4WWIA

Crystal structure of the c domain of staphylococcal protein a in complex with the fc fragment of human igg at 2.3 angstrom resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
57
structure length
57
Chain Sequence
DNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein A
publication title Suppression of conformational heterogeneity at a protein-protein interface.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 21
structure length 57
sequence length 57
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4wwiA00
4GOFA 4ASVA 5CBNA 4HKZH 2KZJA 2Q1KA 5DJUB 3ZDMA 1X0TA 1LT1A 1H0TB 4GODA 3S1KA 1Q2NA 1EDKA 4WWIA 2KZIA 2B87B 2ZAEB 2QRXA 4NPEA 5DJTB 4ASWA 2B88A 3QWOC 1LP1B 2LXBA 1U7JA 1NVOA 1OVRA 4EYYQ 5CBOA 4KJMA 2M0BA 1BDCA 2KUBA 2LXCB 5K5GB 1EC5A 4HJGH 1EDJA 2WMMA 1Y47A 2LR2A 3FXDA 2KS1B 2KIKA 4JBZA 3MHVA 3PH0A 1U7MA 2UWJE 2I8DA 3RGUA 1EDIA 2JWDA 4GOEA 1ZW0A 1FC2C 1JMBA 1DEEG 2M5AA 2R44A 4NPDA 4CPGA 1JM0A 1OVVA 2RKLA 1ZXGA 2K3RA 1BDDA 1S3JA 5C39A 2B89A 2HR3A 1OVUA 2SPZA 4BXLA 4K3AA 2KI7B 2P58A 2QVAA 1EDLA 2OTKE 4K35A 4ZNCA 4ZMDA 1H0TA 5EFWB 1MFTA 1SS1A 4HB1A 3MZWB 4IOIH 2M5AB 3FXEA 2B87A 4NPFX 4MN4C 1LP1A
chains in the Genus database with same CATH superfamily
3AE4C 4IFMA 4HKZH 2I1KA 2O01H 1URQB 1IFJA 3O6QA 2XKMA 5CHXA 3C8VA 3RK2B 3H1LG 2KS1A 1S9KE 4OGQD 3V2RA 4RKUJ 2V4HA 4I1LA 2BASA 3H1KD 3ITKA 3CCUP 3CCVP 3E7KA 1FOSE 3HTKA 2B9BA 4OH8B 1NVOA 3HUSC 1ZMEC 1JO5A 1YJWP 1FE6A 4AQRD 1HJ0A 2KUBA 1JY2P 1HF9A 2ZFCA 2W90A 5APWA 1P84D 1LTJC 1GW3A 3P32A 1GL2C 1N7LA 3L75E 3H1KE 4H0LB 1Q81Q 4N78D 2MKVA 1JM0A 1RHZB 1HH0A 1BDDA 1E79H 2KB7P 3HD7B 3A2AA 1SP4A 1U57A 2E75D 3CX5D 5APQA 2IPPA 2FYNB 3V2PA 1KD1Q 1LJ2A 2WSFJ 3AE1C 3CCJP 3HE5A 1HVVA 2FYUK 1UIXA 1AVYA 2Z5IA 3CC7P 4DT0A 2M3EA 2OQQA 3CC4P 2FYUJ 1SQVK 2QJPC 1P84H 3L73J 1N2DC 1X0TA 2A06G 1FZEA 2QA4P 1SQVJ 2WPSA 3L72G 1M56D 4KHXA 1WT6A 5KAFE 2LKMA 2AXTE 3CX5H 3MTUE 5L8RJ 2WSCJ 1DX7A 2P7JA 1G1IA 4C7RA 1S5LH 5B5EE 2LR2A 4H44C 1OZHA 3FWLA 3IFMA 2E74D 1KQSO 2L91A 1JTHB 1YYCA 3IN6A 3CLQA 1JMBA 3CC2P 2ZYDA 2R44A 1ZRTE 2FYUD 4Z1MH 1Q82Q 1N73B 2R3SA 3L73D 1KILB 4HYTB 2R3CA 2OTLP 1SQVD 2QIWA 2A45G 2YKPA 1J1DC 3L71G 3VOPA 1BCCE 4LGDE 1JY3N 3G4SP 1DD3A 1T2KD 5BU8B 5H2FE 5KLVG 4W7ZA 2PAJA 1Q90D 1JOCA 1NTKG 3P7KA 1NJIQ 5AVXB 1AQ5A 1Z56A 2PP6A 3PLNA 5APSA 1VL2A 1KV4A 1BGYJ 3L73E 3TNUB 3VMXA 1JCCA 2QJKC 1CZQA 3LIDA 2Q6QA 1RE4A 1GW4A 3RL0B 4PD4D 4GODA 2KYVA 2HYNA 2QRXA 1FAVA 1KYOI 3OJAB 5AVZB 4XE5B 4YTPC 1J2JB 1JCDA 2KNCB 3KDPB 1X9VA 2OYIB 1NOHA 1NTZG 1EQ7A 3VMAA 1AFOA 1LT9B 2FFDB 1EXIA 1FJKA 2HG5D 3OA7A 2HPCA 1KQGB 4JBZA 2JKVA 2JP3A 1JY3O 4RESB 3O8ZA 3T97A 2WSCH 3AEFC 1BGYD 3WUVA 1SQPE 1ZXGA 1M90Q 1M1KQ 5C39A 3V2QA 3L74E 1IFDA 1PIXA 4BXLA 4EI2A 4RO0A 3W67A 4C7NB 2NPSC 4PD4H 4YPCA 3RBZA 1JMMA 1SQBJ 1S2EA 1SQXK 1SQQG 2FYZA 4I7ZB 2KP8A 3B5NB 4HB1A 1L4AB 2YNYA 2POHA 1LWUA 4DZOA 4OWFA 1SQXJ 1FZCA 2L5GB 1KILC 3KHUA 1PGQA 4WY4D 1JUNA 3H25A 5KAIE 2O3JA 2XNXA 5AW2B 5AVYB 2WSEJ 2GUVA 2R32A 2E76D 1WRGA 2YKQA 3H1HJ 2LXCB 4N6JA 3TYYA 4YXWH 1SQBD 3C1LA 5KLVD 4U7JA 1PL5A 3TGUG 1EDIA 3GLMA 1SQXD 3HE4A 4WY4A 3VN0A 4M3LA 3A0BH 2AEMA 3L35A 5AW5B 3RK3B 2ZT9C 1L2PA 5KTBA 1EXJA 1KYOE 1FU1A 1M7LA 1K8AQ 3SWFA 3W68A 2BCCE 1VQNP 2P58A 5TISH 1JEKA 1VF5D 3H32B 1SS1A 2IFNA 3M91A 3AEBC 1N8RQ 2R5DA 1ZR4A 3H1HD 5APYA 2A45H 3H1JJ 4Y99C 2CK3H 4ZKUA 1K73Q 5APTA 1SVFA 4OGQC 4EDFA 2WT7B 2O01J 3MUDC 4U3FG 3U1CA 3BCCG 2QM8A 4A7PA 1FJPA 4ASWA 3HUSB 3H1HE 5E79E 1NAYA 1QLED 1KQFB 3KPEA 2QG4A 4LLHA 3CL3D 4EOTA 3KXDA 4KJMA 3WU2H 3G71P 1LTJB 3Q5SA 1XTCC 3B8EB 1HJBA 2WSEH 1EZVD 2Z4EA 4HH2A 3AE7C 3TF5A 3AE8C 2Q7CA 1VPCA 2H8PD 3H1JD 1FZAA 1PP9E 4CPGA 3H1IE 1P84I 4D6TG 2E75C 2P67A 1ZP0C 1D7MA 2E42A 2Y0DA 1YITP 4L74A 2Y0EA 4BRYB 1EDLA 3S4RA 2CPBA 1LGHB 4IL6X 5EFWB 5GTHE 1RY3A 3CX5I 1BE3E 4C46A 1X22A 1OW6A 1PV3A 2QJPB 3BRTB 1PPJD 1FDOA 2IDBA 1BSNA 1N7SD 2G3AA 2KXPB 2QJYC 1L0NK 3GG2A 5DJUB 2WVRA 3FX0A 1H89A 2OYHA 2HODB 1R5SA 5CCGD 1VQLP 1H0TB 3AEEC 1QX8A 3L36A 1QEXA 1Y8AA 1L0NJ 2K9YA 4WWIA 4IFDK 2B88A 2IYPA 2RMZA 1PPJE 1K9MQ 1M1JB 1IFNA 2FXMA 2FXPA 1OFCX 2E74C 4H44B 1BCCG 4PV1D 3IAOA 3N7NA 2KIKA 1N7SA 5KJ7A 1RE4C 2K88A 3BASA 1W5CE 1RF1A 1NTMK 5CCGA 3P8MC 1IK7A 2W8ZA 5AVTB 1J1DB 1L0LK 1T2KC 3L70G 2IYOA 1NTMJ 4Y28J 2IZ1A 1PGPA 3M0DA 1L0ND 1KB9H 3D70A 1KC8Q 1L0LJ 3CCMP 2E43A 3RL0g 2QJKB 3TSIA 4XA4A 1S1CX 3V2NA 2IBZD 1P84E 1KN7A 1IFMA 2ZYGA 2PRRA 4TLFA 2GA1A 1GD2E 2GUSA 4N78E 4D6TD 3AECC 3F5HA 2ITAA 1SQPG 1MFZA 5CMZA 3CWBG 3II6A 4GT1A 1RE3A 3L74G 1LWUC 4PD4I 2Y9YA 3CX5E 1NH4A 1FZCC 1NTMD 3H1LJ 4I6MC 1PGOA 2KSJA 4DCKA 1S5LE 4L75A 1L0LD 1G2CA 3SFDC 3H6PA 2I8DA 4GOEA 1SFCD 3D6YA 3I56P 1DEEG 1USDA 1OVVA 4H13D 4WBAA 3D71A 2QSIA 1M1JC 2D2CD 2NPSB 5B66H 3KZIH 1VQ7P 1NYHA 1NU1G 2Q3IA 1L0LE 3V6IA 1OW8A 4K35A 2E5YA 4UB8H 1KFNA 1NKZB 1OWAA 2OGUA 2B87A 2IZ0A 4ZKPA 1FZFA 4WY4C 1LP1A 3H1LD 3AEDC 1H8AA 1S4XA 5CBNA 1T8ZA 2FKWB 4UB6H 1IFIA 1SFCA 1GK6A 1Q86Q 2J59M 2NZ2A 1OIPA 3JCUH 2K9JB 1QVFO 1IZNB 2E76C 1AJYA 3WUUA 2FYUE 3B71A 3M0AA 1QL1A 3H1LE 2N1TB 1BSHA 2BCCG 1GMJA 2C9LY 2V7QJ 1SQVE 3O6QB 3D6ZA 1GL2D 1ZV8A 1KZUB 4GIFA 3V4WA 3USSA 3L72J 2KS1B 3NFQA 3GHGA 3M06A 1N86A 4YXDC 1K04A 3U59A 2A45I 2YMKA 3U1AA 1ZW0A 2Q9IA 2ZT9B 3HTKB 4GDOA 2JEEA 1W2EA 2BEQD 1CI6A 2XV5A 1E5WA 1PZQA 2O01N 1VF5C 2YO2A 5AVVB 4PD4E 1UIIA 3Q5RA 4WB4A 4ZNCA 4ZMDA 4R4LA 1GL2A 2WITA 1JY3P 5AVRB 1YTZT 4Y99B 3A0HH 4MN4C 1R5LA 1IJDB 1FZBA 1LNQA 1SQBK 3M9QA 4OGQB 2A06D 5KLVK 4ASVA 5AW9B 1NTKK 3AE6C 2YIUC 3L71J 3L72D 1DIPA 3ZDMA 5KLVJ 1KTMA 2QM7A 1NTKJ 1PP9G 2JO1A 3S1KA 3H1IG 3HE5B 4TT3H 1BGYE 1DEBA 1URQD 2KZIA 4NPEA 1G1JA 3RK2D 2W6AA 3NTNA 2FY8A 5K5GB 1IC2A 3MP7B 2WMMA 5AVUB 2DW3A 4R4MA 2RH0A 3PH0A 1FZGA 1NTZK 1BE3G 5GTIH 3CXHI 2OYHC 3MD0A 2G8YA 2E75B 1FC2C 2V7QH 3A0BE 2YO3A 3LIEA 2M5AA 3VYIA 1YQ3C 1AQTA 1NTZJ 3AE9C 2N1TC 3L71D 1EZVI 2KLUA 1PGJA 2J5UA 3SFEC 1GU5A 1URQA 5APVA 1GDTA 4H0LD 1NTKD 3E1IA 2QVAA 5TISE 2PGDA 4DOJA 1LTTC 5AW6B 3HD7D 1N7SC 2O1KA 3PTZA 3MZWB 2HFED 1VQKP 1SQQK 1J1EC 1NWQA 4IL6H 1T3UA 3L71E 1RF1C 5AVQB 3CCLP 2QJYB 1H88A 1MZ9A 1SQBE 5CCGC 4QMAA 4L73A 2W6BA 5KLVE 1SQQJ 3V5BA 3AEAC 5KLIC 3AE3C 2NRGA 1SQXE 2Q5UA 3M0DC 3F89A 1NTZD 3CD6P 3A7OA 3CCQP 1OVRA 4PV1C 2E74B 2WPQA 1FBMA 4GKGA 3HRNA 3WU2E 2M0BA 3HD7A 2K37A 4OVNF 3ABVC 3L75G 1KB9I 3H1KG 3WUTA 1MV8A 1YJNP 3V4QA 3AE5C 3EFFK 3G3ZA 1DH3A 3FGAD 2ZJSE 4NPDA 3CXHD 2P10A 2H89C 2KK7A 2K3RA 1SQQD 1RE3C 1VQ4P 1S3JA 1AA0A 1OVUA 5BU5A 3JC22 3TGUJ 4W80A 2ZVNB 2HPCB 5AW7B 1W2BO 2GM4A 2WTYA 1KMIZ 1GK4A 3T97B 1IO4A 4NPFX 1RQVA 3CXHE 4B86A 2OARA 1SQQE 5BVZA 2R5BA 4LC1A 2FBWC 1IFPA 1EZVE 1LTGC 2I1JA 3AE2C 2C9NY 2Z5HA 3H1JE 2ZXEB 2P2UA 1S72P 1JTHA 2KSEA 3CXHH 2IBZI 4KT0J 1LWUB 1ZOYC 5KJ7D 2LXBA 1FZCB 1YBKA 3RL0D 1N73A 4U3FJ 1JY2N 3TGUD 2M8RA 4I2LC 3Q5PA 1YHQP 1KILA 3BCCJ 5APUA 1AVOA 3S9OA 1SFCC 4PJ0H 1FDMA 3PHLA 2YXRB 1KB9D 1U7MA 4H13C 1FS0E 3RGUA 2D2CC 1A02F 1WMKA 1GZLA 2ZXXA 1K05A 1MKMA 2Y9ZA 3TNUA 2B89A 1YTZI 2HR3A 2SPZA 5AW1B 3C9IA 2FYUG 1VQMP 1KB9E 3QH9A 1CSBA 3L73G 4D6TJ 3GHGC 3HE4B 4WY4B 4JYBA 5AW3B 1OX3A 2JR8A 1YI2P 1OXZA 1VQOP 1SQVG 3L75D 4U3FD 3LW5H 3VMZA 4AYCA 4JF7A 3BCCD 1T6AA 2KNCA 1JY2O 3TDKA 3B5ND 2OYIA 1L4AD 3L37A 2E76B 1LT9A 2FFDA 1NO4A 2AXCA 3Q2YA 2YXQB 1JB0J 3EQ2A 5CJ0A 3IF4A 1VQPP 5DJTB 1TU3F 3L4FA 4U3FE 1RF0A 2WZ7A 3VP8A 3BCCE 3KQGA 1X79B 2MJZA 1L0NE 4C7NA 3MUDA 5CJ4A 3E1RA 3B5NA 2H7HA 1MUUA 1L4AA 3M9HA 3M9BA 1ZR2A 3I55P 2RKLA 1VF5B 1BCCJ 2IBZE 2J58A 5CCHD 1YQ4C 1VQ6P 5B66E 3KZIE 1NHLA 2Q3EA 1LTBC 1BGYG 2W6JH 4D6TE 3RK3D 1M8OB 3UIAA 4UB8E 3B4SA 4JQ0D 3SSUA 2JJLA 1NTME 2YIUB 3L70J 1ZRTD 4UB6E 3VP9A 1OW7A 2HLOA 2H88C 2Q1KA 2YMYA 3NXSA 3JCUE 1CW5A 1URQC 3RK3E 3TK1A 2WWWA 1QGKB 3RK2C 5CCHA 1A02J 1EDKA 1YJ9P 3GMAA 1BCCD 2Y0CA 4EIJA 2JDIH 3NMDA 3PJSK 4JPZB 5AW8B 5KAFH 1SQPK 4EYYQ 5CBOA 2AXTH 1DD4A 1HUCA 3OAKA 3P8CD 3OW2O 5AW4B 5M1BA 1SQPJ 2OYHB 5B5EH 1LTIC 3CWBJ 3EFGA 1VQ5P 3MHVA 3H32A 3L74J 3PRJA 3EWKA 3GF3A 3GW6A 4IFFA 5TJHA 4O9BA 4WVZA 3L70D 3IR9A 1SQBG 4L76A 4H0LC 2XU6A 5KKZB 1LTSC 5AW0B 2ZYAA 3CCEP 1NKNA 1SQXG 4K3AA 3P8CE 3HD7C 2WT7A 1KFMA 2WSFH 1N7SB 3A5TA 5AVSB 2FYNC 1J1EB 1NU1K 4BWNA 3SWYA 1XTGB 5H2FH 3G6EP 3CMAP 1RF1B 3A0HE 3L70E 3HUSA 3RBXA 2WQYC 4GOFA 1NU1J 1USEA 1SQPD 5KLIB 1LTJA 3CWBD 1FDIA 2WPRA 3H1HG 3L74D 1KORA 3BRVB 2E5TA 4PV1B 2ZAEB 1HGZA 3CPWO 1U7JA 3R4YA 1JNMA 2IFMA 1S5LX 2QE7H 1BDCA 1M57D 3CWBE 3N4XA 2KOGA 4BRYA 1OMIA 3MIWA 1Q7YQ 5GTIE 3FWNA 1GTWA 2JWDA 2BCCJ 1IK9A 3K5BA 4H44D 2A06E 1Y9BA 1HBWA 1NU1D 1KQLA 1AV1A 2C0WA 1EZVG 3L72E 1LTAC 1RH5B 1N73C 3H1JG 1FOSF 3PP5A 1G2CB 2HODA 3R2PA 1H0TA 2XDJA 4JYCA 3FXEA 3AEGC 1NU1E 4DJGA 4IL6E 5KKZC 1M1JA 2KZJA 3Q1MA 3VMYA 3G9RA 1KYOD 1LT1A 2WSSH 2OYOA 1VQ9P 2BCCD 5KAIH 5KJ7C 1PPJG 2KLVA 3RL0C 1PFIA 2B87B 1VDFA 3QWOC 1LP1B 3GF7A 3A3YB 2IX7C 1NTKE 1SFCB 3KYQA 2O1JA 1PP9J 2ZVOB 2QEXP 4HJGH 1EDJA 3H1IJ 1VQ8P 4H13B 2OYIC 2RN0A 3BATA 2AEFA 1QL2A 2D2CB 2C0XA 1LT9C 2FFDC 2PFXA 3Q3DA 2K1AA 1RF0C 1HWTC 1KYOH 1BE3J 1ZN5A 3CMEP 1NAFA 3CCSP 2KI7B 2VRSA 3GHGB 1T3JA 2AEJA 1NTZE 3MGNA 2WPVB 1MFTA 1QVGO 2NPSD 4I7ZC 3B5NC 3WMM0 1X8YA 1L4AC 2W27A 2CPSA 1CI6B 1L0NG 2W83C 1PP9D 5AVWB 3H1ID 3LW5J 4W7YA 2BEZF 1ZLLA 3CCRP 4AUWA 2N9BA 3I5CA 3BVHA 1KILD 1NGMB 1Q2NA 1RQUA 1GL2B 3CI9A 4N3YB 2IBZG 4RJTA 1HGVA 5E79H 2N9YB 1BE3D 1R8EA 2NPSA 1EC5A 4PJ0E 1Y47A 3FXDA 3JSVC 2N1TD 1KILE 2UWJE 1NTMG 5CCHC 2JWAA 1SLQA 1HTLC 3L75J 2H43A 2P1JA 4XFJA 3SWKA 3H1KJ 1L0LG 2XNDH 3RK3C 2XZRA 2ZT9D 2OTJP 1S9KD 2FXOA 2K9JA 2OTKE 2YKOA 1GU4A 3VTPC 5GTHH 4IOIH 2M5AB 1YIJP 3TGUE 2M3BA 5APXA 2N1TA
chains in the Genus database with same CATH topology
4GOFA 4ASVA 5CBNA 4HKZH 2KZJA 2Q1KA 5DJUB 3ZDMA 1X0TA 1LT1A 1H0TB 4GODA 3S1KA 1Q2NA 1EDKA 4WWIA 2KZIA 2B87B 2ZAEB 2QRXA 4NPEA 5DJTB 4ASWA 2B88A 3QWOC 1LP1B 2LXBA 1U7JA 1NVOA 1OVRA 4EYYQ 5CBOA 4KJMA 2M0BA 1BDCA 2KUBA 2LXCB 5K5GB 1EC5A 4HJGH 1EDJA 2WMMA 1Y47A 2LR2A 3FXDA 2KS1B 2KIKA 4JBZA 3MHVA 3PH0A 1U7MA 2UWJE 2I8DA 3RGUA 1EDIA 2JWDA 4GOEA 1ZW0A 1FC2C 1JMBA 1DEEG 2M5AA 2R44A 4NPDA 4CPGA 1JM0A 1OVVA 2RKLA 1ZXGA 2K3RA 1BDDA 1S3JA 5C39A 2B89A 2HR3A 1OVUA 2SPZA 4BXLA 4K3AA 2KI7B 2P58A 2QVAA 1EDLA 2OTKE 4K35A 4ZNCA 4ZMDA 1H0TA 5EFWB 1MFTA 1SS1A 4HB1A 3MZWB 4IOIH 2M5AB 3FXEA 2B87A 4NPFX 4MN4C 1LP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GOF A;  4ASV A;  5CBN A;  4HKZ H;  2KZJ A;  2Q1K A;  5DJU B;  3ZDM A;  1X0T A;  1LT1 A;  1H0T B;  4GOD A;  3S1K A;  1Q2N A;  1EDK A;  4WWI A;  2KZI A;  2B87 B;  2ZAE B;  2QRX A;  4NPE A;  5DJT B;  4ASW A;  2B88 A;  3QWO C;  1LP1 B;  2LXB A;  1U7J A;  1NVO A;  1OVR A;  4EYY Q;  5CBO A;  4KJM A;  2M0B A;  1BDC A;  2KUB A;  2LXC B;  5K5G B;  1EC5 A;  4HJG H;  1EDJ A;  2WMM A;  1Y47 A;  2LR2 A;  3FXD A;  2KS1 B;  2KIK A;  4JBZ A;  3MHV A;  3PH0 A;  1U7M A;  2UWJ E;  2I8D A;  3RGU A;  1EDI A;  2JWD A;  4GOE A;  1ZW0 A;  1FC2 C;  1JMB A;  1DEE G;  2M5A A;  2R44 A;  4NPD A;  4CPG A;  1JM0 A;  1OVV A;  2RKL A;  1ZXG A;  2K3R A;  1BDD A;  1S3J A;  5C39 A;  2B89 A;  2HR3 A;  1OVU A;  2SPZ A;  4BXL A;  4K3A A;  2KI7 B;  2P58 A;  2QVA A;  1EDL A;  2OTK E;  4K35 A;  4ZNC A;  4ZMD A;  1H0T A;  5EFW B;  1MFT A;  1SS1 A;  4HB1 A;  3MZW B;  4IOI H;  2M5A B;  3FXE A;  2B87 A;  4NPF X;  4MN4 C;  1LP1 A; 
#chains in the Genus database with same CATH topology
 3AE4 C;  4IFM A;  4HKZ H;  2I1K A;  2O01 H;  1URQ B;  1IFJ A;  3O6Q A;  2XKM A;  5CHX A;  3C8V A;  3RK2 B;  3H1L G;  2KS1 A;  1S9K E;  4OGQ D;  3V2R A;  4RKU J;  2V4H A;  4I1L A;  2BAS A;  3H1K D;  3ITK A;  3CCU P;  3CCV P;  3E7K A;  1FOS E;  3HTK A;  2B9B A;  4OH8 B;  1NVO A;  3HUS C;  1ZME C;  1JO5 A;  1YJW P;  1FE6 A;  4AQR D;  1HJ0 A;  2KUB A;  1JY2 P;  1HF9 A;  2ZFC A;  2W90 A;  5APW A;  1P84 D;  1LTJ C;  1GW3 A;  3P32 A;  1GL2 C;  1N7L A;  3L75 E;  3H1K E;  4H0L B;  1Q81 Q;  4N78 D;  2MKV A;  1JM0 A;  1RHZ B;  1HH0 A;  1BDD A;  1E79 H;  2KB7 P;  3HD7 B;  3A2A A;  1SP4 A;  1U57 A;  2E75 D;  3CX5 D;  5APQ A;  2IPP A;  2FYN B;  3V2P A;  1KD1 Q;  1LJ2 A;  2WSF J;  3AE1 C;  3CCJ P;  3HE5 A;  1HVV A;  2FYU K;  1UIX A;  1AVY A;  2Z5I A;  3CC7 P;  4DT0 A;  2M3E A;  2OQQ A;  3CC4 P;  2FYU J;  1SQV K;  2QJP C;  1P84 H;  3L73 J;  1N2D C;  1X0T A;  2A06 G;  1FZE A;  2QA4 P;  1SQV J;  2WPS A;  3L72 G;  1M56 D;  4KHX A;  1WT6 A;  5KAF E;  2LKM A;  2AXT E;  3CX5 H;  3MTU E;  5L8R J;  2WSC J;  1DX7 A;  2P7J A;  1G1I A;  4C7R A;  1S5L H;  5B5E E;  2LR2 A;  4H44 C;  1OZH A;  3FWL A;  3IFM A;  2E74 D;  1KQS O;  2L91 A;  1JTH B;  1YYC A;  3IN6 A;  3CLQ A;  1JMB A;  3CC2 P;  2ZYD A;  2R44 A;  1ZRT E;  2FYU D;  4Z1M H;  1Q82 Q;  1N73 B;  2R3S A;  3L73 D;  1KIL B;  4HYT B;  2R3C A;  2OTL P;  1SQV D;  2QIW A;  2A45 G;  2YKP A;  1J1D C;  3L71 G;  3VOP A;  1BCC E;  4LGD E;  1JY3 N;  3G4S P;  1DD3 A;  1T2K D;  5BU8 B;  5H2F E;  5KLV G;  4W7Z A;  2PAJ A;  1Q90 D;  1JOC A;  1NTK G;  3P7K A;  1NJI Q;  5AVX B;  1AQ5 A;  1Z56 A;  2PP6 A;  3PLN A;  5APS A;  1VL2 A;  1KV4 A;  1BGY J;  3L73 E;  3TNU B;  3VMX A;  1JCC A;  2QJK C;  1CZQ A;  3LID A;  2Q6Q A;  1RE4 A;  1GW4 A;  3RL0 B;  4PD4 D;  4GOD A;  2KYV A;  2HYN A;  2QRX A;  1FAV A;  1KYO I;  3OJA B;  5AVZ B;  4XE5 B;  4YTP C;  1J2J B;  1JCD A;  2KNC B;  3KDP B;  1X9V A;  2OYI B;  1NOH A;  1NTZ G;  1EQ7 A;  3VMA A;  1AFO A;  1LT9 B;  2FFD B;  1EXI A;  1FJK A;  2HG5 D;  3OA7 A;  2HPC A;  1KQG B;  4JBZ A;  2JKV A;  2JP3 A;  1JY3 O;  4RES B;  3O8Z A;  3T97 A;  2WSC H;  3AEF C;  1BGY D;  3WUV A;  1SQP E;  1ZXG A;  1M90 Q;  1M1K Q;  5C39 A;  3V2Q A;  3L74 E;  1IFD A;  1PIX A;  4BXL A;  4EI2 A;  4RO0 A;  3W67 A;  4C7N B;  2NPS C;  4PD4 H;  4YPC A;  3RBZ A;  1JMM A;  1SQB J;  1S2E A;  1SQX K;  1SQQ G;  2FYZ A;  4I7Z B;  2KP8 A;  3B5N B;  4HB1 A;  1L4A B;  2YNY A;  2POH A;  1LWU A;  4DZO A;  4OWF A;  1SQX J;  1FZC A;  2L5G B;  1KIL C;  3KHU A;  1PGQ A;  4WY4 D;  1JUN A;  3H25 A;  5KAI E;  2O3J A;  2XNX A;  5AW2 B;  5AVY B;  2WSE J;  2GUV A;  2R32 A;  2E76 D;  1WRG A;  2YKQ A;  3H1H J;  2LXC B;  4N6J A;  3TYY A;  4YXW H;  1SQB D;  3C1L A;  5KLV D;  4U7J A;  1PL5 A;  3TGU G;  1EDI A;  3GLM A;  1SQX D;  3HE4 A;  4WY4 A;  3VN0 A;  4M3L A;  3A0B H;  2AEM A;  3L35 A;  5AW5 B;  3RK3 B;  2ZT9 C;  1L2P A;  5KTB A;  1EXJ A;  1KYO E;  1FU1 A;  1M7L A;  1K8A Q;  3SWF A;  3W68 A;  2BCC E;  1VQN P;  2P58 A;  5TIS H;  1JEK A;  1VF5 D;  3H32 B;  1SS1 A;  2IFN A;  3M91 A;  3AEB C;  1N8R Q;  2R5D A;  1ZR4 A;  3H1H D;  5APY A;  2A45 H;  3H1J J;  4Y99 C;  2CK3 H;  4ZKU A;  1K73 Q;  5APT A;  1SVF A;  4OGQ C;  4EDF A;  2WT7 B;  2O01 J;  3MUD C;  4U3F G;  3U1C A;  3BCC G;  2QM8 A;  4A7P A;  1FJP A;  4ASW A;  3HUS B;  3H1H E;  5E79 E;  1NAY A;  1QLE D;  1KQF B;  3KPE A;  2QG4 A;  4LLH A;  3CL3 D;  4EOT A;  3KXD A;  4KJM A;  3WU2 H;  3G71 P;  1LTJ B;  3Q5S A;  1XTC C;  3B8E B;  1HJB A;  2WSE H;  1EZV D;  2Z4E A;  4HH2 A;  3AE7 C;  3TF5 A;  3AE8 C;  2Q7C A;  1VPC A;  2H8P D;  3H1J D;  1FZA A;  1PP9 E;  4CPG A;  3H1I E;  1P84 I;  4D6T G;  2E75 C;  2P67 A;  1ZP0 C;  1D7M A;  2E42 A;  2Y0D A;  1YIT P;  4L74 A;  2Y0E A;  4BRY B;  1EDL A;  3S4R A;  2CPB A;  1LGH B;  4IL6 X;  5EFW B;  5GTH E;  1RY3 A;  3CX5 I;  1BE3 E;  4C46 A;  1X22 A;  1OW6 A;  1PV3 A;  2QJP B;  3BRT B;  1PPJ D;  1FDO A;  2IDB A;  1BSN A;  1N7S D;  2G3A A;  2KXP B;  2QJY C;  1L0N K;  3GG2 A;  5DJU B;  2WVR A;  3FX0 A;  1H89 A;  2OYH A;  2HOD B;  1R5S A;  5CCG D;  1VQL P;  1H0T B;  3AEE C;  1QX8 A;  3L36 A;  1QEX A;  1Y8A A;  1L0N J;  2K9Y A;  4WWI A;  4IFD K;  2B88 A;  2IYP A;  2RMZ A;  1PPJ E;  1K9M Q;  1M1J B;  1IFN A;  2FXM A;  2FXP A;  1OFC X;  2E74 C;  4H44 B;  1BCC G;  4PV1 D;  3IAO A;  3N7N A;  2KIK A;  1N7S A;  5KJ7 A;  1RE4 C;  2K88 A;  3BAS A;  1W5C E;  1RF1 A;  1NTM K;  5CCG A;  3P8M C;  1IK7 A;  2W8Z A;  5AVT B;  1J1D B;  1L0L K;  1T2K C;  3L70 G;  2IYO A;  1NTM J;  4Y28 J;  2IZ1 A;  1PGP A;  3M0D A;  1L0N D;  1KB9 H;  3D70 A;  1KC8 Q;  1L0L J;  3CCM P;  2E43 A;  3RL0 g;  2QJK B;  3TSI A;  4XA4 A;  1S1C X;  3V2N A;  2IBZ D;  1P84 E;  1KN7 A;  1IFM A;  2ZYG A;  2PRR A;  4TLF A;  2GA1 A;  1GD2 E;  2GUS A;  4N78 E;  4D6T D;  3AEC C;  3F5H A;  2ITA A;  1SQP G;  1MFZ A;  5CMZ A;  3CWB G;  3II6 A;  4GT1 A;  1RE3 A;  3L74 G;  1LWU C;  4PD4 I;  2Y9Y A;  3CX5 E;  1NH4 A;  1FZC C;  1NTM D;  3H1L J;  4I6M C;  1PGO A;  2KSJ A;  4DCK A;  1S5L E;  4L75 A;  1L0L D;  1G2C A;  3SFD C;  3H6P A;  2I8D A;  4GOE A;  1SFC D;  3D6Y A;  3I56 P;  1DEE G;  1USD A;  1OVV A;  4H13 D;  4WBA A;  3D71 A;  2QSI A;  1M1J C;  2D2C D;  2NPS B;  5B66 H;  3KZI H;  1VQ7 P;  1NYH A;  1NU1 G;  2Q3I A;  1L0L E;  3V6I A;  1OW8 A;  4K35 A;  2E5Y A;  4UB8 H;  1KFN A;  1NKZ B;  1OWA A;  2OGU A;  2B87 A;  2IZ0 A;  4ZKP A;  1FZF A;  4WY4 C;  1LP1 A;  3H1L D;  3AED C;  1H8A A;  1S4X A;  5CBN A;  1T8Z A;  2FKW B;  4UB6 H;  1IFI A;  1SFC A;  1GK6 A;  1Q86 Q;  2J59 M;  2NZ2 A;  1OIP A;  3JCU H;  2K9J B;  1QVF O;  1IZN B;  2E76 C;  1AJY A;  3WUU A;  2FYU E;  3B71 A;  3M0A A;  1QL1 A;  3H1L E;  2N1T B;  1BSH A;  2BCC G;  1GMJ A;  2C9L Y;  2V7Q J;  1SQV E;  3O6Q B;  3D6Z A;  1GL2 D;  1ZV8 A;  1KZU B;  4GIF A;  3V4W A;  3USS A;  3L72 J;  2KS1 B;  3NFQ A;  3GHG A;  3M06 A;  1N86 A;  4YXD C;  1K04 A;  3U59 A;  2A45 I;  2YMK A;  3U1A A;  1ZW0 A;  2Q9I A;  2ZT9 B;  3HTK B;  4GDO A;  2JEE A;  1W2E A;  2BEQ D;  1CI6 A;  2XV5 A;  1E5W A;  1PZQ A;  2O01 N;  1VF5 C;  2YO2 A;  5AVV B;  4PD4 E;  1UII A;  3Q5R A;  4WB4 A;  4ZNC A;  4ZMD A;  4R4L A;  1GL2 A;  2WIT A;  1JY3 P;  5AVR B;  1YTZ T;  4Y99 B;  3A0H H;  4MN4 C;  1R5L A;  1IJD B;  1FZB A;  1LNQ A;  1SQB K;  3M9Q A;  4OGQ B;  2A06 D;  5KLV K;  4ASV A;  5AW9 B;  1NTK K;  3AE6 C;  2YIU C;  3L71 J;  3L72 D;  1DIP A;  3ZDM A;  5KLV J;  1KTM A;  2QM7 A;  1NTK J;  1PP9 G;  2JO1 A;  3S1K A;  3H1I G;  3HE5 B;  4TT3 H;  1BGY E;  1DEB A;  1URQ D;  2KZI A;  4NPE A;  1G1J A;  3RK2 D;  2W6A A;  3NTN A;  2FY8 A;  5K5G B;  1IC2 A;  3MP7 B;  2WMM A;  5AVU B;  2DW3 A;  4R4M A;  2RH0 A;  3PH0 A;  1FZG A;  1NTZ K;  1BE3 G;  5GTI H;  3CXH I;  2OYH C;  3MD0 A;  2G8Y A;  2E75 B;  1FC2 C;  2V7Q H;  3A0B E;  2YO3 A;  3LIE A;  2M5A A;  3VYI A;  1YQ3 C;  1AQT A;  1NTZ J;  3AE9 C;  2N1T C;  3L71 D;  1EZV I;  2KLU A;  1PGJ A;  2J5U A;  3SFE C;  1GU5 A;  1URQ A;  5APV A;  1GDT A;  4H0L D;  1NTK D;  3E1I A;  2QVA A;  5TIS E;  2PGD A;  4DOJ A;  1LTT C;  5AW6 B;  3HD7 D;  1N7S C;  2O1K A;  3PTZ A;  3MZW B;  2HFE D;  1VQK P;  1SQQ K;  1J1E C;  1NWQ A;  4IL6 H;  1T3U A;  3L71 E;  1RF1 C;  5AVQ B;  3CCL P;  2QJY B;  1H88 A;  1MZ9 A;  1SQB E;  5CCG C;  4QMA A;  4L73 A;  2W6B A;  5KLV E;  1SQQ J;  3V5B A;  3AEA C;  5KLI C;  3AE3 C;  2NRG A;  1SQX E;  2Q5U A;  3M0D C;  3F89 A;  1NTZ D;  3CD6 P;  3A7O A;  3CCQ P;  1OVR A;  4PV1 C;  2E74 B;  2WPQ A;  1FBM A;  4GKG A;  3HRN A;  3WU2 E;  2M0B A;  3HD7 A;  2K37 A;  4OVN F;  3ABV C;  3L75 G;  1KB9 I;  3H1K G;  3WUT A;  1MV8 A;  1YJN P;  3V4Q A;  3AE5 C;  3EFF K;  3G3Z A;  1DH3 A;  3FGA D;  2ZJS E;  4NPD A;  3CXH D;  2P10 A;  2H89 C;  2KK7 A;  2K3R A;  1SQQ D;  1RE3 C;  1VQ4 P;  1S3J A;  1AA0 A;  1OVU A;  5BU5 A;  3JC2 2;  3TGU J;  4W80 A;  2ZVN B;  2HPC B;  5AW7 B;  1W2B O;  2GM4 A;  2WTY A;  1KMI Z;  1GK4 A;  3T97 B;  1IO4 A;  4NPF X;  1RQV A;  3CXH E;  4B86 A;  2OAR A;  1SQQ E;  5BVZ A;  2R5B A;  4LC1 A;  2FBW C;  1IFP A;  1EZV E;  1LTG C;  2I1J A;  3AE2 C;  2C9N Y;  2Z5H A;  3H1J E;  2ZXE B;  2P2U A;  1S72 P;  1JTH A;  2KSE A;  3CXH H;  2IBZ I;  4KT0 J;  1LWU B;  1ZOY C;  5KJ7 D;  2LXB A;  1FZC B;  1YBK A;  3RL0 D;  1N73 A;  4U3F J;  1JY2 N;  3TGU D;  2M8R A;  4I2L C;  3Q5P A;  1YHQ P;  1KIL A;  3BCC J;  5APU A;  1AVO A;  3S9O A;  1SFC C;  4PJ0 H;  1FDM A;  3PHL A;  2YXR B;  1KB9 D;  1U7M A;  4H13 C;  1FS0 E;  3RGU A;  2D2C C;  1A02 F;  1WMK A;  1GZL A;  2ZXX A;  1K05 A;  1MKM A;  2Y9Z A;  3TNU A;  2B89 A;  1YTZ I;  2HR3 A;  2SPZ A;  5AW1 B;  3C9I A;  2FYU G;  1VQM P;  1KB9 E;  3QH9 A;  1CSB A;  3L73 G;  4D6T J;  3GHG C;  3HE4 B;  4WY4 B;  4JYB A;  5AW3 B;  1OX3 A;  2JR8 A;  1YI2 P;  1OXZ A;  1VQO P;  1SQV G;  3L75 D;  4U3F D;  3LW5 H;  3VMZ A;  4AYC A;  4JF7 A;  3BCC D;  1T6A A;  2KNC A;  1JY2 O;  3TDK A;  3B5N D;  2OYI A;  1L4A D;  3L37 A;  2E76 B;  1LT9 A;  2FFD A;  1NO4 A;  2AXC A;  3Q2Y A;  2YXQ B;  1JB0 J;  3EQ2 A;  5CJ0 A;  3IF4 A;  1VQP P;  5DJT B;  1TU3 F;  3L4F A;  4U3F E;  1RF0 A;  2WZ7 A;  3VP8 A;  3BCC E;  3KQG A;  1X79 B;  2MJZ A;  1L0N E;  4C7N A;  3MUD A;  5CJ4 A;  3E1R A;  3B5N A;  2H7H A;  1MUU A;  1L4A A;  3M9H A;  3M9B A;  1ZR2 A;  3I55 P;  2RKL A;  1VF5 B;  1BCC J;  2IBZ E;  2J58 A;  5CCH D;  1YQ4 C;  1VQ6 P;  5B66 E;  3KZI E;  1NHL A;  2Q3E A;  1LTB C;  1BGY G;  2W6J H;  4D6T E;  3RK3 D;  1M8O B;  3UIA A;  4UB8 E;  3B4S A;  4JQ0 D;  3SSU A;  2JJL A;  1NTM E;  2YIU B;  3L70 J;  1ZRT D;  4UB6 E;  3VP9 A;  1OW7 A;  2HLO A;  2H88 C;  2Q1K A;  2YMY A;  3NXS A;  3JCU E;  1CW5 A;  1URQ C;  3RK3 E;  3TK1 A;  2WWW A;  1QGK B;  3RK2 C;  5CCH A;  1A02 J;  1EDK A;  1YJ9 P;  3GMA A;  1BCC D;  2Y0C A;  4EIJ A;  2JDI H;  3NMD A;  3PJS K;  4JPZ B;  5AW8 B;  5KAF H;  1SQP K;  4EYY Q;  5CBO A;  2AXT H;  1DD4 A;  1HUC A;  3OAK A;  3P8C D;  3OW2 O;  5AW4 B;  5M1B A;  1SQP J;  2OYH B;  5B5E H;  1LTI C;  3CWB J;  3EFG A;  1VQ5 P;  3MHV A;  3H32 A;  3L74 J;  3PRJ A;  3EWK A;  3GF3 A;  3GW6 A;  4IFF A;  5TJH A;  4O9B A;  4WVZ A;  3L70 D;  3IR9 A;  1SQB G;  4L76 A;  4H0L C;  2XU6 A;  5KKZ B;  1LTS C;  5AW0 B;  2ZYA A;  3CCE P;  1NKN A;  1SQX G;  4K3A A;  3P8C E;  3HD7 C;  2WT7 A;  1KFM A;  2WSF H;  1N7S B;  3A5T A;  5AVS B;  2FYN C;  1J1E B;  1NU1 K;  4BWN A;  3SWY A;  1XTG B;  5H2F H;  3G6E P;  3CMA P;  1RF1 B;  3A0H E;  3L70 E;  3HUS A;  3RBX A;  2WQY C;  4GOF A;  1NU1 J;  1USE A;  1SQP D;  5KLI B;  1LTJ A;  3CWB D;  1FDI A;  2WPR A;  3H1H G;  3L74 D;  1KOR A;  3BRV B;  2E5T A;  4PV1 B;  2ZAE B;  1HGZ A;  3CPW O;  1U7J A;  3R4Y A;  1JNM A;  2IFM A;  1S5L X;  2QE7 H;  1BDC A;  1M57 D;  3CWB E;  3N4X A;  2KOG A;  4BRY A;  1OMI A;  3MIW A;  1Q7Y Q;  5GTI E;  3FWN A;  1GTW A;  2JWD A;  2BCC J;  1IK9 A;  3K5B A;  4H44 D;  2A06 E;  1Y9B A;  1HBW A;  1NU1 D;  1KQL A;  1AV1 A;  2C0W A;  1EZV G;  3L72 E;  1LTA C;  1RH5 B;  1N73 C;  3H1J G;  1FOS F;  3PP5 A;  1G2C B;  2HOD A;  3R2P A;  1H0T A;  2XDJ A;  4JYC A;  3FXE A;  3AEG C;  1NU1 E;  4DJG A;  4IL6 E;  5KKZ C;  1M1J A;  2KZJ A;  3Q1M A;  3VMY A;  3G9R A;  1KYO D;  1LT1 A;  2WSS H;  2OYO A;  1VQ9 P;  2BCC D;  5KAI H;  5KJ7 C;  1PPJ G;  2KLV A;  3RL0 C;  1PFI A;  2B87 B;  1VDF A;  3QWO C;  1LP1 B;  3GF7 A;  3A3Y B;  2IX7 C;  1NTK E;  1SFC B;  3KYQ A;  2O1J A;  1PP9 J;  2ZVO B;  2QEX P;  4HJG H;  1EDJ A;  3H1I J;  1VQ8 P;  4H13 B;  2OYI C;  2RN0 A;  3BAT A;  2AEF A;  1QL2 A;  2D2C B;  2C0X A;  1LT9 C;  2FFD C;  2PFX A;  3Q3D A;  2K1A A;  1RF0 C;  1HWT C;  1KYO H;  1BE3 J;  1ZN5 A;  3CME P;  1NAF A;  3CCS P;  2KI7 B;  2VRS A;  3GHG B;  1T3J A;  2AEJ A;  1NTZ E;  3MGN A;  2WPV B;  1MFT A;  1QVG O;  2NPS D;  4I7Z C;  3B5N C;  3WMM 0;  1X8Y A;  1L4A C;  2W27 A;  2CPS A;  1CI6 B;  1L0N G;  2W83 C;  1PP9 D;  5AVW B;  3H1I D;  3LW5 J;  4W7Y A;  2BEZ F;  1ZLL A;  3CCR P;  4AUW A;  2N9B A;  3I5C A;  3BVH A;  1KIL D;  1NGM B;  1Q2N A;  1RQU A;  1GL2 B;  3CI9 A;  4N3Y B;  2IBZ G;  4RJT A;  1HGV A;  5E79 H;  2N9Y B;  1BE3 D;  1R8E A;  2NPS A;  1EC5 A;  4PJ0 E;  1Y47 A;  3FXD A;  3JSV C;  2N1T D;  1KIL E;  2UWJ E;  1NTM G;  5CCH C;  2JWA A;  1SLQ A;  1HTL C;  3L75 J;  2H43 A;  2P1J A;  4XFJ A;  3SWK A;  3H1K J;  1L0L G;  2XND H;  3RK3 C;  2XZR A;  2ZT9 D;  2OTJ P;  1S9K D;  2FXO A;  2K9J A;  2OTK E;  2YKO A;  1GU4 A;  3VTP C;  5GTH H;  4IOI H;  2M5A B;  1YIJ P;  3TGU E;  2M3B A;  5APX A;  2N1T A; 
#chains in the Genus database with same CATH homology
 4GOF A;  4ASV A;  5CBN A;  4HKZ H;  2KZJ A;  2Q1K A;  5DJU B;  3ZDM A;  1X0T A;  1LT1 A;  1H0T B;  4GOD A;  3S1K A;  1Q2N A;  1EDK A;  4WWI A;  2KZI A;  2B87 B;  2ZAE B;  2QRX A;  4NPE A;  5DJT B;  4ASW A;  2B88 A;  3QWO C;  1LP1 B;  2LXB A;  1U7J A;  1NVO A;  1OVR A;  4EYY Q;  5CBO A;  4KJM A;  2M0B A;  1BDC A;  2KUB A;  2LXC B;  5K5G B;  1EC5 A;  4HJG H;  1EDJ A;  2WMM A;  1Y47 A;  2LR2 A;  3FXD A;  2KS1 B;  2KIK A;  4JBZ A;  3MHV A;  3PH0 A;  1U7M A;  2UWJ E;  2I8D A;  3RGU A;  1EDI A;  2JWD A;  4GOE A;  1ZW0 A;  1FC2 C;  1JMB A;  1DEE G;  2M5A A;  2R44 A;  4NPD A;  4CPG A;  1JM0 A;  1OVV A;  2RKL A;  1ZXG A;  2K3R A;  1BDD A;  1S3J A;  5C39 A;  2B89 A;  2HR3 A;  1OVU A;  2SPZ A;  4BXL A;  4K3A A;  2KI7 B;  2P58 A;  2QVA A;  1EDL A;  2OTK E;  4K35 A;  4ZNC A;  4ZMD A;  1H0T A;  5EFW B;  1MFT A;  1SS1 A;  4HB1 A;  3MZW B;  4IOI H;  2M5A B;  3FXE A;  2B87 A;  4NPF X;  4MN4 C;  1LP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...