4WWIA

Crystal structure of the c domain of staphylococcal protein a in complex with the fc fragment of human igg at 2.3 angstrom resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
57
structure length
57
Chain Sequence
DNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Immunoglobulin G-binding protein A
publication title Suppression of conformational heterogeneity at a protein-protein interface.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 21
structure length 57
sequence length 57
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4wwiA00
2I8DA 4NPDA 2B87B 2QVAA 1EDKA 1EDIA 1LP1B 1MFTA 2K3RA 1FC2C 2KZJA 2KI7B 3MZWB 4K35A 2R44A 2HR3A 2KS1B 3PH0A 1SS1A 4GODA 4WWIA 3RGUA 2M5AB 4GOEA 4GOFA 1LT1A 1BDCA 4NPFX 1OVUA 2RKLA 2LR2A 4BXLA 1H0TB 3QWOC 2QRXA 2P58A 3FXDA 5CBNA 2M5AA 2WMMA 2OTKE 4HB1A 2SPZA 2B87A 1S3JA 1EC5A 1EDLA 2ZAEB 5EFWB 1LP1A 4JBZA 1ZW0A 5DJUB 1U7MA 1Y47A 4HKZH 4ZMDA 1BDDA 2UWJE 2LXBA 1EDJA 2M0BA 1JM0A 1U7JA 5CBOA 5C39A 2KZIA 1Q2NA 2JWDA 1H0TA 2LXCB 2Q1KA 4ASVA 4IOIH 4ASWA 2B88A 1ZXGA 4CPGA 4ZNCA 5K5GB 2KUBA 4K3AA 2KIKA 3FXEA 3S1KA 1OVRA 4KJMA 1NVOA 1OVVA 3ZDMA 4NPEA 1DEEG 1JMBA 4HJGH 4MN4C 4EYYQ 3MHVA 5DJTB 1X0TA 2B89A
chains in the Genus database with same CATH superfamily
1P84D 3LIDA 2E75C 2QM7A 3SWFA 3CD6P 3H1JE 2K3RA 3MUDA 4L76A 4KHXA 4PD4H 1RY3A 2FXOA 3CCUP 1QVGO 4TT3H 1MZ9A 3JSVC 1EZVE 4C7NB 3M9BA 1NTMG 3U59A 1VL2A 1YQ4C 3H1IG 3M91A 1GW4A 1NTMD 1A02F 1OFCX 3NXSA 1GD2E 4Z1MH 3GHGA 2A45G 5CHXA 2E76D 3GW6A 1Q82Q 1JY2P 3C8VA 3KDPB 1M1JC 1LWUB 3L74J 1JTHA 1QGKB 4I7ZB 5M1BA 1G1IA 3SSUA 2XU6A 2P7JA 3BRTB 1OWAA 1TU3F 4DT0A 2V7QH 3HRNA 5AW6B 2E76B 1J1EB 3TGUJ 3H1IJ 2E74C 2W6JH 3BASA 3L75G 2CPSA 1EXIA 1URQB 3CWBG 3N4XA 3L75D 1ZRTE 3CWBD 1IZNB 5AVVB 2HPCA 2KZJA 1SQVE 4OGQD 2BCCD 3CMAP 1KILA 5AW9B 1FAVA 2QE7H 2YIUB 4JYBA 1PP9J 3BVHA 4NPFX 3TSIA 3AEFC 1FBMA 1M8OB 3V4QA 2IYPA 3JCUE 1VQ7P 1SQBG 1VQ6P 1J1DC 1SQBD 1S3JA 1LJ2A 1L0LE 2JEEA 2WQYC 4H13D 2WSFJ 1SQQE 4N3YB 1ZW0A 4HKZH 3S4RA 2Z4EA 1QVFO 2LXBA 5AVRB 4UB6H 2WSCH 4RO0A 1H88A 4W7ZA 2M0BA 3WU2E 5CCGD 1P84E 3C1LA 2QIWA 4QMAA 5CJ4A 1JNMA 3VOPA 2P67A 4JPZB 4DOJA 4DJGA 2Q3EA 3CCJP 4R4LA 2V4HA 5AVZB 2N1TD 1KQSO 5BVZA 1JEKA 2I1KA 1YJNP 1JMBA 3VMZA 2JKVA 1FDMA 4BRYB 1ZR4A 4EOTA 4H44D 3MP7B 1G2CB 2B9BA 1SVFA 3V6IA 1YTZT 1LWUC 3KZIH 2W6AA 4I7ZC 3EQ2A 1AA0A 2KI7B 5KKZB 1LT9A 2FBWC 2W27A 4GKGA 1YJWP 3RGUA 5APVA 2M5AB 2PGDA 1VF5D 1BCCJ 3TNUA 1VQ9P 1RH5B 2RH0A 2QRXA 1IFDA 1WT6A 1SQXG 5CBNA 1J1EC 3KZIE 1SQXD 1L0NK 2QJYB 1FZEA 3H25A 5TJHA 1URQC 2R3CA 4JBZA 2KB7P 2FYNB 1PIXA 2WPQA 2AEJA 1NGMB 1CI6B 3CCMP 2OYIB 1NWQA 1HBWA 3L75E 2YIUC 3CWBE 2JWDA 2QJKC 2KNCB 3M0DA 3HTKA 1GL2D 4U3FJ 2BCCE 2B88A 2BASA 2WWWA 3SWYA 2BEZF 2JWAA 1JOCA 2ZFCA 3H1HE 4L74A 2O3JA 5CCHC 1YQ3C 1NTKE 4MN4C 1FOSF 1QL1A 1N7SA 1RF1B 1SQBE 2FY8A 1GMJA 1N73A 1GL2B 2DW3A 1KQGB 2YKPA 3AE3C 4EI2A 3D70A 5CJ0A 2R44A 3V2PA 1GW3A 2K1AA 4GOEA 1K9MQ 1JCCA 1FZBA 1HUCA 1SFCD 4W7YA 3P7KA 4WBAA 2Y9ZA 5CCGC 1KQLA 2Q9IA 2WSSH 4W80A 1NTZK 2ZAEB 3AE1C 4LC1A 1FDOA 1AV1A 2OYHA 2E75D 1EDJA 3CX5D 1KYOI 1LTBC 1BGYG 3ITKA 3B5ND 2Y0DA 1BGYD 2KP8A 1SQPJ 1GDTA 3D71A 1R8EA 3H1JG 1AFOA 4N78D 3AEEC 3MTUE 1NKNA 4K3AA 4D6TD 2QJYC 1M90Q 3IN6A 3E7KA 3CCSP 2KOGA 2FYNC 1EZVG 1S5LH 5H2FE 1Q7YQ 1EZVD 3HUSA 2WITA 3U1AA 2WT7A 3B5NB 3H1KJ 5KLVJ 4R4MA 2OYIC 1JUNA 4NPDA 1M56D 1U57A 3P8MC 1KD1Q 1YBKA 4PD4D 2Q7CA 2FYUK 3MUDC 5GTHE 3L71E 1LTIC 1M1KQ 5AW5B 2H8PD 5TISE 3AE7C 3H1JJ 1IFPA 2Z5IA 1FZCB 3WUUA 3F5HA 1L2PA 2WMMA 2SPZA 2B87A 2IBZI 2KXPB 2WPVB 1LP1A 1M7LA 4WY4D 3WMM0 3S9OA 4L75A 1Y47A 3HE4A 2FKWB 3II6A 2ZJSE 1VQ5P 2KS1A 3AECC 2QSIA 3GF7A 1GZLA 2IX7C 3PHLA 1IC2A 3NFQA 1KYOH 1GK4A 4XA4A 3RBXA 1SQVG 4WY4B 1S4XA 3B71A 1NO4A 1USEA 2OYOA 5KLIC 1R5LA 1E79H 2N9YB 5APUA 2N1TA 1FZGA 3USSA 2E5YA 2K9JB 1QL2A 2ZVNB 4IFMA 2G3AA 3V4WA 5AW4B 2FFDA 1MV8A 3SFDC 1H89A 2CK3H 2KLUA 1Y8AA 2GA1A 1VQLP 1J1DB 1SS1A 2XZRA 1RE4A 1BGYE 3CXHI 3TDKA 5AVWB 3L70D 3Q3DA 4N78E 5KJ7A 2QEXP 2VRSA 1SQVJ 1T2KC 3B5NC 4D6TE 1AVYA 1S72P 2FXPA 5APYA 3M0AA 3V2RA 1JMMA 2W83C 3A0HE 3RK3D 2KSEA 3RBZA 1AQTA 1HWTC 3FWLA 1N7SB 4LGDE 2AXCA 1L0LJ 1LTJA 2WPRA 4PD4E 1SQQJ 2YO3A 3B8EB 3E1IA 1RQUA 4IFFA 1FZCC 3C9IA 4CPGA 4ZKPA 1CZQA 3H1LJ 3VP8A 3P8CD 2L5GB 3L4FA 3RK3B 1FU1A 5E79H 4IFDK 4HJGH 1URQD 1NU1K 1K04A 1L4AA 2YMKA 1HH0A 3PRJA 2B89A 5AW8B 4H0LD 3AE6C 1XTGB 2M8RA 3VN0A 1FC2C 2PFXA 2JDIH 3WUTA 4OVNF 3AE2C 1NTZG 1JY3P 4WY4C 3F89A 3AE8C 1NTMJ 1NTZD 5AVYB 3A7OA 2N9BA 5AVTB 3JC22 1IO4A 3VMYA 3FX0A 4RJTA 4H0LB 1GK6A 2OTKE 2BCCG 5APXA 5CCHD 3LW5J 1SFCA 1W2BO 3H1HG 1PL5A 3H1HD 3EFFK 3U1CA 2HODA 1NTKG 2QJKB 1RQVA 3IAOA 1NTKD 2WT7B 2I1JA 1IK9A 3OW2O 1KQFB 2W6BA 5AW7B 1JO5A 1L0NE 4ZNCA 1NJIQ 3ABVC 4Y99B 3L75J 2FYUG 3L70E 3CWBJ 3VP9A 1BE3D 2FYUD 4XE5B 4TLFA 1ZOYC 2GUSA 4EYYQ 2BCCJ 1VPCA 2YKQA 1Q90D 4KT0J 3PLNA 2B87B 1N7SC 1LP1B 2O1KA 4UB6E 4PV1B 3RK3E 2YMYA 3I5CA 3L74E 1W5CE 3CCRP 2C9LY 2KS1B 3CMEP 1SQBJ 1T6AA 1LT1A 1ZV8A 1CSBA 1PFIA 3RK3C 4BXLA 1M1JA 3FXDA 1OW8A 3GG2A 1R5SA 5AVXB 2NRGA 1J2JB 1OZHA 3P8CE 1OX3A 3M06A 1PGQA 1HGZA 3OA7A 1U7MA 1UIXA 1K05A 2UWJE 1YI2P 3HD7D 2ZXXA 5AVUB 2OYHC 1IFIA 2WSFH 1KTMA 5KTBA 2CPBA 1LTGC 4H0LC 2NPSA 1LTSC 3L71G 1NTZE 1KZUB 3L71D 3HD7B 4RESB 1OVVA 4NPEA 3O6QA 2R32A 4Y28J 1EXJA 1NAFA 3G9RA 1IFNA 5KAFH 1DD3A 2Y0EA 1IK7A 3IR9A 3RK2D 1N2DC 4I1LA 5B66H 2O01J 4K35A 1SQXJ 2HR3A 1DX7A 5AW0B 3AEDC 1YJ9P 4Y99C 1HJ0A 2E42A 1QX8A 2RMZA 5APSA 1NTMK 4YXDC 4UB8H 2IFNA 2O1JA 2IDBA 3RK2B 3MIWA 2R5BA 3CCEP 3L71J 1T3JA 1QLED 5B66E 1EDLA 2KLVA 3GHGB 3CC2P 1K73Q 2K37A 1BE3E 2FYUE 4C7RA 1YYCA 4PV1C 2IZ1A 1PGOA 1H8AA 2C9NY 1JTHB 1U7JA 3MGNA 3H32A 1KYOD 5L8RJ 1Y9BA 5KLIB 2Q1KA 1LWUA 4WVZA 1KILD 1NU1D 4A7PA 1FOSE 2KIKA 3S1KA 2YXQB 1T2KD 3N7NA 1LTAC 1CW5A 2J5UA 1OIPA 3ZDMA 1VDFA 2AEFA 2Y9YA 3M9HA 4OWFA 3BATA 3AEBC 3MHVA 3A0BH 2HPCB 2K9YA 4L73A 3G6EP 4D6TG 4YXWH 4JF7A 1FJKA 2H88C 1KILB 3A5TA 2YNYA 2WSEJ 1FE6A 2Q3IA 1KB9I 2P2UA 3AE9C 3FGAD 1T8ZA 4GODA 3GF3A 3CX5I 4U3FE 1Z56A 2JJLA 1JY2N 1RE4C 3HD7C 1JCDA 1DIPA 1KFNA 3L72G 2YXRB 2AXTH 3L72D 2HLOA 5KJ7C 1GU4A 1EC5A 1S5LE 3EFGA 1BGYJ 1AQ5A 1VQOP 1N86A 2Q5UA 5BU8B 3AEGC 2J58A 1EZVI 3CI9A 3CLQA 4D6TJ 3CCVP 1K8AQ 3KQGA 2AXTE 3Q5RA 1PGJA 3MD0A 1ZP0C 1PZQA 3R4YA 4JYCA 2MKVA 2IFMA 3RK2C 1PV3A 2MJZA 1WRGA 3CC4P 2Y0CA 4HYTB 3GHGC 2WVRA 2W8ZA 1YITP 4M3LA 1HJBA 3E1RA 5KAIH 5CCGA 2ZT9D 2I8DA 4BRYA 1EDKA 3BCCG 3M9QA 1LT9B 1OMIA 1DH3A 2H89C 3BCCD 4DZOA 1KORA 1G2CA 1NH4A 1YHQP 1DEBA 1LNQA 3TNUB 2C0XA 5AW2B 3WUVA 2WTYA 1KYOE 2M3EA 1KB9H 2OTJP 2K88A 2LR2A 1SQXK 3RL0C 2P58A 3D6YA 2M5AA 3BRVB 2ZT9B 1PGPA 1JY2O 1KILE 1NU1E 1KMIZ 1XTCC 1L0NG 1L0ND 2NPSB 1VQPP 1A02J 1T3UA 3L36A 3L70G 1KILC 2QM8A 3I55P 4C46A 1RE3A 3AE5C 1N7SD 1S5LX 3KXDA 1AJYA 3HTKB 2V7QJ 1CI6A 1LTTC 5AVQB 2LXCB 3G4SP 3L35A 4ASWA 1NYHA 3Q5SA 5BU5A 5K5GB 3B4SA 1YIJP 2KNCA 3FXEA 3L74G 1MKMA 2Z5HA 3L74D 1VQ8P 1NVOA 2FXMA 2AEMA 1P84I 1N73B 3L72E 2WZ7A 4N6JA 1L0NJ 1DD4A 2P10A 4I6MC 1SQPK 2JO1A 1MFTA 1RF1A 3TGUG 2IBZE 3L70J 2XNXA 4LLHA 3H1ID 3TGUD 1GL2A 2IYOA 1ZR2A 4WWIA 3GLMA 1FZFA 1HF9A 1N8RQ 3H32B 5APTA 4GIFA 4GDOA 2WSCJ 3L73E 5KLVK 1PP9G 3OAKA 2G8YA 2BEQD 1PP9D 1KFMA 5EFWB 5E79E 2OTLP 1RF0A 3HE5A 2OYHB 5DJUB 1LT9C 4ZMDA 2A45I 3Q2YA 1PPJG 3TF5A 1JM0A 1PPJD 2W90A 5C39A 2KZIA 3CXHH 3G3ZA 1H0TA 3BCCE 4EDFA 4IOIH 2D2CD 1JB0J 1HVVA 2ZT9C 1S2EA 3JCUH 4EIJA 1OVRA 4WB4A 2Q6QA 2KK7A 3KYQA 2NPSC 3HUSB 4AQRD 2HG5D 3VMXA 3W67A 4IL6H 3T97A 3CXHE 3RL0g 2XKMA 3H6PA 3VTPC 1NTZJ 1X22A 3M0DC 3Q5PA 3WU2H 3B5NA 1P84H 2D2CB 4PV1D 4DCKA 2XDJA 5APWA 4AUWA 2HFED 1BE3G 1OXZA 5CMZA 1Q81Q 4IL6E 4OGQB 2H7HA 3PH0A 4ZKUA 1S9KD 1ZLLA 1MUUA 3H1LE 3H1HJ 1X8YA 1N73C 1NTKJ 1BCCG 2QA4P 3HE4B 1NOHA 1FZCA 1BCCD 3SWKA 2QG4A 4H13B 3CCQP 2R5DA 1D7MA 5APQA 3V2QA 5CBOA 3PJSK 4U7JA 3LW5H 2A45H 1SP4A 1IFMA 1NTME 1VQKP 3TGUE 3H1IE 1BE3J 2FYUJ 1SQVK 2POHA 4AYCA 2R3SA 4I2LC 4WY4A 4YTPC 2N1TB 4U3FG 3IFMA 2GUVA 4U3FD 5KJ7D 3K5BA 1Q86Q 3PTZA 3G71P 3D6ZA 2RN0A 2E43A 1X0TA 1S1CX 1PP9E 2FYZA 2YKOA 1L0LK 2FFDB 2QVAA 4H44B 1KV4A 2E76C 2L91A 1SQQK 2K9JA 1WMKA 2ZYGA 1ZMEC 2ZVOB 1PPJE 2H43A 2JR8A 2JP3A 3VMAA 3CPWO 1USDA 1RHZB 3HUSC 1VF5B 4IL6X 2OARA 3W68A 1UIIA 4HB1A 2O01N 4GT1A 1IJDB 3NTNA 3VYIA 2D2CC 2PRRA 3IF4A 1E5WA 3O8ZA 3Q1MA 1VQNP 5KAFE 1LTJB 1L4AD 1NHLA 4OGQC 4C7NA 3P32A 1GTWA 4BWNA 4PJ0H 3KHUA 2OGUA 1SQPG 3OJAB 3V2NA 3RL0D 1SQPD 4KJMA 3I56P 1S9KE 4UB8E 1L4AB 4H13C 3KPEA 1MFZA 4PJ0E 1AVOA 1NU1G 1BCCE 1EDIA 1IFJA 3HE5B 4JQ0D 3H1KG 5KLVG 1QEXA 3RL0B 3H1KD 5KLVD 3AE4C 1KB9D 1OW6A 4RKUJ 3R2PA 1EQ7A 1GU5A 3L37A 3UIAA 1M57D 2YO2A 1BDCA 2N1TC 2RKLA 5KKZC 4O9BA 1H0TB 3QWOC 1W2EA 1SFCB 2A06G 2O01H 5H2FH 1KN7A 1N7LA 1URQA 2C0WA 3A2AA 2A06D 2HODB 5GTIH 3TYYA 2FFDC 4H44C 3H1JD 4OH8B 2KSJA 3CC7P 3PP5A 1NTKK 3T97B 3A0BE 2QJPB 4HH2A 3A3YB 1RE3C 1NU1J 5GTHH 1SQBK 1FS0E 1G1JA 2E75B 3CL3D 2IZ0A 5TISH 1SQXE 1X9VA 1HTLC 2IBZG 4ASVA 1VF5C 3V5BA 2HYNA 5B5EH 5GTIE 2IBZD 2KUBA 5CCHA 2LKMA 1JY3N 1ZN5A 2ITAA 1BSHA 2GM4A 1DEEG 5AW3B 1LGHB 3L73G 1LTJC 2NZ2A 4PD4I 3L73D 2PAJA 5B5EE 2OQQA 5AW1B 3SFEC 1RF1C 3AEAC 3MZWB 1X79B 3L72J 1GL2C 1M1JB 3FWNA 2ZYDA 2KYVA 2E74D 2J59M 4GOFA 1KC8Q 3LIEA 1OVUA 5AVSB 1L4AC 4XFJA 2ZXEB 2WSEH 2NPSD 2IPPA 2ZYAA 2XNDH 3GMAA 1NAYA 1SQPE 3QH9A 1ZRTD 1HGVA 1RF0C 2XV5A 1BDDA 1SQVD 1YTZI 3CCLP 2E74B 5KAIE 1OW7A 3L73J 2M3BA 3CXHD 2PP6A 3NMDA 3CX5H 2P1JA 1Q2NA 3EWKA 4YPCA 2E5TA 1FZAA 3TK1A 1VQ4P 1FJPA 3H1KE 5KLVE 1ZXGA 1SFCC 1FDIA 1L0LG 1L0LD 1KB9E 1NKZB 1SQQG 3O6QB 1BSNA 4B86A 1SQQD 1VQMP 3BCCJ 3CX5E 1JY3O 3H1LG 2OYIA 2WPSA 3A0HH 3H1LD 5DJTB 3HD7A 1SLQA 2A06E 2QJPC
chains in the Genus database with same CATH topology
2I8DA 4NPDA 2B87B 2QVAA 1EDKA 1EDIA 1LP1B 1MFTA 2K3RA 1FC2C 2KZJA 2KI7B 3MZWB 4K35A 2R44A 2HR3A 2KS1B 3PH0A 1SS1A 4GODA 4WWIA 3RGUA 2M5AB 4GOEA 4GOFA 1LT1A 1BDCA 4NPFX 1OVUA 2RKLA 2LR2A 4BXLA 1H0TB 3QWOC 2QRXA 2P58A 3FXDA 5CBNA 2M5AA 2WMMA 2OTKE 4HB1A 2SPZA 2B87A 1S3JA 1EC5A 1EDLA 2ZAEB 5EFWB 1LP1A 4JBZA 1ZW0A 5DJUB 1U7MA 1Y47A 4HKZH 4ZMDA 1BDDA 2UWJE 2LXBA 1EDJA 2M0BA 1JM0A 1U7JA 5CBOA 5C39A 2KZIA 1Q2NA 2JWDA 1H0TA 2LXCB 2Q1KA 4ASVA 4IOIH 4ASWA 2B88A 1ZXGA 4CPGA 4ZNCA 5K5GB 2KUBA 4K3AA 2KIKA 3FXEA 3S1KA 1OVRA 4KJMA 1NVOA 1OVVA 3ZDMA 4NPEA 1DEEG 1JMBA 4HJGH 4MN4C 4EYYQ 3MHVA 5DJTB 1X0TA 2B89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I8D A;  4NPD A;  2B87 B;  2QVA A;  1EDK A;  1EDI A;  1LP1 B;  1MFT A;  2K3R A;  1FC2 C;  2KZJ A;  2KI7 B;  3MZW B;  4K35 A;  2R44 A;  2HR3 A;  2KS1 B;  3PH0 A;  1SS1 A;  4GOD A;  4WWI A;  3RGU A;  2M5A B;  4GOE A;  4GOF A;  1LT1 A;  1BDC A;  4NPF X;  1OVU A;  2RKL A;  2LR2 A;  4BXL A;  1H0T B;  3QWO C;  2QRX A;  2P58 A;  3FXD A;  5CBN A;  2M5A A;  2WMM A;  2OTK E;  4HB1 A;  2SPZ A;  2B87 A;  1S3J A;  1EC5 A;  1EDL A;  2ZAE B;  5EFW B;  1LP1 A;  4JBZ A;  1ZW0 A;  5DJU B;  1U7M A;  1Y47 A;  4HKZ H;  4ZMD A;  1BDD A;  2UWJ E;  2LXB A;  1EDJ A;  2M0B A;  1JM0 A;  1U7J A;  5CBO A;  5C39 A;  2KZI A;  1Q2N A;  2JWD A;  1H0T A;  2LXC B;  2Q1K A;  4ASV A;  4IOI H;  4ASW A;  2B88 A;  1ZXG A;  4CPG A;  4ZNC A;  5K5G B;  2KUB A;  4K3A A;  2KIK A;  3FXE A;  3S1K A;  1OVR A;  4KJM A;  1NVO A;  1OVV A;  3ZDM A;  4NPE A;  1DEE G;  1JMB A;  4HJG H;  4MN4 C;  4EYY Q;  3MHV A;  5DJT B;  1X0T A;  2B89 A; 
#chains in the Genus database with same CATH topology
 1P84 D;  3LID A;  2E75 C;  2QM7 A;  3SWF A;  3CD6 P;  3H1J E;  2K3R A;  3MUD A;  4L76 A;  4KHX A;  4PD4 H;  1RY3 A;  2FXO A;  3CCU P;  1QVG O;  4TT3 H;  1MZ9 A;  3JSV C;  1EZV E;  4C7N B;  3M9B A;  1NTM G;  3U59 A;  1VL2 A;  1YQ4 C;  3H1I G;  3M91 A;  1GW4 A;  1NTM D;  1A02 F;  1OFC X;  3NXS A;  1GD2 E;  4Z1M H;  3GHG A;  2A45 G;  5CHX A;  2E76 D;  3GW6 A;  1Q82 Q;  1JY2 P;  3C8V A;  3KDP B;  1M1J C;  1LWU B;  3L74 J;  1JTH A;  1QGK B;  4I7Z B;  5M1B A;  1G1I A;  3SSU A;  2XU6 A;  2P7J A;  3BRT B;  1OWA A;  1TU3 F;  4DT0 A;  2V7Q H;  3HRN A;  5AW6 B;  2E76 B;  1J1E B;  3TGU J;  3H1I J;  2E74 C;  2W6J H;  3BAS A;  3L75 G;  2CPS A;  1EXI A;  1URQ B;  3CWB G;  3N4X A;  3L75 D;  1ZRT E;  3CWB D;  1IZN B;  5AVV B;  2HPC A;  2KZJ A;  1SQV E;  4OGQ D;  2BCC D;  3CMA P;  1KIL A;  5AW9 B;  1FAV A;  2QE7 H;  2YIU B;  4JYB A;  1PP9 J;  3BVH A;  4NPF X;  3TSI A;  3AEF C;  1FBM A;  1M8O B;  3V4Q A;  2IYP A;  3JCU E;  1VQ7 P;  1SQB G;  1VQ6 P;  1J1D C;  1SQB D;  1S3J A;  1LJ2 A;  1L0L E;  2JEE A;  2WQY C;  4H13 D;  2WSF J;  1SQQ E;  4N3Y B;  1ZW0 A;  4HKZ H;  3S4R A;  2Z4E A;  1QVF O;  2LXB A;  5AVR B;  4UB6 H;  2WSC H;  4RO0 A;  1H88 A;  4W7Z A;  2M0B A;  3WU2 E;  5CCG D;  1P84 E;  3C1L A;  2QIW A;  4QMA A;  5CJ4 A;  1JNM A;  3VOP A;  2P67 A;  4JPZ B;  4DOJ A;  4DJG A;  2Q3E A;  3CCJ P;  4R4L A;  2V4H A;  5AVZ B;  2N1T D;  1KQS O;  5BVZ A;  1JEK A;  2I1K A;  1YJN P;  1JMB A;  3VMZ A;  2JKV A;  1FDM A;  4BRY B;  1ZR4 A;  4EOT A;  4H44 D;  3MP7 B;  1G2C B;  2B9B A;  1SVF A;  3V6I A;  1YTZ T;  1LWU C;  3KZI H;  2W6A A;  4I7Z C;  3EQ2 A;  1AA0 A;  2KI7 B;  5KKZ B;  1LT9 A;  2FBW C;  2W27 A;  4GKG A;  1YJW P;  3RGU A;  5APV A;  2M5A B;  2PGD A;  1VF5 D;  1BCC J;  3TNU A;  1VQ9 P;  1RH5 B;  2RH0 A;  2QRX A;  1IFD A;  1WT6 A;  1SQX G;  5CBN A;  1J1E C;  3KZI E;  1SQX D;  1L0N K;  2QJY B;  1FZE A;  3H25 A;  5TJH A;  1URQ C;  2R3C A;  4JBZ A;  2KB7 P;  2FYN B;  1PIX A;  2WPQ A;  2AEJ A;  1NGM B;  1CI6 B;  3CCM P;  2OYI B;  1NWQ A;  1HBW A;  3L75 E;  2YIU C;  3CWB E;  2JWD A;  2QJK C;  2KNC B;  3M0D A;  3HTK A;  1GL2 D;  4U3F J;  2BCC E;  2B88 A;  2BAS A;  2WWW A;  3SWY A;  2BEZ F;  2JWA A;  1JOC A;  2ZFC A;  3H1H E;  4L74 A;  2O3J A;  5CCH C;  1YQ3 C;  1NTK E;  4MN4 C;  1FOS F;  1QL1 A;  1N7S A;  1RF1 B;  1SQB E;  2FY8 A;  1GMJ A;  1N73 A;  1GL2 B;  2DW3 A;  1KQG B;  2YKP A;  3AE3 C;  4EI2 A;  3D70 A;  5CJ0 A;  2R44 A;  3V2P A;  1GW3 A;  2K1A A;  4GOE A;  1K9M Q;  1JCC A;  1FZB A;  1HUC A;  1SFC D;  4W7Y A;  3P7K A;  4WBA A;  2Y9Z A;  5CCG C;  1KQL A;  2Q9I A;  2WSS H;  4W80 A;  1NTZ K;  2ZAE B;  3AE1 C;  4LC1 A;  1FDO A;  1AV1 A;  2OYH A;  2E75 D;  1EDJ A;  3CX5 D;  1KYO I;  1LTB C;  1BGY G;  3ITK A;  3B5N D;  2Y0D A;  1BGY D;  2KP8 A;  1SQP J;  1GDT A;  3D71 A;  1R8E A;  3H1J G;  1AFO A;  4N78 D;  3AEE C;  3MTU E;  1NKN A;  4K3A A;  4D6T D;  2QJY C;  1M90 Q;  3IN6 A;  3E7K A;  3CCS P;  2KOG A;  2FYN C;  1EZV G;  1S5L H;  5H2F E;  1Q7Y Q;  1EZV D;  3HUS A;  2WIT A;  3U1A A;  2WT7 A;  3B5N B;  3H1K J;  5KLV J;  4R4M A;  2OYI C;  1JUN A;  4NPD A;  1M56 D;  1U57 A;  3P8M C;  1KD1 Q;  1YBK A;  4PD4 D;  2Q7C A;  2FYU K;  3MUD C;  5GTH E;  3L71 E;  1LTI C;  1M1K Q;  5AW5 B;  2H8P D;  5TIS E;  3AE7 C;  3H1J J;  1IFP A;  2Z5I A;  1FZC B;  3WUU A;  3F5H A;  1L2P A;  2WMM A;  2SPZ A;  2B87 A;  2IBZ I;  2KXP B;  2WPV B;  1LP1 A;  1M7L A;  4WY4 D;  3WMM 0;  3S9O A;  4L75 A;  1Y47 A;  3HE4 A;  2FKW B;  3II6 A;  2ZJS E;  1VQ5 P;  2KS1 A;  3AEC C;  2QSI A;  3GF7 A;  1GZL A;  2IX7 C;  3PHL A;  1IC2 A;  3NFQ A;  1KYO H;  1GK4 A;  4XA4 A;  3RBX A;  1SQV G;  4WY4 B;  1S4X A;  3B71 A;  1NO4 A;  1USE A;  2OYO A;  5KLI C;  1R5L A;  1E79 H;  2N9Y B;  5APU A;  2N1T A;  1FZG A;  3USS A;  2E5Y A;  2K9J B;  1QL2 A;  2ZVN B;  4IFM A;  2G3A A;  3V4W A;  5AW4 B;  2FFD A;  1MV8 A;  3SFD C;  1H89 A;  2CK3 H;  2KLU A;  1Y8A A;  2GA1 A;  1VQL P;  1J1D B;  1SS1 A;  2XZR A;  1RE4 A;  1BGY E;  3CXH I;  3TDK A;  5AVW B;  3L70 D;  3Q3D A;  4N78 E;  5KJ7 A;  2QEX P;  2VRS A;  1SQV J;  1T2K C;  3B5N C;  4D6T E;  1AVY A;  1S72 P;  2FXP A;  5APY A;  3M0A A;  3V2R A;  1JMM A;  2W83 C;  3A0H E;  3RK3 D;  2KSE A;  3RBZ A;  1AQT A;  1HWT C;  3FWL A;  1N7S B;  4LGD E;  2AXC A;  1L0L J;  1LTJ A;  2WPR A;  4PD4 E;  1SQQ J;  2YO3 A;  3B8E B;  3E1I A;  1RQU A;  4IFF A;  1FZC C;  3C9I A;  4CPG A;  4ZKP A;  1CZQ A;  3H1L J;  3VP8 A;  3P8C D;  2L5G B;  3L4F A;  3RK3 B;  1FU1 A;  5E79 H;  4IFD K;  4HJG H;  1URQ D;  1NU1 K;  1K04 A;  1L4A A;  2YMK A;  1HH0 A;  3PRJ A;  2B89 A;  5AW8 B;  4H0L D;  3AE6 C;  1XTG B;  2M8R A;  3VN0 A;  1FC2 C;  2PFX A;  2JDI H;  3WUT A;  4OVN F;  3AE2 C;  1NTZ G;  1JY3 P;  4WY4 C;  3F89 A;  3AE8 C;  1NTM J;  1NTZ D;  5AVY B;  3A7O A;  2N9B A;  5AVT B;  3JC2 2;  1IO4 A;  3VMY A;  3FX0 A;  4RJT A;  4H0L B;  1GK6 A;  2OTK E;  2BCC G;  5APX A;  5CCH D;  3LW5 J;  1SFC A;  1W2B O;  3H1H G;  1PL5 A;  3H1H D;  3EFF K;  3U1C A;  2HOD A;  1NTK G;  2QJK B;  1RQV A;  3IAO A;  1NTK D;  2WT7 B;  2I1J A;  1IK9 A;  3OW2 O;  1KQF B;  2W6B A;  5AW7 B;  1JO5 A;  1L0N E;  4ZNC A;  1NJI Q;  3ABV C;  4Y99 B;  3L75 J;  2FYU G;  3L70 E;  3CWB J;  3VP9 A;  1BE3 D;  2FYU D;  4XE5 B;  4TLF A;  1ZOY C;  2GUS A;  4EYY Q;  2BCC J;  1VPC A;  2YKQ A;  1Q90 D;  4KT0 J;  3PLN A;  2B87 B;  1N7S C;  1LP1 B;  2O1K A;  4UB6 E;  4PV1 B;  3RK3 E;  2YMY A;  3I5C A;  3L74 E;  1W5C E;  3CCR P;  2C9L Y;  2KS1 B;  3CME P;  1SQB J;  1T6A A;  1LT1 A;  1ZV8 A;  1CSB A;  1PFI A;  3RK3 C;  4BXL A;  1M1J A;  3FXD A;  1OW8 A;  3GG2 A;  1R5S A;  5AVX B;  2NRG A;  1J2J B;  1OZH A;  3P8C E;  1OX3 A;  3M06 A;  1PGQ A;  1HGZ A;  3OA7 A;  1U7M A;  1UIX A;  1K05 A;  2UWJ E;  1YI2 P;  3HD7 D;  2ZXX A;  5AVU B;  2OYH C;  1IFI A;  2WSF H;  1KTM A;  5KTB A;  2CPB A;  1LTG C;  4H0L C;  2NPS A;  1LTS C;  3L71 G;  1NTZ E;  1KZU B;  3L71 D;  3HD7 B;  4RES B;  1OVV A;  4NPE A;  3O6Q A;  2R32 A;  4Y28 J;  1EXJ A;  1NAF A;  3G9R A;  1IFN A;  5KAF H;  1DD3 A;  2Y0E A;  1IK7 A;  3IR9 A;  3RK2 D;  1N2D C;  4I1L A;  5B66 H;  2O01 J;  4K35 A;  1SQX J;  2HR3 A;  1DX7 A;  5AW0 B;  3AED C;  1YJ9 P;  4Y99 C;  1HJ0 A;  2E42 A;  1QX8 A;  2RMZ A;  5APS A;  1NTM K;  4YXD C;  4UB8 H;  2IFN A;  2O1J A;  2IDB A;  3RK2 B;  3MIW A;  2R5B A;  3CCE P;  3L71 J;  1T3J A;  1QLE D;  5B66 E;  1EDL A;  2KLV A;  3GHG B;  3CC2 P;  1K73 Q;  2K37 A;  1BE3 E;  2FYU E;  4C7R A;  1YYC A;  4PV1 C;  2IZ1 A;  1PGO A;  1H8A A;  2C9N Y;  1JTH B;  1U7J A;  3MGN A;  3H32 A;  1KYO D;  5L8R J;  1Y9B A;  5KLI B;  2Q1K A;  1LWU A;  4WVZ A;  1KIL D;  1NU1 D;  4A7P A;  1FOS E;  2KIK A;  3S1K A;  2YXQ B;  1T2K D;  3N7N A;  1LTA C;  1CW5 A;  2J5U A;  1OIP A;  3ZDM A;  1VDF A;  2AEF A;  2Y9Y A;  3M9H A;  4OWF A;  3BAT A;  3AEB C;  3MHV A;  3A0B H;  2HPC B;  2K9Y A;  4L73 A;  3G6E P;  4D6T G;  4YXW H;  4JF7 A;  1FJK A;  2H88 C;  1KIL B;  3A5T A;  2YNY A;  2WSE J;  1FE6 A;  2Q3I A;  1KB9 I;  2P2U A;  3AE9 C;  3FGA D;  1T8Z A;  4GOD A;  3GF3 A;  3CX5 I;  4U3F E;  1Z56 A;  2JJL A;  1JY2 N;  1RE4 C;  3HD7 C;  1JCD A;  1DIP A;  1KFN A;  3L72 G;  2YXR B;  2AXT H;  3L72 D;  2HLO A;  5KJ7 C;  1GU4 A;  1EC5 A;  1S5L E;  3EFG A;  1BGY J;  1AQ5 A;  1VQO P;  1N86 A;  2Q5U A;  5BU8 B;  3AEG C;  2J58 A;  1EZV I;  3CI9 A;  3CLQ A;  4D6T J;  3CCV P;  1K8A Q;  3KQG A;  2AXT E;  3Q5R A;  1PGJ A;  3MD0 A;  1ZP0 C;  1PZQ A;  3R4Y A;  4JYC A;  2MKV A;  2IFM A;  3RK2 C;  1PV3 A;  2MJZ A;  1WRG A;  3CC4 P;  2Y0C A;  4HYT B;  3GHG C;  2WVR A;  2W8Z A;  1YIT P;  4M3L A;  1HJB A;  3E1R A;  5KAI H;  5CCG A;  2ZT9 D;  2I8D A;  4BRY A;  1EDK A;  3BCC G;  3M9Q A;  1LT9 B;  1OMI A;  1DH3 A;  2H89 C;  3BCC D;  4DZO A;  1KOR A;  1G2C A;  1NH4 A;  1YHQ P;  1DEB A;  1LNQ A;  3TNU B;  2C0X A;  5AW2 B;  3WUV A;  2WTY A;  1KYO E;  2M3E A;  1KB9 H;  2OTJ P;  2K88 A;  2LR2 A;  1SQX K;  3RL0 C;  2P58 A;  3D6Y A;  2M5A A;  3BRV B;  2ZT9 B;  1PGP A;  1JY2 O;  1KIL E;  1NU1 E;  1KMI Z;  1XTC C;  1L0N G;  1L0N D;  2NPS B;  1VQP P;  1A02 J;  1T3U A;  3L36 A;  3L70 G;  1KIL C;  2QM8 A;  3I55 P;  4C46 A;  1RE3 A;  3AE5 C;  1N7S D;  1S5L X;  3KXD A;  1AJY A;  3HTK B;  2V7Q J;  1CI6 A;  1LTT C;  5AVQ B;  2LXC B;  3G4S P;  3L35 A;  4ASW A;  1NYH A;  3Q5S A;  5BU5 A;  5K5G B;  3B4S A;  1YIJ P;  2KNC A;  3FXE A;  3L74 G;  1MKM A;  2Z5H A;  3L74 D;  1VQ8 P;  1NVO A;  2FXM A;  2AEM A;  1P84 I;  1N73 B;  3L72 E;  2WZ7 A;  4N6J A;  1L0N J;  1DD4 A;  2P10 A;  4I6M C;  1SQP K;  2JO1 A;  1MFT A;  1RF1 A;  3TGU G;  2IBZ E;  3L70 J;  2XNX A;  4LLH A;  3H1I D;  3TGU D;  1GL2 A;  2IYO A;  1ZR2 A;  4WWI A;  3GLM A;  1FZF A;  1HF9 A;  1N8R Q;  3H32 B;  5APT A;  4GIF A;  4GDO A;  2WSC J;  3L73 E;  5KLV K;  1PP9 G;  3OAK A;  2G8Y A;  2BEQ D;  1PP9 D;  1KFM A;  5EFW B;  5E79 E;  2OTL P;  1RF0 A;  3HE5 A;  2OYH B;  5DJU B;  1LT9 C;  4ZMD A;  2A45 I;  3Q2Y A;  1PPJ G;  3TF5 A;  1JM0 A;  1PPJ D;  2W90 A;  5C39 A;  2KZI A;  3CXH H;  3G3Z A;  1H0T A;  3BCC E;  4EDF A;  4IOI H;  2D2C D;  1JB0 J;  1HVV A;  2ZT9 C;  1S2E A;  3JCU H;  4EIJ A;  1OVR A;  4WB4 A;  2Q6Q A;  2KK7 A;  3KYQ A;  2NPS C;  3HUS B;  4AQR D;  2HG5 D;  3VMX A;  3W67 A;  4IL6 H;  3T97 A;  3CXH E;  3RL0 g;  2XKM A;  3H6P A;  3VTP C;  1NTZ J;  1X22 A;  3M0D C;  3Q5P A;  3WU2 H;  3B5N A;  1P84 H;  2D2C B;  4PV1 D;  4DCK A;  2XDJ A;  5APW A;  4AUW A;  2HFE D;  1BE3 G;  1OXZ A;  5CMZ A;  1Q81 Q;  4IL6 E;  4OGQ B;  2H7H A;  3PH0 A;  4ZKU A;  1S9K D;  1ZLL A;  1MUU A;  3H1L E;  3H1H J;  1X8Y A;  1N73 C;  1NTK J;  1BCC G;  2QA4 P;  3HE4 B;  1NOH A;  1FZC A;  1BCC D;  3SWK A;  2QG4 A;  4H13 B;  3CCQ P;  2R5D A;  1D7M A;  5APQ A;  3V2Q A;  5CBO A;  3PJS K;  4U7J A;  3LW5 H;  2A45 H;  1SP4 A;  1IFM A;  1NTM E;  1VQK P;  3TGU E;  3H1I E;  1BE3 J;  2FYU J;  1SQV K;  2POH A;  4AYC A;  2R3S A;  4I2L C;  4WY4 A;  4YTP C;  2N1T B;  4U3F G;  3IFM A;  2GUV A;  4U3F D;  5KJ7 D;  3K5B A;  1Q86 Q;  3PTZ A;  3G71 P;  3D6Z A;  2RN0 A;  2E43 A;  1X0T A;  1S1C X;  1PP9 E;  2FYZ A;  2YKO A;  1L0L K;  2FFD B;  2QVA A;  4H44 B;  1KV4 A;  2E76 C;  2L91 A;  1SQQ K;  2K9J A;  1WMK A;  2ZYG A;  1ZME C;  2ZVO B;  1PPJ E;  2H43 A;  2JR8 A;  2JP3 A;  3VMA A;  3CPW O;  1USD A;  1RHZ B;  3HUS C;  1VF5 B;  4IL6 X;  2OAR A;  3W68 A;  1UII A;  4HB1 A;  2O01 N;  4GT1 A;  1IJD B;  3NTN A;  3VYI A;  2D2C C;  2PRR A;  3IF4 A;  1E5W A;  3O8Z A;  3Q1M A;  1VQN P;  5KAF E;  1LTJ B;  1L4A D;  1NHL A;  4OGQ C;  4C7N A;  3P32 A;  1GTW A;  4BWN A;  4PJ0 H;  3KHU A;  2OGU A;  1SQP G;  3OJA B;  3V2N A;  3RL0 D;  1SQP D;  4KJM A;  3I56 P;  1S9K E;  4UB8 E;  1L4A B;  4H13 C;  3KPE A;  1MFZ A;  4PJ0 E;  1AVO A;  1NU1 G;  1BCC E;  1EDI A;  1IFJ A;  3HE5 B;  4JQ0 D;  3H1K G;  5KLV G;  1QEX A;  3RL0 B;  3H1K D;  5KLV D;  3AE4 C;  1KB9 D;  1OW6 A;  4RKU J;  3R2P A;  1EQ7 A;  1GU5 A;  3L37 A;  3UIA A;  1M57 D;  2YO2 A;  1BDC A;  2N1T C;  2RKL A;  5KKZ C;  4O9B A;  1H0T B;  3QWO C;  1W2E A;  1SFC B;  2A06 G;  2O01 H;  5H2F H;  1KN7 A;  1N7L A;  1URQ A;  2C0W A;  3A2A A;  2A06 D;  2HOD B;  5GTI H;  3TYY A;  2FFD C;  4H44 C;  3H1J D;  4OH8 B;  2KSJ A;  3CC7 P;  3PP5 A;  1NTK K;  3T97 B;  3A0B E;  2QJP B;  4HH2 A;  3A3Y B;  1RE3 C;  1NU1 J;  5GTH H;  1SQB K;  1FS0 E;  1G1J A;  2E75 B;  3CL3 D;  2IZ0 A;  5TIS H;  1SQX E;  1X9V A;  1HTL C;  2IBZ G;  4ASV A;  1VF5 C;  3V5B A;  2HYN A;  5B5E H;  5GTI E;  2IBZ D;  2KUB A;  5CCH A;  2LKM A;  1JY3 N;  1ZN5 A;  2ITA A;  1BSH A;  2GM4 A;  1DEE G;  5AW3 B;  1LGH B;  3L73 G;  1LTJ C;  2NZ2 A;  4PD4 I;  3L73 D;  2PAJ A;  5B5E E;  2OQQ A;  5AW1 B;  3SFE C;  1RF1 C;  3AEA C;  3MZW B;  1X79 B;  3L72 J;  1GL2 C;  1M1J B;  3FWN A;  2ZYD A;  2KYV A;  2E74 D;  2J59 M;  4GOF A;  1KC8 Q;  3LIE A;  1OVU A;  5AVS B;  1L4A C;  4XFJ A;  2ZXE B;  2WSE H;  2NPS D;  2IPP A;  2ZYA A;  2XND H;  3GMA A;  1NAY A;  1SQP E;  3QH9 A;  1ZRT D;  1HGV A;  1RF0 C;  2XV5 A;  1BDD A;  1SQV D;  1YTZ I;  3CCL P;  2E74 B;  5KAI E;  1OW7 A;  3L73 J;  2M3B A;  3CXH D;  2PP6 A;  3NMD A;  3CX5 H;  2P1J A;  1Q2N A;  3EWK A;  4YPC A;  2E5T A;  1FZA A;  3TK1 A;  1VQ4 P;  1FJP A;  3H1K E;  5KLV E;  1ZXG A;  1SFC C;  1FDI A;  1L0L G;  1L0L D;  1KB9 E;  1NKZ B;  1SQQ G;  3O6Q B;  1BSN A;  4B86 A;  1SQQ D;  1VQM P;  3BCC J;  3CX5 E;  1JY3 O;  3H1L G;  2OYI A;  2WPS A;  3A0H H;  3H1L D;  5DJT B;  3HD7 A;  1SLQ A;  2A06 E;  2QJP C; 
#chains in the Genus database with same CATH homology
 2I8D A;  4NPD A;  2B87 B;  2QVA A;  1EDK A;  1EDI A;  1LP1 B;  1MFT A;  2K3R A;  1FC2 C;  2KZJ A;  2KI7 B;  3MZW B;  4K35 A;  2R44 A;  2HR3 A;  2KS1 B;  3PH0 A;  1SS1 A;  4GOD A;  4WWI A;  3RGU A;  2M5A B;  4GOE A;  4GOF A;  1LT1 A;  1BDC A;  4NPF X;  1OVU A;  2RKL A;  2LR2 A;  4BXL A;  1H0T B;  3QWO C;  2QRX A;  2P58 A;  3FXD A;  5CBN A;  2M5A A;  2WMM A;  2OTK E;  4HB1 A;  2SPZ A;  2B87 A;  1S3J A;  1EC5 A;  1EDL A;  2ZAE B;  5EFW B;  1LP1 A;  4JBZ A;  1ZW0 A;  5DJU B;  1U7M A;  1Y47 A;  4HKZ H;  4ZMD A;  1BDD A;  2UWJ E;  2LXB A;  1EDJ A;  2M0B A;  1JM0 A;  1U7J A;  5CBO A;  5C39 A;  2KZI A;  1Q2N A;  2JWD A;  1H0T A;  2LXC B;  2Q1K A;  4ASV A;  4IOI H;  4ASW A;  2B88 A;  1ZXG A;  4CPG A;  4ZNC A;  5K5G B;  2KUB A;  4K3A A;  2KIK A;  3FXE A;  3S1K A;  1OVR A;  4KJM A;  1NVO A;  1OVV A;  3ZDM A;  4NPE A;  1DEE G;  1JMB A;  4HJG H;  4MN4 C;  4EYY Q;  3MHV A;  5DJT B;  1X0T A;  2B89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...