3JSVC

Crystal structure of mouse nemo cozi in complex with lys63-linked di-ubiquitin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
b'QLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin
publication title Crystal structure of the NEMO ubiquitin-binding domain in complex with Lys 63-linked di-ubiquitin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transcription
total genus 26
structure length 83
sequence length 83
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 3jsvC00
3FX0A 3F89A 2V4HA 4BWNA 2ZVOB 3JSVC 4OWFA 2ZVNB
chains in the Genus database with same CATH superfamily
1SQPE 5AW6B 4GODA 2HODB 2ITAA 3S1KA 2I8DA 2JP3A 2WSFH 5AW7B 1YJWP 3PHLA 1IJDB 2NPSA 2ZVNB 3B71A 2K9JA 2OTJP 5KLVE 4RO0A 1PGJA 2N9YB 1SQXK 4Y28J 4R4MA 5APUA 5CCHD 3L71D 1RE4A 3LIDA 2R5BA 5KLIB 1NTKJ 1HF9A 3ABVC 3NXSA 1LJ2A 3RBZA 2H8PD 2VRSA 3VMXA 1KFNA 3H1KE 5APTA 1BSHA 1SFCC 1VF5D 3P8CD 1NU1G 1NHLA 2Q1KA 2HFED 2P10A 5BVZA 2NPSB 4H0LD 2AEJA 4XE5B 2K9JB 1N8RQ 2P58A 1PPJE 4U3FD 2KUBA 1U7MA 2Y9YA 4U3FE 4I6MC 3H1IG 2E76B 1DH3A 4U7JA 2D2CD 3W67A 1LWUA 1GD2E 5KLVJ 1EQ7A 3CCMP 1VQKP 2XZRA 1VQ8P 1LGHB 2KS1A 1LNQA 1HVVA 1NKNA 4ASWA 2YMKA 3A0BH 2LR2A 1VL2A 4H13B 1SQVK 2HPCB 1MZ9A 2YO3A 2P2UA 1YHQP 5AVSB 2K3RA 1YI2P 2P7JA 1WRGA 5H2FE 5CJ0A 3M91A 1JMBA 1LWUB 1K8AQ 2IFMA 1KMIZ 3EFFK 2C9LY 1M7LA 4XA4A 3A3YB 1L0NG 1HJ0A 2KS1B 4U3FJ 5AW9B 1S9KE 2XNXA 3BCCG 2C0WA 4DZOA 3RK3B 3E1IA 4L75A 3CCQP 5AVYB 5KKZC 1RE3C 1EZVE 3L75E 1OXZA 2YIUC 4MN4C 3T97B 2ZJSE 1VQ4P 1PFIA 1NTMG 4KHXA 2ZFCA 3BASA 1VDFA 5B5EH 1IFNA 1NAFA 3GW6A 2WPRA 2NRGA 3K5BA 1NTZG 4GIFA 4EOTA 1MV8A 1GU4A 1IFJA 4N3YB 1IZNB 1R5SA 5AVUB 3KYQA 2RMZA 4DOJA 2WWWA 3TGUD 2W90A 2RH0A 1SQQG 3TGUE 5APYA 3GHGC 4PV1B 3RK2D 1NAYA 1EC5A 1LT9C 1SS1A 2A45I 4YPCA 1SFCB 5KTBA 1SQXD 3H1HE 2Q3EA 1NKZB 2K1AA 3H1JG 4K3AA 1YIJP 2Q9IA 2KNCA 3Q5SA 3HD7A 3SWFA 1VQ7P 3RGUA 2E74D 1K05A 2B9BA 1VQOP 4PD4I 4Y99C 3E1RA 4UB6H 2WPQA 2ZYAA 4DT0A 3AECC 1DEEG 1R5LA 2BEZF 1PP9G 1CW5A 2FXOA 2L91A 3O6QB 2LXCB 3CX5D 2ZVOB 1P84E 4K35A 4C46A 2KIKA 1UIXA 2BEQD 3CWBG 3ZDMA 1HWTC 3Q5PA 2E75C 2N1TD 5AW1B 1T2KC 2WSCH 4PJ0H 1RH5B 3FWLA 5B66E 3TGUJ 3HD7B 3CMEP 3CX5H 1L4AC 5AW0B 3KXDA 3L70G 3H1HJ 3L4FA 4KJMA 3A7OA 1T8ZA 3L72G 3BVHA 2ZYGA 3VN0A 5BU8B 1Q7YQ 3NTNA 5B66H 2QG4A 3A0HE 1QVFO 1SQVD 4AYCA 1QEXA 3WU2E 1M8OB 3AEDC 1SQBK 1W5CE 4JQ0D 2WITA 3MIWA 2OQQA 4ZNCA 3OW2O 1IO4A 3TDKA 3USSA 2QRXA 2YMYA 2Y0EA 1L0NE 3D6YA 2PRRA 2ZAEB 5KJ7A 3BCCE 3RL0C 4OGQD 4B86A 1SQPK 1T3JA 1ZR4A 1X79B 1KC8Q 3C9IA 1PIXA 3TSIA 3FGAD 1NTME 1VQMP 1IK9A 4XFJA 2JR8A 5APWA 2V7QJ 3G71P 3SWKA 1ZN5A 3SFDC 1SQVJ 1KB9I 4NPEA 1S5LE 3L73G 1IFIA 4I2LC 1KYOE 2K9YA 2YKPA 3IN6A 1S5LX 4WY4D 1RQVA 1YJ9P 1J2JB 2MJZA 2Q7CA 1GW3A 4EYYQ 1NO4A 2QSIA 3B5NA 2QM7A 1OW6A 1FE6A 5KLIC 2OARA 3O8ZA 4TT3H 1VPCA 2UWJE 4R4LA 2IFNA 4H44B 2Q6QA 2IYPA 4WY4A 1PP9E 1PGPA 1BCCD 3PJSK 1ZR2A 4UB8E 3SSUA 2NPSC 2H7HA 1ZXGA 4GKGA 1GL2D 3WUVA 2IBZG 2B88A 3CWBE 4Z1MH 2PGDA 1RE4C 2E76C 2KOGA 2FY8A 4D6TE 3B5NB 1N2DC 3AEAC 2HYNA 1GDTA 2FYUG 1RY3A 1Q82Q 1KILB 4N78E 3L70E 4DCKA 1AV1A 1AQTA 3AE3C 2YKOA 3L72E 2IZ1A 4OWFA 5M1BA 1LTSC 1OVRA 2AXTH 4RESB 1BSNA 1KYOI 3CD6P 4IFDK 3M9QA 5C39A 1USDA 1KORA 3VOPA 1AJYA 1SQBD 4H13C 3FWNA 2QVAA 1PP9J 1VQ6P 4WVZA 1H88A 2KP8A 3I5CA 4H0LC 1H0TA 1L2PA 3KZIE 1DD3A 1LWUC 1FZBA 5CCGD 1W2EA 1FDMA 1RF0A 1JO5A 1SQPD 2WMMA 2C0XA 1SLQA 4IL6E 3R2PA 1FZCA 2D2CC 2JWDA 3RK3C 4D6TJ 5L8RJ 3OJAB 1URQB 5APXA 1FS0E 2KI7B 3CCUP 3U1AA 1GW4A 3L70J 5KLVD 4IL6X 1LTJA 2IZ0A 1H0TB 4WB4A 2GUVA 1FZGA 3VP8A 3WUUA 1KQSO 2ZT9D 2YXRB 4I7ZC 2KK7A 2FFDA 4IFMA 1Q81Q 3S9OA 1SQBJ 3L73E 1SQXG 2W6AA 3GMAA 4PV1C 3H1KD 5CCHA 1IC2A 5KAFE 2LKMA 3M9BA 2GM4A 3H1LG 1BGYG 3G6EP 1PPJD 1S72P 1LTJB 3JCUE 1YQ4C 2JEEA 1SQPJ 3RL0g 4OH8B 4IOIH 5E79E 2FYNB 1NH4A 3L74G 2KZJA 3GF7A 3CCSP 2FFDB 1FOSE 2RN0A 3H32A 1ZP0C 1VQPP 2R5DA 3IF4A 1IFPA 1BDDA 2O3JA 3HUSA 1JCDA 3RK3E 5APQA 1T6AA 2P67A 1KFMA 2KSEA 1KN7A 3HD7C 3H1KJ 1LP1A 2FYUE 2A45H 2E5TA 2M0BA 2ZXEB 4H0LB 4C7RA 3U59A 4PD4E 3RBXA 1FZEA 2R32A 2YXQB 3EWKA 4RKUJ 1S9KD 2E43A 4JYBA 3HUSB 1L0NK 1E5WA 4BRYA 1XTGB 2D2CB 3V4QA 5H2FH 2W8ZA 2B89A 4WBAA 1Y8AA 1EZVD 3SWYA 2FYZA 1X22A 3L75D 1S4XA 3S4RA 1M1JA 1OVUA 1BE3G 3M0AA 1LP1B 1JM0A 2FXMA 1NTMK 2BCCG 1AVYA 1EDKA 2M8RA 2ZYDA 5AVZB 1M90Q 4I7ZB 3HE4A 1DX7A 1NTZK 3FX0A 1ZRTE 1RQUA 1SVFA 2BASA 1SQQK 1QLED 2IBZI 4DJGA 3H1HD 2HLOA 1PGOA 2WSSH 1M1JB 1KV4A 2OYIA 1YITP 3QH9A 1K9MQ 1ZW0A 2CPBA 1MFTA 3G3ZA 1YQ3C 1FDOA 2JDIH 4ZKUA 5KJ7C 1YJNP 3HE4B 1S3JA 5GTHE 1OMIA 2KXPB 1M57D 3L75J 3N7NA 2HR3A 4YXDC 1NU1E 3PLNA 2QEXP 2QA4P 2JKVA 3H1LE 1BGYE 1P84D 1JY2P 2QJKB 2R3CA 1PGQA 5GTHH 2J5UA 3WMM0 2N9BA 2OYIB 2RKLA 3F5HA 1EXJA 3CCEP 2KNCB 3H1IE 1KZUB 4HYTB 1EDIA 3L74E 3RK2B 2AXCA 3BRVB 1LTTC 4H44C 4HH2A 2AEFA 1KB9D 1KB9E 3I55P 1P84H 3A5TA 1QL2A 3GG2A 1RE3A 2N1TA 2M5AA 5AVWB 2YO2A 2A06G 2E74B 5AW4B 3WUTA 3MTUE 1WMKA 1AVOA 3VTPC 3KPEA 2G3AA 3B5NC 1NJIQ 2E42A 1KD1Q 2I1KA 1KILC 1NU1J 3JC22 2IYOA 2PAJA 4GOFA 5AW5B 1BGYJ 2V7QH 3A0HH 1NTKG 3KHUA 1L0ND 3WU2H 2N1TB 3BCCD 5APSA 3H1IJ 2M5AB 3L74J 3M0DA 1J1DB 3AE5C 3Q3DA 2QJYB 4BWNA 4CPGA 1JCCA 1L0LG 4A7PA 1HGVA 1N7SD 1Z56A 1LTAC 1NTMD 3V2PA 1FBMA 1PV3A 3JSVC 2GUSA 4KT0J 2E75D 1OIPA 2BCCE 1T2KD 1HH0A 1OW8A 1NTZE 1GTWA 4LGDE 1N7SA 3HE5A 2KSJA 1L4AD 3CXHE 4RJTA 2PP6A 5KLVG 1JY2O 1KYOD 1USEA 1URQC 1LTBC 1SQQE 3E7KA 2OTLP 2QIWA 1AA0A 3AE1C 1Q90D 3L71G 2G8YA 4HB1A 3H1JD 3AE4C 3H1JE 2O01J 1L4AA 1L0NJ 1S5LH 5KAIE 4OGQB 1IFDA 2JO1A 3BCCJ 1KYOH 2XDJA 3FXDA 1A02J 1RF0C 2H88C 1KILE 1FZCC 2JWAA 4I1LA 3HE5B 1PP9D 3V6IA 3TYYA 2O01N 1NTMJ 3AE2C 4U3FG 1MKMA 1JMMA 1H89A 1MFZA 4EI2A 3RL0D 2POHA 3G4SP 1NTZJ 1LTJC 2Q5UA 3HRNA 2QJPB 3CWBD 3M06A 2FYNC 1JTHA 2IX7C 4D6TD 4M3LA 1SQQJ 3CC7P 4UB8H 2FFDC 3PTZA 1S1CX 4EDFA 5CHXA 4N78D 2QM8A 1GL2A 3L70D 2FYUK 1W2BO 5TJHA 4WY4B 5TISE 3H1JJ 3L72D 5CCHC 1T3UA 3CXHI 1R8EA 2A06E 2Y0DA 1HGZA 4L76A 2R44A 3VMAA 2B87A 3AE6C 5K5GB 2OYHA 3CI9A 3TK1A 1JY3N 1JTHB 1VF5C 2XV5A 1BDCA 3N4XA 4GOEA 2LXBA 1GL2B 5APVA 1NTKE 2IPPA 2IDBA 4C7NA 1XTCC 3CWBJ 3HUSC 2K37A 1N86A 2H43A 1L0LE 4W80A 3KZIH 2NPSD 3ITKA 5CCGA 1M56D 1YBKA 1FDIA 2OGUA 3L72J 2O1JA 4IL6H 1GZLA 1HJBA 1NWQA 1MUUA 3TGUG 2E76D 3AEGC 4IFFA 2AEMA 4L74A 2KLUA 3BRTB 3PRJA 4C7NB 3IFMA 1G2CA 3L73D 1NOHA 4GT1A 3H1HG 1JNMA 1FZCB 1CZQA 3NFQA 3C1LA 4ZMDA 3L71E 4JBZA 4YXWH 3TNUA 3P32A 2OYOA 2Z5HA 1FAVA 4TLFA 1NU1K 3SFEC 1M1JC 1JY3P 2KYVA 4H13D 1N73A 3LIEA 2H89C 4N6JA 2WSFJ 3P8CE 1M1KQ 1L0LJ 3CCJP 5KAFH 1G2CB 3VMYA 3B8EB 3A2AA 3CPWO 1FU1A 3CL3D 2SPZA 1RF1A 3JCUH 5AVRB 2HPCA 1QX8A 2ZT9B 3MUDA 5E79H 1LTGC 3TNUB 2QJKC 1GU5A 3RK3D 3D70A 2IBZD 3A0BE 3V2RA 1SP4A 2IBZE 3V4WA 2OYIC 1YYCA 2HG5D 5GTIE 3II6A 2WVRA 3L73J 1N73B 1KQGB 1NYHA 3AE7C 3D71A 1CSBA 3RK2C 2KZIA 1EDLA 1ZOYC 3KDPB 4OVNF 1LTIC 1LT1A 1VF5B 2FYUD 4AUWA 3W68A 3L71J 4BXLA 4PD4D 5DJUB 2PFXA 3PH0A 1SQVG 2FBWC 5GTIH 3H32B 1KQLA 2WSEH 3AE9C 1K04A 1RF1B 3F89A 4LC1A 3CCRP 3VYIA 1FOSF 3T97A 2E74C 1J1EB 2Z5IA 3AE8C 4PV1D 1DIPA 2L5GB 1SFCD 3VP9A 4PD4H 2V4HA 1JY2N 3FXEA 4HJGH 2Y0CA 3G9RA 1QL1A 5BU5A 3MHVA 4YTPC 3BATA 5B5EE 3CC4P 1SFCA 1G1JA 1WT6A 2MKVA 1OFCX 2QE7H 2N1TC 2WSEJ 5AW2B 2W27A 1J1DC 1JY3O 2FXPA 2QJYC 1ZRTD 1H8AA 3L35A 4BRYB 2FYUJ 2R3SA 3TF5A 2CPSA 3AEEC 1FZFA 1FJPA 2I1JA 3PP5A 1JOCA 3GLMA 3O6QA 2K88A 1HUCA 3HD7D 3Q5RA 4UB6E 1SQXE 2OTKE 1GK4A 5DJTB 1AQ5A 3M0DC 1JUNA 2DW3A 4W7ZA 5AVXB 2NZ2A 3GF3A 1NU1D 3CCLP 1PL5A 3H1LD 1BGYD 1N7LA 2M3BA 2XU6A 4W7YA 3MGNA 2Y9ZA 1VQ9P 2XNDH 4OGQC 1FC2C 4PJ0E 3H1ID 2YNYA 1CI6A 1Q86Q 4JPZB 1BCCG 2ZXXA 3L74D 3OA7A 3CX5E 3AEBC 2YKQA 1QVGO 5AW3B 1N7SC 3H25A 1GMJA 1X9VA 3EQ2A 1EZVI 2WPVB 3MD0A 1VQ5P 3EFGA 4D6TG 1ZLLA 3I56P 4NPDA 3CLQA 5AVVB 2QJPC 1E79H 2WQYC 1Q2NA 5CBOA 1NVOA 1SQXJ 1KB9H 1OWAA 1UIIA 2W6BA 3L37A 1CI6B 2J59M 4NPFX 5AW8B 5AVTB 3AEFC 4GDOA 4WY4C 1GK6A 3H1LJ 4HKZH 1SQVE 3GHGA 1LT9A 3R4YA 4JYCA 1SQBG 1OX3A 5KJ7D 1NTKK 1KQFB 5KKZB 2WSCJ 3H6PA 2C9NY 1IK7A 1YTZI 2YIUB 3VMZA 3CC2P 2WT7A 2CK3H 1FZAA 4EIJA 1L0LK 1OVVA 4WWIA 3V2NA 2P1JA 1BE3D 2XKMA 2O01H 1BE3E 1SQPG 1Y9BA 1GL2C 2BCCD 3CX5I 1NTZD 3GHGB 1FJKA 1LT9B 1P84I 4H44D 1S2EA 3MZWB 3CCVP 3CXHD 3P7KA 1U57A 1SQQD 4QMAA 5KLVK 5CJ4A 1X8YA 2E5YA 2OYHC 2WT7B 1ZMEC 4O9BA 3L36A 5CMZA 1A02F 4Y99B 3CXHH 3B5ND 3H1KG 3D6ZA 1AFOA 2M3EA 1YTZT 2O1KA 1KILD 4L73A 1OW7A 1TU3F 1N7SB 3QWOC 1JEKA 1RHZB 1Y47A 3IR9A 1PPJG 4LLHA 3KQGA 1BE3J 1K73Q 1KTMA 5KAIH 2J58A 3LW5H 2E75B 5CCGC 2BCCJ 2WTYA 4ASVA 1KILA 1PZQA 1L4AB 1OZHA 1DEBA 2Z4EA 1X0TA 3OAKA 1BCCE 2WPSA 1EXIA 1HTLC 2KLVA 3HTKA 3B4SA 2A45G 2GA1A 3Q2YA 4AQRD 1DD4A 1QGKB 1ZV8A 3V5BA 1NGMB 2AXTE 1G1IA 2ZT9C 2FKWB 4ZKPA 3LW5J 2A06D 1JB0J 2W83C 1URQD 3V2QA 3U1CA 5AVQB 3UIAA 1N73C 3MP7B 2JJLA 3Q1MA 2Q3IA 5TISH 3M9HA 3HTKB 1VQLP 2HODA 3RL0B 1URQA 4JF7A 1NTKD 1RF1C 1SQBE 1U7JA 1IFMA 1EZVG 3MUDC 1J1EC 3L75G 1BCCJ 1D7MA 2W6JH 3C8VA 3NMDA 3P8MC 1HBWA 1EDJA 2WZ7A 1L0LD 3CMAP 2KB7P 2B87B 2OYHB 1VQNP 3IAOA 5EFWB 5CBNA
chains in the Genus database with same CATH topology
3FX0A 3F89A 2V4HA 4BWNA 2ZVOB 3JSVC 4OWFA 2ZVNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FX0 A;  3F89 A;  2V4H A;  4BWN A;  2ZVO B;  3JSV C;  4OWF A;  2ZVN B; 
#chains in the Genus database with same CATH topology
 1SQP E;  5AW6 B;  4GOD A;  2HOD B;  2ITA A;  3S1K A;  2I8D A;  2JP3 A;  2WSF H;  5AW7 B;  1YJW P;  3PHL A;  1IJD B;  2NPS A;  2ZVN B;  3B71 A;  2K9J A;  2OTJ P;  5KLV E;  4RO0 A;  1PGJ A;  2N9Y B;  1SQX K;  4Y28 J;  4R4M A;  5APU A;  5CCH D;  3L71 D;  1RE4 A;  3LID A;  2R5B A;  5KLI B;  1NTK J;  1HF9 A;  3ABV C;  3NXS A;  1LJ2 A;  3RBZ A;  2H8P D;  2VRS A;  3VMX A;  1KFN A;  3H1K E;  5APT A;  1BSH A;  1SFC C;  1VF5 D;  3P8C D;  1NU1 G;  1NHL A;  2Q1K A;  2HFE D;  2P10 A;  5BVZ A;  2NPS B;  4H0L D;  2AEJ A;  4XE5 B;  2K9J B;  1N8R Q;  2P58 A;  1PPJ E;  4U3F D;  2KUB A;  1U7M A;  2Y9Y A;  4U3F E;  4I6M C;  3H1I G;  2E76 B;  1DH3 A;  4U7J A;  2D2C D;  3W67 A;  1LWU A;  1GD2 E;  5KLV J;  1EQ7 A;  3CCM P;  1VQK P;  2XZR A;  1VQ8 P;  1LGH B;  2KS1 A;  1LNQ A;  1HVV A;  1NKN A;  4ASW A;  2YMK A;  3A0B H;  2LR2 A;  1VL2 A;  4H13 B;  1SQV K;  2HPC B;  1MZ9 A;  2YO3 A;  2P2U A;  1YHQ P;  5AVS B;  2K3R A;  1YI2 P;  2P7J A;  1WRG A;  5H2F E;  5CJ0 A;  3M91 A;  1JMB A;  1LWU B;  1K8A Q;  2IFM A;  1KMI Z;  3EFF K;  2C9L Y;  1M7L A;  4XA4 A;  3A3Y B;  1L0N G;  1HJ0 A;  2KS1 B;  4U3F J;  5AW9 B;  1S9K E;  2XNX A;  3BCC G;  2C0W A;  4DZO A;  3RK3 B;  3E1I A;  4L75 A;  3CCQ P;  5AVY B;  5KKZ C;  1RE3 C;  1EZV E;  3L75 E;  1OXZ A;  2YIU C;  4MN4 C;  3T97 B;  2ZJS E;  1VQ4 P;  1PFI A;  1NTM G;  4KHX A;  2ZFC A;  3BAS A;  1VDF A;  5B5E H;  1IFN A;  1NAF A;  3GW6 A;  2WPR A;  2NRG A;  3K5B A;  1NTZ G;  4GIF A;  4EOT A;  1MV8 A;  1GU4 A;  1IFJ A;  4N3Y B;  1IZN B;  1R5S A;  5AVU B;  3KYQ A;  2RMZ A;  4DOJ A;  2WWW A;  3TGU D;  2W90 A;  2RH0 A;  1SQQ G;  3TGU E;  5APY A;  3GHG C;  4PV1 B;  3RK2 D;  1NAY A;  1EC5 A;  1LT9 C;  1SS1 A;  2A45 I;  4YPC A;  1SFC B;  5KTB A;  1SQX D;  3H1H E;  2Q3E A;  1NKZ B;  2K1A A;  3H1J G;  4K3A A;  1YIJ P;  2Q9I A;  2KNC A;  3Q5S A;  3HD7 A;  3SWF A;  1VQ7 P;  3RGU A;  2E74 D;  1K05 A;  2B9B A;  1VQO P;  4PD4 I;  4Y99 C;  3E1R A;  4UB6 H;  2WPQ A;  2ZYA A;  4DT0 A;  3AEC C;  1DEE G;  1R5L A;  2BEZ F;  1PP9 G;  1CW5 A;  2FXO A;  2L91 A;  3O6Q B;  2LXC B;  3CX5 D;  2ZVO B;  1P84 E;  4K35 A;  4C46 A;  2KIK A;  1UIX A;  2BEQ D;  3CWB G;  3ZDM A;  1HWT C;  3Q5P A;  2E75 C;  2N1T D;  5AW1 B;  1T2K C;  2WSC H;  4PJ0 H;  1RH5 B;  3FWL A;  5B66 E;  3TGU J;  3HD7 B;  3CME P;  3CX5 H;  1L4A C;  5AW0 B;  3KXD A;  3L70 G;  3H1H J;  3L4F A;  4KJM A;  3A7O A;  1T8Z A;  3L72 G;  3BVH A;  2ZYG A;  3VN0 A;  5BU8 B;  1Q7Y Q;  3NTN A;  5B66 H;  2QG4 A;  3A0H E;  1QVF O;  1SQV D;  4AYC A;  1QEX A;  3WU2 E;  1M8O B;  3AED C;  1SQB K;  1W5C E;  4JQ0 D;  2WIT A;  3MIW A;  2OQQ A;  4ZNC A;  3OW2 O;  1IO4 A;  3TDK A;  3USS A;  2QRX A;  2YMY A;  2Y0E A;  1L0N E;  3D6Y A;  2PRR A;  2ZAE B;  5KJ7 A;  3BCC E;  3RL0 C;  4OGQ D;  4B86 A;  1SQP K;  1T3J A;  1ZR4 A;  1X79 B;  1KC8 Q;  3C9I A;  1PIX A;  3TSI A;  3FGA D;  1NTM E;  1VQM P;  1IK9 A;  4XFJ A;  2JR8 A;  5APW A;  2V7Q J;  3G71 P;  3SWK A;  1ZN5 A;  3SFD C;  1SQV J;  1KB9 I;  4NPE A;  1S5L E;  3L73 G;  1IFI A;  4I2L C;  1KYO E;  2K9Y A;  2YKP A;  3IN6 A;  1S5L X;  4WY4 D;  1RQV A;  1YJ9 P;  1J2J B;  2MJZ A;  2Q7C A;  1GW3 A;  4EYY Q;  1NO4 A;  2QSI A;  3B5N A;  2QM7 A;  1OW6 A;  1FE6 A;  5KLI C;  2OAR A;  3O8Z A;  4TT3 H;  1VPC A;  2UWJ E;  4R4L A;  2IFN A;  4H44 B;  2Q6Q A;  2IYP A;  4WY4 A;  1PP9 E;  1PGP A;  1BCC D;  3PJS K;  1ZR2 A;  4UB8 E;  3SSU A;  2NPS C;  2H7H A;  1ZXG A;  4GKG A;  1GL2 D;  3WUV A;  2IBZ G;  2B88 A;  3CWB E;  4Z1M H;  2PGD A;  1RE4 C;  2E76 C;  2KOG A;  2FY8 A;  4D6T E;  3B5N B;  1N2D C;  3AEA C;  2HYN A;  1GDT A;  2FYU G;  1RY3 A;  1Q82 Q;  1KIL B;  4N78 E;  3L70 E;  4DCK A;  1AV1 A;  1AQT A;  3AE3 C;  2YKO A;  3L72 E;  2IZ1 A;  4OWF A;  5M1B A;  1LTS C;  1OVR A;  2AXT H;  4RES B;  1BSN A;  1KYO I;  3CD6 P;  4IFD K;  3M9Q A;  5C39 A;  1USD A;  1KOR A;  3VOP A;  1AJY A;  1SQB D;  4H13 C;  3FWN A;  2QVA A;  1PP9 J;  1VQ6 P;  4WVZ A;  1H88 A;  2KP8 A;  3I5C A;  4H0L C;  1H0T A;  1L2P A;  3KZI E;  1DD3 A;  1LWU C;  1FZB A;  5CCG D;  1W2E A;  1FDM A;  1RF0 A;  1JO5 A;  1SQP D;  2WMM A;  2C0X A;  1SLQ A;  4IL6 E;  3R2P A;  1FZC A;  2D2C C;  2JWD A;  3RK3 C;  4D6T J;  5L8R J;  3OJA B;  1URQ B;  5APX A;  1FS0 E;  2KI7 B;  3CCU P;  3U1A A;  1GW4 A;  3L70 J;  5KLV D;  4IL6 X;  1LTJ A;  2IZ0 A;  1H0T B;  4WB4 A;  2GUV A;  1FZG A;  3VP8 A;  3WUU A;  1KQS O;  2ZT9 D;  2YXR B;  4I7Z C;  2KK7 A;  2FFD A;  4IFM A;  1Q81 Q;  3S9O A;  1SQB J;  3L73 E;  1SQX G;  2W6A A;  3GMA A;  4PV1 C;  3H1K D;  5CCH A;  1IC2 A;  5KAF E;  2LKM A;  3M9B A;  2GM4 A;  3H1L G;  1BGY G;  3G6E P;  1PPJ D;  1S72 P;  1LTJ B;  3JCU E;  1YQ4 C;  2JEE A;  1SQP J;  3RL0 g;  4OH8 B;  4IOI H;  5E79 E;  2FYN B;  1NH4 A;  3L74 G;  2KZJ A;  3GF7 A;  3CCS P;  2FFD B;  1FOS E;  2RN0 A;  3H32 A;  1ZP0 C;  1VQP P;  2R5D A;  3IF4 A;  1IFP A;  1BDD A;  2O3J A;  3HUS A;  1JCD A;  3RK3 E;  5APQ A;  1T6A A;  2P67 A;  1KFM A;  2KSE A;  1KN7 A;  3HD7 C;  3H1K J;  1LP1 A;  2FYU E;  2A45 H;  2E5T A;  2M0B A;  2ZXE B;  4H0L B;  4C7R A;  3U59 A;  4PD4 E;  3RBX A;  1FZE A;  2R32 A;  2YXQ B;  3EWK A;  4RKU J;  1S9K D;  2E43 A;  4JYB A;  3HUS B;  1L0N K;  1E5W A;  4BRY A;  1XTG B;  2D2C B;  3V4Q A;  5H2F H;  2W8Z A;  2B89 A;  4WBA A;  1Y8A A;  1EZV D;  3SWY A;  2FYZ A;  1X22 A;  3L75 D;  1S4X A;  3S4R A;  1M1J A;  1OVU A;  1BE3 G;  3M0A A;  1LP1 B;  1JM0 A;  2FXM A;  1NTM K;  2BCC G;  1AVY A;  1EDK A;  2M8R A;  2ZYD A;  5AVZ B;  1M90 Q;  4I7Z B;  3HE4 A;  1DX7 A;  1NTZ K;  3FX0 A;  1ZRT E;  1RQU A;  1SVF A;  2BAS A;  1SQQ K;  1QLE D;  2IBZ I;  4DJG A;  3H1H D;  2HLO A;  1PGO A;  2WSS H;  1M1J B;  1KV4 A;  2OYI A;  1YIT P;  3QH9 A;  1K9M Q;  1ZW0 A;  2CPB A;  1MFT A;  3G3Z A;  1YQ3 C;  1FDO A;  2JDI H;  4ZKU A;  5KJ7 C;  1YJN P;  3HE4 B;  1S3J A;  5GTH E;  1OMI A;  2KXP B;  1M57 D;  3L75 J;  3N7N A;  2HR3 A;  4YXD C;  1NU1 E;  3PLN A;  2QEX P;  2QA4 P;  2JKV A;  3H1L E;  1BGY E;  1P84 D;  1JY2 P;  2QJK B;  2R3C A;  1PGQ A;  5GTH H;  2J5U A;  3WMM 0;  2N9B A;  2OYI B;  2RKL A;  3F5H A;  1EXJ A;  3CCE P;  2KNC B;  3H1I E;  1KZU B;  4HYT B;  1EDI A;  3L74 E;  3RK2 B;  2AXC A;  3BRV B;  1LTT C;  4H44 C;  4HH2 A;  2AEF A;  1KB9 D;  1KB9 E;  3I55 P;  1P84 H;  3A5T A;  1QL2 A;  3GG2 A;  1RE3 A;  2N1T A;  2M5A A;  5AVW B;  2YO2 A;  2A06 G;  2E74 B;  5AW4 B;  3WUT A;  3MTU E;  1WMK A;  1AVO A;  3VTP C;  3KPE A;  2G3A A;  3B5N C;  1NJI Q;  2E42 A;  1KD1 Q;  2I1K A;  1KIL C;  1NU1 J;  3JC2 2;  2IYO A;  2PAJ A;  4GOF A;  5AW5 B;  1BGY J;  2V7Q H;  3A0H H;  1NTK G;  3KHU A;  1L0N D;  3WU2 H;  2N1T B;  3BCC D;  5APS A;  3H1I J;  2M5A B;  3L74 J;  3M0D A;  1J1D B;  3AE5 C;  3Q3D A;  2QJY B;  4BWN A;  4CPG A;  1JCC A;  1L0L G;  4A7P A;  1HGV A;  1N7S D;  1Z56 A;  1LTA C;  1NTM D;  3V2P A;  1FBM A;  1PV3 A;  3JSV C;  2GUS A;  4KT0 J;  2E75 D;  1OIP A;  2BCC E;  1T2K D;  1HH0 A;  1OW8 A;  1NTZ E;  1GTW A;  4LGD E;  1N7S A;  3HE5 A;  2KSJ A;  1L4A D;  3CXH E;  4RJT A;  2PP6 A;  5KLV G;  1JY2 O;  1KYO D;  1USE A;  1URQ C;  1LTB C;  1SQQ E;  3E7K A;  2OTL P;  2QIW A;  1AA0 A;  3AE1 C;  1Q90 D;  3L71 G;  2G8Y A;  4HB1 A;  3H1J D;  3AE4 C;  3H1J E;  2O01 J;  1L4A A;  1L0N J;  1S5L H;  5KAI E;  4OGQ B;  1IFD A;  2JO1 A;  3BCC J;  1KYO H;  2XDJ A;  3FXD A;  1A02 J;  1RF0 C;  2H88 C;  1KIL E;  1FZC C;  2JWA A;  4I1L A;  3HE5 B;  1PP9 D;  3V6I A;  3TYY A;  2O01 N;  1NTM J;  3AE2 C;  4U3F G;  1MKM A;  1JMM A;  1H89 A;  1MFZ A;  4EI2 A;  3RL0 D;  2POH A;  3G4S P;  1NTZ J;  1LTJ C;  2Q5U A;  3HRN A;  2QJP B;  3CWB D;  3M06 A;  2FYN C;  1JTH A;  2IX7 C;  4D6T D;  4M3L A;  1SQQ J;  3CC7 P;  4UB8 H;  2FFD C;  3PTZ A;  1S1C X;  4EDF A;  5CHX A;  4N78 D;  2QM8 A;  1GL2 A;  3L70 D;  2FYU K;  1W2B O;  5TJH A;  4WY4 B;  5TIS E;  3H1J J;  3L72 D;  5CCH C;  1T3U A;  3CXH I;  1R8E A;  2A06 E;  2Y0D A;  1HGZ A;  4L76 A;  2R44 A;  3VMA A;  2B87 A;  3AE6 C;  5K5G B;  2OYH A;  3CI9 A;  3TK1 A;  1JY3 N;  1JTH B;  1VF5 C;  2XV5 A;  1BDC A;  3N4X A;  4GOE A;  2LXB A;  1GL2 B;  5APV A;  1NTK E;  2IPP A;  2IDB A;  4C7N A;  1XTC C;  3CWB J;  3HUS C;  2K37 A;  1N86 A;  2H43 A;  1L0L E;  4W80 A;  3KZI H;  2NPS D;  3ITK A;  5CCG A;  1M56 D;  1YBK A;  1FDI A;  2OGU A;  3L72 J;  2O1J A;  4IL6 H;  1GZL A;  1HJB A;  1NWQ A;  1MUU A;  3TGU G;  2E76 D;  3AEG C;  4IFF A;  2AEM A;  4L74 A;  2KLU A;  3BRT B;  3PRJ A;  4C7N B;  3IFM A;  1G2C A;  3L73 D;  1NOH A;  4GT1 A;  3H1H G;  1JNM A;  1FZC B;  1CZQ A;  3NFQ A;  3C1L A;  4ZMD A;  3L71 E;  4JBZ A;  4YXW H;  3TNU A;  3P32 A;  2OYO A;  2Z5H A;  1FAV A;  4TLF A;  1NU1 K;  3SFE C;  1M1J C;  1JY3 P;  2KYV A;  4H13 D;  1N73 A;  3LIE A;  2H89 C;  4N6J A;  2WSF J;  3P8C E;  1M1K Q;  1L0L J;  3CCJ P;  5KAF H;  1G2C B;  3VMY A;  3B8E B;  3A2A A;  3CPW O;  1FU1 A;  3CL3 D;  2SPZ A;  1RF1 A;  3JCU H;  5AVR B;  2HPC A;  1QX8 A;  2ZT9 B;  3MUD A;  5E79 H;  1LTG C;  3TNU B;  2QJK C;  1GU5 A;  3RK3 D;  3D70 A;  2IBZ D;  3A0B E;  3V2R A;  1SP4 A;  2IBZ E;  3V4W A;  2OYI C;  1YYC A;  2HG5 D;  5GTI E;  3II6 A;  2WVR A;  3L73 J;  1N73 B;  1KQG B;  1NYH A;  3AE7 C;  3D71 A;  1CSB A;  3RK2 C;  2KZI A;  1EDL A;  1ZOY C;  3KDP B;  4OVN F;  1LTI C;  1LT1 A;  1VF5 B;  2FYU D;  4AUW A;  3W68 A;  3L71 J;  4BXL A;  4PD4 D;  5DJU B;  2PFX A;  3PH0 A;  1SQV G;  2FBW C;  5GTI H;  3H32 B;  1KQL A;  2WSE H;  3AE9 C;  1K04 A;  1RF1 B;  3F89 A;  4LC1 A;  3CCR P;  3VYI A;  1FOS F;  3T97 A;  2E74 C;  1J1E B;  2Z5I A;  3AE8 C;  4PV1 D;  1DIP A;  2L5G B;  1SFC D;  3VP9 A;  4PD4 H;  2V4H A;  1JY2 N;  3FXE A;  4HJG H;  2Y0C A;  3G9R A;  1QL1 A;  5BU5 A;  3MHV A;  4YTP C;  3BAT A;  5B5E E;  3CC4 P;  1SFC A;  1G1J A;  1WT6 A;  2MKV A;  1OFC X;  2QE7 H;  2N1T C;  2WSE J;  5AW2 B;  2W27 A;  1J1D C;  1JY3 O;  2FXP A;  2QJY C;  1ZRT D;  1H8A A;  3L35 A;  4BRY B;  2FYU J;  2R3S A;  3TF5 A;  2CPS A;  3AEE C;  1FZF A;  1FJP A;  2I1J A;  3PP5 A;  1JOC A;  3GLM A;  3O6Q A;  2K88 A;  1HUC A;  3HD7 D;  3Q5R A;  4UB6 E;  1SQX E;  2OTK E;  1GK4 A;  5DJT B;  1AQ5 A;  3M0D C;  1JUN A;  2DW3 A;  4W7Z A;  5AVX B;  2NZ2 A;  3GF3 A;  1NU1 D;  3CCL P;  1PL5 A;  3H1L D;  1BGY D;  1N7L A;  2M3B A;  2XU6 A;  4W7Y A;  3MGN A;  2Y9Z A;  1VQ9 P;  2XND H;  4OGQ C;  1FC2 C;  4PJ0 E;  3H1I D;  2YNY A;  1CI6 A;  1Q86 Q;  4JPZ B;  1BCC G;  2ZXX A;  3L74 D;  3OA7 A;  3CX5 E;  3AEB C;  2YKQ A;  1QVG O;  5AW3 B;  1N7S C;  3H25 A;  1GMJ A;  1X9V A;  3EQ2 A;  1EZV I;  2WPV B;  3MD0 A;  1VQ5 P;  3EFG A;  4D6T G;  1ZLL A;  3I56 P;  4NPD A;  3CLQ A;  5AVV B;  2QJP C;  1E79 H;  2WQY C;  1Q2N A;  5CBO A;  1NVO A;  1SQX J;  1KB9 H;  1OWA A;  1UII A;  2W6B A;  3L37 A;  1CI6 B;  2J59 M;  4NPF X;  5AW8 B;  5AVT B;  3AEF C;  4GDO A;  4WY4 C;  1GK6 A;  3H1L J;  4HKZ H;  1SQV E;  3GHG A;  1LT9 A;  3R4Y A;  4JYC A;  1SQB G;  1OX3 A;  5KJ7 D;  1NTK K;  1KQF B;  5KKZ B;  2WSC J;  3H6P A;  2C9N Y;  1IK7 A;  1YTZ I;  2YIU B;  3VMZ A;  3CC2 P;  2WT7 A;  2CK3 H;  1FZA A;  4EIJ A;  1L0L K;  1OVV A;  4WWI A;  3V2N A;  2P1J A;  1BE3 D;  2XKM A;  2O01 H;  1BE3 E;  1SQP G;  1Y9B A;  1GL2 C;  2BCC D;  3CX5 I;  1NTZ D;  3GHG B;  1FJK A;  1LT9 B;  1P84 I;  4H44 D;  1S2E A;  3MZW B;  3CCV P;  3CXH D;  3P7K A;  1U57 A;  1SQQ D;  4QMA A;  5KLV K;  5CJ4 A;  1X8Y A;  2E5Y A;  2OYH C;  2WT7 B;  1ZME C;  4O9B A;  3L36 A;  5CMZ A;  1A02 F;  4Y99 B;  3CXH H;  3B5N D;  3H1K G;  3D6Z A;  1AFO A;  2M3E A;  1YTZ T;  2O1K A;  1KIL D;  4L73 A;  1OW7 A;  1TU3 F;  1N7S B;  3QWO C;  1JEK A;  1RHZ B;  1Y47 A;  3IR9 A;  1PPJ G;  4LLH A;  3KQG A;  1BE3 J;  1K73 Q;  1KTM A;  5KAI H;  2J58 A;  3LW5 H;  2E75 B;  5CCG C;  2BCC J;  2WTY A;  4ASV A;  1KIL A;  1PZQ A;  1L4A B;  1OZH A;  1DEB A;  2Z4E A;  1X0T A;  3OAK A;  1BCC E;  2WPS A;  1EXI A;  1HTL C;  2KLV A;  3HTK A;  3B4S A;  2A45 G;  2GA1 A;  3Q2Y A;  4AQR D;  1DD4 A;  1QGK B;  1ZV8 A;  3V5B A;  1NGM B;  2AXT E;  1G1I A;  2ZT9 C;  2FKW B;  4ZKP A;  3LW5 J;  2A06 D;  1JB0 J;  2W83 C;  1URQ D;  3V2Q A;  3U1C A;  5AVQ B;  3UIA A;  1N73 C;  3MP7 B;  2JJL A;  3Q1M A;  2Q3I A;  5TIS H;  3M9H A;  3HTK B;  1VQL P;  2HOD A;  3RL0 B;  1URQ A;  4JF7 A;  1NTK D;  1RF1 C;  1SQB E;  1U7J A;  1IFM A;  1EZV G;  3MUD C;  1J1E C;  3L75 G;  1BCC J;  1D7M A;  2W6J H;  3C8V A;  3NMD A;  3P8M C;  1HBW A;  1EDJ A;  2WZ7 A;  1L0L D;  3CMA P;  2KB7 P;  2B87 B;  2OYH B;  1VQN P;  3IAO A;  5EFW B;  5CBN A; 
#chains in the Genus database with same CATH homology
 3FX0 A;  3F89 A;  2V4H A;  4BWN A;  2ZVO B;  3JSV C;  4OWF A;  2ZVN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...