4WWIA

Crystal structure of the c domain of staphylococcal protein a in complex with the fc fragment of human igg at 2.3 angstrom resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
57
structure length
57
Chain Sequence
DNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Suppression of conformational heterogeneity at a protein-protein interface.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
molecule keywords Immunoglobulin G-binding protein A
total genus 21
structure length 57
sequence length 57
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4wwiA00
1EDLA 2B89A 3FXDA 2M5AA 1X0TA 3FXEA 5DJTB 1OVVA 3MHVA 4MN4C 5CBOA 2R44A 1BDDA 4NPFX 4ZMDA 2M5AB 5DJUB 2SPZA 1U7MA 4BXLA 5K5GB 2KI7B 2M0BA 4GOFA 1ZW0A 2OTKE 2LXBA 4JBZA 1Q2NA 1ZXGA 1EDIA 2B88A 2LXCB 4ASVA 4KJMA 3RGUA 2KZJA 1S3JA 1OVUA 2KZIA 2HR3A 1JMBA 2I8DA 4ASWA 4IOIH 2UWJE 2RKLA 3ZDMA 1NVOA 1Y47A 2P58A 4NPDA 1EDKA 1EC5A 2LR2A 3S1KA 2ZAEB 1SS1A 3MZWB 5C39A 1DEEG 1LP1B 3PH0A 1BDCA 4K35A 4NPEA 2Q1KA 1JM0A 1LP1A 4CPGA 2KS1B 3QWOC 1FC2C 2QVAA 4EYYQ 4K3AA 2B87B 1EDJA 4WWIA 1OVRA 5CBNA 4HB1A 4ZNCA 2WMMA 1MFTA 2B87A 1U7JA 1H0TA 2K3RA 1LT1A 2KUBA 4GODA 2JWDA 2KIKA 4HJGH 5EFWB 2QRXA 4GOEA 4HKZH 1H0TB
chains in the Genus database with same CATH superfamily
1GW4A 3RL0B 4YXDC 2E74B 3SFEC 2B89A 1LTGC 1LGHB 2WT7A 1GTWA 3O8ZA 5KKZC 1Q81Q 1PIXA 1YHQP 1OFCX 1RF1C 4L75A 1NKZB 1HGZA 2N9BA 1RE4A 2WSSH 3H1JD 3LW5H 1UIIA 1X22A 3P8MC 1T8ZA 5KAIH 2Z4EA 2O1JA 1JY3P 1NTKE 2ITAA 1NKNA 3HTKA 1RE3C 1OVVA 1URQA 2XNXA 1HF9A 1FAVA 5CJ4A 1S9KD 3S9OA 3L75J 2Q5UA 1LTBC 1BSNA 1SQBE 2GUVA 1PFIA 4A7PA 1SQBK 3M9BA 4I1LA 2ZXEB 4GIFA 3U1AA 2FYZA 3PJSK 3AEEC 3HUSC 1QGKB 2AEJA 2FYNC 1NTZE 5KLIC 5KLVG 3Q3DA 1BGYE 3RK3C 1ZW0A 2R5DA 3WUUA 4WY4C 3HE5B 3L71G 4LC1A 1QVGO 1A02J 2FYUG 1EXJA 1RF1A 1YTZT 3L70J 5KJ7D 5B5EH 1PZQA 1N7SA 1IFNA 2KLUA 2N9YB 2H88C 1KILA 2YIUB 3AEDC 2QIWA 4TT3H 3L73J 1GZLA 1NTKJ 3KYQA 1WRGA 1KN7A 1SQQD 1ZOYC 1H8AA 1FU1A 3G6EP 5AVQB 1SQVD 2YO2A 3RGUA 1BGYD 2KZJA 3L4FA 4PV1D 3USSA 3D6ZA 3QH9A 1VQ8P 1JMBA 1CZQA 2PRRA 2YMKA 4GDOA 1NU1G 1QL2A 2N1TC 3TF5A 1NU1K 1ZR2A 1P84H 1JOCA 1T3UA 1IFIA 3FGAD 3ZDMA 1NAFA 1SQPJ 2ZVNB 3SWYA 1ZR4A 3RK3E 2OYOA 1Y47A 3L72D 1BSHA 3CPWO 1X9VA 4H13D 3CMAP 5CCGC 2J58A 1URQD 1KTMA 1NWQA 2V4HA 1IFDA 1SQVE 4WY4D 1LWUA 3H1HG 2Y0CA 3V2RA 3H1LG 1AVOA 4EOTA 3L71D 1PP9D 1SQXE 2ZAEB 3KZIH 3OA7A 4M3LA 4HYTB 4YPCA 5AVXB 4WY4B 3AEAC 2E74C 3E1IA 3RK2C 1YJNP 3CX5E 2JJLA 4C7NA 4WBAA 2NPSB 2K9JB 3NTNA 1JUNA 5APXA 5AW2B 5CCHD 3L72E 3CCJP 1ZP0C 2HODB 2IYOA 2BCCE 3B71A 1KFNA 3KZIE 3O6QA 4NPEA 3ABVC 1WMKA 2Q1KA 3V2NA 4L73A 3H1IG 3M9HA 4OGQD 3T97A 3A3YB 1LP1A 4KHXA 3SSUA 1M1JC 4CPGA 1PP9E 3IF4A 1SQXK 2BCCJ 3HD7B 3WUTA 4N3YB 1AFOA 2IX7C 2O3JA 1LT9C 3AE6C 3P32A 2FXMA 3RBZA 2KB7P 2IDBA 3JCUH 3B5ND 3KQGA 3VP8A 4ZKUA 2C9LY 1PV3A 3GHGA 4WWIA 1VQPP 3HD7D 1NTMJ 1URQC 2BCCD 1VF5B 4DT0A 3CXHI 3KXDA 1KB9E 1PGPA 1VDFA 1Y8AA 3SWKA 3BCCJ 5CBNA 4HB1A 3AECC 4ZNCA 1GU4A 1M57D 1KC8Q 1KB9I 4I6MC 1MFTA 1NU1E 5BVZA 1NGMB 1GL2B 5KAFE 1S4XA 2RN0A 3TGUJ 2JEEA 1NTKG 5B66H 3G4SP 1NAYA 1MZ9A 4AYCA 3TNUA 1OZHA 2W8ZA 4C46A 2KUBA 2IBZD 2OQQA 2JWDA 4H44B 1GK6A 3VMZA 2ZT9D 1PP9J 1R5SA 4GOEA 3AE2C 1HWTC 1L0LJ 1FDMA 1NYHA 2H7HA 1NU1D 1L0LK 3TGUD 2IFMA 1DD4A 2QJPC 5L8RJ 1USDA 4QMAA 4PV1C 3A0HH 1SQPD 2ZJSE 3D70A 2PGDA 4BWNA 1LWUC 1ZMEC 3LW5J 4AQRD 1LTIC 1SQVK 1EZVI 2A45G 3CX5D 1L0NJ 1J1EB 3II6A 4DOJA 2B9BA 1X0TA 3M9QA 2FY8A 3V2QA 3V4QA 2JWAA 1PGJA 1EZVE 5DJTB 5APVA 1KD1Q 2OYIC 2WT7B 1LTSC 1L0NK 1G1IA 1YQ3C 2G8YA 2WITA 2XNDH 3C8VA 3S4RA 1M7LA 1AA0A 1BDDA 1QLED 1LT9B 2AEMA 4NPFX 4ZMDA 1IZNB 1M90Q 1PGOA 1UIXA 1NTKD 1YTZI 3CWBJ 1Q86Q 1RY3A 1FDOA 2HFED 2NPSC 1SFCD 1U7MA 1FBMA 1IFPA 1NTMG 1PPJG 1SQBG 1URQB 3H6PA 1VF5C 2WQYC 3KHUA 4O9BA 4I2LC 4BXLA 3NXSA 3CC7P 2KI7B 1U57A 2M0BA 1MV8A 3N4XA 2OYHB 3L74D 3VMAA 4H44C 4U7JA 3H25A 3CCUP 2QM8A 2IFNA 4B86A 1BGYG 1GL2C 3GHGC 1OIPA 2KOGA 3VYIA 1JY2O 2QE7H 3TGUG 4JBZA 2QG4A 1LJ2A 5APUA 5GTHE 4PD4I 3KDPB 4UB6H 1EDIA 1SQVG 3Q5RA 3BRTB 2KK7A 4LLHA 2OYIA 2LXCB 2QJPB 1NO4A 3G3ZA 3M91A 2FXPA 4GKGA 1VQMP 4EDFA 1RF1B 1N86A 1JCDA 2BEQD 2IBZE 3B8EB 3M0DA 4H0LC 5CJ0A 1VQ6P 3L72J 1LNQA 3AE5C 3GLMA 3WU2H 1FZCB 2OGUA 2W83C 3EWKA 3H1HD 4HH2A 2I8DA 4ASWA 3CX5H 5M1BA 2RKLA 2KLVA 1AQTA 2HPCA 1YIJP 1P84E 1QEXA 2YO3A 3IR9A 1K05A 1NVOA 2JKVA 1RE4C 1VF5D 2MKVA 2P58A 3CCMP 1PP9G 4NPDA 1J1EC 3IN6A 3AE8C 2FKWB 3CMEP 3MP7B 1EC5A 1SQQJ 2IZ0A 1GL2D 1BE3J 2CPBA 1N8RQ 3H1HE 5KLIB 4JYBA 1L4AA 3E7KA 2C0XA 1JY2N 1ZRTD 3H1LE 3EFFK 1SFCA 3FX0A 3JCUE 4C7RA 4XA4A 4IFDK 1BDCA 2YNYA 2P7JA 2N1TD 4PD4E 1DEBA 2ZVOB 3HE4A 1M8OB 1LWUB 3GG2A 1E79H 3WMM0 1NTZG 1SQXD 5KLVE 3Q5PA 1HH0A 1YI2P 1IK7A 1T2KD 2M3BA 1VQLP 3L36A 1KFMA 3SWFA 3PLNA 4L76A 1K04A 4WY4A 3PRJA 4C7NB 2IZ1A 2K37A 2NPSA 2GA1A 1FC2C 1VL2A 2QVAA 2Q6QA 2LKMA 1J2JB 3A7OA 3BRVB 1VQ7P 3N7NA 2Q3IA 2BEZF 4RJTA 3H1IJ 2H89C 4D6TG 1JY3O 4PD4D 5AW8B 3RL0D 5CCHA 1FZCA 1OVRA 3PP5A 5BU5A 3ITKA 3T97B 4IFMA 1NJIQ 2GM4A 1AVYA 1KQGB 1FJKA 2IBZG 1JEKA 5AW3B 4H0LB 3RL0g 1KQSO 1VQNP 1EQ7A 2OYHC 1S9KE 5KAIE 1JB0J 2QA4P 1KYOE 2PFXA 3GHGB 3H1KD 1VQ5P 1L0NG 1SQBD 1NTKK 1OW6A 1KB9D 2JO1A 3A0HE 2K3RA 3BASA 1LT1A 2GUSA 1N2DC 1EZVG 2A45I 2XZRA 1AJYA 1YITP 3OW2O 3L74G 1S1CX 1SLQA 4GODA 3IAOA 3PHLA 5AW5B 1N7LA 1NTZD 2OARA 2YKPA 1FDIA 3H32A 1GL2A 1YYCA 3MUDC 1M56D 2K88A 1SQPK 3D71A 3C1LA 1PL5A 3M06A 1OX3A 3TNUB 3G71P 4H13B 3P7KA 1BCCD 4UB8H 5APWA 1Y9BA 1SQBJ 5H2FE 2V7QJ 2N1TA 3OJAB 1EDLA 3H1KJ 3MD0A 2P1JA 2Y0DA 3VN0A 1A02F 2BCCG 3FXDA 1SQQE 2WPSA 3HD7C 1FOSE 3MGNA 2WSFH 4RKUJ 1HBWA 1LTJA 2M5AA 1T3JA 2Z5HA 3H1HJ 1K73Q 3M0AA 1L4AC 1OW8A 3FXEA 1RF0A 2NPSD 2A45H 3MHVA 2K9YA 2ZT9C 1JNMA 3CC2P 2PP6A 1BCCE 1G2CA 1X79B 2IPPA 2P2UA 1LTAC 3AE9C 3OAKA 1KYOI 3W68A 2ZYDA 2IBZI 3RK3D 3F89A 4R4LA 1QL1A 3A0BE 3I5CA 2I1KA 3F5HA 2R32A 5K5GB 1JY2P 3BCCE 1SQXJ 4Y28J 1LT9A 4JYCA 3L74J 3WU2E 2E76D 3K5BA 4U3FG 1MUUA 2ZFCA 1M1JA 2W6AA 5GTHH 2OTKE 3AEBC 1R5LA 2WPRA 3CXHD 2WVRA 3VTPC 2HPCB 2LXBA 1QVFO 3CD6P 1NHLA 2FFDA 4WVZA 1KYOD 4H13C 1BE3D 3LIEA 3L74E 5APSA 4ZKPA 3L70G 1RF0C 2B88A 3AEFC 3U1CA 2OYHA 3P8CD 2E5YA 3CCVP 4ASVA 2R3CA 5TISH 2IYPA 3MTUE 1HTLC 3D6YA 1LTTC 2POHA 3CCLP 3E1RA 2AXTE 1OVUA 2KZIA 5KLVD 1SP4A 1T6AA 2QJYB 1IFMA 3WUVA 1EXIA 1RQVA 3V5BA 3CCQP 3CCSP 2OYIB 5AVYB 4OGQB 5AW1B 1G1JA 1MKMA 1SQQG 1BE3E 3L75G 5CCGD 2J59M 4UB6E 2FYUJ 3FWLA 4IL6E 3P8CE 1FZBA 3B5NB 1NU1J 1CI6B 1NH4A 1FOSF 2LR2A 1FZCC 1VQOP 2QM7A 1P84D 3AE7C 3V2PA 5B5EE 1BCCG 2AXCA 2MJZA 2ZXXA 3Q1MA 3AEGC 1T2KC 1SS1A 5AW0B 2E43A 5AW9B 4DCKA 5C39A 2YKOA 4PD4H 1K9MQ 5APYA 3PH0A 4WB4A 2KNCB 2KS1A 1YJWP 2E42A 1KV4A 1KMIZ 3L73G 2JP3A 2KXPB 1NTZK 2K1AA 3Q2YA 2XV5A 3GMAA 3L35A 1SQQK 1W2BO 1L0NE 1Z56A 3H1LD 4BRYB 1HJBA 1L4AB 4N6JA 1DD3A 4U3FJ 4DZOA 1SFCB 1GU5A 3VP9A 1H89A 1KYOH 2E5TA 3BCCD 5E79H 3CWBD 4D6TD 3TGUE 2G3AA 3HUSA 1J1DC 3MUDA 2PAJA 1NTMD 1PPJD 2FYUK 3HE4B 1L4AD 5APQA 1SQPE 1IJDB 2R5BA 2O01N 4L74A 4EYYQ 1KQFB 1NOHA 1D7MA 2B87B 3CXHE 1S5LH 1EDJA 1HUCA 2YXRB 1GMJA 2V7QH 2JR8A 1R8EA 2E75C 2WSEH 4KT0J 1L0ND 2W6JH 1S5LE 3CXHH 5AVUB 3VMXA 3CI9A 1CSBA 4UB8E 3H1LJ 2O01J 3CWBE 4W7YA 5AW4B 4EI2A 5AVRB 1KB9H 2HLOA 2L91A 1U7JA 1HVVA 1JCCA 2P67A 3L71E 1YQ4C 2Z5IA 5TJHA 1BE3G 1E5WA 3L75E 2Y9ZA 1N73A 2C0WA 1JTHB 2FYNB 1L0LD 1SVFA 3AE3C 4PJ0E 4RO0A 5APTA 4RESB 4YTPC 5GTIE 5EFWB 1GW3A 3H1KE 3L71J 2QRXA 2Q3EA 4HKZH 5B66E 1Q7YQ 2L5GB 2Q9IA 3CCEP 1VPCA 1JMMA 3H1JE 2M3EA 2CPSA 3HTKB 2A06G 1SFCC 3L37A 1K8AQ 3H32B 4W80A 1KQLA 1J1DB 5KLVK 4OVNF 2E75D 2XDJA 3V4WA 3M0DC 2WPVB 2WSFJ 3AE4C 3TSIA 5KTBA 1GD2E 1H88A 1XTCC 2N1TB 2E75B 2HYNA 1FS0E 1SQVJ 2DW3A 3CLQA 1ZV8A 4JPZB 4MN4C 1HJ0A 2R44A 4JF7A 5CBOA 3BVHA 1FE6A 5KLVJ 3A0BH 1P84I 1SQXG 2YMYA 5H2FH 4D6TE 3HE5A 1LTJB 2D2CB 2E76C 2M5AB 2SPZA 3L73D 3NMDA 1WT6A 5DJUB 5AW7B 4D6TJ 3Q5SA 3A5TA 4U3FD 1MFZA 2KSEA 1DIPA 1N7SB 3VOPA 5TISE 1N73C 1KILB 3L70D 2WWWA 1W5CE 2D2CD 3L72G 3LIDA 2WZ7A 4OH8B 1PGQA 1G2CB 3IFMA 5AVZB 1USEA 2FYUE 4GOFA 4I7ZC 2I1JA 3CWBG 1DH3A 1GDTA 5CMZA 5AW6B 3C9IA 2KP8A 1IC2A 1ZRTE 1OMIA 2W6BA 3H1IE 3RK2B 2OTJP 1JO5A 1H0TA 4LGDE 4H0LD 3AE1C 4OWFA 1HGVA 3PTZA 1Q2NA 1ZXGA 3RK2D 1ZLLA 2FBWC 2RH0A 4YXWH 2H43A 1QX8A 3EFGA 3L75D 4Z1MH 1OWAA 3L70E 1RQUA 3CCRP 1IK9A 1M1JB 4OGQC 5KJ7C 4KJMA 1L0LE 2YXQB 1VQ9P 3GF7A 1NTMK 2FYUD 1S3JA 1YBKA 3H1JG 4EIJA 2FFDB 2HR3A 1EZVD 1Q90D 3CX5I 2A06E 3V6IA 1RE3A 4H44D 2UWJE 2ZT9B 4IOIH 3VMYA 5CCHC 4AUWA 5KKZB 2Y0EA 1RHZB 4R4MA 4IL6H 1OW7A 1CW5A 2C9NY 3B4SA 3R2PA 3EQ2A 4IL6X 1BGYJ 4N78D 5CHXA 2J5UA 3I55P 2VRSA 3CL3D 3GW6A 3GF3A 1EDKA 3UIAA 1SQPG 2P10A 2K9JA 1IO4A 4Y99C 1N7SC 3I56P 2HODA 2ZYAA 2QJKC 2HG5D 2WSEJ 3NFQA 1GK4A 3O6QB 5AVTB 3S1KA 2AXTH 2A06D 1NTZJ 1IFJA 3MZWB 2R3SA 2AEFA 1LTJC 2D2CC 1DEEG 2Y9YA 1LP1B 3B5NA 3U59A 1CI6A 1OXZA 3TK1A 1X8YA 5CCGA 5AVWB 3HD7A 2NRGA 3BCCG 2NZ2A 3FWNA 4N78E 1KILC 4K35A 3RBXA 3SFDC 3L73E 2RMZA 4W7ZA 2WTYA 1FZGA 2WSCJ 4U3FE 1ZN5A 4TLFA 1JM0A 4I7ZB 1FZAA 1KZUB 1L2PA 1S5LX 2KYVA 3R4YA 4IFFA 3RL0C 3KPEA 1TU3F 5KAFH 2KNCA 2KS1B 3MIWA 4PV1B 3QWOC 1FZEA 2W90A 3G9RA 5BU8B 3TYYA 5E79E 2QSIA 2FFDC 2BASA 2QJYC 1S2EA 2WPQA 3H1ID 3JC22 4K3AA 2E76B 2Q7CA 4PJ0H 4BRYA 1VQ4P 1DX7A 1KILE 2JDIH 2XKMA 3W67A 5GTIH 1KORA 4GT1A 4DJGA 2YKQA 2O1KA 1L0LG 2M8RA 1NTME 1PPJE 3HUSB 1S72P 1AQ5A 3JSVC 3H1JJ 2WMMA 2W27A 3TDKA 3B5NC 1XTGB 2OTLP 1FJPA 2B87A 2O01H 4Y99B 1AV1A 2XU6A 2QJKB 4XE5B 5AVSB 1BCCJ 2YIUC 1YJ9P 5KJ7A 1N7SD 1KILD 1RH5B 1M1KQ 5AVVB 2WSCH 3RK3B 2KIKA 3BATA 1JY3N 2KSJA 4HJGH 2FXOA 2QEXP 1FZFA 3CC4P 2E74D 3H1KG 1H0TB 1N73B 4JQ0D 2ZYGA 3HRNA 3A2AA 2CK3H 1Q82Q 2H8PD 4XFJA 1W2EA 1JTHA 1VQKP
chains in the Genus database with same CATH topology
1EDLA 2B89A 3FXDA 2M5AA 1X0TA 3FXEA 5DJTB 1OVVA 3MHVA 4MN4C 5CBOA 2R44A 1BDDA 4NPFX 4ZMDA 2M5AB 5DJUB 2SPZA 1U7MA 4BXLA 5K5GB 2KI7B 2M0BA 4GOFA 1ZW0A 2OTKE 2LXBA 4JBZA 1Q2NA 1ZXGA 1EDIA 2B88A 2LXCB 4ASVA 4KJMA 3RGUA 2KZJA 1S3JA 1OVUA 2KZIA 2HR3A 1JMBA 2I8DA 4ASWA 4IOIH 2UWJE 2RKLA 3ZDMA 1NVOA 1Y47A 2P58A 4NPDA 1EDKA 1EC5A 2LR2A 3S1KA 2ZAEB 1SS1A 3MZWB 5C39A 1DEEG 1LP1B 3PH0A 1BDCA 4K35A 4NPEA 2Q1KA 1JM0A 1LP1A 4CPGA 2KS1B 3QWOC 1FC2C 2QVAA 4EYYQ 4K3AA 2B87B 1EDJA 4WWIA 1OVRA 5CBNA 4HB1A 4ZNCA 2WMMA 1MFTA 2B87A 1U7JA 1H0TA 2K3RA 1LT1A 2KUBA 4GODA 2JWDA 2KIKA 4HJGH 5EFWB 2QRXA 4GOEA 4HKZH 1H0TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EDL A;  2B89 A;  3FXD A;  2M5A A;  1X0T A;  3FXE A;  5DJT B;  1OVV A;  3MHV A;  4MN4 C;  5CBO A;  2R44 A;  1BDD A;  4NPF X;  4ZMD A;  2M5A B;  5DJU B;  2SPZ A;  1U7M A;  4BXL A;  5K5G B;  2KI7 B;  2M0B A;  4GOF A;  1ZW0 A;  2OTK E;  2LXB A;  4JBZ A;  1Q2N A;  1ZXG A;  1EDI A;  2B88 A;  2LXC B;  4ASV A;  4KJM A;  3RGU A;  2KZJ A;  1S3J A;  1OVU A;  2KZI A;  2HR3 A;  1JMB A;  2I8D A;  4ASW A;  4IOI H;  2UWJ E;  2RKL A;  3ZDM A;  1NVO A;  1Y47 A;  2P58 A;  4NPD A;  1EDK A;  1EC5 A;  2LR2 A;  3S1K A;  2ZAE B;  1SS1 A;  3MZW B;  5C39 A;  1DEE G;  1LP1 B;  3PH0 A;  1BDC A;  4K35 A;  4NPE A;  2Q1K A;  1JM0 A;  1LP1 A;  4CPG A;  2KS1 B;  3QWO C;  1FC2 C;  2QVA A;  4EYY Q;  4K3A A;  2B87 B;  1EDJ A;  4WWI A;  1OVR A;  5CBN A;  4HB1 A;  4ZNC A;  2WMM A;  1MFT A;  2B87 A;  1U7J A;  1H0T A;  2K3R A;  1LT1 A;  2KUB A;  4GOD A;  2JWD A;  2KIK A;  4HJG H;  5EFW B;  2QRX A;  4GOE A;  4HKZ H;  1H0T B; 
#chains in the Genus database with same CATH topology
 1GW4 A;  3RL0 B;  4YXD C;  2E74 B;  3SFE C;  2B89 A;  1LTG C;  1LGH B;  2WT7 A;  1GTW A;  3O8Z A;  5KKZ C;  1Q81 Q;  1PIX A;  1YHQ P;  1OFC X;  1RF1 C;  4L75 A;  1NKZ B;  1HGZ A;  2N9B A;  1RE4 A;  2WSS H;  3H1J D;  3LW5 H;  1UII A;  1X22 A;  3P8M C;  1T8Z A;  5KAI H;  2Z4E A;  2O1J A;  1JY3 P;  1NTK E;  2ITA A;  1NKN A;  3HTK A;  1RE3 C;  1OVV A;  1URQ A;  2XNX A;  1HF9 A;  1FAV A;  5CJ4 A;  1S9K D;  3S9O A;  3L75 J;  2Q5U A;  1LTB C;  1BSN A;  1SQB E;  2GUV A;  1PFI A;  4A7P A;  1SQB K;  3M9B A;  4I1L A;  2ZXE B;  4GIF A;  3U1A A;  2FYZ A;  3PJS K;  3AEE C;  3HUS C;  1QGK B;  2AEJ A;  2FYN C;  1NTZ E;  5KLI C;  5KLV G;  3Q3D A;  1BGY E;  3RK3 C;  1ZW0 A;  2R5D A;  3WUU A;  4WY4 C;  3HE5 B;  3L71 G;  4LC1 A;  1QVG O;  1A02 J;  2FYU G;  1EXJ A;  1RF1 A;  1YTZ T;  3L70 J;  5KJ7 D;  5B5E H;  1PZQ A;  1N7S A;  1IFN A;  2KLU A;  2N9Y B;  2H88 C;  1KIL A;  2YIU B;  3AED C;  2QIW A;  4TT3 H;  3L73 J;  1GZL A;  1NTK J;  3KYQ A;  1WRG A;  1KN7 A;  1SQQ D;  1ZOY C;  1H8A A;  1FU1 A;  3G6E P;  5AVQ B;  1SQV D;  2YO2 A;  3RGU A;  1BGY D;  2KZJ A;  3L4F A;  4PV1 D;  3USS A;  3D6Z A;  3QH9 A;  1VQ8 P;  1JMB A;  1CZQ A;  2PRR A;  2YMK A;  4GDO A;  1NU1 G;  1QL2 A;  2N1T C;  3TF5 A;  1NU1 K;  1ZR2 A;  1P84 H;  1JOC A;  1T3U A;  1IFI A;  3FGA D;  3ZDM A;  1NAF A;  1SQP J;  2ZVN B;  3SWY A;  1ZR4 A;  3RK3 E;  2OYO A;  1Y47 A;  3L72 D;  1BSH A;  3CPW O;  1X9V A;  4H13 D;  3CMA P;  5CCG C;  2J58 A;  1URQ D;  1KTM A;  1NWQ A;  2V4H A;  1IFD A;  1SQV E;  4WY4 D;  1LWU A;  3H1H G;  2Y0C A;  3V2R A;  3H1L G;  1AVO A;  4EOT A;  3L71 D;  1PP9 D;  1SQX E;  2ZAE B;  3KZI H;  3OA7 A;  4M3L A;  4HYT B;  4YPC A;  5AVX B;  4WY4 B;  3AEA C;  2E74 C;  3E1I A;  3RK2 C;  1YJN P;  3CX5 E;  2JJL A;  4C7N A;  4WBA A;  2NPS B;  2K9J B;  3NTN A;  1JUN A;  5APX A;  5AW2 B;  5CCH D;  3L72 E;  3CCJ P;  1ZP0 C;  2HOD B;  2IYO A;  2BCC E;  3B71 A;  1KFN A;  3KZI E;  3O6Q A;  4NPE A;  3ABV C;  1WMK A;  2Q1K A;  3V2N A;  4L73 A;  3H1I G;  3M9H A;  4OGQ D;  3T97 A;  3A3Y B;  1LP1 A;  4KHX A;  3SSU A;  1M1J C;  4CPG A;  1PP9 E;  3IF4 A;  1SQX K;  2BCC J;  3HD7 B;  3WUT A;  4N3Y B;  1AFO A;  2IX7 C;  2O3J A;  1LT9 C;  3AE6 C;  3P32 A;  2FXM A;  3RBZ A;  2KB7 P;  2IDB A;  3JCU H;  3B5N D;  3KQG A;  3VP8 A;  4ZKU A;  2C9L Y;  1PV3 A;  3GHG A;  4WWI A;  1VQP P;  3HD7 D;  1NTM J;  1URQ C;  2BCC D;  1VF5 B;  4DT0 A;  3CXH I;  3KXD A;  1KB9 E;  1PGP A;  1VDF A;  1Y8A A;  3SWK A;  3BCC J;  5CBN A;  4HB1 A;  3AEC C;  4ZNC A;  1GU4 A;  1M57 D;  1KC8 Q;  1KB9 I;  4I6M C;  1MFT A;  1NU1 E;  5BVZ A;  1NGM B;  1GL2 B;  5KAF E;  1S4X A;  2RN0 A;  3TGU J;  2JEE A;  1NTK G;  5B66 H;  3G4S P;  1NAY A;  1MZ9 A;  4AYC A;  3TNU A;  1OZH A;  2W8Z A;  4C46 A;  2KUB A;  2IBZ D;  2OQQ A;  2JWD A;  4H44 B;  1GK6 A;  3VMZ A;  2ZT9 D;  1PP9 J;  1R5S A;  4GOE A;  3AE2 C;  1HWT C;  1L0L J;  1FDM A;  1NYH A;  2H7H A;  1NU1 D;  1L0L K;  3TGU D;  2IFM A;  1DD4 A;  2QJP C;  5L8R J;  1USD A;  4QMA A;  4PV1 C;  3A0H H;  1SQP D;  2ZJS E;  3D70 A;  2PGD A;  4BWN A;  1LWU C;  1ZME C;  3LW5 J;  4AQR D;  1LTI C;  1SQV K;  1EZV I;  2A45 G;  3CX5 D;  1L0N J;  1J1E B;  3II6 A;  4DOJ A;  2B9B A;  1X0T A;  3M9Q A;  2FY8 A;  3V2Q A;  3V4Q A;  2JWA A;  1PGJ A;  1EZV E;  5DJT B;  5APV A;  1KD1 Q;  2OYI C;  2WT7 B;  1LTS C;  1L0N K;  1G1I A;  1YQ3 C;  2G8Y A;  2WIT A;  2XND H;  3C8V A;  3S4R A;  1M7L A;  1AA0 A;  1BDD A;  1QLE D;  1LT9 B;  2AEM A;  4NPF X;  4ZMD A;  1IZN B;  1M90 Q;  1PGO A;  1UIX A;  1NTK D;  1YTZ I;  3CWB J;  1Q86 Q;  1RY3 A;  1FDO A;  2HFE D;  2NPS C;  1SFC D;  1U7M A;  1FBM A;  1IFP A;  1NTM G;  1PPJ G;  1SQB G;  1URQ B;  3H6P A;  1VF5 C;  2WQY C;  3KHU A;  4O9B A;  4I2L C;  4BXL A;  3NXS A;  3CC7 P;  2KI7 B;  1U57 A;  2M0B A;  1MV8 A;  3N4X A;  2OYH B;  3L74 D;  3VMA A;  4H44 C;  4U7J A;  3H25 A;  3CCU P;  2QM8 A;  2IFN A;  4B86 A;  1BGY G;  1GL2 C;  3GHG C;  1OIP A;  2KOG A;  3VYI A;  1JY2 O;  2QE7 H;  3TGU G;  4JBZ A;  2QG4 A;  1LJ2 A;  5APU A;  5GTH E;  4PD4 I;  3KDP B;  4UB6 H;  1EDI A;  1SQV G;  3Q5R A;  3BRT B;  2KK7 A;  4LLH A;  2OYI A;  2LXC B;  2QJP B;  1NO4 A;  3G3Z A;  3M91 A;  2FXP A;  4GKG A;  1VQM P;  4EDF A;  1RF1 B;  1N86 A;  1JCD A;  2BEQ D;  2IBZ E;  3B8E B;  3M0D A;  4H0L C;  5CJ0 A;  1VQ6 P;  3L72 J;  1LNQ A;  3AE5 C;  3GLM A;  3WU2 H;  1FZC B;  2OGU A;  2W83 C;  3EWK A;  3H1H D;  4HH2 A;  2I8D A;  4ASW A;  3CX5 H;  5M1B A;  2RKL A;  2KLV A;  1AQT A;  2HPC A;  1YIJ P;  1P84 E;  1QEX A;  2YO3 A;  3IR9 A;  1K05 A;  1NVO A;  2JKV A;  1RE4 C;  1VF5 D;  2MKV A;  2P58 A;  3CCM P;  1PP9 G;  4NPD A;  1J1E C;  3IN6 A;  3AE8 C;  2FKW B;  3CME P;  3MP7 B;  1EC5 A;  1SQQ J;  2IZ0 A;  1GL2 D;  1BE3 J;  2CPB A;  1N8R Q;  3H1H E;  5KLI B;  4JYB A;  1L4A A;  3E7K A;  2C0X A;  1JY2 N;  1ZRT D;  3H1L E;  3EFF K;  1SFC A;  3FX0 A;  3JCU E;  4C7R A;  4XA4 A;  4IFD K;  1BDC A;  2YNY A;  2P7J A;  2N1T D;  4PD4 E;  1DEB A;  2ZVO B;  3HE4 A;  1M8O B;  1LWU B;  3GG2 A;  1E79 H;  3WMM 0;  1NTZ G;  1SQX D;  5KLV E;  3Q5P A;  1HH0 A;  1YI2 P;  1IK7 A;  1T2K D;  2M3B A;  1VQL P;  3L36 A;  1KFM A;  3SWF A;  3PLN A;  4L76 A;  1K04 A;  4WY4 A;  3PRJ A;  4C7N B;  2IZ1 A;  2K37 A;  2NPS A;  2GA1 A;  1FC2 C;  1VL2 A;  2QVA A;  2Q6Q A;  2LKM A;  1J2J B;  3A7O A;  3BRV B;  1VQ7 P;  3N7N A;  2Q3I A;  2BEZ F;  4RJT A;  3H1I J;  2H89 C;  4D6T G;  1JY3 O;  4PD4 D;  5AW8 B;  3RL0 D;  5CCH A;  1FZC A;  1OVR A;  3PP5 A;  5BU5 A;  3ITK A;  3T97 B;  4IFM A;  1NJI Q;  2GM4 A;  1AVY A;  1KQG B;  1FJK A;  2IBZ G;  1JEK A;  5AW3 B;  4H0L B;  3RL0 g;  1KQS O;  1VQN P;  1EQ7 A;  2OYH C;  1S9K E;  5KAI E;  1JB0 J;  2QA4 P;  1KYO E;  2PFX A;  3GHG B;  3H1K D;  1VQ5 P;  1L0N G;  1SQB D;  1NTK K;  1OW6 A;  1KB9 D;  2JO1 A;  3A0H E;  2K3R A;  3BAS A;  1LT1 A;  2GUS A;  1N2D C;  1EZV G;  2A45 I;  2XZR A;  1AJY A;  1YIT P;  3OW2 O;  3L74 G;  1S1C X;  1SLQ A;  4GOD A;  3IAO A;  3PHL A;  5AW5 B;  1N7L A;  1NTZ D;  2OAR A;  2YKP A;  1FDI A;  3H32 A;  1GL2 A;  1YYC A;  3MUD C;  1M56 D;  2K88 A;  1SQP K;  3D71 A;  3C1L A;  1PL5 A;  3M06 A;  1OX3 A;  3TNU B;  3G71 P;  4H13 B;  3P7K A;  1BCC D;  4UB8 H;  5APW A;  1Y9B A;  1SQB J;  5H2F E;  2V7Q J;  2N1T A;  3OJA B;  1EDL A;  3H1K J;  3MD0 A;  2P1J A;  2Y0D A;  3VN0 A;  1A02 F;  2BCC G;  3FXD A;  1SQQ E;  2WPS A;  3HD7 C;  1FOS E;  3MGN A;  2WSF H;  4RKU J;  1HBW A;  1LTJ A;  2M5A A;  1T3J A;  2Z5H A;  3H1H J;  1K73 Q;  3M0A A;  1L4A C;  1OW8 A;  3FXE A;  1RF0 A;  2NPS D;  2A45 H;  3MHV A;  2K9Y A;  2ZT9 C;  1JNM A;  3CC2 P;  2PP6 A;  1BCC E;  1G2C A;  1X79 B;  2IPP A;  2P2U A;  1LTA C;  3AE9 C;  3OAK A;  1KYO I;  3W68 A;  2ZYD A;  2IBZ I;  3RK3 D;  3F89 A;  4R4L A;  1QL1 A;  3A0B E;  3I5C A;  2I1K A;  3F5H A;  2R32 A;  5K5G B;  1JY2 P;  3BCC E;  1SQX J;  4Y28 J;  1LT9 A;  4JYC A;  3L74 J;  3WU2 E;  2E76 D;  3K5B A;  4U3F G;  1MUU A;  2ZFC A;  1M1J A;  2W6A A;  5GTH H;  2OTK E;  3AEB C;  1R5L A;  2WPR A;  3CXH D;  2WVR A;  3VTP C;  2HPC B;  2LXB A;  1QVF O;  3CD6 P;  1NHL A;  2FFD A;  4WVZ A;  1KYO D;  4H13 C;  1BE3 D;  3LIE A;  3L74 E;  5APS A;  4ZKP A;  3L70 G;  1RF0 C;  2B88 A;  3AEF C;  3U1C A;  2OYH A;  3P8C D;  2E5Y A;  3CCV P;  4ASV A;  2R3C A;  5TIS H;  2IYP A;  3MTU E;  1HTL C;  3D6Y A;  1LTT C;  2POH A;  3CCL P;  3E1R A;  2AXT E;  1OVU A;  2KZI A;  5KLV D;  1SP4 A;  1T6A A;  2QJY B;  1IFM A;  3WUV A;  1EXI A;  1RQV A;  3V5B A;  3CCQ P;  3CCS P;  2OYI B;  5AVY B;  4OGQ B;  5AW1 B;  1G1J A;  1MKM A;  1SQQ G;  1BE3 E;  3L75 G;  5CCG D;  2J59 M;  4UB6 E;  2FYU J;  3FWL A;  4IL6 E;  3P8C E;  1FZB A;  3B5N B;  1NU1 J;  1CI6 B;  1NH4 A;  1FOS F;  2LR2 A;  1FZC C;  1VQO P;  2QM7 A;  1P84 D;  3AE7 C;  3V2P A;  5B5E E;  1BCC G;  2AXC A;  2MJZ A;  2ZXX A;  3Q1M A;  3AEG C;  1T2K C;  1SS1 A;  5AW0 B;  2E43 A;  5AW9 B;  4DCK A;  5C39 A;  2YKO A;  4PD4 H;  1K9M Q;  5APY A;  3PH0 A;  4WB4 A;  2KNC B;  2KS1 A;  1YJW P;  2E42 A;  1KV4 A;  1KMI Z;  3L73 G;  2JP3 A;  2KXP B;  1NTZ K;  2K1A A;  3Q2Y A;  2XV5 A;  3GMA A;  3L35 A;  1SQQ K;  1W2B O;  1L0N E;  1Z56 A;  3H1L D;  4BRY B;  1HJB A;  1L4A B;  4N6J A;  1DD3 A;  4U3F J;  4DZO A;  1SFC B;  1GU5 A;  3VP9 A;  1H89 A;  1KYO H;  2E5T A;  3BCC D;  5E79 H;  3CWB D;  4D6T D;  3TGU E;  2G3A A;  3HUS A;  1J1D C;  3MUD A;  2PAJ A;  1NTM D;  1PPJ D;  2FYU K;  3HE4 B;  1L4A D;  5APQ A;  1SQP E;  1IJD B;  2R5B A;  2O01 N;  4L74 A;  4EYY Q;  1KQF B;  1NOH A;  1D7M A;  2B87 B;  3CXH E;  1S5L H;  1EDJ A;  1HUC A;  2YXR B;  1GMJ A;  2V7Q H;  2JR8 A;  1R8E A;  2E75 C;  2WSE H;  4KT0 J;  1L0N D;  2W6J H;  1S5L E;  3CXH H;  5AVU B;  3VMX A;  3CI9 A;  1CSB A;  4UB8 E;  3H1L J;  2O01 J;  3CWB E;  4W7Y A;  5AW4 B;  4EI2 A;  5AVR B;  1KB9 H;  2HLO A;  2L91 A;  1U7J A;  1HVV A;  1JCC A;  2P67 A;  3L71 E;  1YQ4 C;  2Z5I A;  5TJH A;  1BE3 G;  1E5W A;  3L75 E;  2Y9Z A;  1N73 A;  2C0W A;  1JTH B;  2FYN B;  1L0L D;  1SVF A;  3AE3 C;  4PJ0 E;  4RO0 A;  5APT A;  4RES B;  4YTP C;  5GTI E;  5EFW B;  1GW3 A;  3H1K E;  3L71 J;  2QRX A;  2Q3E A;  4HKZ H;  5B66 E;  1Q7Y Q;  2L5G B;  2Q9I A;  3CCE P;  1VPC A;  1JMM A;  3H1J E;  2M3E A;  2CPS A;  3HTK B;  2A06 G;  1SFC C;  3L37 A;  1K8A Q;  3H32 B;  4W80 A;  1KQL A;  1J1D B;  5KLV K;  4OVN F;  2E75 D;  2XDJ A;  3V4W A;  3M0D C;  2WPV B;  2WSF J;  3AE4 C;  3TSI A;  5KTB A;  1GD2 E;  1H88 A;  1XTC C;  2N1T B;  2E75 B;  2HYN A;  1FS0 E;  1SQV J;  2DW3 A;  3CLQ A;  1ZV8 A;  4JPZ B;  4MN4 C;  1HJ0 A;  2R44 A;  4JF7 A;  5CBO A;  3BVH A;  1FE6 A;  5KLV J;  3A0B H;  1P84 I;  1SQX G;  2YMY A;  5H2F H;  4D6T E;  3HE5 A;  1LTJ B;  2D2C B;  2E76 C;  2M5A B;  2SPZ A;  3L73 D;  3NMD A;  1WT6 A;  5DJU B;  5AW7 B;  4D6T J;  3Q5S A;  3A5T A;  4U3F D;  1MFZ A;  2KSE A;  1DIP A;  1N7S B;  3VOP A;  5TIS E;  1N73 C;  1KIL B;  3L70 D;  2WWW A;  1W5C E;  2D2C D;  3L72 G;  3LID A;  2WZ7 A;  4OH8 B;  1PGQ A;  1G2C B;  3IFM A;  5AVZ B;  1USE A;  2FYU E;  4GOF A;  4I7Z C;  2I1J A;  3CWB G;  1DH3 A;  1GDT A;  5CMZ A;  5AW6 B;  3C9I A;  2KP8 A;  1IC2 A;  1ZRT E;  1OMI A;  2W6B A;  3H1I E;  3RK2 B;  2OTJ P;  1JO5 A;  1H0T A;  4LGD E;  4H0L D;  3AE1 C;  4OWF A;  1HGV A;  3PTZ A;  1Q2N A;  1ZXG A;  3RK2 D;  1ZLL A;  2FBW C;  2RH0 A;  4YXW H;  2H43 A;  1QX8 A;  3EFG A;  3L75 D;  4Z1M H;  1OWA A;  3L70 E;  1RQU A;  3CCR P;  1IK9 A;  1M1J B;  4OGQ C;  5KJ7 C;  4KJM A;  1L0L E;  2YXQ B;  1VQ9 P;  3GF7 A;  1NTM K;  2FYU D;  1S3J A;  1YBK A;  3H1J G;  4EIJ A;  2FFD B;  2HR3 A;  1EZV D;  1Q90 D;  3CX5 I;  2A06 E;  3V6I A;  1RE3 A;  4H44 D;  2UWJ E;  2ZT9 B;  4IOI H;  3VMY A;  5CCH C;  4AUW A;  5KKZ B;  2Y0E A;  1RHZ B;  4R4M A;  4IL6 H;  1OW7 A;  1CW5 A;  2C9N Y;  3B4S A;  3R2P A;  3EQ2 A;  4IL6 X;  1BGY J;  4N78 D;  5CHX A;  2J5U A;  3I55 P;  2VRS A;  3CL3 D;  3GW6 A;  3GF3 A;  1EDK A;  3UIA A;  1SQP G;  2P10 A;  2K9J A;  1IO4 A;  4Y99 C;  1N7S C;  3I56 P;  2HOD A;  2ZYA A;  2QJK C;  2HG5 D;  2WSE J;  3NFQ A;  1GK4 A;  3O6Q B;  5AVT B;  3S1K A;  2AXT H;  2A06 D;  1NTZ J;  1IFJ A;  3MZW B;  2R3S A;  2AEF A;  1LTJ C;  2D2C C;  1DEE G;  2Y9Y A;  1LP1 B;  3B5N A;  3U59 A;  1CI6 A;  1OXZ A;  3TK1 A;  1X8Y A;  5CCG A;  5AVW B;  3HD7 A;  2NRG A;  3BCC G;  2NZ2 A;  3FWN A;  4N78 E;  1KIL C;  4K35 A;  3RBX A;  3SFD C;  3L73 E;  2RMZ A;  4W7Z A;  2WTY A;  1FZG A;  2WSC J;  4U3F E;  1ZN5 A;  4TLF A;  1JM0 A;  4I7Z B;  1FZA A;  1KZU B;  1L2P A;  1S5L X;  2KYV A;  3R4Y A;  4IFF A;  3RL0 C;  3KPE A;  1TU3 F;  5KAF H;  2KNC A;  2KS1 B;  3MIW A;  4PV1 B;  3QWO C;  1FZE A;  2W90 A;  3G9R A;  5BU8 B;  3TYY A;  5E79 E;  2QSI A;  2FFD C;  2BAS A;  2QJY C;  1S2E A;  2WPQ A;  3H1I D;  3JC2 2;  4K3A A;  2E76 B;  2Q7C A;  4PJ0 H;  4BRY A;  1VQ4 P;  1DX7 A;  1KIL E;  2JDI H;  2XKM A;  3W67 A;  5GTI H;  1KOR A;  4GT1 A;  4DJG A;  2YKQ A;  2O1K A;  1L0L G;  2M8R A;  1NTM E;  1PPJ E;  3HUS B;  1S72 P;  1AQ5 A;  3JSV C;  3H1J J;  2WMM A;  2W27 A;  3TDK A;  3B5N C;  1XTG B;  2OTL P;  1FJP A;  2B87 A;  2O01 H;  4Y99 B;  1AV1 A;  2XU6 A;  2QJK B;  4XE5 B;  5AVS B;  1BCC J;  2YIU C;  1YJ9 P;  5KJ7 A;  1N7S D;  1KIL D;  1RH5 B;  1M1K Q;  5AVV B;  2WSC H;  3RK3 B;  2KIK A;  3BAT A;  1JY3 N;  2KSJ A;  4HJG H;  2FXO A;  2QEX P;  1FZF A;  3CC4 P;  2E74 D;  3H1K G;  1H0T B;  1N73 B;  4JQ0 D;  2ZYG A;  3HRN A;  3A2A A;  2CK3 H;  1Q82 Q;  2H8P D;  4XFJ A;  1W2E A;  1JTH A;  1VQK P; 
#chains in the Genus database with same CATH homology
 1EDL A;  2B89 A;  3FXD A;  2M5A A;  1X0T A;  3FXE A;  5DJT B;  1OVV A;  3MHV A;  4MN4 C;  5CBO A;  2R44 A;  1BDD A;  4NPF X;  4ZMD A;  2M5A B;  5DJU B;  2SPZ A;  1U7M A;  4BXL A;  5K5G B;  2KI7 B;  2M0B A;  4GOF A;  1ZW0 A;  2OTK E;  2LXB A;  4JBZ A;  1Q2N A;  1ZXG A;  1EDI A;  2B88 A;  2LXC B;  4ASV A;  4KJM A;  3RGU A;  2KZJ A;  1S3J A;  1OVU A;  2KZI A;  2HR3 A;  1JMB A;  2I8D A;  4ASW A;  4IOI H;  2UWJ E;  2RKL A;  3ZDM A;  1NVO A;  1Y47 A;  2P58 A;  4NPD A;  1EDK A;  1EC5 A;  2LR2 A;  3S1K A;  2ZAE B;  1SS1 A;  3MZW B;  5C39 A;  1DEE G;  1LP1 B;  3PH0 A;  1BDC A;  4K35 A;  4NPE A;  2Q1K A;  1JM0 A;  1LP1 A;  4CPG A;  2KS1 B;  3QWO C;  1FC2 C;  2QVA A;  4EYY Q;  4K3A A;  2B87 B;  1EDJ A;  4WWI A;  1OVR A;  5CBN A;  4HB1 A;  4ZNC A;  2WMM A;  1MFT A;  2B87 A;  1U7J A;  1H0T A;  2K3R A;  1LT1 A;  2KUB A;  4GOD A;  2JWD A;  2KIK A;  4HJG H;  5EFW B;  2QRX A;  4GOE A;  4HKZ H;  1H0T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...