1LTTC

Lactose binding to heat-labile enterotoxin revealed by x-ray crystallography
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
41
structure length
41
Chain Sequence
GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
publication title Lactose binding to heat-labile enterotoxin revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
total genus 14
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 1992-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1lttC00
1LTTC 1LTSC 1LTAC 1LTGC 1XTCC 1LTIC 1HTLC 1LTBC
chains in the Genus database with same CATH superfamily
1K9MQ 1HTLC 4NPDA 1S1CX 3H1HE 3A2AA 3PJSK 4UB6E 4Y99B 1Q2NA 4KT0J 2E76D 1N7LA 4BRYA 1RF1C 1SQPE 1VQKP 2OYIA 1VL2A 1WRGA 1LTJB 2K88A 3H1JE 1OW7A 2JR8A 1CI6B 2YKQA 1GD2E 2IYOA 4K3AA 4HB1A 5B66H 2FFDB 1N7SB 2KSEA 3NMDA 4U3FJ 5AW9B 3CD6P 1HBWA 3RGUA 1CSBA 1JY2O 3MZWB 1AFOA 3JCUH 4PV1B 1GMJA 1NU1K 3H1KG 2KS1A 3LIEA 1IFMA 2KIKA 1S2EA 3BASA 3L74J 3MP7B 3L73D 4OH8B 1YQ3C 3V4QA 1RHZB 4EYYQ 1VF5C 2PGDA 3GG2A 3IR9A 4ZMDA 3H1LJ 4IFMA 2FYUK 4W7ZA 3CCUP 1YHQP 1G1IA 1NGMB 2OTKE 3TGUG 3AEDC 1URQC 4H0LB 3H1IJ 1WMKA 3IN6A 2KK7A 1FAVA 1NAFA 1BCCJ 1YBKA 3M9QA 2N1TB 1SQPD 2A45G 4EI2A 5KLVK 1KFMA 1OW8A 3CX5I 3M0DA 5GTHE 1EZVD 2FYUJ 2QM8A 3H1JD 3AE5C 3OA7A 1T8ZA 1W2BO 4TT3H 2AXTE 2W90A 3P8CE 4HKZH 2YNYA 4D6TD 1YTZI 3C9IA 3AE4C 5B5EH 3EFGA 5GTIH 1NU1E 4EIJA 3CCLP 2PP6A 2IZ0A 3KDPB 4TLFA 1IJDB 1MZ9A 1DH3A 1OXZA 2XKMA 1AVYA 2ZAEB 3L75E 3R4YA 3KXDA 3W68A 2WSFJ 4Y99C 2J58A 3TNUA 2ZVOB 3VTPC 3CI9A 1SQQJ 1GL2A 1FC2C 5AVZB 3JSVC 1U57A 3RL0C 3I55P 4LLHA 3CMEP 3RBXA 4IL6H 2AEJA 2MKVA 4U3FD 3GMAA 4RESB 4XFJA 5KAFH 2FFDC 1SFCD 2KLUA 3HE4B 1KILD 5KLVE 1KQLA 2ITAA 4KJMA 4PV1C 4C46A 1BSNA 2YMKA 4DJGA 2E74D 3CCMP 1PGJA 1EDIA 3MGNA 1YQ4C 4H44B 1FZEA 2BCCG 2NPSA 4GDOA 3VMZA 3HD7D 3L74D 5AW6B 1L4AD 1GK4A 1YTZT 1KC8Q 3H1LD 2O01J 4Z1MH 1JB0J 1AA0A 4I1LA 4H13D 2OTLP 3AE9C 3H1ID 5KKZB 1QX8A 4ZKPA 1JY3P 2KSJA 4NPEA 4M3LA 1TU3F 5KAIE 2JWAA 2N1TC 2M3BA 1Q7YQ 3B8EB 3TF5A 2FYUD 2WT7A 3U59A 1LTGC 3L72E 1ZR2A 1RE3A 3S9OA 1J1DB 1YJWP 1JCDA 4HJGH 2QRXA 3RK3C 1UIXA 3WU2E 1RE4A 1N73C 3EWKA 1EZVI 4N6JA 1X9VA 4GKGA 2JDIH 1ZP0C 2J59M 3AEFC 1PPJD 1JTHA 1LGHB 3CWBJ 2K1AA 3HTKB 2FYNC 5AW5B 1PIXA 2K9JB 1SQQD 2GM4A 3MUDA 1K04A 4A7PA 3L70J 4I7ZB 1GU4A 1IFNA 2OYHA 5CCGC 2Q5UA 3O6QA 1AQ5A 2O01H 1FJPA 2H7HA 3MTUE 2BASA 1DEEG 5E79H 2FXMA 2HPCA 3H1HG 4GOEA 2NZ2A 1GDTA 1K05A 3KYQA 4UB8E 4WY4A 2XNDH 1S72P 3B5NA 4GT1A 1X79B 2AXCA 2E43A 2OTJP 2Z4EA 1IC2A 3FXDA 2WWWA 1G2CB 4WB4A 1URQD 3G6EP 1FZCB 1HF9A 1S9KD 1VQMP 2NPSD 2BCCJ 2YKOA 5APUA 2RH0A 2KP8A 1L0NG 2A45H 2ZXXA 3CX5E 5KKZC 1NVOA 1ZLLA 3PLNA 5K5GB 1N8RQ 1GU5A 3BCCE 1ZRTD 2O3JA 4RO0A 1X0TA 3CC2P 1GTWA 3HUSC 1YITP 4ASWA 1BE3J 2BEZF 1RF1B 2E75C 2WPQA 1E5WA 2JJLA 4IFDK 1J1DC 2HFED 3R2PA 5BU5A 3SSUA 3CMAP 1DX7A 4KHXA 1SQXJ 3WMM0 2H8PD 2KUBA 3ZDMA 5AVSB 4JF7A 4PJ0H 2GUSA 4IOIH 3G3ZA 4R4MA 3CWBD 5CBOA 1JY3N 2HODA 2FBWC 3U1AA 1USEA 1M7LA 3KZIE 5APXA 4U7JA 3L70D 1T6AA 1N7SD 1YJ9P 5TISH 1FJKA 2KB7P 4I7ZC 1VF5B 1NU1G 1FZFA 3V2RA 4PV1D 3AE3C 2QVAA 4YXDC 1JY2P 5AVWB 1Q86Q 1KZUB 1DEBA 3KPEA 1M57D 5CCHD 4OWFA 2IFMA 1A02F 5CJ4A 1H88A 3UIAA 3Q1MA 1HWTC 4ASVA 1SVFA 4H0LD 1FDOA 1M56D 1LWUB 1M1JC 2Y0CA 3L73E 3SWFA 1LP1B 1SQVG 1T2KD 1VPCA 2BCCD 2N1TD 1LTBC 3N4XA 3P32A 3I56P 3VMAA 3AE1C 1BDCA 1HVVA 1SLQA 1LTAC 3D71A 3AE7C 2R5BA 2IBZD 1NTKG 3JCUE 3GHGB 1NWQA 1CW5A 1IO4A 2P67A 1KB9D 1L0LG 2Y0EA 1BE3D 2OQQA 5BU8B 1SFCA 2KNCA 1L0NJ 3SFEC 2WPVB 1KILA 1NTMJ 3K5BA 3RL0B 1EZVE 3H32B 3AEEC 2HG5D 4WWIA 2FXPA 4YTPC 3SWKA 1SQXD 4D6TE 3KQGA 3GF3A 1HJBA 3HD7A 3IF4A 5AVXB 2R3CA 1HGVA 1L4AA 2R44A 1ZMEC 1E79H 2CPBA 3CXHH 4WVZA 3L72G 1A02J 1K8AQ 3RK2B 5CCGD 1VDFA 3VP8A 2XU6A 1YIJP 2WMMA 3L37A 1X8YA 3M9HA 3W67A 1PL5A 2KZIA 2FKWB 3B4SA 1FDIA 2KLVA 4UB6H 2YXRB 3CC7P 2ZT9C 2K9YA 1GK6A 2W6AA 3LW5H 3AE8C 1GZLA 3H25A 3CXHD 4H44D 1YYCA 5B5EE 2Q9IA 1QL1A 1USDA 4L73A 4U3FE 1OVUA 3L71J 1K73Q 3D70A 2Y9ZA 2FY8A 4C7NA 1KILE 3JC22 4DZOA 3V2QA 1LT9B 2C9LY 1FBMA 4JYBA 2QA4P 1N86A 3RBZA 3AEAC 4K35A 3MIWA 1RF1A 2ZYAA 4W7YA 2I1JA 2YKPA 3RK3B 3L74E 1QLED 4IL6X 1AQTA 4JBZA 2JP3A 1N73B 4LGDE 1LWUC 4IL6E 1SQQK 3H1LE 4LC1A 1KV4A 1H0TA 3H6PA 3T97A 2WITA 2A06E 4GIFA 2Q7CA 1JY2N 1OW6A 1J2JB 3H1IE 1IK9A 1SQBG 2KOGA 1VQ4P 4AQRD 2FYNB 3GHGC 2ZFCA 1SQVJ 1BCCE 3L71E 2QSIA 3F89A 3S1KA 1L0ND 1NTMD 1MUUA 1JO5A 4EOTA 2FYUE 1VQ6P 2IBZI 3V2NA 5GTHH 1NTKJ 5APWA 3TDKA 1N2DC 1KB9I 1RY3A 2M0BA 1L0LJ 1BGYG 2RKLA 3IFMA 2AEMA 1URQA 5BVZA 2LKMA 5C39A 3RK2C 1PPJE 1ZN5A 2DW3A 4OGQB 2MJZA 1KYOH 1KD1Q 4Y28J 3S4RA 1NTZG 1SQQE 4JPZB 5APYA 5AW2B 1JM0A 3H1KJ 5APQA 3M06A 2A06D 3V6IA 2YO2A 5KJ7C 2OYHC 3PRJA 2JKVA 1BCCD 3L71D 1PZQA 3HE5B 5APVA 5H2FH 2QM7A 3HUSB 1EDKA 4BXLA 1LT9C 3TSIA 1HGZA 2E75B 3CXHI 1KQGB 2D2CC 3TGUJ 2B87B 2QJYB 3VP9A 1RF0A 1LTJA 2WTYA 1CI6A 2RN0A 1PP9G 1PGPA 2N9BA 1S9KE 5E79E 1QVFO 2FFDA 1G1JA 1N7SA 2Q3EA 1MFTA 1SQVD 5KTBA 1J1EB 1YI2P 1FZGA 1ZRTE 1Q90D 3L73G 3NFQA 3NTNA 5CHXA 1AJYA 1MKMA 1S5LH 2V7QH 1IFDA 5CCHA 1SQBJ 4BRYB 1NYHA 1L0LD 3IAOA 2OYIB 2WSCH 1OIPA 3P8MC 1IFIA 3M91A 3WU2H 1DD3A 2AEFA 1SQPG 2H89C 2P58A 2ZJSE 1IZNB 2QIWA 1VF5D 1EZVG 2N1TA 3H1JG 5CMZA 3A0HE 3CWBE 1BGYJ 1P84H 4OGQC 2R5DA 4D6TG 2Q1KA 3E7KA 3LIDA 1M1JB 2KS1B 1OVVA 1PGQA 3H1KD 3L70E 3SFDC 1NHLA 5AW1B 3V2PA 4N78D 5CJ0A 4PJ0E 1AVOA 1SQXK 1LTIC 2LR2A 1MV8A 2Y9YA 2K37A 2BEQD 4QMAA 1EDJA 3TGUD 4UB8H 2WSSH 2G8YA 2B88A 2QJYC 4YPCA 2FXOA 1KORA 5CCGA 4RKUJ 1VQ9P 1VQLP 3C1LA 4U3FG 1ZR4A 1KYOI 1OMIA 4N3YB 2M8RA 2L5GB 2Q3IA 2BCCE 1R5SA 1QEXA 3HE4A 3RL0D 1GW4A 1J1EC 2IBZE 1EC5A 3CX5H 2W6BA 1PP9J 1FU1A 2N9YB 1KB9E 3PH0A 1BE3E 2HR3A 3H1LG 2PFXA 1SQBD 2B89A 3TNUB 1U7JA 2ZT9B 1GL2B 2OYIC 3RK2D 1W2EA 3H1IG 4EDFA 3L75G 1SQXE 2E74C 3ITKA 2H88C 3PHLA 1CZQA 3CCRP 4RJTA 3FGAD 2P2UA 2FYUG 3L35A 1KN7A 1HJ0A 1BGYD 1DD4A 1R8EA 3HUSA 1PFIA 2B9BA 3AECC 4R4LA 3H1HJ 5KJ7D 1OFCX 3PP5A 4HH2A 3PTZA 1JMBA 3LW5J 2SPZA 5KLVG 3KZIH 2P10A 1L0NK 2XDJA 1M1KQ 1LT1A 3CCSP 5B66E 1NTMK 3I5CA 3HRNA 4GOFA 4O9BA 1H8AA 4PD4H 3CXHE 1OWAA 2QJPB 5CBNA 3RK3D 3A7OA 1SQQG 3HTKA 2K9JA 4C7RA 3E1IA 1Q81Q 1NAYA 2Z5IA 2ZVNB 1FS0E 3M0DC 1VQNP 2WT7B 4HYTB 5EFWB 1P84I 3FX0A 1LNQA 2OYOA 4PD4D 4MN4C 3USSA 1OX3A 3TYYA 2ZYGA 1ZW0A 2G3AA 3A0BH 1FDMA 5AVRB 2A45I 1KQFB 1PP9D 3OW2O 1OVRA 1JTHB 1LJ2A 3M9BA 2YIUB 2QJKB 1FZBA 1L0NE 1EXJA 1G2CA 1NTME 1FOSE 1VQ7P 3E1RA 1FZCA 3CPWO 1M1JA 1GL2C 2YO3A 4JQ0D 3A3YB 1GW3A 4L76A 2Y0DA 2OYHB 1KMIZ 2NRGA 5GTIE 1JCCA 2I1KA 3Q5PA 3O6QB 4OGQD 3CCEP 2FYZA 3OAKA 4GODA 1NU1J 2HPCB 1VQOP 3V4WA 3RL0g 2J5UA 2D2CB 4WY4B 2KI7B 3H1HD 3L75J 2JWDA 2XNXA 1EXIA 2H43A 3FXEA 3B5NB 2NPSC 3G9RA 1SQVK 5AVYB 5M1BA 1LTSC 3BRTB 3AEGC 3Q5RA 1VQ5P 2WZ7A 5KAFE 1D7MA 3WUUA 2E75D 3II6A 1NTKK 3VMXA 3CWBG 5APSA 2E76B 4DCKA 2QJPC 4OVNF 2O01N 1L0LK 5KLVJ 3GLMA 2CPSA 3L70G 1KYOE 2GUVA 1QL2A 5KLIB 1NOHA 3VOPA 1RE3C 3BCCG 2AXTH 5AVUB 3U1CA 4W80A 4CPGA 1IK7A 1Z56A 1RF0C 1LTJC 3L36A 3B71A 1RE4C 2M5AB 5AVVB 1PGOA 1NJIQ 3ABVC 5H2FE 1N7SC 2Z5HA 3C8VA 4PD4I 1SQVE 2O1KA 3V5BA 3OJAB 2QEXP 2V7QJ 2IFNA 2HODB 2YIUC 2QJKC 1S4XA 3L72J 2WSCJ 5DJUB 3P8CD 1Q82Q 2XV5A 1LWUA 2R32A 1NTKE 3MUDC 1LP1A 1U7MA 1XTGB 4ZKUA 2L91A 1X22A 1WT6A 2YMYA 4AUWA 2KYVA 5TJHA 1L0LE 2IBZG 1MFZA 5CCHC 1NU1D 3BRVB 1KYOD 1JEKA 1BE3G 1NKZB 3GHGA 3D6ZA 4DOJA 4WY4C 3L75D 3GW6A 3VYIA 4H0LC 2LXCB 1IFPA 1S5LX 1T2KC 3B5NC 1H89A 3G71P 3H32A 1JUNA 1SQXG 1T3UA 3AE6C 1S5LE 2GA1A 3F5HA 2RMZA 3P7KA 2OARA 1L2PA 2WSFH 3H1KE 3Q2YA 1S3JA 1Y47A 3BATA 3Q5SA 3GF7A 1NKNA 2KXPB 1Y9BA 2W83C 3Q3DA 2WQYC 3O8ZA 5AVTB 1SQBK 3MHVA 2JEEA 2E76C 5KLVD 4N78E 2XZRA 1DIPA 2WVRA 1P84E 4AYCA 1AV1A 5KAIH 5KLIC 1NTKD 3TGUE 5AW8B 2WPRA 2IYPA 1ZV8A 5AW4B 1SFCB 2KNCB 4NPFX 1KILB 2UWJE 2JO1A 3QH9A 2IPPA 2IDBA 2E74B 2M3EA 3CC4P 2WSEJ 5KJ7A 1SP4A 3HD7B 3CCQP 3QWOC 3MD0A 1L4AB 1ZXGA 2V4HA 1SS1A 2I8DA 3BCCJ 4B86A 2ZT9D 1GL2D 1M8OB 1LT9A 1JY3O 2ZXEB 5APTA 1NTZK 4H13B 3EFFK 2IX7C 4L75A 3L72D 1BDDA 4YXWH 1UIIA 3CCJP 4H44C 3FWNA 2IZ1A 1N73A 3BVHA 1RQVA 1SQBE 1M90Q 1HH0A 3VMYA 4L74A 1YJNP 1OZHA 2QG4A 2W27A 1NTZJ 3SWYA 3TK1A 4JYCA 3CLQA 1KQSO 1P84D 1BSHA 4XE5B 4XA4A 1NTMG 2W8ZA 1R5LA 4C7NB 1BGYE 5TISE 2YXQB 2C0XA 1KTMA 2PAJA 2E5YA 2WPSA 3A0HH 4I2LC 1T3JA 2C0WA 1JOCA 5L8RJ 3VN0A 1VQPP 1KFNA 2P1JA 1W5CE 2C9NY 2WSEH 4DT0A 2M5AA 3NXSA 4I6MC 1H0TB 2K3RA 1NTZE 3T97B 3WUTA 4WBAA 3CCVP 3L74G 3KHUA 2ZYDA 3N7NA 3RK3E 1NO4A 1HUCA 1RQUA 1ZOYC 1PV3A 1LTTC 1SFCC 2A06G 2HLOA 1KILC 2PRRA 3L73J 2W6JH 2Q6QA 1BCCG 3L71G 3G4SP 1FE6A 1JNMA 1VQ8P 1EQ7A 3FWLA 1FOSF 1FZAA 4PD4E 1SQPK 3CX5D 4BWNA 3HD7C 3HE5A 3M0AA 2HYNA 3BCCD 2OGUA 1L4AC 1URQB 3EQ2A 1RH5B 2R3SA 1IFJA 5AW7B 3AE2C 2CK3H 1PP9E 4H13C 2B87A 5AW0B 2NPSB 4IFFA 1XTCC 3WUVA 1SQPJ 3AEBC 2KZJA 2O1JA 5AVQB 5DJTB 3D6YA 3H1JJ 2P7JA 1KB9H 2E42A 2E5TA 2LXBA 2QE7H 4WY4D 2D2CD 1QGKB 3A5TA 4D6TJ 1NTZD 4ZNCA 1PPJG 1FZCC 1JMMA 2POHA 1NH4A 3A0BE 3B5ND 1QVGO 1Y8AA 3CL3D 2VRSA 5AW3B 3L4FA 1EDLA
chains in the Genus database with same CATH topology
2WPQA 1E5WA 2JJLA 4IFDK 1HTLC 1L0LK 1J1DC 2HFED 2N9BA 3R2PA 5BU5A 1S9KE 2FFDA 1G1JA 1N7SA 3A2AA 4Y99B 1DX7A 2CPSA 1N7LA 4KHXA 3WMM0 2H8PD 2GUVA 1QL2A 1RF1C 1NOHA 2OYIA 3VOPA 1WRGA 5KTBA 1LTJB 1J1EB 5AVSB 1FZGA 4JF7A 1CI6B 2GUSA 1RE3C 3NFQA 3G3ZA 2YKQA 5AVUB 1GD2E 3NTNA 5CHXA 3U1CA 1JY3N 2FFDB 1N7SB 4W80A 3NMDA 5AW9B 1Z56A 2HODA 1RF0C 1HBWA 3U1AA 1CSBA 1JY2O 1LTJC 3L36A 1IFDA 1M7LA 5CCHA 1RE4C 5AVVB 1AFOA 5APXA 2OYIB 2WSCH 1N7SD 1NU1K 3P8MC 1FJKA 2KB7P 1N7SC 2Z5HA 1IFIA 1FZFA 3M91A 3V2RA 3LIEA 2O1KA 1IFMA 3V5BA 3BASA 3OJAB 2IFNA 4OH8B 2HODB 3V4QA 2N1TA 1JY2P 5AVWB 5CMZA 3P8CD 3IR9A 1KZUB 1DEBA 4IFMA 2XV5A 1LWUA 2R32A 2FYUK 3KPEA 4W7ZA 1XTGB 2R5DA 4ZKUA 1G1IA 1WT6A 2YMYA 5CCHD 4AUWA 2KYVA 3LIDA 1M1JB 1URQC 2IFMA 1MFZA 5CCHC 1A02F 5CJ4A 1FAVA 1NAFA 1H88A 3UIAA 3BRVB 3M9QA 1HWTC 2N1TB 1NHLA 3GHGA 1SVFA 1NKZB 2A45G 5AW1B 5KLVK 1KFMA 3M0DA 3V2PA 4DOJA 2QM8A 4N78D 1LWUB 1M1JC 4WY4C 5CJ0A 3SWFA 3OA7A 1T8ZA 3VYIA 1T2KD 1VPCA 2N1TD 1LTBC 3N4XA 3P32A 1SQXK 1T2KC 1LTIC 3P8CE 2YNYA 3B5NC 1HVVA 1MV8A 1H89A 3H32A 1JUNA 1SLQA 1T3UA 1LTAC 2R5BA 1YTZI 3P7KA 2OARA 3C9IA 2WSFH 3GHGB 1NWQA 1CW5A 3BATA 1IO4A 2P67A 3EFGA 1NKNA 5CCGA 4EIJA 2PP6A 3KDPB 5BU8B 3O8ZA 5AVTB 1SFCA 1SQBK 2JEEA 1ZR4A 1IJDB 1MZ9A 1KILA 1DH3A 3RL0B 1OXZA 3H32B 4N78E 2HG5D 2XKMA 4N3YB 2M8RA 2L5GB 2Q3IA 2XZRA 4Y99C 2J58A 3TNUA 3HE4A 3VTPC 3CI9A 3RL0D 4AYCA 1GL2A 1GW4A 3KQGA 5AVZB 1HJBA 3HD7A 3RL0C 5AVXB 2R3CA 5AW8B 1HGVA 2WPRA 1J1EC 1L4AA 1ZV8A 2CPBA 2W6BA 1SFCB 5AW4B 1KILB 1FU1A 4LLHA 2IPPA 1A02J 3RK2B 5CCGD 1VDFA 2FFDC 4RESB 3VP8A 2XU6A 1SFCD 5KJ7A 3TNUB 3HE4B 1KILD 1KQLA 3L37A 1GL2B 1X8YA 3M9HA 1SP4A 4C46A 2OYIC 3HD7B 3RK2D 1W2EA 2FKWB 3MD0A 1L4AB 3MGNA 1FZEA 4B86A 2NPSA 2KLVA 3VMZA 1GL2D 1LT9A 1CZQA 1JY3O 2ZXEB 5APTA 3HD7D 1GK6A 1NTZK 5AW6B 2W6AA 3LW5H 1GZLA 1L4AD 2P2UA 1GK4A 1YTZT 3L35A 2IX7C 1YYCA 2Q9IA 1QL1A 3HUSA 1PFIA 4I1LA 1N73A 3BVHA 5KJ7D 4C7NA 4DZOA 1HH0A 3PP5A 3VMYA 4HH2A 3V2QA 1LT9B 2C9LY 1FBMA 4ZKPA 2W27A 4JYBA 1JY3P 1N86A 3SWYA 3TK1A 4JYCA 2KSJA 1L0NK 2XDJA 4M3LA 3MIWA 1RF1A 3CLQA 1NTMK 2N1TC 4W7YA 2I1JA 3I5CA 2YKPA 3RK3B 3HRNA 2M3BA 3B8EB 4XE5B 4O9BA 1H8AA 4XA4A 2WT7A 3U59A 1LTGC 4LGDE 1N73B 1LWUC 1OWAA 1ZR2A 1RE3A 4C7NB 1SQQK 1J1DB 4LC1A 3RK3D 3A7OA 2C0XA 1JCDA 2PAJA 3H6PA 3T97A 3RK3C 3HTKA 2WPSA 2WITA 4GIFA 4I2LC 1T3JA 1RE4A 2Q7CA 2C0WA 4C7RA 1JY2N 1N73C 3E1IA 1J2JB 1IK9A 2KOGA 4AQRD 1JOCA 3GHGC 2Z5IA 2ZFCA 3M0DC 4N6JA 1X9VA 4GKGA 2WT7B 4HYTB 3VN0A 1KFNA 2P1JA 2C9NY 2WSEH 1MUUA 2J59M 1JO5A 4EOTA 1JTHA 1LGHB 3NXSA 4I6MC 3HTKB 4WBAA 5AW5B 3V2NA 5APWA 3TYYA 3N7NA 1N2DC 1NO4A 2GM4A 1RY3A 3MUDA 1FDMA 1HUCA 5AVRB 2A45I 1GU4A 1IFNA 2OYHA 5CCGC 1LTTC 2Q5UA 3IFMA 1URQA 5BVZA 1SFCC 2LKMA 2HLOA 1AQ5A 1KILC 1JTHB 2O01H 1FJPA 2H7HA 3M9BA 3MTUE 2BASA 1FZBA 3RK2C 2FXMA 1G2CA 2HPCA 1FOSE 1JNMA 1EQ7A 1GDTA 1FZCA 1ZN5A 1FZAA 3KYQA 1FOSF 1M1JA 1SQPK 4WY4A 2MJZA 1GL2C 2YO3A 3HD7C 3A3YB 3HE5A 1GW3A 2OYHB 3M0AA 2HYNA 1L4AC 3B5NA 4GT1A 1JCCA 1URQB 3EQ2A 5APYA 2I1KA 5AW2B 1X79B 1IFJA 2E43A 2FYZA 3OAKA 5APQA 5AW7B 2Z4EA 3M06A 1IC2A 2WWWA 1G2CB 4WB4A 2HPCB 5AW0B 2NPSB 4IFFA 1URQD 2YO2A 3V4WA 1XTCC 5KJ7C 2OYHC 1FZCB 4WY4B 2O1JA 5AVQB 1S9KD 2P7JA 3HE5B 2XNXA 5APVA 2H43A 2NPSD 2E42A 2YKOA 5APUA 3B5NB 2KP8A 2A45H 2QM7A 3HUSB 2NPSC 4WY4D 3A5TA 1SQVK 1LT9C 3TSIA 1HGZA 5AVYB 1FZCC 1JMMA 1ZLLA 2POHA 1GU5A 1LTSC 3BRTB 1NH4A 3B5ND 2WZ7A 3CL3D 2VRSA 5AW3B 3VP9A 1RF0A 1LTJA 3L4FA 2WTYA 3HUSC 1GTWA 3II6A 1NTKK 3VMXA 5APSA 1RF1B 1CI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTT C;  1LTS C;  1LTA C;  1LTG C;  1XTC C;  1LTI C;  1HTL C;  1LTB C; 
#chains in the Genus database with same CATH topology
 1K9M Q;  1HTL C;  4NPD A;  1S1C X;  3H1H E;  3A2A A;  3PJS K;  4UB6 E;  4Y99 B;  1Q2N A;  4KT0 J;  2E76 D;  1N7L A;  4BRY A;  1RF1 C;  1SQP E;  1VQK P;  2OYI A;  1VL2 A;  1WRG A;  1LTJ B;  2K88 A;  3H1J E;  1OW7 A;  2JR8 A;  1CI6 B;  2YKQ A;  1GD2 E;  2IYO A;  4K3A A;  4HB1 A;  5B66 H;  2FFD B;  1N7S B;  2KSE A;  3NMD A;  4U3F J;  5AW9 B;  3CD6 P;  1HBW A;  3RGU A;  1CSB A;  1JY2 O;  3MZW B;  1AFO A;  3JCU H;  4PV1 B;  1GMJ A;  1NU1 K;  3H1K G;  2KS1 A;  3LIE A;  1IFM A;  2KIK A;  1S2E A;  3BAS A;  3L74 J;  3MP7 B;  3L73 D;  4OH8 B;  1YQ3 C;  3V4Q A;  1RHZ B;  4EYY Q;  1VF5 C;  2PGD A;  3GG2 A;  3IR9 A;  4ZMD A;  3H1L J;  4IFM A;  2FYU K;  4W7Z A;  3CCU P;  1YHQ P;  1G1I A;  1NGM B;  2OTK E;  3TGU G;  3AED C;  1URQ C;  4H0L B;  3H1I J;  1WMK A;  3IN6 A;  2KK7 A;  1FAV A;  1NAF A;  1BCC J;  1YBK A;  3M9Q A;  2N1T B;  1SQP D;  2A45 G;  4EI2 A;  5KLV K;  1KFM A;  1OW8 A;  3CX5 I;  3M0D A;  5GTH E;  1EZV D;  2FYU J;  2QM8 A;  3H1J D;  3AE5 C;  3OA7 A;  1T8Z A;  1W2B O;  4TT3 H;  2AXT E;  2W90 A;  3P8C E;  4HKZ H;  2YNY A;  4D6T D;  1YTZ I;  3C9I A;  3AE4 C;  5B5E H;  3EFG A;  5GTI H;  1NU1 E;  4EIJ A;  3CCL P;  2PP6 A;  2IZ0 A;  3KDP B;  4TLF A;  1IJD B;  1MZ9 A;  1DH3 A;  1OXZ A;  2XKM A;  1AVY A;  2ZAE B;  3L75 E;  3R4Y A;  3KXD A;  3W68 A;  2WSF J;  4Y99 C;  2J58 A;  3TNU A;  2ZVO B;  3VTP C;  3CI9 A;  1SQQ J;  1GL2 A;  1FC2 C;  5AVZ B;  3JSV C;  1U57 A;  3RL0 C;  3I55 P;  4LLH A;  3CME P;  3RBX A;  4IL6 H;  2AEJ A;  2MKV A;  4U3F D;  3GMA A;  4RES B;  4XFJ A;  5KAF H;  2FFD C;  1SFC D;  2KLU A;  3HE4 B;  1KIL D;  5KLV E;  1KQL A;  2ITA A;  4KJM A;  4PV1 C;  4C46 A;  1BSN A;  2YMK A;  4DJG A;  2E74 D;  3CCM P;  1PGJ A;  1EDI A;  3MGN A;  1YQ4 C;  4H44 B;  1FZE A;  2BCC G;  2NPS A;  4GDO A;  3VMZ A;  3HD7 D;  3L74 D;  5AW6 B;  1L4A D;  1GK4 A;  1YTZ T;  1KC8 Q;  3H1L D;  2O01 J;  4Z1M H;  1JB0 J;  1AA0 A;  4I1L A;  4H13 D;  2OTL P;  3AE9 C;  3H1I D;  5KKZ B;  1QX8 A;  4ZKP A;  1JY3 P;  2KSJ A;  4NPE A;  4M3L A;  1TU3 F;  5KAI E;  2JWA A;  2N1T C;  2M3B A;  1Q7Y Q;  3B8E B;  3TF5 A;  2FYU D;  2WT7 A;  3U59 A;  1LTG C;  3L72 E;  1ZR2 A;  1RE3 A;  3S9O A;  1J1D B;  1YJW P;  1JCD A;  4HJG H;  2QRX A;  3RK3 C;  1UIX A;  3WU2 E;  1RE4 A;  1N73 C;  3EWK A;  1EZV I;  4N6J A;  1X9V A;  4GKG A;  2JDI H;  1ZP0 C;  2J59 M;  3AEF C;  1PPJ D;  1JTH A;  1LGH B;  3CWB J;  2K1A A;  3HTK B;  2FYN C;  5AW5 B;  1PIX A;  2K9J B;  1SQQ D;  2GM4 A;  3MUD A;  1K04 A;  4A7P A;  3L70 J;  4I7Z B;  1GU4 A;  1IFN A;  2OYH A;  5CCG C;  2Q5U A;  3O6Q A;  1AQ5 A;  2O01 H;  1FJP A;  2H7H A;  3MTU E;  2BAS A;  1DEE G;  5E79 H;  2FXM A;  2HPC A;  3H1H G;  4GOE A;  2NZ2 A;  1GDT A;  1K05 A;  3KYQ A;  4UB8 E;  4WY4 A;  2XND H;  1S72 P;  3B5N A;  4GT1 A;  1X79 B;  2AXC A;  2E43 A;  2OTJ P;  2Z4E A;  1IC2 A;  3FXD A;  2WWW A;  1G2C B;  4WB4 A;  1URQ D;  3G6E P;  1FZC B;  1HF9 A;  1S9K D;  1VQM P;  2NPS D;  2BCC J;  2YKO A;  5APU A;  2RH0 A;  2KP8 A;  1L0N G;  2A45 H;  2ZXX A;  3CX5 E;  5KKZ C;  1NVO A;  1ZLL A;  3PLN A;  5K5G B;  1N8R Q;  1GU5 A;  3BCC E;  1ZRT D;  2O3J A;  4RO0 A;  1X0T A;  3CC2 P;  1GTW A;  3HUS C;  1YIT P;  4ASW A;  1BE3 J;  2BEZ F;  1RF1 B;  2E75 C;  2WPQ A;  1E5W A;  2JJL A;  4IFD K;  1J1D C;  2HFE D;  3R2P A;  5BU5 A;  3SSU A;  3CMA P;  1DX7 A;  4KHX A;  1SQX J;  3WMM 0;  2H8P D;  2KUB A;  3ZDM A;  5AVS B;  4JF7 A;  4PJ0 H;  2GUS A;  4IOI H;  3G3Z A;  4R4M A;  3CWB D;  5CBO A;  1JY3 N;  2HOD A;  2FBW C;  3U1A A;  1USE A;  1M7L A;  3KZI E;  5APX A;  4U7J A;  3L70 D;  1T6A A;  1N7S D;  1YJ9 P;  5TIS H;  1FJK A;  2KB7 P;  4I7Z C;  1VF5 B;  1NU1 G;  1FZF A;  3V2R A;  4PV1 D;  3AE3 C;  2QVA A;  4YXD C;  1JY2 P;  5AVW B;  1Q86 Q;  1KZU B;  1DEB A;  3KPE A;  1M57 D;  5CCH D;  4OWF A;  2IFM A;  1A02 F;  5CJ4 A;  1H88 A;  3UIA A;  3Q1M A;  1HWT C;  4ASV A;  1SVF A;  4H0L D;  1FDO A;  1M56 D;  1LWU B;  1M1J C;  2Y0C A;  3L73 E;  3SWF A;  1LP1 B;  1SQV G;  1T2K D;  1VPC A;  2BCC D;  2N1T D;  1LTB C;  3N4X A;  3P32 A;  3I56 P;  3VMA A;  3AE1 C;  1BDC A;  1HVV A;  1SLQ A;  1LTA C;  3D71 A;  3AE7 C;  2R5B A;  2IBZ D;  1NTK G;  3JCU E;  3GHG B;  1NWQ A;  1CW5 A;  1IO4 A;  2P67 A;  1KB9 D;  1L0L G;  2Y0E A;  1BE3 D;  2OQQ A;  5BU8 B;  1SFC A;  2KNC A;  1L0N J;  3SFE C;  2WPV B;  1KIL A;  1NTM J;  3K5B A;  3RL0 B;  1EZV E;  3H32 B;  3AEE C;  2HG5 D;  4WWI A;  2FXP A;  4YTP C;  3SWK A;  1SQX D;  4D6T E;  3KQG A;  3GF3 A;  1HJB A;  3HD7 A;  3IF4 A;  5AVX B;  2R3C A;  1HGV A;  1L4A A;  2R44 A;  1ZME C;  1E79 H;  2CPB A;  3CXH H;  4WVZ A;  3L72 G;  1A02 J;  1K8A Q;  3RK2 B;  5CCG D;  1VDF A;  3VP8 A;  2XU6 A;  1YIJ P;  2WMM A;  3L37 A;  1X8Y A;  3M9H A;  3W67 A;  1PL5 A;  2KZI A;  2FKW B;  3B4S A;  1FDI A;  2KLV A;  4UB6 H;  2YXR B;  3CC7 P;  2ZT9 C;  2K9Y A;  1GK6 A;  2W6A A;  3LW5 H;  3AE8 C;  1GZL A;  3H25 A;  3CXH D;  4H44 D;  1YYC A;  5B5E E;  2Q9I A;  1QL1 A;  1USD A;  4L73 A;  4U3F E;  1OVU A;  3L71 J;  1K73 Q;  3D70 A;  2Y9Z A;  2FY8 A;  4C7N A;  1KIL E;  3JC2 2;  4DZO A;  3V2Q A;  1LT9 B;  2C9L Y;  1FBM A;  4JYB A;  2QA4 P;  1N86 A;  3RBZ A;  3AEA C;  4K35 A;  3MIW A;  1RF1 A;  2ZYA A;  4W7Y A;  2I1J A;  2YKP A;  3RK3 B;  3L74 E;  1QLE D;  4IL6 X;  1AQT A;  4JBZ A;  2JP3 A;  1N73 B;  4LGD E;  1LWU C;  4IL6 E;  1SQQ K;  3H1L E;  4LC1 A;  1KV4 A;  1H0T A;  3H6P A;  3T97 A;  2WIT A;  2A06 E;  4GIF A;  2Q7C A;  1JY2 N;  1OW6 A;  1J2J B;  3H1I E;  1IK9 A;  1SQB G;  2KOG A;  1VQ4 P;  4AQR D;  2FYN B;  3GHG C;  2ZFC A;  1SQV J;  1BCC E;  3L71 E;  2QSI A;  3F89 A;  3S1K A;  1L0N D;  1NTM D;  1MUU A;  1JO5 A;  4EOT A;  2FYU E;  1VQ6 P;  2IBZ I;  3V2N A;  5GTH H;  1NTK J;  5APW A;  3TDK A;  1N2D C;  1KB9 I;  1RY3 A;  2M0B A;  1L0L J;  1BGY G;  2RKL A;  3IFM A;  2AEM A;  1URQ A;  5BVZ A;  2LKM A;  5C39 A;  3RK2 C;  1PPJ E;  1ZN5 A;  2DW3 A;  4OGQ B;  2MJZ A;  1KYO H;  1KD1 Q;  4Y28 J;  3S4R A;  1NTZ G;  1SQQ E;  4JPZ B;  5APY A;  5AW2 B;  1JM0 A;  3H1K J;  5APQ A;  3M06 A;  2A06 D;  3V6I A;  2YO2 A;  5KJ7 C;  2OYH C;  3PRJ A;  2JKV A;  1BCC D;  3L71 D;  1PZQ A;  3HE5 B;  5APV A;  5H2F H;  2QM7 A;  3HUS B;  1EDK A;  4BXL A;  1LT9 C;  3TSI A;  1HGZ A;  2E75 B;  3CXH I;  1KQG B;  2D2C C;  3TGU J;  2B87 B;  2QJY B;  3VP9 A;  1RF0 A;  1LTJ A;  2WTY A;  1CI6 A;  2RN0 A;  1PP9 G;  1PGP A;  2N9B A;  1S9K E;  5E79 E;  1QVF O;  2FFD A;  1G1J A;  1N7S A;  2Q3E A;  1MFT A;  1SQV D;  5KTB A;  1J1E B;  1YI2 P;  1FZG A;  1ZRT E;  1Q90 D;  3L73 G;  3NFQ A;  3NTN A;  5CHX A;  1AJY A;  1MKM A;  1S5L H;  2V7Q H;  1IFD A;  5CCH A;  1SQB J;  4BRY B;  1NYH A;  1L0L D;  3IAO A;  2OYI B;  2WSC H;  1OIP A;  3P8M C;  1IFI A;  3M91 A;  3WU2 H;  1DD3 A;  2AEF A;  1SQP G;  2H89 C;  2P58 A;  2ZJS E;  1IZN B;  2QIW A;  1VF5 D;  1EZV G;  2N1T A;  3H1J G;  5CMZ A;  3A0H E;  3CWB E;  1BGY J;  1P84 H;  4OGQ C;  2R5D A;  4D6T G;  2Q1K A;  3E7K A;  3LID A;  1M1J B;  2KS1 B;  1OVV A;  1PGQ A;  3H1K D;  3L70 E;  3SFD C;  1NHL A;  5AW1 B;  3V2P A;  4N78 D;  5CJ0 A;  4PJ0 E;  1AVO A;  1SQX K;  1LTI C;  2LR2 A;  1MV8 A;  2Y9Y A;  2K37 A;  2BEQ D;  4QMA A;  1EDJ A;  3TGU D;  4UB8 H;  2WSS H;  2G8Y A;  2B88 A;  2QJY C;  4YPC A;  2FXO A;  1KOR A;  5CCG A;  4RKU J;  1VQ9 P;  1VQL P;  3C1L A;  4U3F G;  1ZR4 A;  1KYO I;  1OMI A;  4N3Y B;  2M8R A;  2L5G B;  2Q3I A;  2BCC E;  1R5S A;  1QEX A;  3HE4 A;  3RL0 D;  1GW4 A;  1J1E C;  2IBZ E;  1EC5 A;  3CX5 H;  2W6B A;  1PP9 J;  1FU1 A;  2N9Y B;  1KB9 E;  3PH0 A;  1BE3 E;  2HR3 A;  3H1L G;  2PFX A;  1SQB D;  2B89 A;  3TNU B;  1U7J A;  2ZT9 B;  1GL2 B;  2OYI C;  3RK2 D;  1W2E A;  3H1I G;  4EDF A;  3L75 G;  1SQX E;  2E74 C;  3ITK A;  2H88 C;  3PHL A;  1CZQ A;  3CCR P;  4RJT A;  3FGA D;  2P2U A;  2FYU G;  3L35 A;  1KN7 A;  1HJ0 A;  1BGY D;  1DD4 A;  1R8E A;  3HUS A;  1PFI A;  2B9B A;  3AEC C;  4R4L A;  3H1H J;  5KJ7 D;  1OFC X;  3PP5 A;  4HH2 A;  3PTZ A;  1JMB A;  3LW5 J;  2SPZ A;  5KLV G;  3KZI H;  2P10 A;  1L0N K;  2XDJ A;  1M1K Q;  1LT1 A;  3CCS P;  5B66 E;  1NTM K;  3I5C A;  3HRN A;  4GOF A;  4O9B A;  1H8A A;  4PD4 H;  3CXH E;  1OWA A;  2QJP B;  5CBN A;  3RK3 D;  3A7O A;  1SQQ G;  3HTK A;  2K9J A;  4C7R A;  3E1I A;  1Q81 Q;  1NAY A;  2Z5I A;  2ZVN B;  1FS0 E;  3M0D C;  1VQN P;  2WT7 B;  4HYT B;  5EFW B;  1P84 I;  3FX0 A;  1LNQ A;  2OYO A;  4PD4 D;  4MN4 C;  3USS A;  1OX3 A;  3TYY A;  2ZYG A;  1ZW0 A;  2G3A A;  3A0B H;  1FDM A;  5AVR B;  2A45 I;  1KQF B;  1PP9 D;  3OW2 O;  1OVR A;  1JTH B;  1LJ2 A;  3M9B A;  2YIU B;  2QJK B;  1FZB A;  1L0N E;  1EXJ A;  1G2C A;  1NTM E;  1FOS E;  1VQ7 P;  3E1R A;  1FZC A;  3CPW O;  1M1J A;  1GL2 C;  2YO3 A;  4JQ0 D;  3A3Y B;  1GW3 A;  4L76 A;  2Y0D A;  2OYH B;  1KMI Z;  2NRG A;  5GTI E;  1JCC A;  2I1K A;  3Q5P A;  3O6Q B;  4OGQ D;  3CCE P;  2FYZ A;  3OAK A;  4GOD A;  1NU1 J;  2HPC B;  1VQO P;  3V4W A;  3RL0 g;  2J5U A;  2D2C B;  4WY4 B;  2KI7 B;  3H1H D;  3L75 J;  2JWD A;  2XNX A;  1EXI A;  2H43 A;  3FXE A;  3B5N B;  2NPS C;  3G9R A;  1SQV K;  5AVY B;  5M1B A;  1LTS C;  3BRT B;  3AEG C;  3Q5R A;  1VQ5 P;  2WZ7 A;  5KAF E;  1D7M A;  3WUU A;  2E75 D;  3II6 A;  1NTK K;  3VMX A;  3CWB G;  5APS A;  2E76 B;  4DCK A;  2QJP C;  4OVN F;  2O01 N;  1L0L K;  5KLV J;  3GLM A;  2CPS A;  3L70 G;  1KYO E;  2GUV A;  1QL2 A;  5KLI B;  1NOH A;  3VOP A;  1RE3 C;  3BCC G;  2AXT H;  5AVU B;  3U1C A;  4W80 A;  4CPG A;  1IK7 A;  1Z56 A;  1RF0 C;  1LTJ C;  3L36 A;  3B71 A;  1RE4 C;  2M5A B;  5AVV B;  1PGO A;  1NJI Q;  3ABV C;  5H2F E;  1N7S C;  2Z5H A;  3C8V A;  4PD4 I;  1SQV E;  2O1K A;  3V5B A;  3OJA B;  2QEX P;  2V7Q J;  2IFN A;  2HOD B;  2YIU C;  2QJK C;  1S4X A;  3L72 J;  2WSC J;  5DJU B;  3P8C D;  1Q82 Q;  2XV5 A;  1LWU A;  2R32 A;  1NTK E;  3MUD C;  1LP1 A;  1U7M A;  1XTG B;  4ZKU A;  2L91 A;  1X22 A;  1WT6 A;  2YMY A;  4AUW A;  2KYV A;  5TJH A;  1L0L E;  2IBZ G;  1MFZ A;  5CCH C;  1NU1 D;  3BRV B;  1KYO D;  1JEK A;  1BE3 G;  1NKZ B;  3GHG A;  3D6Z A;  4DOJ A;  4WY4 C;  3L75 D;  3GW6 A;  3VYI A;  4H0L C;  2LXC B;  1IFP A;  1S5L X;  1T2K C;  3B5N C;  1H89 A;  3G71 P;  3H32 A;  1JUN A;  1SQX G;  1T3U A;  3AE6 C;  1S5L E;  2GA1 A;  3F5H A;  2RMZ A;  3P7K A;  2OAR A;  1L2P A;  2WSF H;  3H1K E;  3Q2Y A;  1S3J A;  1Y47 A;  3BAT A;  3Q5S A;  3GF7 A;  1NKN A;  2KXP B;  1Y9B A;  2W83 C;  3Q3D A;  2WQY C;  3O8Z A;  5AVT B;  1SQB K;  3MHV A;  2JEE A;  2E76 C;  5KLV D;  4N78 E;  2XZR A;  1DIP A;  2WVR A;  1P84 E;  4AYC A;  1AV1 A;  5KAI H;  5KLI C;  1NTK D;  3TGU E;  5AW8 B;  2WPR A;  2IYP A;  1ZV8 A;  5AW4 B;  1SFC B;  2KNC B;  4NPF X;  1KIL B;  2UWJ E;  2JO1 A;  3QH9 A;  2IPP A;  2IDB A;  2E74 B;  2M3E A;  3CC4 P;  2WSE J;  5KJ7 A;  1SP4 A;  3HD7 B;  3CCQ P;  3QWO C;  3MD0 A;  1L4A B;  1ZXG A;  2V4H A;  1SS1 A;  2I8D A;  3BCC J;  4B86 A;  2ZT9 D;  1GL2 D;  1M8O B;  1LT9 A;  1JY3 O;  2ZXE B;  5APT A;  1NTZ K;  4H13 B;  3EFF K;  2IX7 C;  4L75 A;  3L72 D;  1BDD A;  4YXW H;  1UII A;  3CCJ P;  4H44 C;  3FWN A;  2IZ1 A;  1N73 A;  3BVH A;  1RQV A;  1SQB E;  1M90 Q;  1HH0 A;  3VMY A;  4L74 A;  1YJN P;  1OZH A;  2QG4 A;  2W27 A;  1NTZ J;  3SWY A;  3TK1 A;  4JYC A;  3CLQ A;  1KQS O;  1P84 D;  1BSH A;  4XE5 B;  4XA4 A;  1NTM G;  2W8Z A;  1R5L A;  4C7N B;  1BGY E;  5TIS E;  2YXQ B;  2C0X A;  1KTM A;  2PAJ A;  2E5Y A;  2WPS A;  3A0H H;  4I2L C;  1T3J A;  2C0W A;  1JOC A;  5L8R J;  3VN0 A;  1VQP P;  1KFN A;  2P1J A;  1W5C E;  2C9N Y;  2WSE H;  4DT0 A;  2M5A A;  3NXS A;  4I6M C;  1H0T B;  2K3R A;  1NTZ E;  3T97 B;  3WUT A;  4WBA A;  3CCV P;  3L74 G;  3KHU A;  2ZYD A;  3N7N A;  3RK3 E;  1NO4 A;  1HUC A;  1RQU A;  1ZOY C;  1PV3 A;  1LTT C;  1SFC C;  2A06 G;  2HLO A;  1KIL C;  2PRR A;  3L73 J;  2W6J H;  2Q6Q A;  1BCC G;  3L71 G;  3G4S P;  1FE6 A;  1JNM A;  1VQ8 P;  1EQ7 A;  3FWL A;  1FOS F;  1FZA A;  4PD4 E;  1SQP K;  3CX5 D;  4BWN A;  3HD7 C;  3HE5 A;  3M0A A;  2HYN A;  3BCC D;  2OGU A;  1L4A C;  1URQ B;  3EQ2 A;  1RH5 B;  2R3S A;  1IFJ A;  5AW7 B;  3AE2 C;  2CK3 H;  1PP9 E;  4H13 C;  2B87 A;  5AW0 B;  2NPS B;  4IFF A;  1XTC C;  3WUV A;  1SQP J;  3AEB C;  2KZJ A;  2O1J A;  5AVQ B;  5DJT B;  3D6Y A;  3H1J J;  2P7J A;  1KB9 H;  2E42 A;  2E5T A;  2LXB A;  2QE7 H;  4WY4 D;  2D2C D;  1QGK B;  3A5T A;  4D6T J;  1NTZ D;  4ZNC A;  1PPJ G;  1FZC C;  1JMM A;  2POH A;  1NH4 A;  3A0B E;  3B5N D;  1QVG O;  1Y8A A;  3CL3 D;  2VRS A;  5AW3 B;  3L4F A;  1EDL A; 
#chains in the Genus database with same CATH homology
 2WPQ A;  1E5W A;  2JJL A;  4IFD K;  1HTL C;  1L0L K;  1J1D C;  2HFE D;  2N9B A;  3R2P A;  5BU5 A;  1S9K E;  2FFD A;  1G1J A;  1N7S A;  3A2A A;  4Y99 B;  1DX7 A;  2CPS A;  1N7L A;  4KHX A;  3WMM 0;  2H8P D;  2GUV A;  1QL2 A;  1RF1 C;  1NOH A;  2OYI A;  3VOP A;  1WRG A;  5KTB A;  1LTJ B;  1J1E B;  5AVS B;  1FZG A;  4JF7 A;  1CI6 B;  2GUS A;  1RE3 C;  3NFQ A;  3G3Z A;  2YKQ A;  5AVU B;  1GD2 E;  3NTN A;  5CHX A;  3U1C A;  1JY3 N;  2FFD B;  1N7S B;  4W80 A;  3NMD A;  5AW9 B;  1Z56 A;  2HOD A;  1RF0 C;  1HBW A;  3U1A A;  1CSB A;  1JY2 O;  1LTJ C;  3L36 A;  1IFD A;  1M7L A;  5CCH A;  1RE4 C;  5AVV B;  1AFO A;  5APX A;  2OYI B;  2WSC H;  1N7S D;  1NU1 K;  3P8M C;  1FJK A;  2KB7 P;  1N7S C;  2Z5H A;  1IFI A;  1FZF A;  3M91 A;  3V2R A;  3LIE A;  2O1K A;  1IFM A;  3V5B A;  3BAS A;  3OJA B;  2IFN A;  4OH8 B;  2HOD B;  3V4Q A;  2N1T A;  1JY2 P;  5AVW B;  5CMZ A;  3P8C D;  3IR9 A;  1KZU B;  1DEB A;  4IFM A;  2XV5 A;  1LWU A;  2R32 A;  2FYU K;  3KPE A;  4W7Z A;  1XTG B;  2R5D A;  4ZKU A;  1G1I A;  1WT6 A;  2YMY A;  5CCH D;  4AUW A;  2KYV A;  3LID A;  1M1J B;  1URQ C;  2IFM A;  1MFZ A;  5CCH C;  1A02 F;  5CJ4 A;  1FAV A;  1NAF A;  1H88 A;  3UIA A;  3BRV B;  3M9Q A;  1HWT C;  2N1T B;  1NHL A;  3GHG A;  1SVF A;  1NKZ B;  2A45 G;  5AW1 B;  5KLV K;  1KFM A;  3M0D A;  3V2P A;  4DOJ A;  2QM8 A;  4N78 D;  1LWU B;  1M1J C;  4WY4 C;  5CJ0 A;  3SWF A;  3OA7 A;  1T8Z A;  3VYI A;  1T2K D;  1VPC A;  2N1T D;  1LTB C;  3N4X A;  3P32 A;  1SQX K;  1T2K C;  1LTI C;  3P8C E;  2YNY A;  3B5N C;  1HVV A;  1MV8 A;  1H89 A;  3H32 A;  1JUN A;  1SLQ A;  1T3U A;  1LTA C;  2R5B A;  1YTZ I;  3P7K A;  2OAR A;  3C9I A;  2WSF H;  3GHG B;  1NWQ A;  1CW5 A;  3BAT A;  1IO4 A;  2P67 A;  3EFG A;  1NKN A;  5CCG A;  4EIJ A;  2PP6 A;  3KDP B;  5BU8 B;  3O8Z A;  5AVT B;  1SFC A;  1SQB K;  2JEE A;  1ZR4 A;  1IJD B;  1MZ9 A;  1KIL A;  1DH3 A;  3RL0 B;  1OXZ A;  3H32 B;  4N78 E;  2HG5 D;  2XKM A;  4N3Y B;  2M8R A;  2L5G B;  2Q3I A;  2XZR A;  4Y99 C;  2J58 A;  3TNU A;  3HE4 A;  3VTP C;  3CI9 A;  3RL0 D;  4AYC A;  1GL2 A;  1GW4 A;  3KQG A;  5AVZ B;  1HJB A;  3HD7 A;  3RL0 C;  5AVX B;  2R3C A;  5AW8 B;  1HGV A;  2WPR A;  1J1E C;  1L4A A;  1ZV8 A;  2CPB A;  2W6B A;  1SFC B;  5AW4 B;  1KIL B;  1FU1 A;  4LLH A;  2IPP A;  1A02 J;  3RK2 B;  5CCG D;  1VDF A;  2FFD C;  4RES B;  3VP8 A;  2XU6 A;  1SFC D;  5KJ7 A;  3TNU B;  3HE4 B;  1KIL D;  1KQL A;  3L37 A;  1GL2 B;  1X8Y A;  3M9H A;  1SP4 A;  4C46 A;  2OYI C;  3HD7 B;  3RK2 D;  1W2E A;  2FKW B;  3MD0 A;  1L4A B;  3MGN A;  1FZE A;  4B86 A;  2NPS A;  2KLV A;  3VMZ A;  1GL2 D;  1LT9 A;  1CZQ A;  1JY3 O;  2ZXE B;  5APT A;  3HD7 D;  1GK6 A;  1NTZ K;  5AW6 B;  2W6A A;  3LW5 H;  1GZL A;  1L4A D;  2P2U A;  1GK4 A;  1YTZ T;  3L35 A;  2IX7 C;  1YYC A;  2Q9I A;  1QL1 A;  3HUS A;  1PFI A;  4I1L A;  1N73 A;  3BVH A;  5KJ7 D;  4C7N A;  4DZO A;  1HH0 A;  3PP5 A;  3VMY A;  4HH2 A;  3V2Q A;  1LT9 B;  2C9L Y;  1FBM A;  4ZKP A;  2W27 A;  4JYB A;  1JY3 P;  1N86 A;  3SWY A;  3TK1 A;  4JYC A;  2KSJ A;  1L0N K;  2XDJ A;  4M3L A;  3MIW A;  1RF1 A;  3CLQ A;  1NTM K;  2N1T C;  4W7Y A;  2I1J A;  3I5C A;  2YKP A;  3RK3 B;  3HRN A;  2M3B A;  3B8E B;  4XE5 B;  4O9B A;  1H8A A;  4XA4 A;  2WT7 A;  3U59 A;  1LTG C;  4LGD E;  1N73 B;  1LWU C;  1OWA A;  1ZR2 A;  1RE3 A;  4C7N B;  1SQQ K;  1J1D B;  4LC1 A;  3RK3 D;  3A7O A;  2C0X A;  1JCD A;  2PAJ A;  3H6P A;  3T97 A;  3RK3 C;  3HTK A;  2WPS A;  2WIT A;  4GIF A;  4I2L C;  1T3J A;  1RE4 A;  2Q7C A;  2C0W A;  4C7R A;  1JY2 N;  1N73 C;  3E1I A;  1J2J B;  1IK9 A;  2KOG A;  4AQR D;  1JOC A;  3GHG C;  2Z5I A;  2ZFC A;  3M0D C;  4N6J A;  1X9V A;  4GKG A;  2WT7 B;  4HYT B;  3VN0 A;  1KFN A;  2P1J A;  2C9N Y;  2WSE H;  1MUU A;  2J59 M;  1JO5 A;  4EOT A;  1JTH A;  1LGH B;  3NXS A;  4I6M C;  3HTK B;  4WBA A;  5AW5 B;  3V2N A;  5APW A;  3TYY A;  3N7N A;  1N2D C;  1NO4 A;  2GM4 A;  1RY3 A;  3MUD A;  1FDM A;  1HUC A;  5AVR B;  2A45 I;  1GU4 A;  1IFN A;  2OYH A;  5CCG C;  1LTT C;  2Q5U A;  3IFM A;  1URQ A;  5BVZ A;  1SFC C;  2LKM A;  2HLO A;  1AQ5 A;  1KIL C;  1JTH B;  2O01 H;  1FJP A;  2H7H A;  3M9B A;  3MTU E;  2BAS A;  1FZB A;  3RK2 C;  2FXM A;  1G2C A;  2HPC A;  1FOS E;  1JNM A;  1EQ7 A;  1GDT A;  1FZC A;  1ZN5 A;  1FZA A;  3KYQ A;  1FOS F;  1M1J A;  1SQP K;  4WY4 A;  2MJZ A;  1GL2 C;  2YO3 A;  3HD7 C;  3A3Y B;  3HE5 A;  1GW3 A;  2OYH B;  3M0A A;  2HYN A;  1L4A C;  3B5N A;  4GT1 A;  1JCC A;  1URQ B;  3EQ2 A;  5APY A;  2I1K A;  5AW2 B;  1X79 B;  1IFJ A;  2E43 A;  2FYZ A;  3OAK A;  5APQ A;  5AW7 B;  2Z4E A;  3M06 A;  1IC2 A;  2WWW A;  1G2C B;  4WB4 A;  2HPC B;  5AW0 B;  2NPS B;  4IFF A;  1URQ D;  2YO2 A;  3V4W A;  1XTC C;  5KJ7 C;  2OYH C;  1FZC B;  4WY4 B;  2O1J A;  5AVQ B;  1S9K D;  2P7J A;  3HE5 B;  2XNX A;  5APV A;  2H43 A;  2NPS D;  2E42 A;  2YKO A;  5APU A;  3B5N B;  2KP8 A;  2A45 H;  2QM7 A;  3HUS B;  2NPS C;  4WY4 D;  3A5T A;  1SQV K;  1LT9 C;  3TSI A;  1HGZ A;  5AVY B;  1FZC C;  1JMM A;  1ZLL A;  2POH A;  1GU5 A;  1LTS C;  3BRT B;  1NH4 A;  3B5N D;  2WZ7 A;  3CL3 D;  2VRS A;  5AW3 B;  3VP9 A;  1RF0 A;  1LTJ A;  3L4F A;  2WTY A;  3HUS C;  1GTW A;  3II6 A;  1NTK K;  3VMX A;  5APS A;  1RF1 B;  1CI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...