3IN6A 3A0HE 2NZ2A 2YO2A 2FYZA 4HJGH 2XV5A 1EC5A 1BE3D 3GF3A 3R2PA 1H88A 3BRVB 3H1KD 3VMYA 3CX5E 3Q5SA 1RQVA 2IDBA 3M0DA 3CCEP 1GL2B 3CCJP 3VMAA 5CHXA 1ZW0A 2FYUK 3H1KE 3KPEA 2B9BA 1YQ3C 3LIEA 2V7QH 4CPGA 1W5CE 2KI7B 1U7JA 3SWFA 2WSEJ 3RK2B 1VQPP 2R5BA 2W27A 3AE7C 1AJYA 2FYUG 2WSCH 3M9BA 3D6ZA 1VQKP 2N1TD 2QRXA 1MFTA 4W80A 1J1DC 1Q90D 2FYUE 4B86A 4IFMA 1SS1A 1NOHA 4L76A 1S5LH 2IBZI 5APXA 3SFEC 2NRGA 3VP9A 1SQPE 3H1LD 3A2AA 3TSIA 1NJIQ 2IPPA 3FWLA 4C7NB 2HFED 2YKQA 3KHUA 3U1CA 1SQXD 3B5NB 3H1LE 5BVZA 2O01H 2M5AA 1LP1B 2KK7A 3H32A 4I6MC 1EDJA 1N73B 3MHVA 2SPZA 3M9HA 2YXQB 5CBOA 2NPSA 4K3AA 2QM7A 5AVXB 1E79H 4TLFA 3L75G 2P10A 3Q1MA 3L35A 3CWBD 3P8CE 1HJ0A 3H1KJ 4WVZA 2W6AA 3M0AA 5CCGC 3VTPC 2ZXEB 1SQVE 3RK3D 1JM0A 3H1JG 3E7KA 2Q9IA 4U3FE 1MZ9A 1XTGB 2IX7C 1G2CA 3V2QA 3TYYA 2KSJA 1L0LD 3S4RA 5KAIE 2FYUJ 1LTJB 2OTLP 4LLHA 2KLUA 1NTZK 5CMZA 1SQPJ 4UB6H 2N9BA 2AEJA 2W83C 2K1AA 5AVSB 1NO4A 1NTZG 2AEMA 2BEQD 1RF1A 1YJNP 1S5LE 4H13C 2ZYDA 1CZQA 1EZVD 1HTLC 3LW5J 1NTZE 1FZBA 2LKMA 3MGNA 2JJLA 1GTWA 2QM8A 5AVTB 1KB9I 1NU1D 2I8DA 2IBZG 5KLIB 1BCCE 1S5LX 4H44C 2Q6QA 3C9IA 3L73D 3L70D 3SSUA 4BRYB 1EQ7A 1YI2P 2YIUC 3L75J 5K5GB 1JNMA 2VRSA 4HB1A 2M5AB 1M57D 1SQVJ 3H32B 1X0TA 5APQA 1URQD 1LGHB 4U3FJ 1KB9H 1YHQP 2N1TA 2ZVNB 2Z5HA 3L72D 3CCMP 2Z5IA 1S4XA 3BVHA 3H1JJ 2OYHC 1JY3N 2ZT9B 1GL2C 2V7QJ 3L74D 1NTKK 2XNXA 1GK6A 4WBAA 3L72E 1S2EA 5AW1B 2H7HA 3MUDC 4D6TD 2ZJSE 2WSCJ 1M7LA 2GA1A 1KMIZ 1RE3C 4AQRD 1KQSO 3ITKA 1LTAC 2HPCB 4DOJA 1SQBK 4D6TE 2C0WA 1T6AA 2C0XA 5CJ4A 1NTMK 1N7LA 5APVA 3BCCG 5AW8B 1SQBG 1NTZJ 4UB6E 2E74D 1KYOI 1QVFO 1UIXA 1NTMG 4L75A 3JSVC 1J1DB 3FX0A 1SVFA 1BCCJ 1A02J 2C9NY 2H88C 2O01J 1EDKA 1P84D 3GHGC 1OZHA 3B5NC 3G3ZA 1PP9G 1RF1B 1ZR2A 2K37A 4ZMDA 1GMJA 2P7JA 2E42A 1LWUC 2WPVB 1KYOH 1KN7A 2JEEA 4GODA 5GTIH 5APUA 1OXZA 1JB0J 1JY2P 3HE5B 2LR2A 3BASA 5AVWB 2YKPA 2AEFA 3EFGA 3L36A 3HE4B 2Y9YA 2QVAA 1VF5C 2KIKA 2QJKC 1KILC 1VPCA 2FXPA 1FZGA 2BASA 4UB8E 2FXMA 3AE4C 1FOSE 1GD2E 2FFDA 1M56D 1RF0C 1YJWP 4YPCA 2OTJP 3HUSB 2YXRB 4D6TJ 1AA0A 3KXDA 1RE4A 1FBMA 1X22A 4C46A 1DIPA 2W6BA 2PP6A 1LTJC 2MJZA 3L71E 2WSSH 3C8VA 3PJSK 2CPBA 2R3CA 2E5YA 1NAYA 1VQOP 4RKUJ 2L91A 1Q82Q 1BGYD 3A3YB 1NYHA 3AE5C 1JMBA 2LXBA 1NTMJ 4R4MA 3AEGC 4EIJA 3TGUE 1L4AA 1BGYE 3WUVA 1M1JA 1R5SA 1T3JA 4N78D 1FU1A 1WT6A 3P32A 2KS1B 2A45I 3BATA 1IFDA 1HUCA 4EYYQ 1URQA 4GDOA 4JYCA 1FZCA 2H89C 1JMMA 3M91A 2WSFH 1RY3A 1MV8A 4N78E 1GK4A 5AW3B 5KLIC 3SFDC 3IAOA 3FXEA 4WY4B 1FJPA 3AE9C 1KYOE 2A45H 3M9QA 1HBWA 1FZFA 3B4SA 3Q5RA 1EDLA 3OJAB 5GTIE 2Q3IA 4H44B 1FC2C 5DJTB 2OGUA 2I1JA 3NXSA 2PGDA 2HODA 1OX3A 4OVNF 5KJ7D 2NPSC 3MIWA 1JO5A 5CCHC 4KT0J 1USEA 2ZT9C 3CI9A 1SQQD 3L71J 4MN4C 5AVZB 2K9JB 3H1KG 1JEKA 1SFCD 1DD3A 2A06D 3HD7A 2OYHB 4DCKA 5APSA 3N7NA 1BE3E 5H2FE 1G1IA 3NMDA 3WMM0 1VQ7P 3TGUJ 1DEEG 5KAIH 2KNCB 1HGVA 1YQ4C 2IFNA 1JY3O 3TF5A 4ASWA 1VQ9P 1SQPK 4JQ0D 2YMYA 2J59M 2D2CB 1MKMA 3TNUA 1EZVI 3CXHD 3BRTB 1K04A 4IFFA 1Q7YQ 1JY3P 3CMEP 3T97A 1SQPG 1GW3A 3EQ2A 2R44A 1N7SD 3CXHE 2WQYC 1L4AB 4LGDE 5AVRB 1K73Q 1SQXK 1OFCX 1RF1C 4QMAA 1QL1A 3H1LG 2QE7H 3PHLA 1QL2A 3UIAA 1FDIA 1LTBC 2W8ZA 1SQXG 2JWDA 2A45G 3GHGB 2XZRA 3HTKA 4R4LA 2HG5D 2OYIB 2PAJA 1N86A 1GZLA 1LWUB 4XFJA 1SQXE 1W2BO 1SQVK 1YYCA 1UIIA 3PLNA 5KAFE 1ZV8A 2E76B 2OQQA 1ZLLA 3MTUE 1BE3J 1VF5B 2QJKB 1KILB 3HUSC 1VQ6P 1PV3A 1NKNA 1G1JA 1SQVG 2J5UA 4OGQB 3GW6A 2WT7B 2B87B 2N1TC 3W67A 4U3FG 2O01N 3VOPA 1L0LK 3RL0g 3D6YA 1HJBA 2UWJE 3CWBE 1L0ND 5BU5A 1AV1A 3RL0B 3TDKA 2L5GB 4U7JA 3GG2A 1T2KC 1L0LG 3RK3E 2B88A 1VQMP 1DEBA 3PH0A 3HD7B 2E75D 3E1RA 2KB7P 1L0LE 1J1EB 5CBNA 1K9MQ 1FDMA 4I2LC 4ZNCA 2FYNC 1P84I 1IC2A 2WSFJ 5AVQB 1H0TA 2BCCD 1LTIC 5KJ7A 3TNUB 2OARA 3H1LJ 1OW8A 3T97B 4JPZB 1JTHA 4A7PA 1KD1Q 1GL2D 1BCCG 5B66E 2BCCE 1IFNA 1SQXJ 1BDCA 5AW9B 1EXJA 4WY4C 5KLVD 1SFCA 1PL5A 5AW2B 2KP8A 1EZVE 1JUNA 4GKGA 3VYIA 3VMZA 3VMXA 3AE2C 3RK2D 3RK3C 1AVOA 4PV1B 5KLVE 1NU1E 4DZOA 3M06A 3H1HD 4I7ZB 3L73E 4EOTA 3CWBJ 3L70E 4UB8H 3JCUH 5AVYB 3CC7P 1IZNB 2NPSB 2WWWA 3L72G 2JO1A 2FFDC 3JC22 1KC8Q 1PIXA 1IJDB 1N7SA 4PD4D 1KORA 4BWNA 1L0LJ 1LT9A 1RE4C 4W7YA 3B5ND 4D6TG 3H1ID 3L74E 4PD4E 1GDTA 2POHA 3KQGA 3I5CA 1PGJA 2D2CC 3H1IE 3L4FA 1G2CB 1RH5B 1JOCA 4GT1A 2QIWA 2IFMA 2BEZF 2IYOA 2XKMA 1NH4A 3WU2H 4W7ZA 1VQNP 1NTKD 2WTYA 4I1LA 1L4AC 3D71A 4WB4A 1OIPA 1M1JC 2JKVA 2M0BA 3BCCD 4H0LB 2W90A 2V4HA 1DX7A 1SQBD 1URQC 1FZCC 1NU1J 3N4XA 4WWIA 3V4WA 2OYIC 1PPJD 3L73J 3HRNA 1H8AA 3L70J 3Q3DA 1P84E 3CCRP 3I56P 5APYA 3USSA 2R3SA 3C1LA 5L8RJ 2E76C 4XE5B 4ASVA 4BXLA 1LNQA 1PP9D 2CK3H 1KZUB 2FY8A 2KUBA 1KQGB 3CC2P 4OGQC 1NAFA 1AVYA 3AEAC 3L72J 2R32A 4L73A 1KQFB 2OYOA 3AEEC 3G4SP 1S3JA 3FWNA 3JCUE 3L74J 3Q2YA 1U7MA 2JDIH 3CLQA 1QX8A 3RL0C 4EDFA 3L71G 2KZJA 5H2FH 1T8ZA 2N1TB 4NPDA 1EXIA 1BSHA 4NPEA 3HD7C 1M90Q 3GMAA 3CXHI 1GL2A 3M0DC 1VQ5P 1Z56A 3CCUP 4YTPC 1LT9B 1J1EC 3TGUG 1KTMA 1IFIA 1ZOYC 1N2DC 1BGYG 3D70A 1TU3F 4Z1MH 2IYPA 4DT0A 1FZAA 3WU2E 1Q2NA 3CXHH 1S9KD 2WZ7A 2FYNB 5CCHD 2ZT9D 3Q5PA 1MFZA 4XA4A 2KYVA 2CPSA 3AE3C 3CCQP 2N9YB 4L74A 1M8OB 4PV1C 4C7NA 4YXDC 1VQLP 1IFMA 1M1KQ 3CC4P 1CI6A 4I7ZC 5KKZB 1VQ4P 4M3LA 1FJKA 5APWA 5KAFH 1LP1A 3RK3B 5GTHE 1SQQK 2QSIA 3H25A 2IZ1A 5CJ0A 1N73A 4PJ0E 3S9OA 1S72P 2JP3A 4TT3H 3A5TA 2XNDH 3TK1A 2XDJA 5AW0B 1SQQG 1NVOA 2Y9ZA 2Q3EA 1BE3G 3EFFK 2IZ0A 5KTBA 1OVRA 2PRRA 1SQQE 2FFDB 1J2JB 1HVVA 1YIJP 2KLVA 2M8RA 3IFMA 3CX5D 2OTKE 2ZYAA 3QH9A 2A06E 1E5WA 1BGYJ 2HLOA 2QJPB 2E5TA 1WRGA 2Q7CA 2GUSA 2KOGA 2RKLA 5BU8B 2ZYGA 1LTJA 3V2PA 4ZKPA 4O9BA 2WPQA 2FXOA 3V5BA 2O1KA 2KXPB 2J58A 2ZAEB 4H0LC 2C9LY 1NGMB 1RQUA 2WVRA 2QJYC 5E79E 4KHXA 2FYUD 4RJTA 2Q1KA 3ABVC 5DJUB 5KJ7C 5B66H 3KDPB 1M1JB 1JY2N 5CCGD 2QEXP 1SQPD 1YBKA 1ZP0C 2K88A 2FKWB 3CCLP 3AE1C 1IK9A 3AECC 1Q86Q 1URQB 1FE6A 1FZCB 1USDA 2WPSA 1SFCC 1T2KD 3U59A 3CCSP 2DW3A 1ZMEC 1AQTA 1DH3A 5AW6B 3II6A 4BRYA 1CI6B 1VL2A 1SQQJ 4PD4I 1IO4A 5B5EH 1L0NK 1PZQA 3A0BE 2R5DA 3CWBG 4N3YB 3AE8C 2HODB 3P8CD 1VDFA 3FGAD 2ZXXA 5AVVB 1YJ9P 3B71A 1L0NG 5CCHA 4H13D 3L75D 2KZIA 3PRJA 3RBZA 1SLQA 1N7SC 2E74B 5C39A 1DD4A 4IFDK 1SQVD 1FAVA 4PD4H 4WY4D 1LT9C 1T3UA 2P1JA 1Q81Q 4U3FD 1L0NE 3L75E 4Y28J 2ITAA 1R5LA 4JF7A 4H44D 2KSEA 4GIFA 1ZR4A 2HPCA 3H1JD 3O8ZA 3QWOC 2HR3A 1HH0A 1ZN5A 2JR8A 2E43A 2P58A 1KFMA 3MP7B 4C7RA 1OVVA 2QG4A 3H1JE 1NKZB 1X8YA 3VP8A 4OH8B 4Y99C 2BCCG 4K35A 1HWTC 3S1KA 1OW7A 2HYNA 5AW7B 5KLVK 1WMKA 3KZIH 2G3AA 1JCCA 1FDOA 1NU1K 2AXCA 4DJGA 3GF7A 1EZVG 3WUTA 1PGOA 4NPFX 1YTZT 2O3JA 5KLVG 1NTZD 1OWAA 1P84H 5KKZC 4RESB 1NU1G 3B8EB 3L37A 1OMIA 3L73G 3FXDA 3V4QA 3OW2O 1BCCD 3L70G 2JWAA 2D2CD 1CW5A 3H1HG 3I55P 3HE5A 3HTKB 1FZEA 1U57A 1LTTC 2IBZD 3HE4A 2P2UA 2E75C 1N8RQ 1QEXA 1OVUA 2Y0EA 2AXTH 3H1HE 1LTGC 1L4AD 2FBWC 1D7MA 5B5EE 4EI2A 2IBZE
chains in the Genus database with same CATH topology
3L72G 1SQBG 1NTKG 1SQXG 2A06G 3H1HG 2FYUG 1L0NG 5KLVG 1NTZG 3L75G 1PP9G 1NTMG 2BCCG 1P84H 3H1JG 1SQQG 2IBZG 3L74G 1NU1G 1PPJG 3CX5H 3CWBG 3H1LG 3L71G 3CXHH 1SQVG 4PD4H 1KYOH 1BE3G 3L73G 3TGUG 1KB9H 3BCCG 1EZVG 1SQPG 4D6TG 1L0LG 3H1KG 3L70G 1BCCG 4U3FG 1BGYG 3H1IG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L72 G;  1SQB G;  1NTK G;  1SQX G;  2A06 G;  3H1H G;  2FYU G;  1L0N G;  5KLV G;  1NTZ G;  3L75 G;  1PP9 G;  1NTM G;  2BCC G;  1P84 H;  3H1J G;  1SQQ G;  2IBZ G;  3L74 G;  1NU1 G;  1PPJ G;  3CX5 H;  3CWB G;  3H1L G;  3L71 G;  3CXH H;  1SQV G;  4PD4 H;  1KYO H;  1BE3 G;  3L73 G;  3TGU G;  1KB9 H;  3BCC G;  1EZV G;  1SQP G;  4D6T G;  1L0L G;  3H1K G;  3L70 G;  1BCC G;  4U3F G;  1BGY G;  3H1I G; 
#chains in the Genus database with same CATH topology
 1L0N J;  2P67 A;  3F89 A;  3ZDM A;  1AFO A;  3L74 G;  2M3E A;  3HUS A;  2GM4 A;  3IF4 A;  1NHL A;  3O6Q A;  2B89 A;  2QJP C;  3H1I G;  5CCG A;  4LC1 A;  1LJ2 A;  1GU5 A;  1PGQ A;  1KFN A;  3CL3 D;  2Y0D A;  3GLM A;  1QLE D;  2Q5U A;  2E76 D;  1A02 F;  2QA4 P;  1LT1 A;  3RK2 C;  1IFJ A;  1H89 A;  4IL6 H;  1VF5 D;  1NTK G;  5TIS H;  1KIL D;  2BCC J;  3RBX A;  4OGQ D;  1YIT P;  4HYT B;  3NFQ A;  2LXC B;  1HF9 A;  1ZRT D;  3EWK A;  1KIL E;  1NTK E;  5AW5 B;  2GUV A;  1ZXG A;  2YO3 A;  2KS1 A;  1GU4 A;  3SWY A;  2QJY B;  3RL0 D;  4ZKU A;  5KLV J;  3PTZ A;  4GOE A;  3KZI E;  5AW4 B;  1ZRT E;  2WSE H;  1H0T B;  4OWF A;  1CSB A;  3SWK A;  1KV4 A;  3H6P A;  1NTM D;  3BCC E;  2Z4E A;  1PPJ G;  3G9R A;  3K5B A;  3HD7 D;  1SQB E;  3P7K A;  1JTH B;  1QVG O;  1NTM E;  3KYQ A;  4N6J A;  3H1H J;  1BSN A;  3CCV P;  4WY4 A;  1PPJ E;  2K3R A;  5GTH H;  1JY2 O;  1SFC B;  4RO0 A;  1PFI A;  4PJ0 H;  2H8P D;  5APT A;  1L2P A;  4HKZ H;  1BDD A;  5AVU B;  2H43 A;  3OAK A;  1PP9 E;  1N73 C;  3CX5 I;  2Y0C A;  4AUW A;  2AXT E;  3G71 P;  1W2E A;  3LID A;  3AEB C;  1FS0 E;  4GOF A;  3RGU A;  3WUU A;  1X79 B;  1KB9 D;  2E74 C;  3VN0 A;  2YNY A;  1LTS C;  1PGP A;  3H1I J;  1YTZ I;  2K9J A;  3A0H H;  2W6J H;  1KB9 E;  1IK7 A;  2RH0 A;  2OYH A;  1KQL A;  3CPW O;  1XTC C;  4PV1 D;  1N7S B;  3P8M C;  1OW6 A;  1R8E A;  3CX5 H;  1QGK B;  3L71 D;  2RMZ A;  3O6Q B;  2KNC A;  3CMA P;  1EDI A;  3MUD A;  2ZVO B;  2XU6 A;  5TJH A;  1NTK J;  5EFW B;  3AEF C;  1RE3 A;  1JCD A;  3MZW B;  3AE6 C;  3G6E P;  1Y8A A;  2PFX A;  1HGZ A;  1AQ5 A;  3BCC J;  4IL6 E;  2NPS D;  5E79 H;  3TGU D;  5TIS E;  1X9V A;  4HH2 A;  1SQB J;  1Y9B A;  3F5H A;  3PP5 A;  3V2N A;  4Y99 B;  1S9K E;  1VQ8 P;  2RN0 A;  4KJM A;  1FOS F;  4IL6 X;  3V6I A;  4JYB A;  5M1B A;  4YXW H;  1K8A Q;  2K9Y A;  4IOI H;  1PP9 J;  3GHG A;  2WPR A;  3B5N A;  2YMK A;  1SP4 A;  2OYI A;  1KYO D;  2ZFC A;  2G8Y A;  4H13 B;  1LWU A;  3IR9 A;  1Y47 A;  1RHZ B;  3A0B H;  3V2R A;  3NTN A;  3LW5 H;  1NWQ A;  3E1I A;  3U1A A;  1K05 A;  4H0L D;  1IFP A;  2E75 B;  4AYC A;  1KIL A;  1MUU A;  2M3B A;  2MKV A;  2WT7 A;  2B87 A;  1S1C X;  3A7O A;  3MD0 A;  3AED C;  2WIT A;  2O1J A;  2WMM A;  2YIU B;  4JBZ A;  3R4Y A;  1GW4 A;  3OA7 A;  2A06 G;  3CD6 P;  2I1K A;  3W68 A;  2YKO A;  1RF0 A;  3IN6 A;  3A0H E;  2NZ2 A;  2YO2 A;  2FYZ A;  4HJG H;  2XV5 A;  1EC5 A;  1BE3 D;  3GF3 A;  3R2P A;  1H88 A;  3BRV B;  3H1K D;  3VMY A;  3CX5 E;  3Q5S A;  1RQV A;  2IDB A;  3M0D A;  3CCE P;  1GL2 B;  3CCJ P;  3VMA A;  5CHX A;  1ZW0 A;  2FYU K;  3H1K E;  3KPE A;  2B9B A;  1YQ3 C;  3LIE A;  2V7Q H;  4CPG A;  1W5C E;  2KI7 B;  1U7J A;  3SWF A;  2WSE J;  3RK2 B;  1VQP P;  2R5B A;  2W27 A;  3AE7 C;  1AJY A;  2FYU G;  2WSC H;  3M9B A;  3D6Z A;  1VQK P;  2N1T D;  2QRX A;  1MFT A;  4W80 A;  1J1D C;  1Q90 D;  2FYU E;  4B86 A;  4IFM A;  1SS1 A;  1NOH A;  4L76 A;  1S5L H;  2IBZ I;  5APX A;  3SFE C;  2NRG A;  3VP9 A;  1SQP E;  3H1L D;  3A2A A;  3TSI A;  1NJI Q;  2IPP A;  3FWL A;  4C7N B;  2HFE D;  2YKQ A;  3KHU A;  3U1C A;  1SQX D;  3B5N B;  3H1L E;  5BVZ A;  2O01 H;  2M5A A;  1LP1 B;  2KK7 A;  3H32 A;  4I6M C;  1EDJ A;  1N73 B;  3MHV A;  2SPZ A;  3M9H A;  2YXQ B;  5CBO A;  2NPS A;  4K3A A;  2QM7 A;  5AVX B;  1E79 H;  4TLF A;  3L75 G;  2P10 A;  3Q1M A;  3L35 A;  3CWB D;  3P8C E;  1HJ0 A;  3H1K J;  4WVZ A;  2W6A A;  3M0A A;  5CCG C;  3VTP C;  2ZXE B;  1SQV E;  3RK3 D;  1JM0 A;  3H1J G;  3E7K A;  2Q9I A;  4U3F E;  1MZ9 A;  1XTG B;  2IX7 C;  1G2C A;  3V2Q A;  3TYY A;  2KSJ A;  1L0L D;  3S4R A;  5KAI E;  2FYU J;  1LTJ B;  2OTL P;  4LLH A;  2KLU A;  1NTZ K;  5CMZ A;  1SQP J;  4UB6 H;  2N9B A;  2AEJ A;  2W83 C;  2K1A A;  5AVS B;  1NO4 A;  1NTZ G;  2AEM A;  2BEQ D;  1RF1 A;  1YJN P;  1S5L E;  4H13 C;  2ZYD A;  1CZQ A;  1EZV D;  1HTL C;  3LW5 J;  1NTZ E;  1FZB A;  2LKM A;  3MGN A;  2JJL A;  1GTW A;  2QM8 A;  5AVT B;  1KB9 I;  1NU1 D;  2I8D A;  2IBZ G;  5KLI B;  1BCC E;  1S5L X;  4H44 C;  2Q6Q A;  3C9I A;  3L73 D;  3L70 D;  3SSU A;  4BRY B;  1EQ7 A;  1YI2 P;  2YIU C;  3L75 J;  5K5G B;  1JNM A;  2VRS A;  4HB1 A;  2M5A B;  1M57 D;  1SQV J;  3H32 B;  1X0T A;  5APQ A;  1URQ D;  1LGH B;  4U3F J;  1KB9 H;  1YHQ P;  2N1T A;  2ZVN B;  2Z5H A;  3L72 D;  3CCM P;  2Z5I A;  1S4X A;  3BVH A;  3H1J J;  2OYH C;  1JY3 N;  2ZT9 B;  1GL2 C;  2V7Q J;  3L74 D;  1NTK K;  2XNX A;  1GK6 A;  4WBA A;  3L72 E;  1S2E A;  5AW1 B;  2H7H A;  3MUD C;  4D6T D;  2ZJS E;  2WSC J;  1M7L A;  2GA1 A;  1KMI Z;  1RE3 C;  4AQR D;  1KQS O;  3ITK A;  1LTA C;  2HPC B;  4DOJ A;  1SQB K;  4D6T E;  2C0W A;  1T6A A;  2C0X A;  5CJ4 A;  1NTM K;  1N7L A;  5APV A;  3BCC G;  5AW8 B;  1SQB G;  1NTZ J;  4UB6 E;  2E74 D;  1KYO I;  1QVF O;  1UIX A;  1NTM G;  4L75 A;  3JSV C;  1J1D B;  3FX0 A;  1SVF A;  1BCC J;  1A02 J;  2C9N Y;  2H88 C;  2O01 J;  1EDK A;  1P84 D;  3GHG C;  1OZH A;  3B5N C;  3G3Z A;  1PP9 G;  1RF1 B;  1ZR2 A;  2K37 A;  4ZMD A;  1GMJ A;  2P7J A;  2E42 A;  1LWU C;  2WPV B;  1KYO H;  1KN7 A;  2JEE A;  4GOD A;  5GTI H;  5APU A;  1OXZ A;  1JB0 J;  1JY2 P;  3HE5 B;  2LR2 A;  3BAS A;  5AVW B;  2YKP A;  2AEF A;  3EFG A;  3L36 A;  3HE4 B;  2Y9Y A;  2QVA A;  1VF5 C;  2KIK A;  2QJK C;  1KIL C;  1VPC A;  2FXP A;  1FZG A;  2BAS A;  4UB8 E;  2FXM A;  3AE4 C;  1FOS E;  1GD2 E;  2FFD A;  1M56 D;  1RF0 C;  1YJW P;  4YPC A;  2OTJ P;  3HUS B;  2YXR B;  4D6T J;  1AA0 A;  3KXD A;  1RE4 A;  1FBM A;  1X22 A;  4C46 A;  1DIP A;  2W6B A;  2PP6 A;  1LTJ C;  2MJZ A;  3L71 E;  2WSS H;  3C8V A;  3PJS K;  2CPB A;  2R3C A;  2E5Y A;  1NAY A;  1VQO P;  4RKU J;  2L91 A;  1Q82 Q;  1BGY D;  3A3Y B;  1NYH A;  3AE5 C;  1JMB A;  2LXB A;  1NTM J;  4R4M A;  3AEG C;  4EIJ A;  3TGU E;  1L4A A;  1BGY E;  3WUV A;  1M1J A;  1R5S A;  1T3J A;  4N78 D;  1FU1 A;  1WT6 A;  3P32 A;  2KS1 B;  2A45 I;  3BAT A;  1IFD A;  1HUC A;  4EYY Q;  1URQ A;  4GDO A;  4JYC A;  1FZC A;  2H89 C;  1JMM A;  3M91 A;  2WSF H;  1RY3 A;  1MV8 A;  4N78 E;  1GK4 A;  5AW3 B;  5KLI C;  3SFD C;  3IAO A;  3FXE A;  4WY4 B;  1FJP A;  3AE9 C;  1KYO E;  2A45 H;  3M9Q A;  1HBW A;  1FZF A;  3B4S A;  3Q5R A;  1EDL A;  3OJA B;  5GTI E;  2Q3I A;  4H44 B;  1FC2 C;  5DJT B;  2OGU A;  2I1J A;  3NXS A;  2PGD A;  2HOD A;  1OX3 A;  4OVN F;  5KJ7 D;  2NPS C;  3MIW A;  1JO5 A;  5CCH C;  4KT0 J;  1USE A;  2ZT9 C;  3CI9 A;  1SQQ D;  3L71 J;  4MN4 C;  5AVZ B;  2K9J B;  3H1K G;  1JEK A;  1SFC D;  1DD3 A;  2A06 D;  3HD7 A;  2OYH B;  4DCK A;  5APS A;  3N7N A;  1BE3 E;  5H2F E;  1G1I A;  3NMD A;  3WMM 0;  1VQ7 P;  3TGU J;  1DEE G;  5KAI H;  2KNC B;  1HGV A;  1YQ4 C;  2IFN A;  1JY3 O;  3TF5 A;  4ASW A;  1VQ9 P;  1SQP K;  4JQ0 D;  2YMY A;  2J59 M;  2D2C B;  1MKM A;  3TNU A;  1EZV I;  3CXH D;  3BRT B;  1K04 A;  4IFF A;  1Q7Y Q;  1JY3 P;  3CME P;  3T97 A;  1SQP G;  1GW3 A;  3EQ2 A;  2R44 A;  1N7S D;  3CXH E;  2WQY C;  1L4A B;  4LGD E;  5AVR B;  1K73 Q;  1SQX K;  1OFC X;  1RF1 C;  4QMA A;  1QL1 A;  3H1L G;  2QE7 H;  3PHL A;  1QL2 A;  3UIA A;  1FDI A;  1LTB C;  2W8Z A;  1SQX G;  2JWD A;  2A45 G;  3GHG B;  2XZR A;  3HTK A;  4R4L A;  2HG5 D;  2OYI B;  2PAJ A;  1N86 A;  1GZL A;  1LWU B;  4XFJ A;  1SQX E;  1W2B O;  1SQV K;  1YYC A;  1UII A;  3PLN A;  5KAF E;  1ZV8 A;  2E76 B;  2OQQ A;  1ZLL A;  3MTU E;  1BE3 J;  1VF5 B;  2QJK B;  1KIL B;  3HUS C;  1VQ6 P;  1PV3 A;  1NKN A;  1G1J A;  1SQV G;  2J5U A;  4OGQ B;  3GW6 A;  2WT7 B;  2B87 B;  2N1T C;  3W67 A;  4U3F G;  2O01 N;  3VOP A;  1L0L K;  3RL0 g;  3D6Y A;  1HJB A;  2UWJ E;  3CWB E;  1L0N D;  5BU5 A;  1AV1 A;  3RL0 B;  3TDK A;  2L5G B;  4U7J A;  3GG2 A;  1T2K C;  1L0L G;  3RK3 E;  2B88 A;  1VQM P;  1DEB A;  3PH0 A;  3HD7 B;  2E75 D;  3E1R A;  2KB7 P;  1L0L E;  1J1E B;  5CBN A;  1K9M Q;  1FDM A;  4I2L C;  4ZNC A;  2FYN C;  1P84 I;  1IC2 A;  2WSF J;  5AVQ B;  1H0T A;  2BCC D;  1LTI C;  5KJ7 A;  3TNU B;  2OAR A;  3H1L J;  1OW8 A;  3T97 B;  4JPZ B;  1JTH A;  4A7P A;  1KD1 Q;  1GL2 D;  1BCC G;  5B66 E;  2BCC E;  1IFN A;  1SQX J;  1BDC A;  5AW9 B;  1EXJ A;  4WY4 C;  5KLV D;  1SFC A;  1PL5 A;  5AW2 B;  2KP8 A;  1EZV E;  1JUN A;  4GKG A;  3VYI A;  3VMZ A;  3VMX A;  3AE2 C;  3RK2 D;  3RK3 C;  1AVO A;  4PV1 B;  5KLV E;  1NU1 E;  4DZO A;  3M06 A;  3H1H D;  4I7Z B;  3L73 E;  4EOT A;  3CWB J;  3L70 E;  4UB8 H;  3JCU H;  5AVY B;  3CC7 P;  1IZN B;  2NPS B;  2WWW A;  3L72 G;  2JO1 A;  2FFD C;  3JC2 2;  1KC8 Q;  1PIX A;  1IJD B;  1N7S A;  4PD4 D;  1KOR A;  4BWN A;  1L0L J;  1LT9 A;  1RE4 C;  4W7Y A;  3B5N D;  4D6T G;  3H1I D;  3L74 E;  4PD4 E;  1GDT A;  2POH A;  3KQG A;  3I5C A;  1PGJ A;  2D2C C;  3H1I E;  3L4F A;  1G2C B;  1RH5 B;  1JOC A;  4GT1 A;  2QIW A;  2IFM A;  2BEZ F;  2IYO A;  2XKM A;  1NH4 A;  3WU2 H;  4W7Z A;  1VQN P;  1NTK D;  2WTY A;  4I1L A;  1L4A C;  3D71 A;  4WB4 A;  1OIP A;  1M1J C;  2JKV A;  2M0B A;  3BCC D;  4H0L B;  2W90 A;  2V4H A;  1DX7 A;  1SQB D;  1URQ C;  1FZC C;  1NU1 J;  3N4X A;  4WWI A;  3V4W A;  2OYI C;  1PPJ D;  3L73 J;  3HRN A;  1H8A A;  3L70 J;  3Q3D A;  1P84 E;  3CCR P;  3I56 P;  5APY A;  3USS A;  2R3S A;  3C1L A;  5L8R J;  2E76 C;  4XE5 B;  4ASV A;  4BXL A;  1LNQ A;  1PP9 D;  2CK3 H;  1KZU B;  2FY8 A;  2KUB A;  1KQG B;  3CC2 P;  4OGQ C;  1NAF A;  1AVY A;  3AEA C;  3L72 J;  2R32 A;  4L73 A;  1KQF B;  2OYO A;  3AEE C;  3G4S P;  1S3J A;  3FWN A;  3JCU E;  3L74 J;  3Q2Y A;  1U7M A;  2JDI H;  3CLQ A;  1QX8 A;  3RL0 C;  4EDF A;  3L71 G;  2KZJ A;  5H2F H;  1T8Z A;  2N1T B;  4NPD A;  1EXI A;  1BSH A;  4NPE A;  3HD7 C;  1M90 Q;  3GMA A;  3CXH I;  1GL2 A;  3M0D C;  1VQ5 P;  1Z56 A;  3CCU P;  4YTP C;  1LT9 B;  1J1E C;  3TGU G;  1KTM A;  1IFI A;  1ZOY C;  1N2D C;  1BGY G;  3D70 A;  1TU3 F;  4Z1M H;  2IYP A;  4DT0 A;  1FZA A;  3WU2 E;  1Q2N A;  3CXH H;  1S9K D;  2WZ7 A;  2FYN B;  5CCH D;  2ZT9 D;  3Q5P A;  1MFZ A;  4XA4 A;  2KYV A;  2CPS A;  3AE3 C;  3CCQ P;  2N9Y B;  4L74 A;  1M8O B;  4PV1 C;  4C7N A;  4YXD C;  1VQL P;  1IFM A;  1M1K Q;  3CC4 P;  1CI6 A;  4I7Z C;  5KKZ B;  1VQ4 P;  4M3L A;  1FJK A;  5APW A;  5KAF H;  1LP1 A;  3RK3 B;  5GTH E;  1SQQ K;  2QSI A;  3H25 A;  2IZ1 A;  5CJ0 A;  1N73 A;  4PJ0 E;  3S9O A;  1S72 P;  2JP3 A;  4TT3 H;  3A5T A;  2XND H;  3TK1 A;  2XDJ A;  5AW0 B;  1SQQ G;  1NVO A;  2Y9Z A;  2Q3E A;  1BE3 G;  3EFF K;  2IZ0 A;  5KTB A;  1OVR A;  2PRR A;  1SQQ E;  2FFD B;  1J2J B;  1HVV A;  1YIJ P;  2KLV A;  2M8R A;  3IFM A;  3CX5 D;  2OTK E;  2ZYA A;  3QH9 A;  2A06 E;  1E5W A;  1BGY J;  2HLO A;  2QJP B;  2E5T A;  1WRG A;  2Q7C A;  2GUS A;  2KOG A;  2RKL A;  5BU8 B;  2ZYG A;  1LTJ A;  3V2P A;  4ZKP A;  4O9B A;  2WPQ A;  2FXO A;  3V5B A;  2O1K A;  2KXP B;  2J58 A;  2ZAE B;  4H0L C;  2C9L Y;  1NGM B;  1RQU A;  2WVR A;  2QJY C;  5E79 E;  4KHX A;  2FYU D;  4RJT A;  2Q1K A;  3ABV C;  5DJU B;  5KJ7 C;  5B66 H;  3KDP B;  1M1J B;  1JY2 N;  5CCG D;  2QEX P;  1SQP D;  1YBK A;  1ZP0 C;  2K88 A;  2FKW B;  3CCL P;  3AE1 C;  1IK9 A;  3AEC C;  1Q86 Q;  1URQ B;  1FE6 A;  1FZC B;  1USD A;  2WPS A;  1SFC C;  1T2K D;  3U59 A;  3CCS P;  2DW3 A;  1ZME C;  1AQT A;  1DH3 A;  5AW6 B;  3II6 A;  4BRY A;  1CI6 B;  1VL2 A;  1SQQ J;  4PD4 I;  1IO4 A;  5B5E H;  1L0N K;  1PZQ A;  3A0B E;  2R5D A;  3CWB G;  4N3Y B;  3AE8 C;  2HOD B;  3P8C D;  1VDF A;  3FGA D;  2ZXX A;  5AVV B;  1YJ9 P;  3B71 A;  1L0N G;  5CCH A;  4H13 D;  3L75 D;  2KZI A;  3PRJ A;  3RBZ A;  1SLQ A;  1N7S C;  2E74 B;  5C39 A;  1DD4 A;  4IFD K;  1SQV D;  1FAV A;  4PD4 H;  4WY4 D;  1LT9 C;  1T3U A;  2P1J A;  1Q81 Q;  4U3F D;  1L0N E;  3L75 E;  4Y28 J;  2ITA A;  1R5L A;  4JF7 A;  4H44 D;  2KSE A;  4GIF A;  1ZR4 A;  2HPC A;  3H1J D;  3O8Z A;  3QWO C;  2HR3 A;  1HH0 A;  1ZN5 A;  2JR8 A;  2E43 A;  2P58 A;  1KFM A;  3MP7 B;  4C7R A;  1OVV A;  2QG4 A;  3H1J E;  1NKZ B;  1X8Y A;  3VP8 A;  4OH8 B;  4Y99 C;  2BCC G;  4K35 A;  1HWT C;  3S1K A;  1OW7 A;  2HYN A;  5AW7 B;  5KLV K;  1WMK A;  3KZI H;  2G3A A;  1JCC A;  1FDO A;  1NU1 K;  2AXC A;  4DJG A;  3GF7 A;  1EZV G;  3WUT A;  1PGO A;  4NPF X;  1YTZ T;  2O3J A;  5KLV G;  1NTZ D;  1OWA A;  1P84 H;  5KKZ C;  4RES B;  1NU1 G;  3B8E B;  3L37 A;  1OMI A;  3L73 G;  3FXD A;  3V4Q A;  3OW2 O;  1BCC D;  3L70 G;  2JWA A;  2D2C D;  1CW5 A;  3H1H G;  3I55 P;  3HE5 A;  3HTK B;  1FZE A;  1U57 A;  1LTT C;  2IBZ D;  3HE4 A;  2P2U A;  2E75 C;  1N8R Q;  1QEX A;  1OVU A;  2Y0E A;  2AXT H;  3H1H E;  1LTG C;  1L4A D;  2FBW C;  1D7M A;  5B5E E;  4EI2 A;  2IBZ E; 
#chains in the Genus database with same CATH homology
 3L72 G;  1SQB G;  1NTK G;  1SQX G;  2A06 G;  3H1H G;  2FYU G;  1L0N G;  5KLV G;  1NTZ G;  3L75 G;  1PP9 G;  1NTM G;  2BCC G;  1P84 H;  3H1J G;  1SQQ G;  2IBZ G;  3L74 G;  1NU1 G;  1PPJ G;  3CX5 H;  3CWB G;  3H1L G;  3L71 G;  3CXH H;  1SQV G;  4PD4 H;  1KYO H;  1BE3 G;  3L73 G;  3TGU G;  1KB9 H;  3BCC G;  1EZV G;  1SQP G;  4D6T G;  1L0L G;  3H1K G;  3L70 G;  1BCC G;  4U3F G;  1BGY G;  3H1I G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...