1LTTC

Lactose binding to heat-labile enterotoxin revealed by x-ray crystallography
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
41
structure length
41
Chain Sequence
b'GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
publication title Lactose binding to heat-labile enterotoxin revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 14
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 1992-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1lttC00
1LTGC 1LTAC 1LTIC 1LTTC 1HTLC 1LTBC 1XTCC 1LTSC
chains in the Genus database with same CATH superfamily
3H1LG 2POHA 2QJKB 1ZR4A 4EYYQ 1HGVA 1SQXK 1NU1D 1BDCA 1LTBC 1KQLA 4U3FD 2ZYGA 1JMBA 3CMAP 3U1CA 2I1JA 2JWAA 2B87A 4PD4D 5BVZA 3CC7P 3L37A 3L73J 5KJ7D 3G4SP 2W27A 3CL3D 2IYOA 5APQA 4C7NA 5B5EH 3H1JG 1KB9I 3L71J 3GHGC 1J1DB 3E7KA 1YITP 1KC8Q 4GOEA 1QVFO 1VQ4P 1NVOA 1BGYJ 2YMKA 2DW3A 2V7QJ 3I55P 2N9BA 1SQPE 1EZVD 4OGQB 2HYNA 1KILC 1L4AA 4H44D 4OVNF 1VQKP 1KQFB 1MKMA 4N78E 1GL2C 1ZLLA 3H32B 3H25A 3TDKA 1FZCA 1SQBE 3HRNA 3WU2H 5H2FE 3GW6A 2NPSA 3PTZA 2YO3A 2H7HA 2WWWA 2ZXXA 2NPSD 2O3JA 4JYBA 4H13C 1PP9J 2W6BA 2QJKC 3C1LA 1JCCA 3VMZA 1CZQA 3CX5D 1CI6A 2WT7B 1L0NE 2H88C 2PFXA 1JTHA 2FYUJ 1N7LA 1PFIA 3TSIA 2P2UA 3L75E 2KZJA 2WPSA 1NKZB 4GODA 2YXQB 5CHXA 1LT9C 2KUBA 1NTZD 1QL2A 3FGAD 1FJKA 1NYHA 4AUWA 3U59A 2OGUA 1NTKG 1SFCB 1UIXA 2XV5A 3JCUH 4W7YA 1R5LA 1RE4C 3VYIA 3Q5SA 2NRGA 3H1HG 3GHGA 2QVAA 2PGDA 2OYOA 1PIXA 3LW5J 2FYZA 1HBWA 3L70J 3HD7A 1J1DC 3WU2E 3OA7A 2CK3H 3UIAA 2AXCA 1EDLA 4NPDA 3KPEA 3VP9A 3W68A 1A02F 1SQPK 1S3JA 1KILA 1U57A 2KB7P 3WMM0 4PJ0E 3G3ZA 4OGQC 2HPCB 4TLFA 1KB9D 3CCQP 5B66H 2HR3A 3QWOC 1IC2A 1GL2D 1PL5A 2GM4A 4DOJA 1X22A 1M57D 2RH0A 1X0TA 1SQBK 3A0BE 5C39A 1VQLP 2A06E 2QJYB 1S2EA 1K8AQ 2OYIB 1AFOA 3JCUE 2AXTE 4GIFA 3L74E 2E75C 2BCCE 2YXRB 4H13D 5AVZB 5CJ0A 4OWFA 1L0NK 2HFED 1URQC 2WSCH 3CXHE 2IBZE 5AVXB 1ZP0C 3P8CE 1GU5A 1DX7A 1GK4A 1EDKA 1WRGA 1X79B 3L75D 1T2KD 3AEGC 1J2JB 1WT6A 1BCCG 3K5BA 1AJYA 1H0TB 2IPPA 1T8ZA 1FZFA 1VF5B 1S72P 1AV1A 1SQVG 4D6TJ 1RE4A 5APTA 1JCDA 2K88A 3L73E 1AVYA 3P32A 3O8ZA 3L71E 3HUSC 3U1AA 3VMAA 5AW8B 3PHLA 3CCVP 1BGYE 1FS0E 1VQ5P 1FE6A 3L4FA 1LP1B 3JC22 1R5SA 1FU1A 2BEZF 2JR8A 2O1KA 3WUTA 3HE4B 2WSEJ 1NTKD 3H32A 3H1LJ 1EXIA 4IL6H 1FAVA 2A45G 1RY3A 3B71A 1NTMG 4H44B 5TISH 1JUNA 3LW5H 2OYIC 2P1JA 1KQGB 2ZYDA 1QEXA 3HE5B 2E75D 2A45I 4U3FG 2Q1KA 4UB8H 1SQXG 3KDPB 2FXOA 4Y28J 3C8VA 2H8PD 2LKMA 1URQD 1NAFA 4PD4H 2WT7A 3CMEP 1PP9E 1K9MQ 1NO4A 2WSFH 3TGUG 2FYUE 3H1JJ 3BVHA 3CC2P 3M06A 1SLQA 3EFGA 3MP7B 1T3UA 2KYVA 2WQYC 2R32A 1SFCA 1VF5C 3EFFK 2WPVB 2E76D 3Q5PA 1PPJG 3SFEC 2J59M 3H1KD 2K9JB 1S9KE 3IAOA 3RGUA 1KN7A 2QM8A 1D7MA 3L73D 3CPWO 2G8YA 4U7JA 3L70E 3SWYA 1L0LD 3B5NC 3MUDA 1ZRTE 3TYYA 3R4YA 2GA1A 3A0HH 5AVYB 1BGYD 1BCCD 5APWA 2HPCA 3LIEA 1W5CE 2KIKA 1H8AA 3PP5A 3F89A 2HG5D 2FXPA 3I56P 2FBWC 2YNYA 2QRXA 1P84E 5E79E 2OYHB 2NZ2A 2ITAA 1AVOA 5KAIH 4H0LC 2J58A 2XDJA 3CWBD 1XTCC 1HJ0A 1LTGC 2OYIA 2QA4P 2R3CA 4ZKUA 5BU8B 1KYOI 1GL2B 1YQ3C 2PAJA 4N3YB 3BCCJ 3CX5I 1BE3J 4Z1MH 2XZRA 5CCGC 2FYUK 3H1HJ 1OWAA 2IYPA 4DZOA 1RH5B 1KZUB 4RKUJ 1H0TA 3FXDA 2ZT9C 1SQQJ 1PGPA 2LXBA 1NTMD 1VF5D 1H89A 2JP3A 1RE3A 1JEKA 1HJBA 4JF7A 1EDJA 5KAFE 3SWKA 4D6TE 5AW1B 1SQXD 3HTKB 1PGJA 2KLVA 5KAIE 4LGDE 5AW2B 1LT9B 5K5GB 1KB9H 1OW7A 3RL0D 3R2PA 1N7SD 5GTIH 2GUVA 3B5ND 3Q1MA 5KJ7A 2KK7A 3TGUD 2Y0DA 3BRTB 5DJUB 3O6QB 1LP1A 1LWUC 1G2CB 3KYQA 5AW7B 3VTPC 2Q3EA 3HE4A 2WVRA 3USSA 2Q5UA 2Z4EA 1USEA 1KORA 2IFMA 2OYHC 3QH9A 1PPJD 2W90A 1ZMEC 3H1LE 1FJPA 2P58A 3H1ID 3OAKA 4CPGA 2WSCJ 1SP4A 4HYTB 2IZ0A 4H0LD 4GT1A 2O01N 3I5CA 1NHLA 3CLQA 3PLNA 3AE8C 2KXPB 1QVGO 2KSEA 3HE5A 4JQ0D 1FZAA 3L75G 2AEMA 1UIIA 2HODB 2IZ1A 3EQ2A 3CCJP 1SQVJ 1BDDA 1FDMA 5APVA 5KLVK 2Q9IA 3H6PA 5GTIE 1GK6A 1QX8A 1G1IA 1RHZB 2J5UA 5CCGD 2HLOA 1AQTA 3L72E 3RK3E 4A7PA 1JY3O 4C46A 3KXDA 3G6EP 1OFCX 1M7LA 4BRYB 2ZVOB 2E75B 3AE4C 1KYOD 3GF3A 3H1JE 4NPFX 5B5EE 2ZT9D 2M8RA 1URQB 3MIWA 1M1KQ 2JO1A 4MN4C 2K9JA 2VRSA 4WWIA 2JEEA 3D6ZA 1T2KC 4WY4D 1A02J 2C9LY 1M1JB 2B89A 1GD2E 1U7JA 1VQPP 2E76B 2E5TA 2YKQA 2KLUA 5TJHA 1NU1J 2LR2A 3CCUP 4U3FJ 2OYHA 4RJTA 1IFDA 3HUSB 3TF5A 3AE9C 1OMIA 2WPQA 2Z5HA 3L74G 1ZR2A 1E79H 1SQPD 2BCCG 3AECC 5AW5B 2IFNA 2IBZG 3AEEC 1KTMA 2WSFJ 3CCMP 1GL2A 4IOIH 2JKVA 2N9YB 1FOSF 4N78D 1GU4A 4IFFA 4K35A 1JY2O 5EFWB 3CC4P 4L73A 1Q82Q 1NKNA 1AQ5A 2XNDH 2QIWA 1VL2A 3CXHI 2IBZI 4KHXA 3E1RA 3BCCE 3AE6C 3S9OA 1BE3E 3L72D 2M3EA 1SQBD 2PP6A 3H1HE 5AW6B 3H1KG 1KFNA 2P10A 1HH0A 5DJTB 5AVQB 3L73G 2MJZA 1ZV8A 4TT3H 1SQQE 1VQ8P 1IO4A 5KLVJ 5CBNA 4XA4A 1L0ND 3HTKA 1L0LG 3CCLP 1LT9A 1OW8A 2B88A 2Y9ZA 1BGYG 1HGZA 2CPBA 3FX0A 1Z56A 1M1JC 5B66E 3FWLA 2E74D 1R8EA 3O6QA 1G2CA 4NPEA 2E76C 1VPCA 4W80A 4L74A 1BSNA 1QGKB 3CWBG 1OVRA 5APYA 1FDIA 2FYNB 3RL0B 1N7SB 5AVWB 1VQOP 3B5NB 3F5HA 1NTZJ 3P8MC 2ZFCA 1H88A 4QMAA 4M3LA 4GKGA 3A3YB 2N1TD 2R5BA 1MUUA 4WB4A 4IL6X 3MZWB 3T97B 3CD6P 2HODA 2A45H 5CCHD 2O1JA 1NH4A 1JOCA 4H0LB 4K3AA 1N73B 2XKMA 1USDA 1GMJA 1IK7A 5GTHH 4BRYA 2A06D 4I2LC 4I7ZC 2R3SA 1URQA 3L74D 1SQQK 1X9VA 2BCCD 3V6IA 1M56D 2W6AA 4I6MC 4N6JA 3CXHD 2BEQD 2IBZD 2RMZA 3P8CD 2ZAEB 3MD0A 5APSA 2KS1B 2QM7A 1DD3A 1JNMA 1MFZA 1M1JA 2PRRA 2ZT9B 2V4HA 4ZKPA 1RF0C 4PV1D 3M9BA 1FDOA 4ZMDA 4XFJA 1QLED 4IL6E 1Y9BA 3H1IG 1JY3P 4GOFA 2FKWB 2Y9YA 4WY4B 3V2QA 1NU1E 3HUSA 3NFQA 5TISE 2FYNC 1EQ7A 2Q3IA 3RL0C 1N7SC 2YO2A 4U3FE 3L71D 2QEXP 2K37A 4UB8E 3BATA 1LWUB 1YI2P 2AEFA 1FC2C 1Y47A 5CBOA 4PD4E 2Z5IA 3GLMA 2YMYA 3OW2O 2E42A 2QG4A 1KYOH 4Y99B 2NPSC 5M1BA 2ZYAA 4UB6H 2XNXA 1SQVK 1GTWA 2QSIA 2JWDA 3VP8A 3CX5H 4BWNA 3IR9A 1N8RQ 1N73C 3KHUA 1YBKA 2WPRA 2ZVNB 1KQSO 5BU5A 1YYCA 4IFMA 1NWQA 3D6YA 2LXCB 1VDFA 2Q7CA 1HF9A 1QL1A 1EZVE 2KSJA 2IDBA 2OTLP 2OTJP 1TU3F 5AVSB 3AEBC 4RO0A 1YJWP 1NTKJ 2WMMA 1JB0J 2QJPB 2RN0A 3L36A 2D2CC 1PP9D 1JY3N 3M9HA 5KLVE 3JSVC 2K1AA 1DH3A 1JMMA 2H89C 1LJ2A 3A0HE 2FYUD 1LGHB 1RF0A 1JY2P 2G3AA 2OTKE 2M3BA 3ABVC 4ASWA 5AW0B 1VQNP 4L76A 3ITKA 1WMKA 1FBMA 4DCKA 1GW3A 1NU1K 1XTGB 3AE1C 1S9KD 4WY4C 3CX5E 1SQPG 1RF1B 1N7SA 3B5NA 1AA0A 2E74B 4AYCA 3L70D 1ZRTD 2GUSA 3L35A 4LLHA 1NTZE 2M5AB 2H43A 3GF7A 3IF4A 2KNCB 1SVFA 3BRVB 3H1KJ 1M8OB 3T97A 4JYCA 3N4XA 5H2FH 3L72G 1P84D 2WTYA 1SQBG 3WUUA 4Y99C 1K05A 1FZGA 1N73A 3PH0A 1RQUA 2N1TB 4I1LA 2CPSA 1L0LJ 3LIDA 2QE7H 3CCEP 3FWNA 3NMDA 5AVTB 1SS1A 3HD7C 1NGMB 1BCCJ 1HTLC 1L0NG 3V2NA 1JY2N 1BSHA 1KILE 1HWTC 4KJMA 1DEBA 5CCGA 1KB9E 2WZ7A 3AE2C 1K73Q 2D2CD 2QJPC 1YQ4C 1L4AD 5KTBA 3RK2C 2WITA 2KS1A 1IZNB 3RK3C 1W2BO 5KLVD 3CWBJ 3SFDC 3VMYA 2KZIA 4WVZA 4EI2A 2O01H 1IFPA 2P67A 4OH8B 2MKVA 1YJ9P 1DD4A 4JBZA 2P7JA 2Q6QA 1OVVA 1NAYA 3VMXA 1J1EB 2I1KA 3PRJA 1YTZI 4WY4A 1M90Q 4D6TD 2M0BA 5AW3B 1K04A 1LTIC 1VQMP 4PJ0H 4HB1A 4O9BA 1FZEA 4ZNCA 3P7KA 1RF1C 1PGOA 4PV1B 4JPZB 2OARA 4YXDC 1HVVA 1GW4A 2E74C 1NTZK 1PZQA 1LWUA 1NOHA 2RKLA 4ASVA 3B8EB 1NTMJ 3A7OA 1EC5A 1RQVA 3II6A 3A0BH 1OXZA 3A5TA 1NJIQ 3AEFC 1OVUA 1SQXJ 1ZOYC 3BCCG 2A06G 1IFNA 1HUCA 5AW4B 1Q81Q 2JDIH 2KOGA 3CCRP 2AXTH 1BE3G 1OX3A 3H1LD 3VOPA 3ZDMA 5KLIB 1DIPA 2N1TC 3CXHH 3TGUJ 1VQ9P 3M91A 2W8ZA 3IN6A 3HD7D 1SQQG 3KZIH 3RBXA 3AE7C 3MHVA 5L8RJ 2FFDB 3WUVA 1OW6A 1KILD 5KKZB 4R4LA 3AE5C 5CCHC 1W2EA 3D70A 3M0DC 1EXJA 1IFIA 4C7RA 1NTKE 3G9RA 2YIUB 2C0WA 3B4SA 3S1KA 3RK2D 1T6AA 3H1IJ 1GDTA 5AVUB 1LTTC 3RK3D 2YKPA 4YPCA 1ZW0A 5APUA 1IFJA 4I7ZB 2ZXEB 4WBAA 2L5GB 4HH2A 3H1JD 3OJAB 4EOTA 3GG2A 3Q2YA 1LT1A 2SPZA 3TK1A 4EIJA 3M0AA 1JO5A 3L71G 3C9IA 1J1EC 1IFMA 1OIPA 1YTZT 2ZJSE 3TNUB 3G71P 2V7QH 2R5DA 1YHQP 1RF1A 4R4MA 1CSBA 1T3JA 2B9BA 2E5YA 1MFTA 2W83C 4PV1C 1FZBA 1MV8A 1GZLA 3KZIE 1LTJB 2M5AA 1VQ7P 3RL0g 3V5BA 3NXSA 2KNCA 1CW5A 3FXEA 1Q86Q 5AVRB 2KI7B 1KD1Q 2JJLA 1SFCC 3H1KE 3RBZA 2FY8A 1S1CX 1U7MA 1Y8AA 3CI9A 2N1TA 2BASA 1G1JA 4HKZH 3SWFA 5KLIC 3D71A 2W6JH 3V2PA 4B86A 5AW9B 1KFMA 3MGNA 1L0LE 2B87B 1PP9G 1X8YA 3VN0A 2UWJE 3V4WA 1BCCE 3MUDC 2FFDC 5CCHA 2Y0EA 3M0DA 2FYUG 2IX7C 4OGQD 2YKOA 1NTKK 5KKZC 1ZXGA 4C7NB 1SQVE 1KV4A 2YIUC 3BCCD 3MTUE 1DEEG 1Q90D 1KMIZ 1BE3D 1SQPJ 1YIJP 4HJGH 3H1HD 3CWBE 1LTSC 4AQRD 3AE3C 2C9NY 3BASA 1S5LX 2QJYC 3E1IA 2D2CB 1NU1G 2Y0CA 1S5LH 1L4AB 1SQQD 1PV3A 3L70G 3N7NA 3SSUA 4L75A 1N86A 3AEDC 3KQGA 4RESB 1FZCB 1ZN5A 3L72J 4BXLA 1LTAC 1SQBJ 1S4XA 1P84H 5E79H 3CCSP 1LTJC 4LC1A 3V4QA 2FXMA 3GMAA 5CMZA 2NPSB 2I8DA 2OQQA 4PD4I 1NTME 3NTNA 1OZHA 2XU6A 5CJ4A 1L0NJ 1FOSE 1VQ6P 5GTHE 3L75J 3M9QA 1SFCD 1CI6B 1P84I 1SQXE 4YXWH 1JTHB 1RE3C 3EWKA 4W7ZA 4GDOA 1EZVG 1LNQA 4DT0A 1L0LK 1L2PA 5APXA 1S5LE 1N2DC 3TGUE 3A2AA 3V2RA 3W67A 2FFDA 1JM0A 2K3RA 5KLVG 1EZVI 5KJ7C 2O01J 1EDIA 2KP8A 3GHGB 3IFMA 1SQVD 2K9YA 1PPJE 1Q7YQ 1IK9A 3HD7B 4DJGA 2WSSH 3H1IE 5KAFH 1Q2NA 4D6TG 1MZ9A 1KILB 4KT0J 3AEAC 4H44C 4IFDK 5AVVB 1E5WA 3RK2B 2E43A 1L4AC 2R44A 3RK3B 3TNUA 1IJDB 4XE5B 1PGQA 2AEJA 4EDFA 1NTZG 2C0XA 1FZCC 3Q5RA 1YJNP 3S4RA 1LTJA 2L91A 3L74J 1KYOE 2WSEH 2BCCJ 3Q3DA 3PJSK 1NTMK 4UB6E 4H13B 4YTPC
chains in the Genus database with same CATH topology
1LTIC 2POHA 3M06A 1SLQA 1HGZA 3EFGA 4O9BA 1FZEA 1T3UA 2CPBA 2KYVA 3P7KA 1RF1C 2R32A 1ZR4A 1Z56A 1M1JC 1HGVA 1SQXK 1SFCA 2OARA 1HVVA 1GW4A 1NTZK 1LTBC 1LWUA 1NOHA 1KQLA 1G2CA 2J59M 1VPCA 3B8EB 3U1CA 1S9KE 4W80A 2QM8A 2I1JA 3A7OA 3II6A 5APYA 1OXZA 3A5TA 5BVZA 3RL0B 1N7SB 5AVWB 3SWYA 3B5NC 1IFNA 3B5NB 3MUDA 3TYYA 1HUCA 5AW4B 3L37A 2KOGA 5KJ7D 3P8MC 2W27A 2ZFCA 5AVYB 1H88A 3CL3D 5APWA 3VOPA 5APQA 2HPCA 3LIEA 4M3LA 4GKGA 4C7NA 3A3YB 2N1TD 2N1TC 2R5BA 1H8AA 3PP5A 3GHGC 2HG5D 1J1DB 1MUUA 4WB4A 2YNYA 3M91A 3HD7D 2OYHB 2FFDB 2HODA 2A45H 2N9BA 5CCHD 1KILD 2O1JA 1NH4A 2HYNA 1JOCA 2J58A 1KILC 1W2EA 5CCHC 2XDJA 3M0DC 1XTCC 1N73B 1LTGC 2XKMA 2OYIA 1L4AA 1IFIA 4C7RA 2C0WA 3RK2D 2R3CA 4N78E 4ZKUA 5BU8B 1GDTA 5AVUB 1LTTC 3RK3D 1GL2C 1GL2B 1ZLLA 2YKPA 3H32B 5APUA 4I2LC 1IFJA 1URQA 1FZCA 2PAJA 2ZXEB 1SQQK 4WBAA 1X9VA 2L5GB 4HH2A 4N3YB 3OJAB 2W6AA 4EOTA 4I6MC 4N6JA 2XZRA 5CCGC 3TK1A 3P8CD 2FYUK 4EIJA 3HRNA 3M0AA 1OWAA 3MD0A 4DZOA 1JO5A 5APSA 1KZUB 1J1EC 2NPSA 3C9IA 2YO3A 2H7HA 1IFMA 2WWWA 2QM7A 1YTZT 3TNUB 1JNMA 2NPSD 2R5DA 4JYBA 1RF1A 1MFZA 1CSBA 1M1JA 1T3JA 2W6BA 4ZKPA 1JCCA 3VMZA 1CZQA 1RF0C 1CI6A 1H89A 2WT7B 3M9BA 1FZBA 1MV8A 1GZLA 1JTHA 1N7LA 1RE3A 1PFIA 3TSIA 2P2UA 1HJBA 4JF7A 2WPSA 1LTJB 5AW1B 1NKZB 3HTKB 3V5BA 2KLVA 1JY3P 4LGDE 5CHXA 5AW2B 1LT9C 1LT9B 3NXSA 2FKWB 4WY4B 1CW5A 1QL2A 1FJKA 5AVRB 3V2QA 3HUSA 4AUWA 3NFQA 3RL0D 1EQ7A 1N7SD 2Q3IA 3R2PA 3RL0C 2GUVA 3U59A 2JJLA 1N7SC 2YO2A 3B5ND 1SFCC 1SFCB 5KJ7A 2XV5A 4W7YA 3BRTB 1RE4C 3BATA 3CI9A 1LWUC 1LWUB 3VYIA 1G2CB 2N1TA 2BASA 3KYQA 1G1JA 3GHGA 3SWFA 2Z5IA 5AW7B 1HBWA 2FYZA 3VTPC 3HE4A 3V2PA 2YMYA 5AW9B 4B86A 1KFMA 3MGNA 3HD7A 1J1DC 2E42A 2Q5UA 3OA7A 3UIAA 1X8YA 2Z4EA 3KPEA 3VN0A 3VP9A 2IFMA 2OYHC 1A02F 1SQPK 3V4WA 1FJPA 2FFDC 5CCHA 1KILA 4Y99B 3OAKA 3M0DA 2KB7P 1SP4A 2IX7C 2XNXA 4HYTB 1SQVK 3WMM0 1GTWA 2YKOA 3G3ZA 4GT1A 1NTKK 3I5CA 1NHLA 2HPCB 3VP8A 3IR9A 1N73C 4C7NB 3CLQA 2WPRA 3MTUE 3HE5A 5BU5A 1YYCA 4IFMA 1NWQA 1IC2A 1GL2D 1VDFA 2Q7CA 1FZAA 1QL1A 4DOJA 2KSJA 2GM4A 1LTSC 4AQRD 2HODB 3EQ2A 5AVSB 2C9NY 3BASA 1FDMA 1SQBK 5APVA 5KLVK 2Q9IA 3L36A 3E1IA 3H6PA 1GK6A 5CCGD 1G1IA 2HLOA 1JY3N 2OYIB 1L4AB 3M9HA 1AFOA 1JY3O 4C46A 1DH3A 1M7LA 4GIFA 1JMMA 3N7NA 1N86A 1LGHB 5AVZB 1RF0A 5CJ0A 3KQGA 1L0NK 2HFED 4RESB 1URQC 1URQB 1JY2P 2M8RA 2WSCH 1FZCB 1ZN5A 5AVXB 3P8CE 1GU5A 3MIWA 1LTAC 1DX7A 1GK4A 2M3BA 5AW0B 1WRGA 2VRSA 1X79B 2JEEA 1LTJC 4LC1A 1T2KD 3V4QA 2FXMA 1FBMA 1T2KC 1J2JB 1GW3A 5CMZA 2NPSB 1NU1K 1WT6A 1XTGB 4WY4D 1S9KD 4WY4C 3NTNA 1A02J 2XU6A 2IPPA 5CJ4A 1RF1B 1T8ZA 1FOSE 1FZFA 2C9LY 1N7SA 1M1JB 1GD2E 3B5NA 3M9QA 1RE4A 4AYCA 1SFCD 1CI6B 5APTA 1JTHB 1JCDA 1RE3C 2GUSA 2YKQA 3L35A 4W7ZA 4LLHA 2H43A 1L0LK 5APXA 3P32A 3O8ZA 1SVFA 3BRVB 1N2DC 2OYHA 1IFDA 3HUSC 3HUSB 3U1AA 3A2AA 3T97A 3V2RA 4JYCA 3N4XA 2FFDA 5AW8B 2WTYA 5KJ7C 2WPQA 2Z5HA 4Y99C 1FZGA 1N73A 3L4FA 2KP8A 1ZR2A 2N1TB 4I1LA 2CPSA 1FU1A 3GHGB 5AW5B 3LIDA 2IFNA 3NMDA 5AVTB 3IFMA 2O1KA 3HE4B 1IK9A 1GL2A 3HD7C 3H32A 3HD7B 1FOSF 1HTLC 3V2NA 1JY2N 4N78D 1GU4A 1FAVA 4IFFA 1JY2O 1HWTC 1DEBA 1MZ9A 2A45G 1RY3A 1KILB 1NKNA 1AQ5A 5CCGA 4KHXA 2WZ7A 1JUNA 4IFDK 1L4AD 5KTBA 5AVVB 3LW5H 3RK2C 1E5WA 3RK2B 2OYIC 2E43A 1L4AC 2WITA 2P1JA 3RK3C 3RK3B 2PP6A 3TNUA 1IJDB 5AW6B 3HE5B 2A45I 3VMYA 3KDPB 1KFNA 4XE5B 1HH0A 2O01H 2H8PD 2LKMA 5AVQB 1URQD 1NAFA 2C0XA 2WT7A 2MJZA 2P67A 1FZCC 1ZV8A 4OH8B 1IO4A 2P7JA 4XA4A 1LTJA 1NO4A 3HTKA 3VMXA 2WSFH 1J1EB 2I1KA 2WSEH 1YTZI 1LT9A 1NTMK 4WY4A 5AW3B 3BVHA 2NPSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTG C;  1LTA C;  1LTI C;  1LTT C;  1HTL C;  1LTB C;  1XTC C;  1LTS C; 
#chains in the Genus database with same CATH topology
 3H1L G;  2POH A;  2QJK B;  1ZR4 A;  4EYY Q;  1HGV A;  1SQX K;  1NU1 D;  1BDC A;  1LTB C;  1KQL A;  4U3F D;  2ZYG A;  1JMB A;  3CMA P;  3U1C A;  2I1J A;  2JWA A;  2B87 A;  4PD4 D;  5BVZ A;  3CC7 P;  3L37 A;  3L73 J;  5KJ7 D;  3G4S P;  2W27 A;  3CL3 D;  2IYO A;  5APQ A;  4C7N A;  5B5E H;  3H1J G;  1KB9 I;  3L71 J;  3GHG C;  1J1D B;  3E7K A;  1YIT P;  1KC8 Q;  4GOE A;  1QVF O;  1VQ4 P;  1NVO A;  1BGY J;  2YMK A;  2DW3 A;  2V7Q J;  3I55 P;  2N9B A;  1SQP E;  1EZV D;  4OGQ B;  2HYN A;  1KIL C;  1L4A A;  4H44 D;  4OVN F;  1VQK P;  1KQF B;  1MKM A;  4N78 E;  1GL2 C;  1ZLL A;  3H32 B;  3H25 A;  3TDK A;  1FZC A;  1SQB E;  3HRN A;  3WU2 H;  5H2F E;  3GW6 A;  2NPS A;  3PTZ A;  2YO3 A;  2H7H A;  2WWW A;  2ZXX A;  2NPS D;  2O3J A;  4JYB A;  4H13 C;  1PP9 J;  2W6B A;  2QJK C;  3C1L A;  1JCC A;  3VMZ A;  1CZQ A;  3CX5 D;  1CI6 A;  2WT7 B;  1L0N E;  2H88 C;  2PFX A;  1JTH A;  2FYU J;  1N7L A;  1PFI A;  3TSI A;  2P2U A;  3L75 E;  2KZJ A;  2WPS A;  1NKZ B;  4GOD A;  2YXQ B;  5CHX A;  1LT9 C;  2KUB A;  1NTZ D;  1QL2 A;  3FGA D;  1FJK A;  1NYH A;  4AUW A;  3U59 A;  2OGU A;  1NTK G;  1SFC B;  1UIX A;  2XV5 A;  3JCU H;  4W7Y A;  1R5L A;  1RE4 C;  3VYI A;  3Q5S A;  2NRG A;  3H1H G;  3GHG A;  2QVA A;  2PGD A;  2OYO A;  1PIX A;  3LW5 J;  2FYZ A;  1HBW A;  3L70 J;  3HD7 A;  1J1D C;  3WU2 E;  3OA7 A;  2CK3 H;  3UIA A;  2AXC A;  1EDL A;  4NPD A;  3KPE A;  3VP9 A;  3W68 A;  1A02 F;  1SQP K;  1S3J A;  1KIL A;  1U57 A;  2KB7 P;  3WMM 0;  4PJ0 E;  3G3Z A;  4OGQ C;  2HPC B;  4TLF A;  1KB9 D;  3CCQ P;  5B66 H;  2HR3 A;  3QWO C;  1IC2 A;  1GL2 D;  1PL5 A;  2GM4 A;  4DOJ A;  1X22 A;  1M57 D;  2RH0 A;  1X0T A;  1SQB K;  3A0B E;  5C39 A;  1VQL P;  2A06 E;  2QJY B;  1S2E A;  1K8A Q;  2OYI B;  1AFO A;  3JCU E;  2AXT E;  4GIF A;  3L74 E;  2E75 C;  2BCC E;  2YXR B;  4H13 D;  5AVZ B;  5CJ0 A;  4OWF A;  1L0N K;  2HFE D;  1URQ C;  2WSC H;  3CXH E;  2IBZ E;  5AVX B;  1ZP0 C;  3P8C E;  1GU5 A;  1DX7 A;  1GK4 A;  1EDK A;  1WRG A;  1X79 B;  3L75 D;  1T2K D;  3AEG C;  1J2J B;  1WT6 A;  1BCC G;  3K5B A;  1AJY A;  1H0T B;  2IPP A;  1T8Z A;  1FZF A;  1VF5 B;  1S72 P;  1AV1 A;  1SQV G;  4D6T J;  1RE4 A;  5APT A;  1JCD A;  2K88 A;  3L73 E;  1AVY A;  3P32 A;  3O8Z A;  3L71 E;  3HUS C;  3U1A A;  3VMA A;  5AW8 B;  3PHL A;  3CCV P;  1BGY E;  1FS0 E;  1VQ5 P;  1FE6 A;  3L4F A;  1LP1 B;  3JC2 2;  1R5S A;  1FU1 A;  2BEZ F;  2JR8 A;  2O1K A;  3WUT A;  3HE4 B;  2WSE J;  1NTK D;  3H32 A;  3H1L J;  1EXI A;  4IL6 H;  1FAV A;  2A45 G;  1RY3 A;  3B71 A;  1NTM G;  4H44 B;  5TIS H;  1JUN A;  3LW5 H;  2OYI C;  2P1J A;  1KQG B;  2ZYD A;  1QEX A;  3HE5 B;  2E75 D;  2A45 I;  4U3F G;  2Q1K A;  4UB8 H;  1SQX G;  3KDP B;  2FXO A;  4Y28 J;  3C8V A;  2H8P D;  2LKM A;  1URQ D;  1NAF A;  4PD4 H;  2WT7 A;  3CME P;  1PP9 E;  1K9M Q;  1NO4 A;  2WSF H;  3TGU G;  2FYU E;  3H1J J;  3BVH A;  3CC2 P;  3M06 A;  1SLQ A;  3EFG A;  3MP7 B;  1T3U A;  2KYV A;  2WQY C;  2R32 A;  1SFC A;  1VF5 C;  3EFF K;  2WPV B;  2E76 D;  3Q5P A;  1PPJ G;  3SFE C;  2J59 M;  3H1K D;  2K9J B;  1S9K E;  3IAO A;  3RGU A;  1KN7 A;  2QM8 A;  1D7M A;  3L73 D;  3CPW O;  2G8Y A;  4U7J A;  3L70 E;  3SWY A;  1L0L D;  3B5N C;  3MUD A;  1ZRT E;  3TYY A;  3R4Y A;  2GA1 A;  3A0H H;  5AVY B;  1BGY D;  1BCC D;  5APW A;  2HPC A;  3LIE A;  1W5C E;  2KIK A;  1H8A A;  3PP5 A;  3F89 A;  2HG5 D;  2FXP A;  3I56 P;  2FBW C;  2YNY A;  2QRX A;  1P84 E;  5E79 E;  2OYH B;  2NZ2 A;  2ITA A;  1AVO A;  5KAI H;  4H0L C;  2J58 A;  2XDJ A;  3CWB D;  1XTC C;  1HJ0 A;  1LTG C;  2OYI A;  2QA4 P;  2R3C A;  4ZKU A;  5BU8 B;  1KYO I;  1GL2 B;  1YQ3 C;  2PAJ A;  4N3Y B;  3BCC J;  3CX5 I;  1BE3 J;  4Z1M H;  2XZR A;  5CCG C;  2FYU K;  3H1H J;  1OWA A;  2IYP A;  4DZO A;  1RH5 B;  1KZU B;  4RKU J;  1H0T A;  3FXD A;  2ZT9 C;  1SQQ J;  1PGP A;  2LXB A;  1NTM D;  1VF5 D;  1H89 A;  2JP3 A;  1RE3 A;  1JEK A;  1HJB A;  4JF7 A;  1EDJ A;  5KAF E;  3SWK A;  4D6T E;  5AW1 B;  1SQX D;  3HTK B;  1PGJ A;  2KLV A;  5KAI E;  4LGD E;  5AW2 B;  1LT9 B;  5K5G B;  1KB9 H;  1OW7 A;  3RL0 D;  3R2P A;  1N7S D;  5GTI H;  2GUV A;  3B5N D;  3Q1M A;  5KJ7 A;  2KK7 A;  3TGU D;  2Y0D A;  3BRT B;  5DJU B;  3O6Q B;  1LP1 A;  1LWU C;  1G2C B;  3KYQ A;  5AW7 B;  3VTP C;  2Q3E A;  3HE4 A;  2WVR A;  3USS A;  2Q5U A;  2Z4E A;  1USE A;  1KOR A;  2IFM A;  2OYH C;  3QH9 A;  1PPJ D;  2W90 A;  1ZME C;  3H1L E;  1FJP A;  2P58 A;  3H1I D;  3OAK A;  4CPG A;  2WSC J;  1SP4 A;  4HYT B;  2IZ0 A;  4H0L D;  4GT1 A;  2O01 N;  3I5C A;  1NHL A;  3CLQ A;  3PLN A;  3AE8 C;  2KXP B;  1QVG O;  2KSE A;  3HE5 A;  4JQ0 D;  1FZA A;  3L75 G;  2AEM A;  1UII A;  2HOD B;  2IZ1 A;  3EQ2 A;  3CCJ P;  1SQV J;  1BDD A;  1FDM A;  5APV A;  5KLV K;  2Q9I A;  3H6P A;  5GTI E;  1GK6 A;  1QX8 A;  1G1I A;  1RHZ B;  2J5U A;  5CCG D;  2HLO A;  1AQT A;  3L72 E;  3RK3 E;  4A7P A;  1JY3 O;  4C46 A;  3KXD A;  3G6E P;  1OFC X;  1M7L A;  4BRY B;  2ZVO B;  2E75 B;  3AE4 C;  1KYO D;  3GF3 A;  3H1J E;  4NPF X;  5B5E E;  2ZT9 D;  2M8R A;  1URQ B;  3MIW A;  1M1K Q;  2JO1 A;  4MN4 C;  2K9J A;  2VRS A;  4WWI A;  2JEE A;  3D6Z A;  1T2K C;  4WY4 D;  1A02 J;  2C9L Y;  1M1J B;  2B89 A;  1GD2 E;  1U7J A;  1VQP P;  2E76 B;  2E5T A;  2YKQ A;  2KLU A;  5TJH A;  1NU1 J;  2LR2 A;  3CCU P;  4U3F J;  2OYH A;  4RJT A;  1IFD A;  3HUS B;  3TF5 A;  3AE9 C;  1OMI A;  2WPQ A;  2Z5H A;  3L74 G;  1ZR2 A;  1E79 H;  1SQP D;  2BCC G;  3AEC C;  5AW5 B;  2IFN A;  2IBZ G;  3AEE C;  1KTM A;  2WSF J;  3CCM P;  1GL2 A;  4IOI H;  2JKV A;  2N9Y B;  1FOS F;  4N78 D;  1GU4 A;  4IFF A;  4K35 A;  1JY2 O;  5EFW B;  3CC4 P;  4L73 A;  1Q82 Q;  1NKN A;  1AQ5 A;  2XND H;  2QIW A;  1VL2 A;  3CXH I;  2IBZ I;  4KHX A;  3E1R A;  3BCC E;  3AE6 C;  3S9O A;  1BE3 E;  3L72 D;  2M3E A;  1SQB D;  2PP6 A;  3H1H E;  5AW6 B;  3H1K G;  1KFN A;  2P10 A;  1HH0 A;  5DJT B;  5AVQ B;  3L73 G;  2MJZ A;  1ZV8 A;  4TT3 H;  1SQQ E;  1VQ8 P;  1IO4 A;  5KLV J;  5CBN A;  4XA4 A;  1L0N D;  3HTK A;  1L0L G;  3CCL P;  1LT9 A;  1OW8 A;  2B88 A;  2Y9Z A;  1BGY G;  1HGZ A;  2CPB A;  3FX0 A;  1Z56 A;  1M1J C;  5B66 E;  3FWL A;  2E74 D;  1R8E A;  3O6Q A;  1G2C A;  4NPE A;  2E76 C;  1VPC A;  4W80 A;  4L74 A;  1BSN A;  1QGK B;  3CWB G;  1OVR A;  5APY A;  1FDI A;  2FYN B;  3RL0 B;  1N7S B;  5AVW B;  1VQO P;  3B5N B;  3F5H A;  1NTZ J;  3P8M C;  2ZFC A;  1H88 A;  4QMA A;  4M3L A;  4GKG A;  3A3Y B;  2N1T D;  2R5B A;  1MUU A;  4WB4 A;  4IL6 X;  3MZW B;  3T97 B;  3CD6 P;  2HOD A;  2A45 H;  5CCH D;  2O1J A;  1NH4 A;  1JOC A;  4H0L B;  4K3A A;  1N73 B;  2XKM A;  1USD A;  1GMJ A;  1IK7 A;  5GTH H;  4BRY A;  2A06 D;  4I2L C;  4I7Z C;  2R3S A;  1URQ A;  3L74 D;  1SQQ K;  1X9V A;  2BCC D;  3V6I A;  1M56 D;  2W6A A;  4I6M C;  4N6J A;  3CXH D;  2BEQ D;  2IBZ D;  2RMZ A;  3P8C D;  2ZAE B;  3MD0 A;  5APS A;  2KS1 B;  2QM7 A;  1DD3 A;  1JNM A;  1MFZ A;  1M1J A;  2PRR A;  2ZT9 B;  2V4H A;  4ZKP A;  1RF0 C;  4PV1 D;  3M9B A;  1FDO A;  4ZMD A;  4XFJ A;  1QLE D;  4IL6 E;  1Y9B A;  3H1I G;  1JY3 P;  4GOF A;  2FKW B;  2Y9Y A;  4WY4 B;  3V2Q A;  1NU1 E;  3HUS A;  3NFQ A;  5TIS E;  2FYN C;  1EQ7 A;  2Q3I A;  3RL0 C;  1N7S C;  2YO2 A;  4U3F E;  3L71 D;  2QEX P;  2K37 A;  4UB8 E;  3BAT A;  1LWU B;  1YI2 P;  2AEF A;  1FC2 C;  1Y47 A;  5CBO A;  4PD4 E;  2Z5I A;  3GLM A;  2YMY A;  3OW2 O;  2E42 A;  2QG4 A;  1KYO H;  4Y99 B;  2NPS C;  5M1B A;  2ZYA A;  4UB6 H;  2XNX A;  1SQV K;  1GTW A;  2QSI A;  2JWD A;  3VP8 A;  3CX5 H;  4BWN A;  3IR9 A;  1N8R Q;  1N73 C;  3KHU A;  1YBK A;  2WPR A;  2ZVN B;  1KQS O;  5BU5 A;  1YYC A;  4IFM A;  1NWQ A;  3D6Y A;  2LXC B;  1VDF A;  2Q7C A;  1HF9 A;  1QL1 A;  1EZV E;  2KSJ A;  2IDB A;  2OTL P;  2OTJ P;  1TU3 F;  5AVS B;  3AEB C;  4RO0 A;  1YJW P;  1NTK J;  2WMM A;  1JB0 J;  2QJP B;  2RN0 A;  3L36 A;  2D2C C;  1PP9 D;  1JY3 N;  3M9H A;  5KLV E;  3JSV C;  2K1A A;  1DH3 A;  1JMM A;  2H89 C;  1LJ2 A;  3A0H E;  2FYU D;  1LGH B;  1RF0 A;  1JY2 P;  2G3A A;  2OTK E;  2M3B A;  3ABV C;  4ASW A;  5AW0 B;  1VQN P;  4L76 A;  3ITK A;  1WMK A;  1FBM A;  4DCK A;  1GW3 A;  1NU1 K;  1XTG B;  3AE1 C;  1S9K D;  4WY4 C;  3CX5 E;  1SQP G;  1RF1 B;  1N7S A;  3B5N A;  1AA0 A;  2E74 B;  4AYC A;  3L70 D;  1ZRT D;  2GUS A;  3L35 A;  4LLH A;  1NTZ E;  2M5A B;  2H43 A;  3GF7 A;  3IF4 A;  2KNC B;  1SVF A;  3BRV B;  3H1K J;  1M8O B;  3T97 A;  4JYC A;  3N4X A;  5H2F H;  3L72 G;  1P84 D;  2WTY A;  1SQB G;  3WUU A;  4Y99 C;  1K05 A;  1FZG A;  1N73 A;  3PH0 A;  1RQU A;  2N1T B;  4I1L A;  2CPS A;  1L0L J;  3LID A;  2QE7 H;  3CCE P;  3FWN A;  3NMD A;  5AVT B;  1SS1 A;  3HD7 C;  1NGM B;  1BCC J;  1HTL C;  1L0N G;  3V2N A;  1JY2 N;  1BSH A;  1KIL E;  1HWT C;  4KJM A;  1DEB A;  5CCG A;  1KB9 E;  2WZ7 A;  3AE2 C;  1K73 Q;  2D2C D;  2QJP C;  1YQ4 C;  1L4A D;  5KTB A;  3RK2 C;  2WIT A;  2KS1 A;  1IZN B;  3RK3 C;  1W2B O;  5KLV D;  3CWB J;  3SFD C;  3VMY A;  2KZI A;  4WVZ A;  4EI2 A;  2O01 H;  1IFP A;  2P67 A;  4OH8 B;  2MKV A;  1YJ9 P;  1DD4 A;  4JBZ A;  2P7J A;  2Q6Q A;  1OVV A;  1NAY A;  3VMX A;  1J1E B;  2I1K A;  3PRJ A;  1YTZ I;  4WY4 A;  1M90 Q;  4D6T D;  2M0B A;  5AW3 B;  1K04 A;  1LTI C;  1VQM P;  4PJ0 H;  4HB1 A;  4O9B A;  1FZE A;  4ZNC A;  3P7K A;  1RF1 C;  1PGO A;  4PV1 B;  4JPZ B;  2OAR A;  4YXD C;  1HVV A;  1GW4 A;  2E74 C;  1NTZ K;  1PZQ A;  1LWU A;  1NOH A;  2RKL A;  4ASV A;  3B8E B;  1NTM J;  3A7O A;  1EC5 A;  1RQV A;  3II6 A;  3A0B H;  1OXZ A;  3A5T A;  1NJI Q;  3AEF C;  1OVU A;  1SQX J;  1ZOY C;  3BCC G;  2A06 G;  1IFN A;  1HUC A;  5AW4 B;  1Q81 Q;  2JDI H;  2KOG A;  3CCR P;  2AXT H;  1BE3 G;  1OX3 A;  3H1L D;  3VOP A;  3ZDM A;  5KLI B;  1DIP A;  2N1T C;  3CXH H;  3TGU J;  1VQ9 P;  3M91 A;  2W8Z A;  3IN6 A;  3HD7 D;  1SQQ G;  3KZI H;  3RBX A;  3AE7 C;  3MHV A;  5L8R J;  2FFD B;  3WUV A;  1OW6 A;  1KIL D;  5KKZ B;  4R4L A;  3AE5 C;  5CCH C;  1W2E A;  3D70 A;  3M0D C;  1EXJ A;  1IFI A;  4C7R A;  1NTK E;  3G9R A;  2YIU B;  2C0W A;  3B4S A;  3S1K A;  3RK2 D;  1T6A A;  3H1I J;  1GDT A;  5AVU B;  1LTT C;  3RK3 D;  2YKP A;  4YPC A;  1ZW0 A;  5APU A;  1IFJ A;  4I7Z B;  2ZXE B;  4WBA A;  2L5G B;  4HH2 A;  3H1J D;  3OJA B;  4EOT A;  3GG2 A;  3Q2Y A;  1LT1 A;  2SPZ A;  3TK1 A;  4EIJ A;  3M0A A;  1JO5 A;  3L71 G;  3C9I A;  1J1E C;  1IFM A;  1OIP A;  1YTZ T;  2ZJS E;  3TNU B;  3G71 P;  2V7Q H;  2R5D A;  1YHQ P;  1RF1 A;  4R4M A;  1CSB A;  1T3J A;  2B9B A;  2E5Y A;  1MFT A;  2W83 C;  4PV1 C;  1FZB A;  1MV8 A;  1GZL A;  3KZI E;  1LTJ B;  2M5A A;  1VQ7 P;  3RL0 g;  3V5B A;  3NXS A;  2KNC A;  1CW5 A;  3FXE A;  1Q86 Q;  5AVR B;  2KI7 B;  1KD1 Q;  2JJL A;  1SFC C;  3H1K E;  3RBZ A;  2FY8 A;  1S1C X;  1U7M A;  1Y8A A;  3CI9 A;  2N1T A;  2BAS A;  1G1J A;  4HKZ H;  3SWF A;  5KLI C;  3D71 A;  2W6J H;  3V2P A;  4B86 A;  5AW9 B;  1KFM A;  3MGN A;  1L0L E;  2B87 B;  1PP9 G;  1X8Y A;  3VN0 A;  2UWJ E;  3V4W A;  1BCC E;  3MUD C;  2FFD C;  5CCH A;  2Y0E A;  3M0D A;  2FYU G;  2IX7 C;  4OGQ D;  2YKO A;  1NTK K;  5KKZ C;  1ZXG A;  4C7N B;  1SQV E;  1KV4 A;  2YIU C;  3BCC D;  3MTU E;  1DEE G;  1Q90 D;  1KMI Z;  1BE3 D;  1SQP J;  1YIJ P;  4HJG H;  3H1H D;  3CWB E;  1LTS C;  4AQR D;  3AE3 C;  2C9N Y;  3BAS A;  1S5L X;  2QJY C;  3E1I A;  2D2C B;  1NU1 G;  2Y0C A;  1S5L H;  1L4A B;  1SQQ D;  1PV3 A;  3L70 G;  3N7N A;  3SSU A;  4L75 A;  1N86 A;  3AED C;  3KQG A;  4RES B;  1FZC B;  1ZN5 A;  3L72 J;  4BXL A;  1LTA C;  1SQB J;  1S4X A;  1P84 H;  5E79 H;  3CCS P;  1LTJ C;  4LC1 A;  3V4Q A;  2FXM A;  3GMA A;  5CMZ A;  2NPS B;  2I8D A;  2OQQ A;  4PD4 I;  1NTM E;  3NTN A;  1OZH A;  2XU6 A;  5CJ4 A;  1L0N J;  1FOS E;  1VQ6 P;  5GTH E;  3L75 J;  3M9Q A;  1SFC D;  1CI6 B;  1P84 I;  1SQX E;  4YXW H;  1JTH B;  1RE3 C;  3EWK A;  4W7Z A;  4GDO A;  1EZV G;  1LNQ A;  4DT0 A;  1L0L K;  1L2P A;  5APX A;  1S5L E;  1N2D C;  3TGU E;  3A2A A;  3V2R A;  3W67 A;  2FFD A;  1JM0 A;  2K3R A;  5KLV G;  1EZV I;  5KJ7 C;  2O01 J;  1EDI A;  2KP8 A;  3GHG B;  3IFM A;  1SQV D;  2K9Y A;  1PPJ E;  1Q7Y Q;  1IK9 A;  3HD7 B;  4DJG A;  2WSS H;  3H1I E;  5KAF H;  1Q2N A;  4D6T G;  1MZ9 A;  1KIL B;  4KT0 J;  3AEA C;  4H44 C;  4IFD K;  5AVV B;  1E5W A;  3RK2 B;  2E43 A;  1L4A C;  2R44 A;  3RK3 B;  3TNU A;  1IJD B;  4XE5 B;  1PGQ A;  2AEJ A;  4EDF A;  1NTZ G;  2C0X A;  1FZC C;  3Q5R A;  1YJN P;  3S4R A;  1LTJ A;  2L91 A;  3L74 J;  1KYO E;  2WSE H;  2BCC J;  3Q3D A;  3PJS K;  1NTM K;  4UB6 E;  4H13 B;  4YTP C; 
#chains in the Genus database with same CATH homology
 1LTI C;  2POH A;  3M06 A;  1SLQ A;  1HGZ A;  3EFG A;  4O9B A;  1FZE A;  1T3U A;  2CPB A;  2KYV A;  3P7K A;  1RF1 C;  2R32 A;  1ZR4 A;  1Z56 A;  1M1J C;  1HGV A;  1SQX K;  1SFC A;  2OAR A;  1HVV A;  1GW4 A;  1NTZ K;  1LTB C;  1LWU A;  1NOH A;  1KQL A;  1G2C A;  2J59 M;  1VPC A;  3B8E B;  3U1C A;  1S9K E;  4W80 A;  2QM8 A;  2I1J A;  3A7O A;  3II6 A;  5APY A;  1OXZ A;  3A5T A;  5BVZ A;  3RL0 B;  1N7S B;  5AVW B;  3SWY A;  3B5N C;  1IFN A;  3B5N B;  3MUD A;  3TYY A;  1HUC A;  5AW4 B;  3L37 A;  2KOG A;  5KJ7 D;  3P8M C;  2W27 A;  2ZFC A;  5AVY B;  1H88 A;  3CL3 D;  5APW A;  3VOP A;  5APQ A;  2HPC A;  3LIE A;  4M3L A;  4GKG A;  4C7N A;  3A3Y B;  2N1T D;  2N1T C;  2R5B A;  1H8A A;  3PP5 A;  3GHG C;  2HG5 D;  1J1D B;  1MUU A;  4WB4 A;  2YNY A;  3M91 A;  3HD7 D;  2OYH B;  2FFD B;  2HOD A;  2A45 H;  2N9B A;  5CCH D;  1KIL D;  2O1J A;  1NH4 A;  2HYN A;  1JOC A;  2J58 A;  1KIL C;  1W2E A;  5CCH C;  2XDJ A;  3M0D C;  1XTC C;  1N73 B;  1LTG C;  2XKM A;  2OYI A;  1L4A A;  1IFI A;  4C7R A;  2C0W A;  3RK2 D;  2R3C A;  4N78 E;  4ZKU A;  5BU8 B;  1GDT A;  5AVU B;  1LTT C;  3RK3 D;  1GL2 C;  1GL2 B;  1ZLL A;  2YKP A;  3H32 B;  5APU A;  4I2L C;  1IFJ A;  1URQ A;  1FZC A;  2PAJ A;  2ZXE B;  1SQQ K;  4WBA A;  1X9V A;  2L5G B;  4HH2 A;  4N3Y B;  3OJA B;  2W6A A;  4EOT A;  4I6M C;  4N6J A;  2XZR A;  5CCG C;  3TK1 A;  3P8C D;  2FYU K;  4EIJ A;  3HRN A;  3M0A A;  1OWA A;  3MD0 A;  4DZO A;  1JO5 A;  5APS A;  1KZU B;  1J1E C;  2NPS A;  3C9I A;  2YO3 A;  2H7H A;  1IFM A;  2WWW A;  2QM7 A;  1YTZ T;  3TNU B;  1JNM A;  2NPS D;  2R5D A;  4JYB A;  1RF1 A;  1MFZ A;  1CSB A;  1M1J A;  1T3J A;  2W6B A;  4ZKP A;  1JCC A;  3VMZ A;  1CZQ A;  1RF0 C;  1CI6 A;  1H89 A;  2WT7 B;  3M9B A;  1FZB A;  1MV8 A;  1GZL A;  1JTH A;  1N7L A;  1RE3 A;  1PFI A;  3TSI A;  2P2U A;  1HJB A;  4JF7 A;  2WPS A;  1LTJ B;  5AW1 B;  1NKZ B;  3HTK B;  3V5B A;  2KLV A;  1JY3 P;  4LGD E;  5CHX A;  5AW2 B;  1LT9 C;  1LT9 B;  3NXS A;  2FKW B;  4WY4 B;  1CW5 A;  1QL2 A;  1FJK A;  5AVR B;  3V2Q A;  3HUS A;  4AUW A;  3NFQ A;  3RL0 D;  1EQ7 A;  1N7S D;  2Q3I A;  3R2P A;  3RL0 C;  2GUV A;  3U59 A;  2JJL A;  1N7S C;  2YO2 A;  3B5N D;  1SFC C;  1SFC B;  5KJ7 A;  2XV5 A;  4W7Y A;  3BRT B;  1RE4 C;  3BAT A;  3CI9 A;  1LWU C;  1LWU B;  3VYI A;  1G2C B;  2N1T A;  2BAS A;  3KYQ A;  1G1J A;  3GHG A;  3SWF A;  2Z5I A;  5AW7 B;  1HBW A;  2FYZ A;  3VTP C;  3HE4 A;  3V2P A;  2YMY A;  5AW9 B;  4B86 A;  1KFM A;  3MGN A;  3HD7 A;  1J1D C;  2E42 A;  2Q5U A;  3OA7 A;  3UIA A;  1X8Y A;  2Z4E A;  3KPE A;  3VN0 A;  3VP9 A;  2IFM A;  2OYH C;  1A02 F;  1SQP K;  3V4W A;  1FJP A;  2FFD C;  5CCH A;  1KIL A;  4Y99 B;  3OAK A;  3M0D A;  2KB7 P;  1SP4 A;  2IX7 C;  2XNX A;  4HYT B;  1SQV K;  3WMM 0;  1GTW A;  2YKO A;  3G3Z A;  4GT1 A;  1NTK K;  3I5C A;  1NHL A;  2HPC B;  3VP8 A;  3IR9 A;  1N73 C;  4C7N B;  3CLQ A;  2WPR A;  3MTU E;  3HE5 A;  5BU5 A;  1YYC A;  4IFM A;  1NWQ A;  1IC2 A;  1GL2 D;  1VDF A;  2Q7C A;  1FZA A;  1QL1 A;  4DOJ A;  2KSJ A;  2GM4 A;  1LTS C;  4AQR D;  2HOD B;  3EQ2 A;  5AVS B;  2C9N Y;  3BAS A;  1FDM A;  1SQB K;  5APV A;  5KLV K;  2Q9I A;  3L36 A;  3E1I A;  3H6P A;  1GK6 A;  5CCG D;  1G1I A;  2HLO A;  1JY3 N;  2OYI B;  1L4A B;  3M9H A;  1AFO A;  1JY3 O;  4C46 A;  1DH3 A;  1M7L A;  4GIF A;  1JMM A;  3N7N A;  1N86 A;  1LGH B;  5AVZ B;  1RF0 A;  5CJ0 A;  3KQG A;  1L0N K;  2HFE D;  4RES B;  1URQ C;  1URQ B;  1JY2 P;  2M8R A;  2WSC H;  1FZC B;  1ZN5 A;  5AVX B;  3P8C E;  1GU5 A;  3MIW A;  1LTA C;  1DX7 A;  1GK4 A;  2M3B A;  5AW0 B;  1WRG A;  2VRS A;  1X79 B;  2JEE A;  1LTJ C;  4LC1 A;  1T2K D;  3V4Q A;  2FXM A;  1FBM A;  1T2K C;  1J2J B;  1GW3 A;  5CMZ A;  2NPS B;  1NU1 K;  1WT6 A;  1XTG B;  4WY4 D;  1S9K D;  4WY4 C;  3NTN A;  1A02 J;  2XU6 A;  2IPP A;  5CJ4 A;  1RF1 B;  1T8Z A;  1FOS E;  1FZF A;  2C9L Y;  1N7S A;  1M1J B;  1GD2 E;  3B5N A;  3M9Q A;  1RE4 A;  4AYC A;  1SFC D;  1CI6 B;  5APT A;  1JTH B;  1JCD A;  1RE3 C;  2GUS A;  2YKQ A;  3L35 A;  4W7Z A;  4LLH A;  2H43 A;  1L0L K;  5APX A;  3P32 A;  3O8Z A;  1SVF A;  3BRV B;  1N2D C;  2OYH A;  1IFD A;  3HUS C;  3HUS B;  3U1A A;  3A2A A;  3T97 A;  3V2R A;  4JYC A;  3N4X A;  2FFD A;  5AW8 B;  2WTY A;  5KJ7 C;  2WPQ A;  2Z5H A;  4Y99 C;  1FZG A;  1N73 A;  3L4F A;  2KP8 A;  1ZR2 A;  2N1T B;  4I1L A;  2CPS A;  1FU1 A;  3GHG B;  5AW5 B;  3LID A;  2IFN A;  3NMD A;  5AVT B;  3IFM A;  2O1K A;  3HE4 B;  1IK9 A;  1GL2 A;  3HD7 C;  3H32 A;  3HD7 B;  1FOS F;  1HTL C;  3V2N A;  1JY2 N;  4N78 D;  1GU4 A;  1FAV A;  4IFF A;  1JY2 O;  1HWT C;  1DEB A;  1MZ9 A;  2A45 G;  1RY3 A;  1KIL B;  1NKN A;  1AQ5 A;  5CCG A;  4KHX A;  2WZ7 A;  1JUN A;  4IFD K;  1L4A D;  5KTB A;  5AVV B;  3LW5 H;  3RK2 C;  1E5W A;  3RK2 B;  2OYI C;  2E43 A;  1L4A C;  2WIT A;  2P1J A;  3RK3 C;  3RK3 B;  2PP6 A;  3TNU A;  1IJD B;  5AW6 B;  3HE5 B;  2A45 I;  3VMY A;  3KDP B;  1KFN A;  4XE5 B;  1HH0 A;  2O01 H;  2H8P D;  2LKM A;  5AVQ B;  1URQ D;  1NAF A;  2C0X A;  2WT7 A;  2MJZ A;  2P67 A;  1FZC C;  1ZV8 A;  4OH8 B;  1IO4 A;  2P7J A;  4XA4 A;  1LTJ A;  1NO4 A;  3HTK A;  3VMX A;  2WSF H;  1J1E B;  2I1K A;  2WSE H;  1YTZ I;  1LT9 A;  1NTM K;  4WY4 A;  5AW3 B;  3BVH A;  2NPS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...