3H1KG

Chicken cytochrome bc1 complex with zn++ and an iodinated derivative of kresoxim-methyl bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Crystallographic location of two Zn(2+)-binding sites in the avian cytochrome bc(1) complex
pubmed rcsb
total genus 19
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3h1kG00
3BCCG 1NU1G 3L75G 1NTZG 1KB9H 4PD4H 4D6TG 2A06G 1L0LG 3L74G 3CWBG 2FYUG 1SQVG 2BCCG 3H1IG 1PP9G 1SQQG 1KYOH 1BE3G 4U3FG 1BGYG 1BCCG 3H1JG 1NTKG 3L73G 1P84H 1L0NG 2IBZG 1SQBG 3H1KG 3CXHH 1SQXG 3L70G 1EZVG 3L72G 1SQPG 3H1HG 3CX5H 3TGUG 1NTMG 3H1LG 1PPJG 3L71G 5KLVG
chains in the Genus database with same CATH superfamily
1L0ND 1N2DC 4EYYQ 3CLQA 2H89C 2FYUG 2QG4A 2KUBA 2ZVNB 2N1TB 1LP1B 5KJ7D 3USSA 1AV1A 5AVSB 3H1LG 1JTHA 2OYIC 3CWBE 2V7QH 2WPRA 1QGKB 1NKNA 1JOCA 4JQ0D 4H13C 1CZQA 2BASA 4GODA 3H1LJ 1ZP0C 3BCCJ 5C39A 2KNCB 3T97A 4GIFA 2B9BA 3V2PA 2JEEA 1FDOA 5AVUB 1IFJA 1M1JC 5CCHD 1E5WA 1WT6A 1YQ4C 1PGJA 5H2FE 3TGUD 3VMXA 2ITAA 2WWWA 1QVFO 5APXA 2YIUC 4DT0A 1NGMB 5APWA 2WT7A 1SQBD 4AYCA 2QJPC 1NTKE 3BASA 2FXPA 4OVNF 2CPBA 3KXDA 2BCCG 4IL6H 1MKMA 5TISH 2R3SA 1YJWP 3E1RA 3GF7A 3VP8A 2P67A 2A45G 1FOSF 2BCCJ 3C1LA 1YTZT 3GLMA 1BGYG 1BCCG 2FYNB 1NAYA 3L72J 1RF0C 2J59M 1OX3A 3AEEC 3EFFK 3L74D 1L0LE 1L4AB 1MZ9A 1EZVI 1BCCJ 1VQOP 3OW2O 1SFCA 4TT3H 3M9BA 1KYOI 2ZJSE 3FXDA 3V2NA 1GTWA 3NXSA 3TK1A 3HE5B 5BVZA 1D7MA 1SP4A 3RK2D 2AXTH 1EZVD 4UB8E 1NTZK 3TF5A 1BSHA 1PV3A 2N9YB 1GK4A 3HUSB 5KLVE 2E5YA 4NPEA 1FDIA 2V7QJ 1L0NK 4C7RA 2QJKB 5KAIH 1WMKA 3D6YA 1PPJG 1KYOD 1G2CB 1SQVJ 3TDKA 1T2KD 3H25A 2M5AB 1KB9I 1KILE 2KS1A 4H0LB 1PIXA 3CX5D 3RK3D 3A0BE 2FFDB 5H2FH 2YKPA 2C9NY 4DJGA 3OAKA 3F89A 1N7SD 1SLQA 4HKZH 3I56P 3B4SA 2V4HA 5DJTB 1PP9E 4U3FJ 4PJ0E 3G9RA 3L73E 3P8MC 1N73A 3JSVC 4BRYA 1KB9D 1PZQA 3S1KA 2QE7H 4BXLA 1SQPG 3CI9A 1CSBA 1JCDA 2Q3IA 1N8RQ 1VPCA 1OXZA 1NTZG 1EDKA 4IFMA 2E43A 3KYQA 3CMEP 1L0NG 3JCUE 1SQPJ 2H88C 3P8CD 2RKLA 4LLHA 1VQ5P 3H1ID 2I8DA 1VQNP 1XTCC 3Q3DA 4LC1A 5CCGC 2I1KA 4H44B 1SQQE 3KZIE 4I1LA 2W27A 4JBZA 2CPSA 3Q5RA 3FX0A 1N7SB 4RESB 3TNUB 2VRSA 3L71E 3TYYA 3MP7B 2FYNC 1NU1E 3QWOC 1LT9A 2QSIA 3RBXA 1HWTC 4I7ZC 1BE3J 1CW5A 3H1JE 1FJKA 2E76B 5KAFE 3CMAP 1AFOA 2P2UA 2M8RA 4UB8H 5E79H 2Z5IA 4WY4C 2N9BA 3CWBJ 3BRTB 1Q86Q 5AVZB 2QA4P 1KV4A 3PP5A 1PFIA 1LTJC 2BEQD 3CXHE 3H1LD 1TU3F 1RF1C 3N4XA 1LWUB 1GDTA 1GL2B 3A0BH 2OGUA 5GTIE 3HUSC 3RGUA 2HR3A 1PL5A 4ZMDA 2Y0DA 1YIJP 1LJ2A 1RE3A 2QJKC 4RKUJ 4GDOA 4ASWA 1OVVA 4PJ0H 1AQ5A 3GW6A 2P7JA 1ZR4A 1M1JA 3WMM0 1HJ0A 1CI6A 3V4WA 1FZCC 3CCUP 1NYHA 1H89A 4M3LA 1NTKJ 3VOPA 3ZDMA 2JKVA 3SWKA 1R5LA 2WVRA 1P84H 2D2CD 2LXCB 4DCKA 1Q81Q 3AE4C 1PGQA 2BCCD 2HG5D 3CC2P 3CCMP 3U59A 2RMZA 5KTBA 4AUWA 2XU6A 1IJDB 1GW4A 4RO0A 1K73Q 3AEAC 1FDMA 3HD7C 3RL0g 2QJYB 3CCVP 4Z1MH 1S5LE 5L8RJ 1L0LJ 1ZOYC 1BGYD 1BCCD 2QRXA 3I5CA 5CBOA 1KILC 5KAFH 2C0XA 1JM0A 4NPDA 3L75J 1RQVA 1FBMA 1X9VA 3H1KJ 1HH0A 4L74A 2D2CB 2Q9IA 2OYHB 1GK6A 4OH8B 2IBZG 2E76C 3PRJA 3CXHH 5KLVJ 1R5SA 1S1CX 1QVGO 3A2AA 4OGQB 1SQVD 1BSNA 3SFDC 3GHGB 2SPZA 4GOFA 1J1DB 5GTIH 3L36A 1NH4A 3LIEA 5EFWB 1QX8A 1VQ6P 1LP1A 3M0AA 2ZYAA 2L5GB 3IN6A 4DOJA 2WSSH 3H1HE 1BDCA 1LT1A 4WB4A 2WPQA 1KFMA 3JC22 3RL0D 5APVA 1W2EA 1LWUC 2B87A 2R5BA 1PP9J 3O8ZA 1GL2C 1VQ8P 2IZ0A 3AEBC 1NTMK 3L73J 1QL1A 3H1IG 3L70E 1FE6A 1MUUA 1DX7A 3PLNA 1W2BO 1OW6A 2IDBA 4C7NB 4D6TE 1QLED 1FZFA 2WMMA 1Q2NA 2R3CA 4UB6E 1SQPD 2Z4EA 4LGDE 2PP6A 1NTZE 4CPGA 3A7OA 1S5LH 1SQQJ 2NPSB 1GW3A 1GMJA 3OA7A 5CCGA 1X79B 4C46A 3WU2E 1NO4A 3L71J 3G4SP 2H7HA 1BDDA 2YKQA 2W90A 1NU1J 2HLOA 1NTMG 1BE3D 1WRGA 2JR8A 2QJYC 1EC5A 2WPVB 3BCCG 5CHXA 3H1JJ 2HYNA 1M90Q 1USEA 1K04A 3M0DC 4Y99C 3W67A 1NTMJ 3CWBD 5CCGD 3CCQP 3B5NB 3M9HA 4PV1C 3P32A 1FC2C 1S9KE 1IFPA 2ZT9C 4WY4A 2E74D 4I2LC 3HTKB 5AVVB 1JY3O 3TGUE 2JWDA 1LTJA 3A0HH 3HE5A 3S4RA 2IZ1A 1RF1A 4OGQC 1HGZA 2KOGA 2OYOA 1SQBE 4N78D 2K9JB 4JYBA 4OWFA 1SQVK 3M06A 3L37A 3N7NA 3L72G 5M1BA 5AW4B 3U1AA 1URQA 1JY3P 1MFZA 2JO1A 3C8VA 1FZCA 3AE3C 5APUA 3FWLA 4UB6H 1E79H 3CCSP 2OARA 2R5DA 3S9OA 2B89A 4PD4E 1IZNB 3L74E 1JTHB 2HPCA 1SQXE 3SSUA 2K37A 1LTTC 1URQD 1L0LD 3WU2H 1AVYA 2IX7C 3HD7A 3T97B 1LNQA 2FY8A 3MHVA 1SQPK 2AEJA 1EXIA 1SQVG 1ZRTE 2NPSC 3GMAA 1S5LX 1H88A 4ASVA 1EZVE 4QMAA 3L75D 3MGNA 1KQSO 2N1TC 1KILA 2KYVA 5GTHE 2IBZI 1SFCD 5KKZB 3HE4A 5AVQB 1S2EA 2J5UA 3V5BA 1G1JA 3H1KD 1KYOE 1ZN5A 2WT7B 1X22A 3MD0A 3R4YA 1JB0J 2E5TA 3D71A 4U3FG 5KLVD 2IFMA 3V4QA 2E75D 1OWAA 4EI2A 3CX5E 3EWKA 4WVZA 2IBZD 2A06G 2KSEA 4W7YA 1HGVA 1T3JA 1LTIC 1VQMP 3CPWO 3H1HJ 1KMIZ 1JUNA 1S4XA 1OMIA 1JMBA 3BATA 1P84I 1PP9D 1KB9E 1A02J 1K8AQ 3W68A 3RK2B 1IO4A 2IYOA 1ZW0A 1H8AA 2ZAEB 4HH2A 1YBKA 5BU5A 3WUTA 1JMMA 3L70J 1DIPA 2HODA 5KJ7C 1SFCB 1U7MA 3ABVC 1LTBC 3P8CE 3UIAA 1KQGB 1VF5D 1JY3N 1P84D 4PD4H 1K05A 5APTA 3RK3B 2C0WA 4O9BA 2E75B 1BE3G 1DEEG 2ZVOB 4RJTA 1YQ3C 2XNXA 1IFIA 1NTKK 3WUVA 1SQQD 2ZFCA 1NJIQ 3CWBG 5CCHC 3H32A 1L4AC 2PAJA 3PJSK 1NWQA 2O1JA 3SWFA 1RE4C 2KS1B 2RH0A 1OIPA 2M0BA 1UIXA 3CXHI 3H1JD 3CC7P 4B86A 2FYUE 5GTHH 2KZJA 4A7PA 1LTAC 2OYIA 1L0LK 1NTMD 1N73B 3BCCD 3H1LE 1H0TA 4BRYB 1JY2P 3CX5H 1J2JB 5AVRB 3M0DA 2LXBA 2JDIH 3CXHD 5KKZC 4HYTB 1NTKG 3CCEP 3AEDC 2KSJA 1YJNP 1OW8A 5AVXB 2NZ2A 3G71P 4EOTA 4H0LC 5B66E 2FFDC 4AQRD 1IK7A 5KLVK 1SQBJ 4H13D 1JEKA 3JCUH 2YMYA 1LT9B 2BCCE 3E7KA 1L0LG 3C9IA 3RK2C 3L72D 2XZRA 2W6BA 3KZIH 1PGOA 2CK3H 1EXJA 3QH9A 2HFED 4JPZB 2P58A 1DEBA 3L74J 1RF0A 5AW7B 1NHLA 3L75G 1BGYE 1BCCE 4U7JA 3EQ2A 5DJUB 2IFNA 1SQXJ 1T2KC 4H44C 3CCRP 2AEFA 2QM7A 3R2PA 3H1KG 1W5CE 2K3RA 2NRGA 1FOSE 3RBZA 1X0TA 1M7LA 3PTZA 1N7SC 4H13B 2B88A 5KLVG 3SWYA 2ZXEB 2R44A 1JCCA 1FU1A 2AEMA 4EIJA 4Y28J 3MIWA 3ITKA 1OVUA 1SQQK 2Z5HA 3KQGA 3K5BA 1JNMA 1CI6B 2G3AA 2N1TA 1NVOA 1HBWA 1PP9G 1YITP 1NU1K 3LIDA 1VQKP 3L73G 2JWAA 1JY2N 1PPJE 2FBWC 2QJPB 1N73C 2FXOA 2ZXXA 4U3FD 1NOHA 4K35A 3IR9A 3H1HD 2Q3EA 3VTPC 3AE6C 2KNCA 2A06D 1HUCA 2QM8A 3KPEA 4IL6E 2GA1A 1IFDA 5TISE 1ZR2A 1KTMA 1SQQG 1J1EB 1FZEA 2POHA 2YMKA 2KZIA 2JP3A 1SQPE 3Q5PA 2KB7P 2A45H 1EDLA 1HJBA 3PH0A 3L71G 4NPFX 5KJ7A 1NU1G 2YKOA 4WWIA 3AE7C 2KIKA 2K9JA 1L0NE 1KD1Q 3H1JG 3IF4A 1AQTA 3RL0B 1T3UA 1RHZB 1YJ9P 1U7JA 4JF7A 1BE3E 5KLIB 3TSIA 4TLFA 3AE5C 1S72P 2FKWB 2Q5UA 4GOEA 2M3EA 5CCHA 2P10A 1L4AA 1VQ9P 1M1KQ 2FYUJ 1N86A 2L91A 2K88A 3F5HA 2ZYGA 5AW3B 2AXTE 1IK9A 2B87B 5APSA 1RE4A 2O01H 3PHLA 4IOIH 2O01N 3O6QB 5KAIE 3SFEC 1RE3C 2D2CC 1USDA 2QVAA 2OYHC 3KHUA 1S9KD 2Y9YA 1OZHA 2XV5A 3CL3D 1L4AD 1IFMA 3GHGC 1OW7A 1J1DC 1KC8Q 5CMZA 2YXRB 3HUSA 4N78E 1FJPA 4WY4D 1G2CA 3GF3A 5AW6B 1NTKD 2QIWA 2WTYA 3CC4P 2M5AA 2W6AA 2ZYDA 4PD4I 2FFDA 2Q1KA 2WSCH 4HJGH 1HTLC 3LW5H 4L75A 2IPPA 2H43A 3HRNA 4MN4C 1VQLP 1MFTA 1Q7YQ 2E74B 3CD6P 1ZXGA 4N3YB 3D70A 4I7ZB 2QEXP 3MZWB 4YTPC 1J1EC 4PD4D 4H0LD 3B71A 2YO2A 3MUDC 3NMDA 2KLVA 1BGYJ 3VN0A 1SQXD 3CCJP 4ZKUA 3G6EP 3L4FA 4WY4B 2DW3A 1SVFA 2Q7CA 1UIIA 3L75E 2WSEH 2OTKE 1YI2P 3RL0C 1LTJB 3Q2YA 4L76A 3M91A 1XTGB 2FYZA 3B8EB 1ZRTD 1RF1B 2P1JA 3CX5I 1A02F 3H1KE 2PRRA 1N7SA 1LTSC 5E79E 5KLIC 3TNUA 3AEFC 3HD7D 2M3BA 1KQLA 2OQQA 1X8YA 3U1CA 3RK3E 4R4LA 1IFNA 1KFNA 3H1HG 3E1IA 1YYCA 2O01J 3GG2A 2G8YA 1EQ7A 3Q1MA 4DZOA 1DD3A 1M56D 3AE8C 3B5NC 1KILD 2IBZE 4H44D 1URQB 2XKMA 2OTJP 1NAFA 1FZCB 2W8ZA 3P7KA 1FZGA 3L70G 3BRVB 2WPSA 1FZAA 3L73D 1Y8AA 4D6TG 2Y9ZA 3FWNA 1VQPP 3A3YB 2WQYC 2Y0EA 1JO5A 2HPCB 5AVWB 1LWUA 2GM4A 2GUVA 2E76D 3VYIA 1GL2A 2E42A 1T8ZA 1VDFA 2K1AA 4D6TJ 1ZLLA 3H1IE 4JYCA 3NFQA 3HD7B 1RH5B 1AVOA 1P84E 2WSCJ 4GKGA 3LW5J 2J58A 1OFCX 1T6AA 5BU8B 2W83C 4IL6X 4XE5B 1NTZJ 1SQBK 1DD4A 2LKMA 4XFJA 1GL2D 1VQ7P 1KILB 1RY3A 3II6A 3HE4B 2PFXA 1JY2O 1L0NJ 2MJZA 1SS1A 1QL2A 2E74C 3L71D 1NU1D 4K3AA 2AXCA 2BEZF 2KI7B 1FAVA 3AECC 3FXEA 2PGDA 2IYPA 1RQUA 3V2RA 2LR2A 5CJ0A 1KYOH 2KXPB 2WSEJ 2K9YA 1NTME 5AVYB 1NKZB 2WZ7A 2FYUD 3BCCE 2C9LY 1VF5B 3TGUG 1SQXK 1M8OB 3NTNA 2FXMA 2W6JH 1GZLA 2I1JA 1OVRA 2YO3A 5AW5B 3V2QA 1EDJA 4HB1A 1SQBG 1ZMEC 4W80A 3TGUJ 5K5GB 2WSFH 2HODB 1Y47A 1M57D 3VP9A 2XDJA 1KB9H 2JJLA 2OYHA 4IFFA 1HVVA 4N6JA 1K9MQ 3GHGA 1URQC 2H8PD 4PV1D 3H6PA 4I6MC 1Q90D 1EDIA 4YPCA 5B5EE 4XA4A 3A5TA 3AE2C 3I55P 2A45I 1IC2A 2ZT9D 4ZNCA 1KN7A 2RN0A 5AW9B 3L74G 3CCLP 2GUSA 1YHQP 1YTZI 3H32B 1Z56A 1PGPA 3L72E 2KLUA 1LGHB 1SQXG 4KHXA 2YNYA 2MKVA 1QEXA 1SFCC 4OGQD 1AA0A 3G3ZA 2Y0CA 3M9QA 5APQA 3D6ZA 5CBNA 2KP8A 2XNDH 1GU5A 3VMYA 5CJ4A 2OYIB 4C7NA 3RK3C 2E75C 5AW8B 1AJYA 1EZVG 5AVTB 1H0TB 2R32A 4GT1A 2O1KA 4W7ZA 1VQ4P 2O3JA 4Y99B 5AW1B 3AE9C 1FS0E 3MUDA 5AW0B 1LTGC 4PV1B 1R8EA 1Q82Q 1N7LA 2YXQB 3AE1C 2ZT9B 1MV8A 1M1JB 2NPSA 3VMZA 4IFDK 1KORA 1SQVE 3MTUE 1DH3A 4YXDC 2YIUB 3EFGA 3FGAD 4ZKPA 3AEGC 5TJHA 5APYA 1S3JA 5B66H 4U3FE 1VF5C 3L35A 4EDFA 2NPSD 2OTLP 3V6IA 2Q6QA 1U57A 1PPJD 2WSFJ 3A0HE 3BVHA 4R4MA 2FYUK 1FZBA 3OJAB 2N1TD 3B5NA 1HF9A 4KJMA 3WUUA 1GU4A 2A06E 4L73A 5AW2B 5B5EH 2UWJE 2KK7A 3HTKA 4BWNA 4YXWH 3O6QA 3Q5SA 3L70D 1GD2E 3IAOA 1ZV8A 2WITA 3VMAA 4D6TD 3H1IJ 1G1IA 3B5ND 3IFMA 4KT0J 1L2PA 1KQFB 1LT9C 1VL2A 1NTZD 1KZUB 4WBAA 3KDPB 1Y9BA
chains in the Genus database with same CATH topology
3BCCG 1NU1G 3L75G 1NTZG 1KB9H 4PD4H 4D6TG 2A06G 1L0LG 3L74G 3CWBG 2FYUG 1SQVG 2BCCG 3H1IG 1PP9G 1SQQG 1KYOH 1BE3G 4U3FG 1BGYG 1BCCG 3H1JG 1NTKG 3L73G 1P84H 1L0NG 2IBZG 1SQBG 3H1KG 3CXHH 1SQXG 3L70G 1EZVG 3L72G 1SQPG 3H1HG 3CX5H 3TGUG 1NTMG 3H1LG 1PPJG 3L71G 5KLVG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCC G;  1NU1 G;  3L75 G;  1NTZ G;  1KB9 H;  4PD4 H;  4D6T G;  2A06 G;  1L0L G;  3L74 G;  3CWB G;  2FYU G;  1SQV G;  2BCC G;  3H1I G;  1PP9 G;  1SQQ G;  1KYO H;  1BE3 G;  4U3F G;  1BGY G;  1BCC G;  3H1J G;  1NTK G;  3L73 G;  1P84 H;  1L0N G;  2IBZ G;  1SQB G;  3H1K G;  3CXH H;  1SQX G;  3L70 G;  1EZV G;  3L72 G;  1SQP G;  3H1H G;  3CX5 H;  3TGU G;  1NTM G;  3H1L G;  1PPJ G;  3L71 G;  5KLV G; 
#chains in the Genus database with same CATH topology
 1L0N D;  1N2D C;  4EYY Q;  3CLQ A;  2H89 C;  2FYU G;  2QG4 A;  2KUB A;  2ZVN B;  2N1T B;  1LP1 B;  5KJ7 D;  3USS A;  1AV1 A;  5AVS B;  3H1L G;  1JTH A;  2OYI C;  3CWB E;  2V7Q H;  2WPR A;  1QGK B;  1NKN A;  1JOC A;  4JQ0 D;  4H13 C;  1CZQ A;  2BAS A;  4GOD A;  3H1L J;  1ZP0 C;  3BCC J;  5C39 A;  2KNC B;  3T97 A;  4GIF A;  2B9B A;  3V2P A;  2JEE A;  1FDO A;  5AVU B;  1IFJ A;  1M1J C;  5CCH D;  1E5W A;  1WT6 A;  1YQ4 C;  1PGJ A;  5H2F E;  3TGU D;  3VMX A;  2ITA A;  2WWW A;  1QVF O;  5APX A;  2YIU C;  4DT0 A;  1NGM B;  5APW A;  2WT7 A;  1SQB D;  4AYC A;  2QJP C;  1NTK E;  3BAS A;  2FXP A;  4OVN F;  2CPB A;  3KXD A;  2BCC G;  4IL6 H;  1MKM A;  5TIS H;  2R3S A;  1YJW P;  3E1R A;  3GF7 A;  3VP8 A;  2P67 A;  2A45 G;  1FOS F;  2BCC J;  3C1L A;  1YTZ T;  3GLM A;  1BGY G;  1BCC G;  2FYN B;  1NAY A;  3L72 J;  1RF0 C;  2J59 M;  1OX3 A;  3AEE C;  3EFF K;  3L74 D;  1L0L E;  1L4A B;  1MZ9 A;  1EZV I;  1BCC J;  1VQO P;  3OW2 O;  1SFC A;  4TT3 H;  3M9B A;  1KYO I;  2ZJS E;  3FXD A;  3V2N A;  1GTW A;  3NXS A;  3TK1 A;  3HE5 B;  5BVZ A;  1D7M A;  1SP4 A;  3RK2 D;  2AXT H;  1EZV D;  4UB8 E;  1NTZ K;  3TF5 A;  1BSH A;  1PV3 A;  2N9Y B;  1GK4 A;  3HUS B;  5KLV E;  2E5Y A;  4NPE A;  1FDI A;  2V7Q J;  1L0N K;  4C7R A;  2QJK B;  5KAI H;  1WMK A;  3D6Y A;  1PPJ G;  1KYO D;  1G2C B;  1SQV J;  3TDK A;  1T2K D;  3H25 A;  2M5A B;  1KB9 I;  1KIL E;  2KS1 A;  4H0L B;  1PIX A;  3CX5 D;  3RK3 D;  3A0B E;  2FFD B;  5H2F H;  2YKP A;  2C9N Y;  4DJG A;  3OAK A;  3F89 A;  1N7S D;  1SLQ A;  4HKZ H;  3I56 P;  3B4S A;  2V4H A;  5DJT B;  1PP9 E;  4U3F J;  4PJ0 E;  3G9R A;  3L73 E;  3P8M C;  1N73 A;  3JSV C;  4BRY A;  1KB9 D;  1PZQ A;  3S1K A;  2QE7 H;  4BXL A;  1SQP G;  3CI9 A;  1CSB A;  1JCD A;  2Q3I A;  1N8R Q;  1VPC A;  1OXZ A;  1NTZ G;  1EDK A;  4IFM A;  2E43 A;  3KYQ A;  3CME P;  1L0N G;  3JCU E;  1SQP J;  2H88 C;  3P8C D;  2RKL A;  4LLH A;  1VQ5 P;  3H1I D;  2I8D A;  1VQN P;  1XTC C;  3Q3D A;  4LC1 A;  5CCG C;  2I1K A;  4H44 B;  1SQQ E;  3KZI E;  4I1L A;  2W27 A;  4JBZ A;  2CPS A;  3Q5R A;  3FX0 A;  1N7S B;  4RES B;  3TNU B;  2VRS A;  3L71 E;  3TYY A;  3MP7 B;  2FYN C;  1NU1 E;  3QWO C;  1LT9 A;  2QSI A;  3RBX A;  1HWT C;  4I7Z C;  1BE3 J;  1CW5 A;  3H1J E;  1FJK A;  2E76 B;  5KAF E;  3CMA P;  1AFO A;  2P2U A;  2M8R A;  4UB8 H;  5E79 H;  2Z5I A;  4WY4 C;  2N9B A;  3CWB J;  3BRT B;  1Q86 Q;  5AVZ B;  2QA4 P;  1KV4 A;  3PP5 A;  1PFI A;  1LTJ C;  2BEQ D;  3CXH E;  3H1L D;  1TU3 F;  1RF1 C;  3N4X A;  1LWU B;  1GDT A;  1GL2 B;  3A0B H;  2OGU A;  5GTI E;  3HUS C;  3RGU A;  2HR3 A;  1PL5 A;  4ZMD A;  2Y0D A;  1YIJ P;  1LJ2 A;  1RE3 A;  2QJK C;  4RKU J;  4GDO A;  4ASW A;  1OVV A;  4PJ0 H;  1AQ5 A;  3GW6 A;  2P7J A;  1ZR4 A;  1M1J A;  3WMM 0;  1HJ0 A;  1CI6 A;  3V4W A;  1FZC C;  3CCU P;  1NYH A;  1H89 A;  4M3L A;  1NTK J;  3VOP A;  3ZDM A;  2JKV A;  3SWK A;  1R5L A;  2WVR A;  1P84 H;  2D2C D;  2LXC B;  4DCK A;  1Q81 Q;  3AE4 C;  1PGQ A;  2BCC D;  2HG5 D;  3CC2 P;  3CCM P;  3U59 A;  2RMZ A;  5KTB A;  4AUW A;  2XU6 A;  1IJD B;  1GW4 A;  4RO0 A;  1K73 Q;  3AEA C;  1FDM A;  3HD7 C;  3RL0 g;  2QJY B;  3CCV P;  4Z1M H;  1S5L E;  5L8R J;  1L0L J;  1ZOY C;  1BGY D;  1BCC D;  2QRX A;  3I5C A;  5CBO A;  1KIL C;  5KAF H;  2C0X A;  1JM0 A;  4NPD A;  3L75 J;  1RQV A;  1FBM A;  1X9V A;  3H1K J;  1HH0 A;  4L74 A;  2D2C B;  2Q9I A;  2OYH B;  1GK6 A;  4OH8 B;  2IBZ G;  2E76 C;  3PRJ A;  3CXH H;  5KLV J;  1R5S A;  1S1C X;  1QVG O;  3A2A A;  4OGQ B;  1SQV D;  1BSN A;  3SFD C;  3GHG B;  2SPZ A;  4GOF A;  1J1D B;  5GTI H;  3L36 A;  1NH4 A;  3LIE A;  5EFW B;  1QX8 A;  1VQ6 P;  1LP1 A;  3M0A A;  2ZYA A;  2L5G B;  3IN6 A;  4DOJ A;  2WSS H;  3H1H E;  1BDC A;  1LT1 A;  4WB4 A;  2WPQ A;  1KFM A;  3JC2 2;  3RL0 D;  5APV A;  1W2E A;  1LWU C;  2B87 A;  2R5B A;  1PP9 J;  3O8Z A;  1GL2 C;  1VQ8 P;  2IZ0 A;  3AEB C;  1NTM K;  3L73 J;  1QL1 A;  3H1I G;  3L70 E;  1FE6 A;  1MUU A;  1DX7 A;  3PLN A;  1W2B O;  1OW6 A;  2IDB A;  4C7N B;  4D6T E;  1QLE D;  1FZF A;  2WMM A;  1Q2N A;  2R3C A;  4UB6 E;  1SQP D;  2Z4E A;  4LGD E;  2PP6 A;  1NTZ E;  4CPG A;  3A7O A;  1S5L H;  1SQQ J;  2NPS B;  1GW3 A;  1GMJ A;  3OA7 A;  5CCG A;  1X79 B;  4C46 A;  3WU2 E;  1NO4 A;  3L71 J;  3G4S P;  2H7H A;  1BDD A;  2YKQ A;  2W90 A;  1NU1 J;  2HLO A;  1NTM G;  1BE3 D;  1WRG A;  2JR8 A;  2QJY C;  1EC5 A;  2WPV B;  3BCC G;  5CHX A;  3H1J J;  2HYN A;  1M90 Q;  1USE A;  1K04 A;  3M0D C;  4Y99 C;  3W67 A;  1NTM J;  3CWB D;  5CCG D;  3CCQ P;  3B5N B;  3M9H A;  4PV1 C;  3P32 A;  1FC2 C;  1S9K E;  1IFP A;  2ZT9 C;  4WY4 A;  2E74 D;  4I2L C;  3HTK B;  5AVV B;  1JY3 O;  3TGU E;  2JWD A;  1LTJ A;  3A0H H;  3HE5 A;  3S4R A;  2IZ1 A;  1RF1 A;  4OGQ C;  1HGZ A;  2KOG A;  2OYO A;  1SQB E;  4N78 D;  2K9J B;  4JYB A;  4OWF A;  1SQV K;  3M06 A;  3L37 A;  3N7N A;  3L72 G;  5M1B A;  5AW4 B;  3U1A A;  1URQ A;  1JY3 P;  1MFZ A;  2JO1 A;  3C8V A;  1FZC A;  3AE3 C;  5APU A;  3FWL A;  4UB6 H;  1E79 H;  3CCS P;  2OAR A;  2R5D A;  3S9O A;  2B89 A;  4PD4 E;  1IZN B;  3L74 E;  1JTH B;  2HPC A;  1SQX E;  3SSU A;  2K37 A;  1LTT C;  1URQ D;  1L0L D;  3WU2 H;  1AVY A;  2IX7 C;  3HD7 A;  3T97 B;  1LNQ A;  2FY8 A;  3MHV A;  1SQP K;  2AEJ A;  1EXI A;  1SQV G;  1ZRT E;  2NPS C;  3GMA A;  1S5L X;  1H88 A;  4ASV A;  1EZV E;  4QMA A;  3L75 D;  3MGN A;  1KQS O;  2N1T C;  1KIL A;  2KYV A;  5GTH E;  2IBZ I;  1SFC D;  5KKZ B;  3HE4 A;  5AVQ B;  1S2E A;  2J5U A;  3V5B A;  1G1J A;  3H1K D;  1KYO E;  1ZN5 A;  2WT7 B;  1X22 A;  3MD0 A;  3R4Y A;  1JB0 J;  2E5T A;  3D71 A;  4U3F G;  5KLV D;  2IFM A;  3V4Q A;  2E75 D;  1OWA A;  4EI2 A;  3CX5 E;  3EWK A;  4WVZ A;  2IBZ D;  2A06 G;  2KSE A;  4W7Y A;  1HGV A;  1T3J A;  1LTI C;  1VQM P;  3CPW O;  3H1H J;  1KMI Z;  1JUN A;  1S4X A;  1OMI A;  1JMB A;  3BAT A;  1P84 I;  1PP9 D;  1KB9 E;  1A02 J;  1K8A Q;  3W68 A;  3RK2 B;  1IO4 A;  2IYO A;  1ZW0 A;  1H8A A;  2ZAE B;  4HH2 A;  1YBK A;  5BU5 A;  3WUT A;  1JMM A;  3L70 J;  1DIP A;  2HOD A;  5KJ7 C;  1SFC B;  1U7M A;  3ABV C;  1LTB C;  3P8C E;  3UIA A;  1KQG B;  1VF5 D;  1JY3 N;  1P84 D;  4PD4 H;  1K05 A;  5APT A;  3RK3 B;  2C0W A;  4O9B A;  2E75 B;  1BE3 G;  1DEE G;  2ZVO B;  4RJT A;  1YQ3 C;  2XNX A;  1IFI A;  1NTK K;  3WUV A;  1SQQ D;  2ZFC A;  1NJI Q;  3CWB G;  5CCH C;  3H32 A;  1L4A C;  2PAJ A;  3PJS K;  1NWQ A;  2O1J A;  3SWF A;  1RE4 C;  2KS1 B;  2RH0 A;  1OIP A;  2M0B A;  1UIX A;  3CXH I;  3H1J D;  3CC7 P;  4B86 A;  2FYU E;  5GTH H;  2KZJ A;  4A7P A;  1LTA C;  2OYI A;  1L0L K;  1NTM D;  1N73 B;  3BCC D;  3H1L E;  1H0T A;  4BRY B;  1JY2 P;  3CX5 H;  1J2J B;  5AVR B;  3M0D A;  2LXB A;  2JDI H;  3CXH D;  5KKZ C;  4HYT B;  1NTK G;  3CCE P;  3AED C;  2KSJ A;  1YJN P;  1OW8 A;  5AVX B;  2NZ2 A;  3G71 P;  4EOT A;  4H0L C;  5B66 E;  2FFD C;  4AQR D;  1IK7 A;  5KLV K;  1SQB J;  4H13 D;  1JEK A;  3JCU H;  2YMY A;  1LT9 B;  2BCC E;  3E7K A;  1L0L G;  3C9I A;  3RK2 C;  3L72 D;  2XZR A;  2W6B A;  3KZI H;  1PGO A;  2CK3 H;  1EXJ A;  3QH9 A;  2HFE D;  4JPZ B;  2P58 A;  1DEB A;  3L74 J;  1RF0 A;  5AW7 B;  1NHL A;  3L75 G;  1BGY E;  1BCC E;  4U7J A;  3EQ2 A;  5DJU B;  2IFN A;  1SQX J;  1T2K C;  4H44 C;  3CCR P;  2AEF A;  2QM7 A;  3R2P A;  3H1K G;  1W5C E;  2K3R A;  2NRG A;  1FOS E;  3RBZ A;  1X0T A;  1M7L A;  3PTZ A;  1N7S C;  4H13 B;  2B88 A;  5KLV G;  3SWY A;  2ZXE B;  2R44 A;  1JCC A;  1FU1 A;  2AEM A;  4EIJ A;  4Y28 J;  3MIW A;  3ITK A;  1OVU A;  1SQQ K;  2Z5H A;  3KQG A;  3K5B A;  1JNM A;  1CI6 B;  2G3A A;  2N1T A;  1NVO A;  1HBW A;  1PP9 G;  1YIT P;  1NU1 K;  3LID A;  1VQK P;  3L73 G;  2JWA A;  1JY2 N;  1PPJ E;  2FBW C;  2QJP B;  1N73 C;  2FXO A;  2ZXX A;  4U3F D;  1NOH A;  4K35 A;  3IR9 A;  3H1H D;  2Q3E A;  3VTP C;  3AE6 C;  2KNC A;  2A06 D;  1HUC A;  2QM8 A;  3KPE A;  4IL6 E;  2GA1 A;  1IFD A;  5TIS E;  1ZR2 A;  1KTM A;  1SQQ G;  1J1E B;  1FZE A;  2POH A;  2YMK A;  2KZI A;  2JP3 A;  1SQP E;  3Q5P A;  2KB7 P;  2A45 H;  1EDL A;  1HJB A;  3PH0 A;  3L71 G;  4NPF X;  5KJ7 A;  1NU1 G;  2YKO A;  4WWI A;  3AE7 C;  2KIK A;  2K9J A;  1L0N E;  1KD1 Q;  3H1J G;  3IF4 A;  1AQT A;  3RL0 B;  1T3U A;  1RHZ B;  1YJ9 P;  1U7J A;  4JF7 A;  1BE3 E;  5KLI B;  3TSI A;  4TLF A;  3AE5 C;  1S72 P;  2FKW B;  2Q5U A;  4GOE A;  2M3E A;  5CCH A;  2P10 A;  1L4A A;  1VQ9 P;  1M1K Q;  2FYU J;  1N86 A;  2L91 A;  2K88 A;  3F5H A;  2ZYG A;  5AW3 B;  2AXT E;  1IK9 A;  2B87 B;  5APS A;  1RE4 A;  2O01 H;  3PHL A;  4IOI H;  2O01 N;  3O6Q B;  5KAI E;  3SFE C;  1RE3 C;  2D2C C;  1USD A;  2QVA A;  2OYH C;  3KHU A;  1S9K D;  2Y9Y A;  1OZH A;  2XV5 A;  3CL3 D;  1L4A D;  1IFM A;  3GHG C;  1OW7 A;  1J1D C;  1KC8 Q;  5CMZ A;  2YXR B;  3HUS A;  4N78 E;  1FJP A;  4WY4 D;  1G2C A;  3GF3 A;  5AW6 B;  1NTK D;  2QIW A;  2WTY A;  3CC4 P;  2M5A A;  2W6A A;  2ZYD A;  4PD4 I;  2FFD A;  2Q1K A;  2WSC H;  4HJG H;  1HTL C;  3LW5 H;  4L75 A;  2IPP A;  2H43 A;  3HRN A;  4MN4 C;  1VQL P;  1MFT A;  1Q7Y Q;  2E74 B;  3CD6 P;  1ZXG A;  4N3Y B;  3D70 A;  4I7Z B;  2QEX P;  3MZW B;  4YTP C;  1J1E C;  4PD4 D;  4H0L D;  3B71 A;  2YO2 A;  3MUD C;  3NMD A;  2KLV A;  1BGY J;  3VN0 A;  1SQX D;  3CCJ P;  4ZKU A;  3G6E P;  3L4F A;  4WY4 B;  2DW3 A;  1SVF A;  2Q7C A;  1UII A;  3L75 E;  2WSE H;  2OTK E;  1YI2 P;  3RL0 C;  1LTJ B;  3Q2Y A;  4L76 A;  3M91 A;  1XTG B;  2FYZ A;  3B8E B;  1ZRT D;  1RF1 B;  2P1J A;  3CX5 I;  1A02 F;  3H1K E;  2PRR A;  1N7S A;  1LTS C;  5E79 E;  5KLI C;  3TNU A;  3AEF C;  3HD7 D;  2M3B A;  1KQL A;  2OQQ A;  1X8Y A;  3U1C A;  3RK3 E;  4R4L A;  1IFN A;  1KFN A;  3H1H G;  3E1I A;  1YYC A;  2O01 J;  3GG2 A;  2G8Y A;  1EQ7 A;  3Q1M A;  4DZO A;  1DD3 A;  1M56 D;  3AE8 C;  3B5N C;  1KIL D;  2IBZ E;  4H44 D;  1URQ B;  2XKM A;  2OTJ P;  1NAF A;  1FZC B;  2W8Z A;  3P7K A;  1FZG A;  3L70 G;  3BRV B;  2WPS A;  1FZA A;  3L73 D;  1Y8A A;  4D6T G;  2Y9Z A;  3FWN A;  1VQP P;  3A3Y B;  2WQY C;  2Y0E A;  1JO5 A;  2HPC B;  5AVW B;  1LWU A;  2GM4 A;  2GUV A;  2E76 D;  3VYI A;  1GL2 A;  2E42 A;  1T8Z A;  1VDF A;  2K1A A;  4D6T J;  1ZLL A;  3H1I E;  4JYC A;  3NFQ A;  3HD7 B;  1RH5 B;  1AVO A;  1P84 E;  2WSC J;  4GKG A;  3LW5 J;  2J58 A;  1OFC X;  1T6A A;  5BU8 B;  2W83 C;  4IL6 X;  4XE5 B;  1NTZ J;  1SQB K;  1DD4 A;  2LKM A;  4XFJ A;  1GL2 D;  1VQ7 P;  1KIL B;  1RY3 A;  3II6 A;  3HE4 B;  2PFX A;  1JY2 O;  1L0N J;  2MJZ A;  1SS1 A;  1QL2 A;  2E74 C;  3L71 D;  1NU1 D;  4K3A A;  2AXC A;  2BEZ F;  2KI7 B;  1FAV A;  3AEC C;  3FXE A;  2PGD A;  2IYP A;  1RQU A;  3V2R A;  2LR2 A;  5CJ0 A;  1KYO H;  2KXP B;  2WSE J;  2K9Y A;  1NTM E;  5AVY B;  1NKZ B;  2WZ7 A;  2FYU D;  3BCC E;  2C9L Y;  1VF5 B;  3TGU G;  1SQX K;  1M8O B;  3NTN A;  2FXM A;  2W6J H;  1GZL A;  2I1J A;  1OVR A;  2YO3 A;  5AW5 B;  3V2Q A;  1EDJ A;  4HB1 A;  1SQB G;  1ZME C;  4W80 A;  3TGU J;  5K5G B;  2WSF H;  2HOD B;  1Y47 A;  1M57 D;  3VP9 A;  2XDJ A;  1KB9 H;  2JJL A;  2OYH A;  4IFF A;  1HVV A;  4N6J A;  1K9M Q;  3GHG A;  1URQ C;  2H8P D;  4PV1 D;  3H6P A;  4I6M C;  1Q90 D;  1EDI A;  4YPC A;  5B5E E;  4XA4 A;  3A5T A;  3AE2 C;  3I55 P;  2A45 I;  1IC2 A;  2ZT9 D;  4ZNC A;  1KN7 A;  2RN0 A;  5AW9 B;  3L74 G;  3CCL P;  2GUS A;  1YHQ P;  1YTZ I;  3H32 B;  1Z56 A;  1PGP A;  3L72 E;  2KLU A;  1LGH B;  1SQX G;  4KHX A;  2YNY A;  2MKV A;  1QEX A;  1SFC C;  4OGQ D;  1AA0 A;  3G3Z A;  2Y0C A;  3M9Q A;  5APQ A;  3D6Z A;  5CBN A;  2KP8 A;  2XND H;  1GU5 A;  3VMY A;  5CJ4 A;  2OYI B;  4C7N A;  3RK3 C;  2E75 C;  5AW8 B;  1AJY A;  1EZV G;  5AVT B;  1H0T B;  2R32 A;  4GT1 A;  2O1K A;  4W7Z A;  1VQ4 P;  2O3J A;  4Y99 B;  5AW1 B;  3AE9 C;  1FS0 E;  3MUD A;  5AW0 B;  1LTG C;  4PV1 B;  1R8E A;  1Q82 Q;  1N7L A;  2YXQ B;  3AE1 C;  2ZT9 B;  1MV8 A;  1M1J B;  2NPS A;  3VMZ A;  4IFD K;  1KOR A;  1SQV E;  3MTU E;  1DH3 A;  4YXD C;  2YIU B;  3EFG A;  3FGA D;  4ZKP A;  3AEG C;  5TJH A;  5APY A;  1S3J A;  5B66 H;  4U3F E;  1VF5 C;  3L35 A;  4EDF A;  2NPS D;  2OTL P;  3V6I A;  2Q6Q A;  1U57 A;  1PPJ D;  2WSF J;  3A0H E;  3BVH A;  4R4M A;  2FYU K;  1FZB A;  3OJA B;  2N1T D;  3B5N A;  1HF9 A;  4KJM A;  3WUU A;  1GU4 A;  2A06 E;  4L73 A;  5AW2 B;  5B5E H;  2UWJ E;  2KK7 A;  3HTK A;  4BWN A;  4YXW H;  3O6Q A;  3Q5S A;  3L70 D;  1GD2 E;  3IAO A;  1ZV8 A;  2WIT A;  3VMA A;  4D6T D;  3H1I J;  1G1I A;  3B5N D;  3IFM A;  4KT0 J;  1L2P A;  1KQF B;  1LT9 C;  1VL2 A;  1NTZ D;  1KZU B;  4WBA A;  3KDP B;  1Y9B A; 
#chains in the Genus database with same CATH homology
 3BCC G;  1NU1 G;  3L75 G;  1NTZ G;  1KB9 H;  4PD4 H;  4D6T G;  2A06 G;  1L0L G;  3L74 G;  3CWB G;  2FYU G;  1SQV G;  2BCC G;  3H1I G;  1PP9 G;  1SQQ G;  1KYO H;  1BE3 G;  4U3F G;  1BGY G;  1BCC G;  3H1J G;  1NTK G;  3L73 G;  1P84 H;  1L0N G;  2IBZ G;  1SQB G;  3H1K G;  3CXH H;  1SQX G;  3L70 G;  1EZV G;  3L72 G;  1SQP G;  3H1H G;  3CX5 H;  3TGU G;  1NTM G;  3H1L G;  1PPJ G;  3L71 G;  5KLV G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...