3JSVC

Crystal structure of mouse nemo cozi in complex with lys63-linked di-ubiquitin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
QLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin
publication title Crystal structure of the NEMO ubiquitin-binding domain in complex with Lys 63-linked di-ubiquitin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transcription
total genus 26
structure length 83
sequence length 83
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 3jsvC00
2ZVOB 3JSVC 2ZVNB 4BWNA 3FX0A 3F89A 4OWFA 2V4HA
chains in the Genus database with same CATH superfamily
3G9RA 2AXCA 3KDPB 1OIPA 3WUUA 3USSA 2FXOA 5CBOA 4CPGA 2N1TA 5CCHC 1SQPK 2K9YA 4BXLA 1SQXG 2BASA 2FYUJ 2NRGA 1NTKJ 2D2CD 1LWUC 1LTAC 5DJTB 1GL2A 1IFMA 1RQVA 1FBMA 2IBZG 1RE4C 1H0TB 3EFGA 2ZXEB 3CCSP 2E5YA 3E7KA 1NGMB 1BCCD 3HE4A 3M91A 4MN4C 2OQQA 1WMKA 4PV1C 4HKZH 4WWIA 3MHVA 3LW5H 3AE3C 1QVGO 1A02J 3HD7D 1Z56A 3AE1C 2N1TC 1S9KD 1MKMA 2JO1A 3A0BE 4Y99B 1YQ3C 5K5GB 2OTKE 3A0BH 2RKLA 1GL2C 1EDKA 1JOCA 1HJ0A 2BEZF 2R3CA 1M7LA 3U59A 1URQA 3CPWO 1FE6A 4BWNA 3Q5RA 2P7JA 3TNUA 1AVYA 1BGYE 1FOSE 1L4AA 2KNCB 2WSEJ 2E76C 1G2CB 2K88A 2YMKA 1JEKA 4OVNF 3RGUA 2XNXA 3H1HG 2YNYA 3LIDA 1R5SA 3P32A 1N7SD 1BE3J 3B8EB 1W2EA 2I1JA 2O1JA 5KLVG 1EDLA 1NO4A 2OYIB 1M56D 1YTZT 1LNQA 2B87A 2IFMA 3FWLA 2WZ7A 3VMZA 1URQC 3U1AA 2OYOA 3HUSB 3OAKA 1USDA 2KLUA 5APVA 1L4AC 1KORA 2A45G 4H44C 4DJGA 2BCCE 5AW4B 2K3RA 1CSBA 2H88C 2OTJP 4PV1B 3L72E 1KILE 3HTKB 1J1DB 1L0NG 3NXSA 3AEBC 1UIXA 3L71J 2A06E 2FY8A 4NPFX 2QSIA 5AW0B 3L70E 1PGOA 2O01J 1OFCX 1JCDA 1M57D 1NU1E 2WQYC 1T2KD 1PPJG 3HD7A 3D6ZA 1LT9A 5KAIE 3RK2D 5KAIH 4I6MC 4YPCA 2HYNA 3EWKA 3L4FA 3D71A 5AW1B 1ZMEC 2C9LY 1ZOYC 1JCCA 2WSCH 1NH4A 4LLHA 1VQOP 1S2EA 3CCEP 3A0HE 2IPPA 1BCCG 1BGYD 1NYHA 3A0HH 3GHGA 1XTGB 2KUBA 2KK7A 2LXBA 3BRTB 3H1KE 1UIIA 2ZYGA 3LW5J 3HD7C 1LT9C 1FJKA 1L0LG 2R44A 1AFOA 1BSHA 3A7OA 2M5AA 2CK3H 1J1EB 3H1JD 5TISE 1VF5B 3K5BA 5TISH 4ZNCA 2K37A 1SQXE 1LJ2A 3CCJP 3GHGC 2HPCB 3AEEC 1S72P 1IJDB 1ZP0C 1KMIZ 2OYHB 2WPRA 2IBZE 3H1IG 1H88A 4JYBA 1FU1A 3L72D 1KILD 2KSJA 3CWBG 3HE5B 3IF4A 2HLOA 3R4YA 1NOHA 1S3JA 4GOEA 4UB6E 2MJZA 2PRRA 4UB6H 3L70D 4L74A 2FYUK 1NTKK 1HVVA 2FKWB 1NU1D 1K8AQ 5CJ4A 1Q86Q 5APXA 3L35A 4WBAA 1E79H 1NKNA 1S5LE 3P8CD 3UIAA 1KC8Q 1S5LH 1ZLLA 3MTUE 1VQ8P 3RBXA 1FZCA 4ZKPA 5APTA 2IYPA 2Y0EA 2JKVA 1W2BO 3MIWA 1RE3A 1IZNB 3H1HE 5B5EE 1SVFA 5B5EH 1T2KC 2H8PD 3I5CA 5AVZB 4R4MA 5KLVE 3RK2C 4M3LA 1MUUA 3G4SP 2W8ZA 1MZ9A 3E1RA 3BCCG 1DH3A 3FX0A 3CXHE 3GF3A 2E74D 1EXIA 1JM0A 1YHQP 3TF5A 1EDIA 1Y9BA 1LP1A 3CXHH 4GODA 4GOFA 3L74J 2A45H 1BDDA 1RE3C 1SQXD 2K9JA 1IFPA 5H2FE 4U3FD 2V4HA 1L0NE 5H2FH 2PP6A 5APYA 4U7JA 1PGQA 4PD4I 1KILA 1Q81Q 2QJKC 1IC2A 2M3BA 3GMAA 4D6TG 1JY2P 3H1KJ 1SQVD 1Q7YQ 2AXTE 5KLIB 1VQKP 3WUTA 2AXTH 4EYYQ 1JB0J 1YYCA 4EI2A 3H1JG 1PPJE 3I56P 2V7QH 5KKZC 4W7ZA 1LTSC 1SQBD 1HGZA 3BASA 1PFIA 3S4RA 2HFED 4RKUJ 2IDBA 4R4LA 1PV3A 3VMYA 1KILC 2JEEA 1RQUA 1LTTC 1BCCE 4XE5B 2I1KA 1G1IA 3GF7A 1A02F 1Y47A 2I8DA 2IBZI 2R3SA 2IZ1A 4AYCA 2P10A 3O6QB 1JUNA 1L0LE 2IX7C 5AVQB 1JY2N 2AEFA 3PTZA 1JTHA 5KLVD 3KPEA 2QA4P 3CCVP 1HGVA 3B5NB 1HF9A 2YO2A 2KS1B 3CXHD 3KYQA 1PP9G 1VPCA 3AECC 3H1IE 2GUVA 2PFXA 2OARA 2C0WA 2UWJE 4IFDK 2YMYA 1CI6A 2YIUB 3CWBE 1TU3F 2POHA 5KKZB 1NTZJ 3H1LD 3AE9C 1PZQA 4I7ZC 1SQQJ 2AEJA 1VF5D 3C8VA 2E74C 4RJTA 2Z4EA 2HR3A 1PPJD 3HRNA 3OJAB 1FDOA 4WY4D 3M06A 2QG4A 1N73B 3WUVA 2P2UA 4K3AA 4IFFA 2GM4A 1CW5A 4U3FG 4KT0J 2WPSA 2QJPB 2WSFH 3CX5E 1L0NJ 4XFJA 1VL2A 3T97A 3CX5H 4OGQB 1SQVG 4N3YB 1KN7A 3PLNA 4H13B 1X9VA 1SFCB 4O9BA 3W67A 4RESB 4N78D 2NPSB 1U7JA 1L0LD 2W6BA 3RL0g 1SQBG 4BRYA 3RK3E 3BCCE 4NPEA 2N9YB 4H0LC 4JBZA 1QVFO 2J59M 2B89A 1ZW0A 3L73J 3KHUA 1HBWA 5AW3B 2ZT9C 3CL3D 3H25A 2E75C 2WT7B 1RY3A 5E79E 1BCCJ 1M1JB 4DZOA 5E79H 4I7ZB 3H1ID 1CZQA 3ITKA 5APQA 4ZMDA 4D6TE 2QVAA 3CWBD 2MKVA 3D70A 1JY3P 3AEFC 3G71P 3H1JE 3NFQA 1P84D 1LWUB 2IYOA 1M1KQ 3VN0A 2JWDA 1EZVG 2HODB 3NMDA 2KB7P 1ZR4A 3BATA 3MD0A 4WY4A 1LTJA 3VMXA 1IFDA 2FFDA 3H32B 5AVTB 2M3EA 1OW7A 1RHZB 3VMAA 2Q7CA 3AEAC 1RH5B 2FXPA 3EQ2A 1NTMJ 2M0BA 2P67A 3CX5D 5CJ0A 2N1TB 2E43A 4IL6X 3H1LG 1KB9D 3GG2A 3N7NA 1GL2B 3L75J 5APUA 1J2JB 1YQ4C 1LTGC 3NTNA 1IFJA 3RL0D 1GMJA 1KYOD 1FZEA 1JY3N 4WY4C 1OVVA 2ZT9B 1LTJC 1AQTA 3C1LA 1D7MA 2FFDC 2ZFCA 3HE4B 4W7YA 2D2CC 3AEGC 1X8YA 2Q9IA 5AW7B 3P8CE 2YXRB 1IFIA 3BVHA 3RK3D 3BCCD 3V5BA 2E76B 3A3YB 1AVOA 1OXZA 1HH0A 3SWYA 4A7PA 5GTIE 1PP9E 2WSFJ 1X79B 3S9OA 5GTIH 2Z5HA 1RF1A 4IFMA 4LGDE 3A5TA 1Y8AA 2SPZA 3U1CA 2WTYA 1LTIC 2YKPA 1QL1A 2LKMA 1URQB 2KZIA 4D6TD 3VP9A 3TNUB 3Q5SA 3Q3DA 1N7SA 1HWTC 1E5WA 1L4AB 3Q2YA 4H44B 1SQPD 1YITP 4L73A 1DD4A 2QJYC 3TYYA 1BE3G 3I55P 3JSVC 3E1IA 2IZ0A 1K73Q 3SWKA 1RF1C 4U3FE 2E5TA 1BGYJ 2B87B 1AA0A 1NTZK 5M1BA 2C0XA 1VQNP 3M9HA 2YKOA 1SP4A 1SQQK 4DT0A 1N7SC 1SQVE 5KJ7D 5AVSB 2XZRA 3SWFA 5AW8B 2OGUA 2L91A 3F5HA 3IAOA 2XKMA 4UB8E 3A2AA 4UB8H 3L71G 3MGNA 4Z1MH 2FYNC 1SQBE 4C46A 1H8AA 1X0TA 1X22A 2W27A 2ZYDA 3M9QA 3N4XA 1L0NK 4JPZB 4XA4A 2BCCJ 1PGJA 1NWQA 2WWWA 5AW9B 3VP8A 5CBNA 3L72J 1GDTA 3HD7B 1LT9B 4OGQD 1PP9D 4LC1A 1SS1A 4NPDA 5CMZA 1G1JA 4H13D 1Q90D 1SFCD 5KAFE 1FZFA 2QJYB 3G6EP 1LT1A 1JMMA 5KAFH 2NPSD 1OW6A 3FXEA 3L70J 1FZBA 3G3ZA 1GU5A 2QEXP 5AW5B 2B9BA 1JO5A 1NU1J 1ZXGA 3GHGB 3RK3C 5CCGD 1EZVE 1QLED 1FZCC 1FDIA 1L2PA 2L5GB 1GZLA 2W90A 2WSCJ 4C7NA 4K35A 2KI7B 2M5AB 3CC4P 3KXDA 2ZJSE 3CCRP 3GW6A 2O1KA 4I1LA 2Y9ZA 3V6IA 3H1LE 2KXPB 3R2PA 5CCHD 3KZIE 1KQFB 1SQPG 3KZIH 2WSSH 3FGAD 2WPVB 3H6PA 1OWAA 2RH0A 2FYZA 2ZXXA 3V4QA 1NTMK 1SQXJ 3ZDMA 4PV1D 2G8YA 1K9MQ 4U3FJ 2QE7H 1NAFA 2PGDA 3V4WA 3W68A 1H0TA 4HB1A 3PHLA 1T6AA 4IOIH 1GK6A 4PJ0E 3CMAP 3AE7C 4PJ0H 2PAJA 2QIWA 3RK2B 4WB4A 1SQVJ 3KQGA 5L8RJ 4KJMA 1GL2D 5GTHE 4N78E 1MFTA 1MV8A 1VQ9P 4EDFA 5GTHH 1IFNA 3WU2E 2KOGA 1KZUB 1FZCB 3PH0A 1OZHA 3WU2H 5AVXB 1SQBJ 4WVZA 2QM7A 3MUDA 1BE3E 2W83C 5BVZA 3TGUD 2NZ2A 4HH2A 1KQSO 1EZVD 4ASVA 3P8MC 2QJKB 2P1JA 2KNCA 1G2CA 2ZVOB 1PGPA 3L74G 1URQD 2J5UA 1QL2A 1LP1B 3H1HJ 3QWOC 2FYUD 1NTKD 4Y99C 1N8RQ 1L4AD 2JR8A 4H44D 1YBKA 2K9JB 1P84E 2OYIA 1GD2E 3MUDC 1YJWP 1P84H 3FXDA 5KLVJ 3L71E 3FWNA 3AE5C 3AE6C 3HUSA 1HUCA 1KILB 2WPQA 1N2DC 1U57A 3AE4C 5APWA 2ZVNB 1LGHB 4GKGA 2KSEA 2O01H 3CCUP 2YKQA 3GLMA 1KD1Q 3CXHI 3HTKA 2A45I 1OVRA 3LIEA 1GU4A 1KB9E 2OYIC 1KB9H 3H1LJ 3L73D 3V2RA 3JCUE 1ZN5A 2ZYAA 3HUSC 3JCUH 1KYOE 2Y9YA 2QRXA 5AVWB 1KYOH 5BU8B 2JP3A 1DEEG 2V7QJ 3SSUA 1PL5A 3QH9A 1EXJA 1OVUA 1ZRTE 2P58A 3AE8C 1J1DC 1S1CX 1YJNP 1BE3D 4KHXA 3CI9A 3MP7B 5C39A 3TK1A 1VQ7P 3CCQP 3V2QA 4I2LC 1SLQA 2GA1A 1JTHB 1S5LX 5DJUB 4GDOA 2Y0DA 3IN6A 3TDKA 1T3UA 1NJIQ 2G3AA 2E74B 3M9BA 1NU1K 1IK7A 2WITA 1T8ZA 1SQPE 1L0LJ 4ZKUA 1KFMA 1NTMD 2WMMA 1CI6B 3L71D 1FOSF 3TGUG 3IFMA 1NTZG 3BRVB 2HPCA 1GK4A 1SQQG 4DOJA 3L75D 2OYHA 1FAVA 1N86A 2HG5D 5AW2B 3H1IJ 2R32A 3O8ZA 1PIXA 1FZAA 1KQGB 3HE5A 1BSNA 2FYUG 2KYVA 1NTKG 5TJHA 3CWBJ 1AQ5A 5B66E 4EIJA 1RF0A 3CLQA 1J1EC 3S1KA 3ABVC 1VF5C 2FXMA 2J58A 5B66H 4H0LB 4YTPC 1QX8A 1SQXK 3T97B 3VTPC 1P84I 4OH8B 3M0AA 2E75B 1WT6A 2N9BA 2OYHC 3F89A 2Q6QA 1LTBC 2O01N 1ZRTD 1ZV8A 2KIKA 2KP8A 1SQVK 4W80A 4ASWA 1S4XA 1WRGA 1KTMA 2CPBA 1RF0C 4BRYB 2H43A 1BDCA 3D6YA 1YJ9P 1NKZB 2H7HA 3L74E 3L73G 3CX5I 1SQBK 2KLVA 3B71A 4PD4E 4AUWA 2ZAEB 1KB9I 3OW2O 1ZR2A 4PD4H 5BU5A 2XNDH 1KYOI 1KFNA 3B5ND 2Y0CA 1QGKB 3BCCJ 1FJPA 2KZJA 4YXDC 3MZWB 1AJYA 2Q1KA 2JWAA 3EFFK 1DEBA 1MFZA 5KLVK 2WVRA 1EQ7A 4WY4B 4D6TJ 1LTJB 2FFDB 2BCCD 2D2CB 1OMIA 3VYIA 2W6JH 1K05A 1W5CE 1SQPJ 1NTMG 2LR2A 5AVVB 4L76A 3CMEP 3H1JJ 4AQRD 2RN0A 1YIJP 3SFDC 4GT1A 1GW4A 1T3JA 3WMM0 2XU6A 2BEQD 4HYTB 4JF7A 4L75A 2A06D 1JY2O 1N7LA 3M0DA 2YXQB 3L75G 2E42A 1M8OB 1VQ4P 1AV1A 3OA7A 1VQ6P 2W6AA 4GIFA 1USEA 3CC7P 2DW3A 1IO4A 5KLIC 1YI2P 1H89A 2B88A 1KQLA 2M8RA 1VQPP 3L37A 4QMAA 1VDFA 1EDJA 1OX3A 3O6QA 1XTCC 1R5LA 3L74D 3RL0C 3PRJA 4TLFA 3IR9A 3V2PA 4PD4D 5AVRB 1U7MA 3M0DC 4JYCA 3CCMP 1RF1B 1VQMP 1Q2NA 2YO3A 3RBZA 3TGUE 1NTZE 1NHLA 4TT3H 3B5NA 5AW6B 1JNMA 2KS1A 3JC22 3H1KD 1SQQE 1NVOA 3B4SA 1N7SB 1GTWA 1PP9J 2O3JA 1HJBA 1FS0E 1L0LK 3Q5PA 2FYUE 1NTKE 2FYNB 5KJ7A 2R5BA 4RO0A 3CCLP 1BGYG 1YTZI 4JQ0D 2JDIH 4IL6E 4N6JA 1JMBA 4IL6H 3B5NC 2JJLA 2IBZD 1N73A 3CD6P 3TSIA 1M90Q 3PJSK 4Y28J 2YIUC 3PP5A 5AVYB 4B86A 4DCKA 4HJGH 4YXWH 2Q3EA 3RL0B 1DIPA 1QEXA 2FBWC 2CPSA 5KJ7C 3P7KA 1FC2C 2K1AA 2N1TD 1VQ5P 3L73E 3II6A 2BCCG 4H0LD 1EC5A 3RK3B 3VOPA 2LXCB 1SFCA 3V2NA 2RMZA 2R5DA 3C9IA 3L72G 2NPSA 1KV4A 3Q1MA 2ZT9D 5AVUB 2XV5A 2E75D 1DD3A 1N73C 1FDMA 2WSEH 2GUSA 2Q5UA 5KTBA 5APSA 2A06G 3CC2P 2QJPC 5CCGA 1K04A 2E76D 3H1HD 2VRSA 3L70G 1S9KE 1NTZD 1IK9A 1DX7A 2OTLP 2XDJA 2WT7A 4OGQC 1NU1G 1SQQD 2QM8A 3AEDC 1M1JA 4H13C 2AEMA 4OWFA 1HTLC 1SFCC 1NAYA 2NPSC 2IFNA 1OW8A 2Q3IA 2ITAA 1VQLP 2Z5IA 5CCHA 4C7NB 1FZGA 1Q82Q 5CHXA 4C7RA 1NTME 1LWUA 5CCGC 3L36A 1L0ND 1R8EA 5EFWB 1RE4A 2HODA 3H1KG 3TGUJ 1GW3A 3L75E 3SFEC 1M1JC 3H32A 1JY3O 2H89C 4EOTA 1EZVI 2C9NY 3AE2C
chains in the Genus database with same CATH topology
2ZVOB 3JSVC 2ZVNB 4BWNA 3FX0A 3F89A 4OWFA 2V4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZVO B;  3JSV C;  2ZVN B;  4BWN A;  3FX0 A;  3F89 A;  4OWF A;  2V4H A; 
#chains in the Genus database with same CATH topology
 3G9R A;  2AXC A;  3KDP B;  1OIP A;  3WUU A;  3USS A;  2FXO A;  5CBO A;  4CPG A;  2N1T A;  5CCH C;  1SQP K;  2K9Y A;  4BXL A;  1SQX G;  2BAS A;  2FYU J;  2NRG A;  1NTK J;  2D2C D;  1LWU C;  1LTA C;  5DJT B;  1GL2 A;  1IFM A;  1RQV A;  1FBM A;  2IBZ G;  1RE4 C;  1H0T B;  3EFG A;  2ZXE B;  3CCS P;  2E5Y A;  3E7K A;  1NGM B;  1BCC D;  3HE4 A;  3M91 A;  4MN4 C;  2OQQ A;  1WMK A;  4PV1 C;  4HKZ H;  4WWI A;  3MHV A;  3LW5 H;  3AE3 C;  1QVG O;  1A02 J;  3HD7 D;  1Z56 A;  3AE1 C;  2N1T C;  1S9K D;  1MKM A;  2JO1 A;  3A0B E;  4Y99 B;  1YQ3 C;  5K5G B;  2OTK E;  3A0B H;  2RKL A;  1GL2 C;  1EDK A;  1JOC A;  1HJ0 A;  2BEZ F;  2R3C A;  1M7L A;  3U59 A;  1URQ A;  3CPW O;  1FE6 A;  4BWN A;  3Q5R A;  2P7J A;  3TNU A;  1AVY A;  1BGY E;  1FOS E;  1L4A A;  2KNC B;  2WSE J;  2E76 C;  1G2C B;  2K88 A;  2YMK A;  1JEK A;  4OVN F;  3RGU A;  2XNX A;  3H1H G;  2YNY A;  3LID A;  1R5S A;  3P32 A;  1N7S D;  1BE3 J;  3B8E B;  1W2E A;  2I1J A;  2O1J A;  5KLV G;  1EDL A;  1NO4 A;  2OYI B;  1M56 D;  1YTZ T;  1LNQ A;  2B87 A;  2IFM A;  3FWL A;  2WZ7 A;  3VMZ A;  1URQ C;  3U1A A;  2OYO A;  3HUS B;  3OAK A;  1USD A;  2KLU A;  5APV A;  1L4A C;  1KOR A;  2A45 G;  4H44 C;  4DJG A;  2BCC E;  5AW4 B;  2K3R A;  1CSB A;  2H88 C;  2OTJ P;  4PV1 B;  3L72 E;  1KIL E;  3HTK B;  1J1D B;  1L0N G;  3NXS A;  3AEB C;  1UIX A;  3L71 J;  2A06 E;  2FY8 A;  4NPF X;  2QSI A;  5AW0 B;  3L70 E;  1PGO A;  2O01 J;  1OFC X;  1JCD A;  1M57 D;  1NU1 E;  2WQY C;  1T2K D;  1PPJ G;  3HD7 A;  3D6Z A;  1LT9 A;  5KAI E;  3RK2 D;  5KAI H;  4I6M C;  4YPC A;  2HYN A;  3EWK A;  3L4F A;  3D71 A;  5AW1 B;  1ZME C;  2C9L Y;  1ZOY C;  1JCC A;  2WSC H;  1NH4 A;  4LLH A;  1VQO P;  1S2E A;  3CCE P;  3A0H E;  2IPP A;  1BCC G;  1BGY D;  1NYH A;  3A0H H;  3GHG A;  1XTG B;  2KUB A;  2KK7 A;  2LXB A;  3BRT B;  3H1K E;  1UII A;  2ZYG A;  3LW5 J;  3HD7 C;  1LT9 C;  1FJK A;  1L0L G;  2R44 A;  1AFO A;  1BSH A;  3A7O A;  2M5A A;  2CK3 H;  1J1E B;  3H1J D;  5TIS E;  1VF5 B;  3K5B A;  5TIS H;  4ZNC A;  2K37 A;  1SQX E;  1LJ2 A;  3CCJ P;  3GHG C;  2HPC B;  3AEE C;  1S72 P;  1IJD B;  1ZP0 C;  1KMI Z;  2OYH B;  2WPR A;  2IBZ E;  3H1I G;  1H88 A;  4JYB A;  1FU1 A;  3L72 D;  1KIL D;  2KSJ A;  3CWB G;  3HE5 B;  3IF4 A;  2HLO A;  3R4Y A;  1NOH A;  1S3J A;  4GOE A;  4UB6 E;  2MJZ A;  2PRR A;  4UB6 H;  3L70 D;  4L74 A;  2FYU K;  1NTK K;  1HVV A;  2FKW B;  1NU1 D;  1K8A Q;  5CJ4 A;  1Q86 Q;  5APX A;  3L35 A;  4WBA A;  1E79 H;  1NKN A;  1S5L E;  3P8C D;  3UIA A;  1KC8 Q;  1S5L H;  1ZLL A;  3MTU E;  1VQ8 P;  3RBX A;  1FZC A;  4ZKP A;  5APT A;  2IYP A;  2Y0E A;  2JKV A;  1W2B O;  3MIW A;  1RE3 A;  1IZN B;  3H1H E;  5B5E E;  1SVF A;  5B5E H;  1T2K C;  2H8P D;  3I5C A;  5AVZ B;  4R4M A;  5KLV E;  3RK2 C;  4M3L A;  1MUU A;  3G4S P;  2W8Z A;  1MZ9 A;  3E1R A;  3BCC G;  1DH3 A;  3FX0 A;  3CXH E;  3GF3 A;  2E74 D;  1EXI A;  1JM0 A;  1YHQ P;  3TF5 A;  1EDI A;  1Y9B A;  1LP1 A;  3CXH H;  4GOD A;  4GOF A;  3L74 J;  2A45 H;  1BDD A;  1RE3 C;  1SQX D;  2K9J A;  1IFP A;  5H2F E;  4U3F D;  2V4H A;  1L0N E;  5H2F H;  2PP6 A;  5APY A;  4U7J A;  1PGQ A;  4PD4 I;  1KIL A;  1Q81 Q;  2QJK C;  1IC2 A;  2M3B A;  3GMA A;  4D6T G;  1JY2 P;  3H1K J;  1SQV D;  1Q7Y Q;  2AXT E;  5KLI B;  1VQK P;  3WUT A;  2AXT H;  4EYY Q;  1JB0 J;  1YYC A;  4EI2 A;  3H1J G;  1PPJ E;  3I56 P;  2V7Q H;  5KKZ C;  4W7Z A;  1LTS C;  1SQB D;  1HGZ A;  3BAS A;  1PFI A;  3S4R A;  2HFE D;  4RKU J;  2IDB A;  4R4L A;  1PV3 A;  3VMY A;  1KIL C;  2JEE A;  1RQU A;  1LTT C;  1BCC E;  4XE5 B;  2I1K A;  1G1I A;  3GF7 A;  1A02 F;  1Y47 A;  2I8D A;  2IBZ I;  2R3S A;  2IZ1 A;  4AYC A;  2P10 A;  3O6Q B;  1JUN A;  1L0L E;  2IX7 C;  5AVQ B;  1JY2 N;  2AEF A;  3PTZ A;  1JTH A;  5KLV D;  3KPE A;  2QA4 P;  3CCV P;  1HGV A;  3B5N B;  1HF9 A;  2YO2 A;  2KS1 B;  3CXH D;  3KYQ A;  1PP9 G;  1VPC A;  3AEC C;  3H1I E;  2GUV A;  2PFX A;  2OAR A;  2C0W A;  2UWJ E;  4IFD K;  2YMY A;  1CI6 A;  2YIU B;  3CWB E;  1TU3 F;  2POH A;  5KKZ B;  1NTZ J;  3H1L D;  3AE9 C;  1PZQ A;  4I7Z C;  1SQQ J;  2AEJ A;  1VF5 D;  3C8V A;  2E74 C;  4RJT A;  2Z4E A;  2HR3 A;  1PPJ D;  3HRN A;  3OJA B;  1FDO A;  4WY4 D;  3M06 A;  2QG4 A;  1N73 B;  3WUV A;  2P2U A;  4K3A A;  4IFF A;  2GM4 A;  1CW5 A;  4U3F G;  4KT0 J;  2WPS A;  2QJP B;  2WSF H;  3CX5 E;  1L0N J;  4XFJ A;  1VL2 A;  3T97 A;  3CX5 H;  4OGQ B;  1SQV G;  4N3Y B;  1KN7 A;  3PLN A;  4H13 B;  1X9V A;  1SFC B;  4O9B A;  3W67 A;  4RES B;  4N78 D;  2NPS B;  1U7J A;  1L0L D;  2W6B A;  3RL0 g;  1SQB G;  4BRY A;  3RK3 E;  3BCC E;  4NPE A;  2N9Y B;  4H0L C;  4JBZ A;  1QVF O;  2J59 M;  2B89 A;  1ZW0 A;  3L73 J;  3KHU A;  1HBW A;  5AW3 B;  2ZT9 C;  3CL3 D;  3H25 A;  2E75 C;  2WT7 B;  1RY3 A;  5E79 E;  1BCC J;  1M1J B;  4DZO A;  5E79 H;  4I7Z B;  3H1I D;  1CZQ A;  3ITK A;  5APQ A;  4ZMD A;  4D6T E;  2QVA A;  3CWB D;  2MKV A;  3D70 A;  1JY3 P;  3AEF C;  3G71 P;  3H1J E;  3NFQ A;  1P84 D;  1LWU B;  2IYO A;  1M1K Q;  3VN0 A;  2JWD A;  1EZV G;  2HOD B;  3NMD A;  2KB7 P;  1ZR4 A;  3BAT A;  3MD0 A;  4WY4 A;  1LTJ A;  3VMX A;  1IFD A;  2FFD A;  3H32 B;  5AVT B;  2M3E A;  1OW7 A;  1RHZ B;  3VMA A;  2Q7C A;  3AEA C;  1RH5 B;  2FXP A;  3EQ2 A;  1NTM J;  2M0B A;  2P67 A;  3CX5 D;  5CJ0 A;  2N1T B;  2E43 A;  4IL6 X;  3H1L G;  1KB9 D;  3GG2 A;  3N7N A;  1GL2 B;  3L75 J;  5APU A;  1J2J B;  1YQ4 C;  1LTG C;  3NTN A;  1IFJ A;  3RL0 D;  1GMJ A;  1KYO D;  1FZE A;  1JY3 N;  4WY4 C;  1OVV A;  2ZT9 B;  1LTJ C;  1AQT A;  3C1L A;  1D7M A;  2FFD C;  2ZFC A;  3HE4 B;  4W7Y A;  2D2C C;  3AEG C;  1X8Y A;  2Q9I A;  5AW7 B;  3P8C E;  2YXR B;  1IFI A;  3BVH A;  3RK3 D;  3BCC D;  3V5B A;  2E76 B;  3A3Y B;  1AVO A;  1OXZ A;  1HH0 A;  3SWY A;  4A7P A;  5GTI E;  1PP9 E;  2WSF J;  1X79 B;  3S9O A;  5GTI H;  2Z5H A;  1RF1 A;  4IFM A;  4LGD E;  3A5T A;  1Y8A A;  2SPZ A;  3U1C A;  2WTY A;  1LTI C;  2YKP A;  1QL1 A;  2LKM A;  1URQ B;  2KZI A;  4D6T D;  3VP9 A;  3TNU B;  3Q5S A;  3Q3D A;  1N7S A;  1HWT C;  1E5W A;  1L4A B;  3Q2Y A;  4H44 B;  1SQP D;  1YIT P;  4L73 A;  1DD4 A;  2QJY C;  3TYY A;  1BE3 G;  3I55 P;  3JSV C;  3E1I A;  2IZ0 A;  1K73 Q;  3SWK A;  1RF1 C;  4U3F E;  2E5T A;  1BGY J;  2B87 B;  1AA0 A;  1NTZ K;  5M1B A;  2C0X A;  1VQN P;  3M9H A;  2YKO A;  1SP4 A;  1SQQ K;  4DT0 A;  1N7S C;  1SQV E;  5KJ7 D;  5AVS B;  2XZR A;  3SWF A;  5AW8 B;  2OGU A;  2L91 A;  3F5H A;  3IAO A;  2XKM A;  4UB8 E;  3A2A A;  4UB8 H;  3L71 G;  3MGN A;  4Z1M H;  2FYN C;  1SQB E;  4C46 A;  1H8A A;  1X0T A;  1X22 A;  2W27 A;  2ZYD A;  3M9Q A;  3N4X A;  1L0N K;  4JPZ B;  4XA4 A;  2BCC J;  1PGJ A;  1NWQ A;  2WWW A;  5AW9 B;  3VP8 A;  5CBN A;  3L72 J;  1GDT A;  3HD7 B;  1LT9 B;  4OGQ D;  1PP9 D;  4LC1 A;  1SS1 A;  4NPD A;  5CMZ A;  1G1J A;  4H13 D;  1Q90 D;  1SFC D;  5KAF E;  1FZF A;  2QJY B;  3G6E P;  1LT1 A;  1JMM A;  5KAF H;  2NPS D;  1OW6 A;  3FXE A;  3L70 J;  1FZB A;  3G3Z A;  1GU5 A;  2QEX P;  5AW5 B;  2B9B A;  1JO5 A;  1NU1 J;  1ZXG A;  3GHG B;  3RK3 C;  5CCG D;  1EZV E;  1QLE D;  1FZC C;  1FDI A;  1L2P A;  2L5G B;  1GZL A;  2W90 A;  2WSC J;  4C7N A;  4K35 A;  2KI7 B;  2M5A B;  3CC4 P;  3KXD A;  2ZJS E;  3CCR P;  3GW6 A;  2O1K A;  4I1L A;  2Y9Z A;  3V6I A;  3H1L E;  2KXP B;  3R2P A;  5CCH D;  3KZI E;  1KQF B;  1SQP G;  3KZI H;  2WSS H;  3FGA D;  2WPV B;  3H6P A;  1OWA A;  2RH0 A;  2FYZ A;  2ZXX A;  3V4Q A;  1NTM K;  1SQX J;  3ZDM A;  4PV1 D;  2G8Y A;  1K9M Q;  4U3F J;  2QE7 H;  1NAF A;  2PGD A;  3V4W A;  3W68 A;  1H0T A;  4HB1 A;  3PHL A;  1T6A A;  4IOI H;  1GK6 A;  4PJ0 E;  3CMA P;  3AE7 C;  4PJ0 H;  2PAJ A;  2QIW A;  3RK2 B;  4WB4 A;  1SQV J;  3KQG A;  5L8R J;  4KJM A;  1GL2 D;  5GTH E;  4N78 E;  1MFT A;  1MV8 A;  1VQ9 P;  4EDF A;  5GTH H;  1IFN A;  3WU2 E;  2KOG A;  1KZU B;  1FZC B;  3PH0 A;  1OZH A;  3WU2 H;  5AVX B;  1SQB J;  4WVZ A;  2QM7 A;  3MUD A;  1BE3 E;  2W83 C;  5BVZ A;  3TGU D;  2NZ2 A;  4HH2 A;  1KQS O;  1EZV D;  4ASV A;  3P8M C;  2QJK B;  2P1J A;  2KNC A;  1G2C A;  2ZVO B;  1PGP A;  3L74 G;  1URQ D;  2J5U A;  1QL2 A;  1LP1 B;  3H1H J;  3QWO C;  2FYU D;  1NTK D;  4Y99 C;  1N8R Q;  1L4A D;  2JR8 A;  4H44 D;  1YBK A;  2K9J B;  1P84 E;  2OYI A;  1GD2 E;  3MUD C;  1YJW P;  1P84 H;  3FXD A;  5KLV J;  3L71 E;  3FWN A;  3AE5 C;  3AE6 C;  3HUS A;  1HUC A;  1KIL B;  2WPQ A;  1N2D C;  1U57 A;  3AE4 C;  5APW A;  2ZVN B;  1LGH B;  4GKG A;  2KSE A;  2O01 H;  3CCU P;  2YKQ A;  3GLM A;  1KD1 Q;  3CXH I;  3HTK A;  2A45 I;  1OVR A;  3LIE A;  1GU4 A;  1KB9 E;  2OYI C;  1KB9 H;  3H1L J;  3L73 D;  3V2R A;  3JCU E;  1ZN5 A;  2ZYA A;  3HUS C;  3JCU H;  1KYO E;  2Y9Y A;  2QRX A;  5AVW B;  1KYO H;  5BU8 B;  2JP3 A;  1DEE G;  2V7Q J;  3SSU A;  1PL5 A;  3QH9 A;  1EXJ A;  1OVU A;  1ZRT E;  2P58 A;  3AE8 C;  1J1D C;  1S1C X;  1YJN P;  1BE3 D;  4KHX A;  3CI9 A;  3MP7 B;  5C39 A;  3TK1 A;  1VQ7 P;  3CCQ P;  3V2Q A;  4I2L C;  1SLQ A;  2GA1 A;  1JTH B;  1S5L X;  5DJU B;  4GDO A;  2Y0D A;  3IN6 A;  3TDK A;  1T3U A;  1NJI Q;  2G3A A;  2E74 B;  3M9B A;  1NU1 K;  1IK7 A;  2WIT A;  1T8Z A;  1SQP E;  1L0L J;  4ZKU A;  1KFM A;  1NTM D;  2WMM A;  1CI6 B;  3L71 D;  1FOS F;  3TGU G;  3IFM A;  1NTZ G;  3BRV B;  2HPC A;  1GK4 A;  1SQQ G;  4DOJ A;  3L75 D;  2OYH A;  1FAV A;  1N86 A;  2HG5 D;  5AW2 B;  3H1I J;  2R32 A;  3O8Z A;  1PIX A;  1FZA A;  1KQG B;  3HE5 A;  1BSN A;  2FYU G;  2KYV A;  1NTK G;  5TJH A;  3CWB J;  1AQ5 A;  5B66 E;  4EIJ A;  1RF0 A;  3CLQ A;  1J1E C;  3S1K A;  3ABV C;  1VF5 C;  2FXM A;  2J58 A;  5B66 H;  4H0L B;  4YTP C;  1QX8 A;  1SQX K;  3T97 B;  3VTP C;  1P84 I;  4OH8 B;  3M0A A;  2E75 B;  1WT6 A;  2N9B A;  2OYH C;  3F89 A;  2Q6Q A;  1LTB C;  2O01 N;  1ZRT D;  1ZV8 A;  2KIK A;  2KP8 A;  1SQV K;  4W80 A;  4ASW A;  1S4X A;  1WRG A;  1KTM A;  2CPB A;  1RF0 C;  4BRY B;  2H43 A;  1BDC A;  3D6Y A;  1YJ9 P;  1NKZ B;  2H7H A;  3L74 E;  3L73 G;  3CX5 I;  1SQB K;  2KLV A;  3B71 A;  4PD4 E;  4AUW A;  2ZAE B;  1KB9 I;  3OW2 O;  1ZR2 A;  4PD4 H;  5BU5 A;  2XND H;  1KYO I;  1KFN A;  3B5N D;  2Y0C A;  1QGK B;  3BCC J;  1FJP A;  2KZJ A;  4YXD C;  3MZW B;  1AJY A;  2Q1K A;  2JWA A;  3EFF K;  1DEB A;  1MFZ A;  5KLV K;  2WVR A;  1EQ7 A;  4WY4 B;  4D6T J;  1LTJ B;  2FFD B;  2BCC D;  2D2C B;  1OMI A;  3VYI A;  2W6J H;  1K05 A;  1W5C E;  1SQP J;  1NTM G;  2LR2 A;  5AVV B;  4L76 A;  3CME P;  3H1J J;  4AQR D;  2RN0 A;  1YIJ P;  3SFD C;  4GT1 A;  1GW4 A;  1T3J A;  3WMM 0;  2XU6 A;  2BEQ D;  4HYT B;  4JF7 A;  4L75 A;  2A06 D;  1JY2 O;  1N7L A;  3M0D A;  2YXQ B;  3L75 G;  2E42 A;  1M8O B;  1VQ4 P;  1AV1 A;  3OA7 A;  1VQ6 P;  2W6A A;  4GIF A;  1USE A;  3CC7 P;  2DW3 A;  1IO4 A;  5KLI C;  1YI2 P;  1H89 A;  2B88 A;  1KQL A;  2M8R A;  1VQP P;  3L37 A;  4QMA A;  1VDF A;  1EDJ A;  1OX3 A;  3O6Q A;  1XTC C;  1R5L A;  3L74 D;  3RL0 C;  3PRJ A;  4TLF A;  3IR9 A;  3V2P A;  4PD4 D;  5AVR B;  1U7M A;  3M0D C;  4JYC A;  3CCM P;  1RF1 B;  1VQM P;  1Q2N A;  2YO3 A;  3RBZ A;  3TGU E;  1NTZ E;  1NHL A;  4TT3 H;  3B5N A;  5AW6 B;  1JNM A;  2KS1 A;  3JC2 2;  3H1K D;  1SQQ E;  1NVO A;  3B4S A;  1N7S B;  1GTW A;  1PP9 J;  2O3J A;  1HJB A;  1FS0 E;  1L0L K;  3Q5P A;  2FYU E;  1NTK E;  2FYN B;  5KJ7 A;  2R5B A;  4RO0 A;  3CCL P;  1BGY G;  1YTZ I;  4JQ0 D;  2JDI H;  4IL6 E;  4N6J A;  1JMB A;  4IL6 H;  3B5N C;  2JJL A;  2IBZ D;  1N73 A;  3CD6 P;  3TSI A;  1M90 Q;  3PJS K;  4Y28 J;  2YIU C;  3PP5 A;  5AVY B;  4B86 A;  4DCK A;  4HJG H;  4YXW H;  2Q3E A;  3RL0 B;  1DIP A;  1QEX A;  2FBW C;  2CPS A;  5KJ7 C;  3P7K A;  1FC2 C;  2K1A A;  2N1T D;  1VQ5 P;  3L73 E;  3II6 A;  2BCC G;  4H0L D;  1EC5 A;  3RK3 B;  3VOP A;  2LXC B;  1SFC A;  3V2N A;  2RMZ A;  2R5D A;  3C9I A;  3L72 G;  2NPS A;  1KV4 A;  3Q1M A;  2ZT9 D;  5AVU B;  2XV5 A;  2E75 D;  1DD3 A;  1N73 C;  1FDM A;  2WSE H;  2GUS A;  2Q5U A;  5KTB A;  5APS A;  2A06 G;  3CC2 P;  2QJP C;  5CCG A;  1K04 A;  2E76 D;  3H1H D;  2VRS A;  3L70 G;  1S9K E;  1NTZ D;  1IK9 A;  1DX7 A;  2OTL P;  2XDJ A;  2WT7 A;  4OGQ C;  1NU1 G;  1SQQ D;  2QM8 A;  3AED C;  1M1J A;  4H13 C;  2AEM A;  4OWF A;  1HTL C;  1SFC C;  1NAY A;  2NPS C;  2IFN A;  1OW8 A;  2Q3I A;  2ITA A;  1VQL P;  2Z5I A;  5CCH A;  4C7N B;  1FZG A;  1Q82 Q;  5CHX A;  4C7R A;  1NTM E;  1LWU A;  5CCG C;  3L36 A;  1L0N D;  1R8E A;  5EFW B;  1RE4 A;  2HOD A;  3H1K G;  3TGU J;  1GW3 A;  3L75 E;  3SFE C;  1M1J C;  3H32 A;  1JY3 O;  2H89 C;  4EOT A;  1EZV I;  2C9N Y;  3AE2 C; 
#chains in the Genus database with same CATH homology
 2ZVO B;  3JSV C;  2ZVN B;  4BWN A;  3FX0 A;  3F89 A;  4OWF A;  2V4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...