3JSVC

Crystal structure of mouse nemo cozi in complex with lys63-linked di-ubiquitin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
QLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin
publication title Crystal structure of the NEMO ubiquitin-binding domain in complex with Lys 63-linked di-ubiquitin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transcription
total genus 26
structure length 83
sequence length 83
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 3jsvC00
2ZVOB 3JSVC 4BWNA 4OWFA 2ZVNB 3F89A 3FX0A 2V4HA
chains in the Genus database with same CATH superfamily
2E75D 4ZNCA 3L70D 1FOSE 2QE7H 1BGYE 1SQVD 1NTKK 3MUDC 2Q1KA 3BRTB 1BGYD 2J5UA 5AVTB 1R8EA 3A0BE 4GT1A 5KLIB 1SS1A 3PHLA 5APTA 2OYHA 4HJGH 2KZIA 2WT7B 2LXBA 1KQFB 2WSSH 1ZLLA 1E5WA 3SWFA 3L72E 3RL0D 1URQA 3CCLP 2Y0DA 1VQMP 4U3FJ 3L72D 2IZ1A 4OGQD 1OMIA 1KQSO 3GF3A 1JTHB 3NMDA 4JBZA 2YKQA 3TNUB 1KMIZ 2IYOA 3G71P 4I1LA 5AW6B 3GG2A 3CCVP 2K37A 1CI6A 3O6QB 3S1KA 1QL2A 2M8RA 2G8YA 4IFFA 3W67A 1GDTA 4XE5B 1QVFO 1NAFA 1GD2E 1KN7A 1BCCG 1JM0A 2P2UA 2AEMA 3JC22 1OXZA 1NTMK 1VQKP 1SQPJ 5AW1B 3VP9A 3RBZA 1KQLA 2RKLA 1DD3A 2FKWB 4GODA 2XDJA 4UB6E 5GTIH 3CC7P 4D6TG 4DZOA 3PJSK 3L71E 5KLVJ 1HJ0A 2JWDA 3H1HE 3MUDA 2OGUA 3L71D 1VQ7P 3H1HD 2M5AA 3TYYA 1WRGA 2KLUA 4PJ0E 5CCGC 1YIJP 2WWWA 4EI2A 2HYNA 5KTBA 1L4AC 4WB4A 1OVUA 1UIXA 1IFMA 1HVVA 1KYOH 3HD7B 5KAFE 3A5TA 3IFMA 1L0LJ 5CCHD 2WPQA 1KFMA 1K73Q 1FZAA 1S5LH 1QVGO 2QVAA 4O9BA 2K3RA 4RO0A 1JCDA 4IFDK 2HODA 1CW5A 3QH9A 4YTPC 3NTNA 2FYUE 5APUA 2I8DA 1L0NJ 3JSVC 2JR8A 4TT3H 2FYUD 2GM4A 3VYIA 2NPSC 1ZMEC 5AVYB 1JY2O 3II6A 4U3FG 1ZP0C 1KB9E 2W8ZA 1IK7A 4EYYQ 5CJ4A 1KB9D 1NH4A 1NVOA 5H2FH 1PGJA 4WVZA 3L74J 3WU2H 4AYCA 3HE5B 3E1IA 3M9BA 3WMM0 3VN0A 3Q5PA 2FYNC 3Q3DA 2A45H 5APVA 1LWUB 3PTZA 1FJPA 1IC2A 2FXMA 5APYA 3BATA 3VMYA 1PP9J 1SQPG 3AEDC 2WQYC 1USDA 2FYNB 1N73B 3B5NA 1S2EA 3CC2P 2KK7A 1KB9I 1AV1A 1Z56A 1MZ9A 3L75G 2R32A 3KQGA 3V2QA 3JCUE 5KLVG 1GW4A 4ASVA 4BWNA 1ZR4A 3W68A 1EZVE 2AXCA 2E75C 2DW3A 3CXHE 4JYBA 1EZVD 3MIWA 1NO4A 2W6JH 2KYVA 1JCCA 5B5EH 2H43A 4I2LC 1VQ9P 3Q5RA 1T2KD 1QL1A 5AVSB 1L0LG 1SP4A 1NKZB 3M9HA 3RL0C 4PV1B 3AE8C 1SQBE 4H13C 1SFCA 1SQQE 1SQBD 4I7ZC 3NXSA 4OGQC 1Q90D 2O1JA 1SQQD 1EZVI 3GHGC 2FFDB 3CXHI 2WSEH 1KORA 4ZKPA 2YXRB 3RL0B 1LT9B 2WSEJ 1L0NG 3V4WA 4H13B 5EFWB 4BXLA 3CWBJ 1NTZJ 1U57A 1G2CB 5APSA 3N4XA 2FYZA 4C7NB 1IZNB 3IN6A 1K8AQ 1M1JA 1MKMA 4N78D 3AEGC 3H1IE 1HGZA 2XKMA 2Q3IA 3L74G 2JJLA 1LTTC 2K9JB 3AEAC 3MGNA 3H1ID 2QA4P 2HR3A 3CMEP 2KS1A 2D2CD 1PGPA 1PL5A 1RF1C 2A45G 2E5TA 2RMZA 4PD4H 1GL2D 1SQVJ 2CPBA 2L91A 1P84E 3KXDA 3ABVC 3GLMA 3RK3B 2QJKC 3B5ND 1BGYJ 2R3CA 1VPCA 1RF1B 2Y0EA 1P84D 1N2DC 1FZFA 1FJKA 3FWNA 1JY2P 3TDKA 4LLHA 3ITKA 1NOHA 2V7QH 2R44A 1NGMB 2V7QJ 3VP8A 2BEQD 4XA4A 2FYUK 1JMBA 2KSJA 2QJKB 1FDOA 3TK1A 3VMAA 1Y8AA 3C8VA 4R4LA 3L72J 4H0LD 4OVNF 2IDBA 3WUVA 5KKZC 1K9MQ 2M0BA 2OYHC 2O3JA 2O01N 3H1JJ 4IOIH 4KT0J 4HKZH 3T97A 2HLOA 4NPFX 1P84I 3U59A 1R5SA 4IL6X 1X79B 1SFCD 2KB7P 2JO1A 5BU5A 2YIUB 1S1CX 3SWYA 1DD4A 1VF5D 2W6BA 2OYHB 1AVYA 2QSIA 1Q7YQ 1J1EB 4Y99B 2WSCH 2PFXA 1OW7A 1ZN5A 1HBWA 2WSCJ 2BEZF 2QM8A 4LGDE 4D6TJ 2K1AA 1URQB 2KOGA 4H44B 4DT0A 1EC5A 3P7KA 1LTIC 3PLNA 1MUUA 2N1TD 1BE3E 1PPJG 3BASA 1NTZG 1BE3D 1S9KE 5M1BA 4TLFA 5E79H 2QEXP 1BSHA 2YO2A 3S9OA 3VOPA 3TGUG 2E43A 2AEJA 2NZ2A 5AVZB 5CCHA 1J2JB 2K88A 1VQNP 1RF0C 3FGAD 1LP1A 2B87A 3MP7B 2XNDH 2Y9YA 4WY4B 1NU1J 3VMZA 3HE4A 1AA0A 1VQ5P 1XTGB 1YJNP 2HFED 2ZFCA 2AXTH 2KUBA 5KJ7A 1SQVG 5TJHA 4BRYA 1LTBC 1BGYG 2PP6A 1SQBK 1YITP 1SQXK 1T2KC 3MZWB 1SQQK 2M5AB 1K05A 4W80A 1A02F 1X0TA 1FDIA 1YJWP 3IF4A 1FU1A 2C0XA 3RK2D 1RE3C 2E76D 1IK9A 2IFMA 3KZIH 3H1KJ 3L72G 1AFOA 3H1LJ 3KHUA 3V6IA 3AE1C 2KLVA 3H1JG 2JDIH 2LR2A 3AE3C 1BCCE 1QX8A 3L73E 3HUSA 3N7NA 2HODB 1BCCD 1RY3A 1M7LA 1KZUB 2KI7B 3L73D 4L76A 4JPZB 1EQ7A 2Y9ZA 4L75A 5KAIE 2QRXA 4YPCA 3L75J 4IFMA 1RF0A 3NFQA 1FS0E 4IL6E 2D2CC 2GUSA 1LTJC 5AVVB 1S5LX 3V2NA 3BCCJ 2WPRA 4W7ZA 3CCJP 5AW5B 5B66E 2WT7A 1FZBA 3L71G 5TISE 3VMXA 1ZOYC 1GL2C 5CBNA 1YI2P 2D2CB 3B5NC 3V4QA 4GOEA 1X9VA 2FXOA 5AW9B 1NTKJ 3SSUA 1VL2A 3B71A 3I55P 1RE3A 3MHVA 1NU1G 2FXPA 1L4AB 3AEFC 3TNUA 5KJ7D 3CCSP 3IR9A 1JNMA 2POHA 4CPGA 3TF5A 1M1KQ 4HH2A 1SQBJ 3B8EB 1T3UA 2BCCE 3A0HH 2JEEA 2OTKE 2E5YA 4YXDC 2V4HA 1SQQJ 2BCCD 2QM7A 4U3FE 4L73A 1H88A 2I1JA 3KYQA 1FBMA 1IFNA 1N86A 3CCRP 1BDCA 1SFCC 1QLED 2ZT9D 2RN0A 2WPVB 1VF5C 2P1JA 3H1KG 3EFGA 2NPSB 1ZXGA 4W7YA 3H1LG 4RKUJ 2XZRA 3U1CA 3KPEA 3P32A 2P10A 2B88A 1XTCC 3G9RA 1LTJA 4NPEA 2N1TC 1BDDA 5CMZA 4LC1A 2IX7C 1NTMJ 1GL2A 1M1JC 3M06A 3HRNA 5GTIE 3UIAA 2YMYA 1SVFA 2W27A 3P8MC 4M3LA 1VQ4P 2E42A 3LW5H 2C0WA 1FZCA 4YXWH 1M1JB 3LW5J 5AVWB 3OAKA 3CCMP 1W2BO 3BCCG 3I5CA 1YHQP 3CXHD 3MTUE 3AEEC 2P7JA 1U7JA 3CX5H 2KS1B 3AECC 3GW6A 1EZVG 2WITA 2E75B 1KYOE 1L0LE 1VQPP 1MV8A 1KYOD 1L0LD 1S5LE 1NTKG 2I1KA 1SQXE 1Q86Q 2ZVOB 1KILA 3A7OA 2ZYDA 1RH5B 2IBZG 1OFCX 1SQXD 2QJPC 4GOFA 1HTLC 3HE5A 3RK2C 2KXPB 1HWTC 2HPCA 3S4RA 3CI9A 3BVHA 1SQBG 1L0NE 1H0TB 3SFDC 1SQQG 1L0ND 3OA7A 2ITAA 2N1TA 5GTHH 4I7ZB 4OGQB 2OTJP 5APQA 1FC2C 1DH3A 3GHGB 1KYOI 3TGUJ 5CBOA 2GUVA 2P58A 3L74E 5H2FE 2QIWA 1X22A 1EDLA 4UB8H 3WU2E 1NJIQ 3L74D 2O01H 3T97B 1J1DC 2ZVNB 2O01J 1YJ9P 1HUCA 1IJDB 1HF9A 3USSA 1LT1A 4N3YB 5AW0B 1BSNA 4RJTA 2B9BA 4QMAA 1CSBA 4RESB 3L37A 1PP9E 3L70J 3AE7C 1RE4A 1NTMG 3HD7D 4Y28J 1PP9D 1ZRTE 1LTSC 3AE9C 3GMAA 2M3BA 3Q2YA 2WTYA 3A0BH 3D6ZA 3L36A 3I56P 1R5LA 5CCHC 1GMJA 1JMMA 2FFDA 2A45I 5KJ7C 1LT9A 2WMMA 5B5EE 1RHZB 3A2AA 3GF7A 3ZDMA 1NHLA 3FWLA 1GU4A 1LP1B 2B87B 1G2CA 3VTPC 1KQGB 1S72P 1LGHB 4ASWA 1KILE 3HE4B 3IAOA 3O8ZA 1PGOA 3SWKA 1DX7A 1KILD 2W90A 1VQOP 5KKZB 4BRYB 1ZR2A 2OARA 2XU6A 4N6JA 3TSIA 2ZT9C 4L74A 3FXDA 1M8OB 1YBKA 2H89C 4JYCA 3P8CE 2WVRA 1PV3A 2A06E 1Y9BA 3CLQA 3CWBE 4WWIA 1SQPK 3L35A 2OYIA 3P8CD 2KNCA 4UB6H 1OVRA 2A06D 3AE4C 3CWBD 2ZYAA 3HUSC 1T8ZA 2ZT9B 3EWKA 3Q5SA 1N8RQ 2SPZA 3L71J 2BASA 3D6YA 1VQLP 1S9KD 5KLVK 3H1HJ 1CI6B 4DJGA 1G1IA 3K5BA 1W2EA 4PJ0H 3PP5A 4MN4C 3HUSB 1MFZA 3Q1MA 1A02J 1LTGC 3MD0A 4PD4E 3RGUA 5KAFH 5KLIC 3U1AA 1OX3A 3L70G 2C9NY 1NKNA 1SQVE 1L0LK 4PD4D 2VRSA 3KDPB 1NYHA 1UIIA 1IFIA 1N7SA 1CZQA 2OYOA 4PV1D 1JB0J 2W83C 3M0DA 1QGKB 2E74D 1FAVA 3FXEA 2FYUJ 3L4FA 3G6EP 2JP3A 2XV5A 2BCCJ 2J59M 1L0NK 1TU3F 4H13D 2UWJE 3HTKA 2ZAEB 3OJAB 1KB9H 2Z4EA 1AQ5A 3H1JE 4PD4I 5AW3B 1S4XA 3E7KA 2IFNA 1U7MA 2Y0CA 3H1JD 2R5BA 3PH0A 1PFIA 3H32A 4JQ0D 2B89A 4C7RA 1OWAA 2LKMA 1M90Q 5DJTB 2KZJA 4D6TE 3L73G 4OWFA 3F5HA 1NAYA 2IYPA 4D6TD 4WY4A 5BU8B 2H8PD 3RK3E 2Z5IA 1KC8Q 3RK3D 2XNXA 2YXQB 3B4SA 5E79E 4NPDA 2AEFA 3CCEP 1T6AA 1YQ4C 1JUNA 3JCUH 4AQRD 4ZMDA 4A7PA 1K04A 1JY3N 5AVRB 3H1HG 3HD7C 1JOCA 5DJUB 3CXHH 2YMKA 2KSEA 1LTJB 3R4YA 1AQTA 2R3SA 2P67A 1D7MA 1NU1E 3RBXA 4C46A 1GL2B 3H6PA 1FZCC 1JTHA 3AEBC 3AE2C 1NU1D 2AXTE 3B5NB 2YO3A 2Z5HA 1IO4A 3CC4P 1JY3O 1LNQA 3V5BA 3O6QA 2KIKA 1GK4A 1N7SD 4H0LC 1JY2N 1SQXJ 1FZCB 1Q2NA 1KV4A 4Z1MH 2FYUG 2OTLP 1EDIA 4U3FD 1KILC 2JWAA 3EQ2A 4H0LB 1URQD 1EDKA 2BCCG 4H44D 3KZIE 3H1KE 1NTZK 3H1LE 3H1KD 2IPPA 3R2PA 1LTAC 2K9YA 2PRRA 1LWUC 1VQ6P 3H1LD 2PAJA 1FE6A 3BRVB 1SFCB 3SFEC 1KILB 3H1IJ 1OZHA 3V2PA 1EXJA 4U7JA 2ZJSE 1VF5B 4XFJA 1AJYA 5L8RJ 5AVQB 2HPCB 1OW8A 1SQPE 1N73C 5AW8B 3HD7A 1EDJA 1IFJA 2N9BA 1SQPD 2YKPA 1N7LA 4DCKA 1IFPA 3L75E 2N1TB 3M9QA 5CCGA 1S3JA 4WY4D 5KLVE 4EIJA 1SQVK 1L4AA 3L75D 1P84H 1YTZI 4KJMA 5KLVD 1GTWA 3BCCE 3LIEA 1M57D 3BCCD 1RE4C 1W5CE 1M56D 3G3ZA 2YKOA 3CPWO 2L5GB 1RQUA 4KHXA 5CHXA 1ZW0A 3LIDA 2WSFH 2WSFJ 2N9YB 1FZEA 1ZV8A 2QJYC 3CD6P 4PV1C 3A3YB 1USEA 1NTKE 1KD1Q 4GIFA 1Q82Q 1JEKA 1NTKD 2E74C 1VDFA 2JKVA 2IBZE 2GA1A 3RL0g 3D70A 2NPSA 3FX0A 2E76C 2FFDC 2IBZD 1PGQA 2QJYB 5AVUB 1LT9C 2CK3H 2ZXXA 1LWUA 2KP8A 4I6MC 1SQXG 3CCQP 3A0HE 4B86A 2E74B 2Q6QA 4ZKUA 3WUUA 1JO5A 2QJPB 2IZ0A 3RK2B 4OH8B 2E76B 1LJ2A 3AE5C 5C39A 1GK6A 1N73A 5AW4B 5K5GB 3WUTA 1EXIA 1BE3J 1FZGA 5APXA 2H88C 4N78E 2Q9IA 1QEXA 2IBZI 2FY8A 1GW3A 3QWOC 2O1KA 4EOTA 2QG4A 2R5DA 1OVVA 4HB1A 2CPSA 3H1IG 1E79H 3PRJA 2OYIC 3C9IA 2FBWC 4HYTB 1KTMA 1JY3P 1X8YA 3M0AA 1NTME 1H8AA 3RK3C 1J1DB 1RQVA 1NTMD 1ZRTD 1NU1K 5CCGD 1FDMA 3V2RA 2OYIB 1PP9G 2ZYGA 2MKVA 1L4AD 2KNCB 1PZQA 2ZXEB 2J58A 1HH0A 2OQQA 3CMAP 1L2PA 2WZ7A 3CX5E 4EDFA 1YQ3C 1H0TA 2C9LY 4K35A 1Q81Q 4GDOA 1N7SC 1GU5A 3CX5D 3CL3D 1YTZT 5AVXB 4C7NA 1FOSF 2Q7CA 3GHGA 1NWQA 3M0DC 2YIUC 2Q3EA 5AW7B 1PIXA 1J1EC 1T3JA 5BVZA 4Y99C 2NPSD 4AUWA 4DOJA 2K9JA 3H25A 1G1JA 2Q5UA 4JF7A 1N7SB 1URQC 4H44C 1KFNA 1BCCJ 4GKGA 2M3EA 3L73J 4K3AA 3C1LA 4WBAA 1MFTA 5AW2B 1PPJE 1VQ8P 3AE6C 1AVOA 1NTZE 1Y47A 1GZLA 1HGVA 5GTHE 1WMKA 3E1RA 3M91A 3CX5I 1OW6A 1PPJD 3OW2O 5CJ0A 5KAIH 1NTZD 2W6AA 2NRGA 1OIPA 3F89A 3G4SP 2PGDA 3TGUE 2LXCB 3CCUP 3D71A 3HTKB 2H7HA 1RF1A 4IL6H 1SLQA 2YNYA 3TGUD 2HG5D 2A06G 2RH0A 1BE3G 4UB8E 3CWBG 1HJBA 5APWA 3EFFK 1DIPA 4R4MA 5B66H 1WT6A 4WY4C 3H32B 5TISH 1H89A 1DEBA 2G3AA 2MJZA 1DEEG 3L70E 1IFDA 1YYCA 2WPSA
chains in the Genus database with same CATH topology
2ZVOB 3JSVC 4BWNA 4OWFA 2ZVNB 3F89A 3FX0A 2V4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZVO B;  3JSV C;  4BWN A;  4OWF A;  2ZVN B;  3F89 A;  3FX0 A;  2V4H A; 
#chains in the Genus database with same CATH topology
 2E75 D;  4ZNC A;  3L70 D;  1FOS E;  2QE7 H;  1BGY E;  1SQV D;  1NTK K;  3MUD C;  2Q1K A;  3BRT B;  1BGY D;  2J5U A;  5AVT B;  1R8E A;  3A0B E;  4GT1 A;  5KLI B;  1SS1 A;  3PHL A;  5APT A;  2OYH A;  4HJG H;  2KZI A;  2WT7 B;  2LXB A;  1KQF B;  2WSS H;  1ZLL A;  1E5W A;  3SWF A;  3L72 E;  3RL0 D;  1URQ A;  3CCL P;  2Y0D A;  1VQM P;  4U3F J;  3L72 D;  2IZ1 A;  4OGQ D;  1OMI A;  1KQS O;  3GF3 A;  1JTH B;  3NMD A;  4JBZ A;  2YKQ A;  3TNU B;  1KMI Z;  2IYO A;  3G71 P;  4I1L A;  5AW6 B;  3GG2 A;  3CCV P;  2K37 A;  1CI6 A;  3O6Q B;  3S1K A;  1QL2 A;  2M8R A;  2G8Y A;  4IFF A;  3W67 A;  1GDT A;  4XE5 B;  1QVF O;  1NAF A;  1GD2 E;  1KN7 A;  1BCC G;  1JM0 A;  2P2U A;  2AEM A;  3JC2 2;  1OXZ A;  1NTM K;  1VQK P;  1SQP J;  5AW1 B;  3VP9 A;  3RBZ A;  1KQL A;  2RKL A;  1DD3 A;  2FKW B;  4GOD A;  2XDJ A;  4UB6 E;  5GTI H;  3CC7 P;  4D6T G;  4DZO A;  3PJS K;  3L71 E;  5KLV J;  1HJ0 A;  2JWD A;  3H1H E;  3MUD A;  2OGU A;  3L71 D;  1VQ7 P;  3H1H D;  2M5A A;  3TYY A;  1WRG A;  2KLU A;  4PJ0 E;  5CCG C;  1YIJ P;  2WWW A;  4EI2 A;  2HYN A;  5KTB A;  1L4A C;  4WB4 A;  1OVU A;  1UIX A;  1IFM A;  1HVV A;  1KYO H;  3HD7 B;  5KAF E;  3A5T A;  3IFM A;  1L0L J;  5CCH D;  2WPQ A;  1KFM A;  1K73 Q;  1FZA A;  1S5L H;  1QVG O;  2QVA A;  4O9B A;  2K3R A;  4RO0 A;  1JCD A;  4IFD K;  2HOD A;  1CW5 A;  3QH9 A;  4YTP C;  3NTN A;  2FYU E;  5APU A;  2I8D A;  1L0N J;  3JSV C;  2JR8 A;  4TT3 H;  2FYU D;  2GM4 A;  3VYI A;  2NPS C;  1ZME C;  5AVY B;  1JY2 O;  3II6 A;  4U3F G;  1ZP0 C;  1KB9 E;  2W8Z A;  1IK7 A;  4EYY Q;  5CJ4 A;  1KB9 D;  1NH4 A;  1NVO A;  5H2F H;  1PGJ A;  4WVZ A;  3L74 J;  3WU2 H;  4AYC A;  3HE5 B;  3E1I A;  3M9B A;  3WMM 0;  3VN0 A;  3Q5P A;  2FYN C;  3Q3D A;  2A45 H;  5APV A;  1LWU B;  3PTZ A;  1FJP A;  1IC2 A;  2FXM A;  5APY A;  3BAT A;  3VMY A;  1PP9 J;  1SQP G;  3AED C;  2WQY C;  1USD A;  2FYN B;  1N73 B;  3B5N A;  1S2E A;  3CC2 P;  2KK7 A;  1KB9 I;  1AV1 A;  1Z56 A;  1MZ9 A;  3L75 G;  2R32 A;  3KQG A;  3V2Q A;  3JCU E;  5KLV G;  1GW4 A;  4ASV A;  4BWN A;  1ZR4 A;  3W68 A;  1EZV E;  2AXC A;  2E75 C;  2DW3 A;  3CXH E;  4JYB A;  1EZV D;  3MIW A;  1NO4 A;  2W6J H;  2KYV A;  1JCC A;  5B5E H;  2H43 A;  4I2L C;  1VQ9 P;  3Q5R A;  1T2K D;  1QL1 A;  5AVS B;  1L0L G;  1SP4 A;  1NKZ B;  3M9H A;  3RL0 C;  4PV1 B;  3AE8 C;  1SQB E;  4H13 C;  1SFC A;  1SQQ E;  1SQB D;  4I7Z C;  3NXS A;  4OGQ C;  1Q90 D;  2O1J A;  1SQQ D;  1EZV I;  3GHG C;  2FFD B;  3CXH I;  2WSE H;  1KOR A;  4ZKP A;  2YXR B;  3RL0 B;  1LT9 B;  2WSE J;  1L0N G;  3V4W A;  4H13 B;  5EFW B;  4BXL A;  3CWB J;  1NTZ J;  1U57 A;  1G2C B;  5APS A;  3N4X A;  2FYZ A;  4C7N B;  1IZN B;  3IN6 A;  1K8A Q;  1M1J A;  1MKM A;  4N78 D;  3AEG C;  3H1I E;  1HGZ A;  2XKM A;  2Q3I A;  3L74 G;  2JJL A;  1LTT C;  2K9J B;  3AEA C;  3MGN A;  3H1I D;  2QA4 P;  2HR3 A;  3CME P;  2KS1 A;  2D2C D;  1PGP A;  1PL5 A;  1RF1 C;  2A45 G;  2E5T A;  2RMZ A;  4PD4 H;  1GL2 D;  1SQV J;  2CPB A;  2L91 A;  1P84 E;  3KXD A;  3ABV C;  3GLM A;  3RK3 B;  2QJK C;  3B5N D;  1BGY J;  2R3C A;  1VPC A;  1RF1 B;  2Y0E A;  1P84 D;  1N2D C;  1FZF A;  1FJK A;  3FWN A;  1JY2 P;  3TDK A;  4LLH A;  3ITK A;  1NOH A;  2V7Q H;  2R44 A;  1NGM B;  2V7Q J;  3VP8 A;  2BEQ D;  4XA4 A;  2FYU K;  1JMB A;  2KSJ A;  2QJK B;  1FDO A;  3TK1 A;  3VMA A;  1Y8A A;  3C8V A;  4R4L A;  3L72 J;  4H0L D;  4OVN F;  2IDB A;  3WUV A;  5KKZ C;  1K9M Q;  2M0B A;  2OYH C;  2O3J A;  2O01 N;  3H1J J;  4IOI H;  4KT0 J;  4HKZ H;  3T97 A;  2HLO A;  4NPF X;  1P84 I;  3U59 A;  1R5S A;  4IL6 X;  1X79 B;  1SFC D;  2KB7 P;  2JO1 A;  5BU5 A;  2YIU B;  1S1C X;  3SWY A;  1DD4 A;  1VF5 D;  2W6B A;  2OYH B;  1AVY A;  2QSI A;  1Q7Y Q;  1J1E B;  4Y99 B;  2WSC H;  2PFX A;  1OW7 A;  1ZN5 A;  1HBW A;  2WSC J;  2BEZ F;  2QM8 A;  4LGD E;  4D6T J;  2K1A A;  1URQ B;  2KOG A;  4H44 B;  4DT0 A;  1EC5 A;  3P7K A;  1LTI C;  3PLN A;  1MUU A;  2N1T D;  1BE3 E;  1PPJ G;  3BAS A;  1NTZ G;  1BE3 D;  1S9K E;  5M1B A;  4TLF A;  5E79 H;  2QEX P;  1BSH A;  2YO2 A;  3S9O A;  3VOP A;  3TGU G;  2E43 A;  2AEJ A;  2NZ2 A;  5AVZ B;  5CCH A;  1J2J B;  2K88 A;  1VQN P;  1RF0 C;  3FGA D;  1LP1 A;  2B87 A;  3MP7 B;  2XND H;  2Y9Y A;  4WY4 B;  1NU1 J;  3VMZ A;  3HE4 A;  1AA0 A;  1VQ5 P;  1XTG B;  1YJN P;  2HFE D;  2ZFC A;  2AXT H;  2KUB A;  5KJ7 A;  1SQV G;  5TJH A;  4BRY A;  1LTB C;  1BGY G;  2PP6 A;  1SQB K;  1YIT P;  1SQX K;  1T2K C;  3MZW B;  1SQQ K;  2M5A B;  1K05 A;  4W80 A;  1A02 F;  1X0T A;  1FDI A;  1YJW P;  3IF4 A;  1FU1 A;  2C0X A;  3RK2 D;  1RE3 C;  2E76 D;  1IK9 A;  2IFM A;  3KZI H;  3H1K J;  3L72 G;  1AFO A;  3H1L J;  3KHU A;  3V6I A;  3AE1 C;  2KLV A;  3H1J G;  2JDI H;  2LR2 A;  3AE3 C;  1BCC E;  1QX8 A;  3L73 E;  3HUS A;  3N7N A;  2HOD B;  1BCC D;  1RY3 A;  1M7L A;  1KZU B;  2KI7 B;  3L73 D;  4L76 A;  4JPZ B;  1EQ7 A;  2Y9Z A;  4L75 A;  5KAI E;  2QRX A;  4YPC A;  3L75 J;  4IFM A;  1RF0 A;  3NFQ A;  1FS0 E;  4IL6 E;  2D2C C;  2GUS A;  1LTJ C;  5AVV B;  1S5L X;  3V2N A;  3BCC J;  2WPR A;  4W7Z A;  3CCJ P;  5AW5 B;  5B66 E;  2WT7 A;  1FZB A;  3L71 G;  5TIS E;  3VMX A;  1ZOY C;  1GL2 C;  5CBN A;  1YI2 P;  2D2C B;  3B5N C;  3V4Q A;  4GOE A;  1X9V A;  2FXO A;  5AW9 B;  1NTK J;  3SSU A;  1VL2 A;  3B71 A;  3I55 P;  1RE3 A;  3MHV A;  1NU1 G;  2FXP A;  1L4A B;  3AEF C;  3TNU A;  5KJ7 D;  3CCS P;  3IR9 A;  1JNM A;  2POH A;  4CPG A;  3TF5 A;  1M1K Q;  4HH2 A;  1SQB J;  3B8E B;  1T3U A;  2BCC E;  3A0H H;  2JEE A;  2OTK E;  2E5Y A;  4YXD C;  2V4H A;  1SQQ J;  2BCC D;  2QM7 A;  4U3F E;  4L73 A;  1H88 A;  2I1J A;  3KYQ A;  1FBM A;  1IFN A;  1N86 A;  3CCR P;  1BDC A;  1SFC C;  1QLE D;  2ZT9 D;  2RN0 A;  2WPV B;  1VF5 C;  2P1J A;  3H1K G;  3EFG A;  2NPS B;  1ZXG A;  4W7Y A;  3H1L G;  4RKU J;  2XZR A;  3U1C A;  3KPE A;  3P32 A;  2P10 A;  2B88 A;  1XTC C;  3G9R A;  1LTJ A;  4NPE A;  2N1T C;  1BDD A;  5CMZ A;  4LC1 A;  2IX7 C;  1NTM J;  1GL2 A;  1M1J C;  3M06 A;  3HRN A;  5GTI E;  3UIA A;  2YMY A;  1SVF A;  2W27 A;  3P8M C;  4M3L A;  1VQ4 P;  2E42 A;  3LW5 H;  2C0W A;  1FZC A;  4YXW H;  1M1J B;  3LW5 J;  5AVW B;  3OAK A;  3CCM P;  1W2B O;  3BCC G;  3I5C A;  1YHQ P;  3CXH D;  3MTU E;  3AEE C;  2P7J A;  1U7J A;  3CX5 H;  2KS1 B;  3AEC C;  3GW6 A;  1EZV G;  2WIT A;  2E75 B;  1KYO E;  1L0L E;  1VQP P;  1MV8 A;  1KYO D;  1L0L D;  1S5L E;  1NTK G;  2I1K A;  1SQX E;  1Q86 Q;  2ZVO B;  1KIL A;  3A7O A;  2ZYD A;  1RH5 B;  2IBZ G;  1OFC X;  1SQX D;  2QJP C;  4GOF A;  1HTL C;  3HE5 A;  3RK2 C;  2KXP B;  1HWT C;  2HPC A;  3S4R A;  3CI9 A;  3BVH A;  1SQB G;  1L0N E;  1H0T B;  3SFD C;  1SQQ G;  1L0N D;  3OA7 A;  2ITA A;  2N1T A;  5GTH H;  4I7Z B;  4OGQ B;  2OTJ P;  5APQ A;  1FC2 C;  1DH3 A;  3GHG B;  1KYO I;  3TGU J;  5CBO A;  2GUV A;  2P58 A;  3L74 E;  5H2F E;  2QIW A;  1X22 A;  1EDL A;  4UB8 H;  3WU2 E;  1NJI Q;  3L74 D;  2O01 H;  3T97 B;  1J1D C;  2ZVN B;  2O01 J;  1YJ9 P;  1HUC A;  1IJD B;  1HF9 A;  3USS A;  1LT1 A;  4N3Y B;  5AW0 B;  1BSN A;  4RJT A;  2B9B A;  4QMA A;  1CSB A;  4RES B;  3L37 A;  1PP9 E;  3L70 J;  3AE7 C;  1RE4 A;  1NTM G;  3HD7 D;  4Y28 J;  1PP9 D;  1ZRT E;  1LTS C;  3AE9 C;  3GMA A;  2M3B A;  3Q2Y A;  2WTY A;  3A0B H;  3D6Z A;  3L36 A;  3I56 P;  1R5L A;  5CCH C;  1GMJ A;  1JMM A;  2FFD A;  2A45 I;  5KJ7 C;  1LT9 A;  2WMM A;  5B5E E;  1RHZ B;  3A2A A;  3GF7 A;  3ZDM A;  1NHL A;  3FWL A;  1GU4 A;  1LP1 B;  2B87 B;  1G2C A;  3VTP C;  1KQG B;  1S72 P;  1LGH B;  4ASW A;  1KIL E;  3HE4 B;  3IAO A;  3O8Z A;  1PGO A;  3SWK A;  1DX7 A;  1KIL D;  2W90 A;  1VQO P;  5KKZ B;  4BRY B;  1ZR2 A;  2OAR A;  2XU6 A;  4N6J A;  3TSI A;  2ZT9 C;  4L74 A;  3FXD A;  1M8O B;  1YBK A;  2H89 C;  4JYC A;  3P8C E;  2WVR A;  1PV3 A;  2A06 E;  1Y9B A;  3CLQ A;  3CWB E;  4WWI A;  1SQP K;  3L35 A;  2OYI A;  3P8C D;  2KNC A;  4UB6 H;  1OVR A;  2A06 D;  3AE4 C;  3CWB D;  2ZYA A;  3HUS C;  1T8Z A;  2ZT9 B;  3EWK A;  3Q5S A;  1N8R Q;  2SPZ A;  3L71 J;  2BAS A;  3D6Y A;  1VQL P;  1S9K D;  5KLV K;  3H1H J;  1CI6 B;  4DJG A;  1G1I A;  3K5B A;  1W2E A;  4PJ0 H;  3PP5 A;  4MN4 C;  3HUS B;  1MFZ A;  3Q1M A;  1A02 J;  1LTG C;  3MD0 A;  4PD4 E;  3RGU A;  5KAF H;  5KLI C;  3U1A A;  1OX3 A;  3L70 G;  2C9N Y;  1NKN A;  1SQV E;  1L0L K;  4PD4 D;  2VRS A;  3KDP B;  1NYH A;  1UII A;  1IFI A;  1N7S A;  1CZQ A;  2OYO A;  4PV1 D;  1JB0 J;  2W83 C;  3M0D A;  1QGK B;  2E74 D;  1FAV A;  3FXE A;  2FYU J;  3L4F A;  3G6E P;  2JP3 A;  2XV5 A;  2BCC J;  2J59 M;  1L0N K;  1TU3 F;  4H13 D;  2UWJ E;  3HTK A;  2ZAE B;  3OJA B;  1KB9 H;  2Z4E A;  1AQ5 A;  3H1J E;  4PD4 I;  5AW3 B;  1S4X A;  3E7K A;  2IFN A;  1U7M A;  2Y0C A;  3H1J D;  2R5B A;  3PH0 A;  1PFI A;  3H32 A;  4JQ0 D;  2B89 A;  4C7R A;  1OWA A;  2LKM A;  1M90 Q;  5DJT B;  2KZJ A;  4D6T E;  3L73 G;  4OWF A;  3F5H A;  1NAY A;  2IYP A;  4D6T D;  4WY4 A;  5BU8 B;  2H8P D;  3RK3 E;  2Z5I A;  1KC8 Q;  3RK3 D;  2XNX A;  2YXQ B;  3B4S A;  5E79 E;  4NPD A;  2AEF A;  3CCE P;  1T6A A;  1YQ4 C;  1JUN A;  3JCU H;  4AQR D;  4ZMD A;  4A7P A;  1K04 A;  1JY3 N;  5AVR B;  3H1H G;  3HD7 C;  1JOC A;  5DJU B;  3CXH H;  2YMK A;  2KSE A;  1LTJ B;  3R4Y A;  1AQT A;  2R3S A;  2P67 A;  1D7M A;  1NU1 E;  3RBX A;  4C46 A;  1GL2 B;  3H6P A;  1FZC C;  1JTH A;  3AEB C;  3AE2 C;  1NU1 D;  2AXT E;  3B5N B;  2YO3 A;  2Z5H A;  1IO4 A;  3CC4 P;  1JY3 O;  1LNQ A;  3V5B A;  3O6Q A;  2KIK A;  1GK4 A;  1N7S D;  4H0L C;  1JY2 N;  1SQX J;  1FZC B;  1Q2N A;  1KV4 A;  4Z1M H;  2FYU G;  2OTL P;  1EDI A;  4U3F D;  1KIL C;  2JWA A;  3EQ2 A;  4H0L B;  1URQ D;  1EDK A;  2BCC G;  4H44 D;  3KZI E;  3H1K E;  1NTZ K;  3H1L E;  3H1K D;  2IPP A;  3R2P A;  1LTA C;  2K9Y A;  2PRR A;  1LWU C;  1VQ6 P;  3H1L D;  2PAJ A;  1FE6 A;  3BRV B;  1SFC B;  3SFE C;  1KIL B;  3H1I J;  1OZH A;  3V2P A;  1EXJ A;  4U7J A;  2ZJS E;  1VF5 B;  4XFJ A;  1AJY A;  5L8R J;  5AVQ B;  2HPC B;  1OW8 A;  1SQP E;  1N73 C;  5AW8 B;  3HD7 A;  1EDJ A;  1IFJ A;  2N9B A;  1SQP D;  2YKP A;  1N7L A;  4DCK A;  1IFP A;  3L75 E;  2N1T B;  3M9Q A;  5CCG A;  1S3J A;  4WY4 D;  5KLV E;  4EIJ A;  1SQV K;  1L4A A;  3L75 D;  1P84 H;  1YTZ I;  4KJM A;  5KLV D;  1GTW A;  3BCC E;  3LIE A;  1M57 D;  3BCC D;  1RE4 C;  1W5C E;  1M56 D;  3G3Z A;  2YKO A;  3CPW O;  2L5G B;  1RQU A;  4KHX A;  5CHX A;  1ZW0 A;  3LID A;  2WSF H;  2WSF J;  2N9Y B;  1FZE A;  1ZV8 A;  2QJY C;  3CD6 P;  4PV1 C;  3A3Y B;  1USE A;  1NTK E;  1KD1 Q;  4GIF A;  1Q82 Q;  1JEK A;  1NTK D;  2E74 C;  1VDF A;  2JKV A;  2IBZ E;  2GA1 A;  3RL0 g;  3D70 A;  2NPS A;  3FX0 A;  2E76 C;  2FFD C;  2IBZ D;  1PGQ A;  2QJY B;  5AVU B;  1LT9 C;  2CK3 H;  2ZXX A;  1LWU A;  2KP8 A;  4I6M C;  1SQX G;  3CCQ P;  3A0H E;  4B86 A;  2E74 B;  2Q6Q A;  4ZKU A;  3WUU A;  1JO5 A;  2QJP B;  2IZ0 A;  3RK2 B;  4OH8 B;  2E76 B;  1LJ2 A;  3AE5 C;  5C39 A;  1GK6 A;  1N73 A;  5AW4 B;  5K5G B;  3WUT A;  1EXI A;  1BE3 J;  1FZG A;  5APX A;  2H88 C;  4N78 E;  2Q9I A;  1QEX A;  2IBZ I;  2FY8 A;  1GW3 A;  3QWO C;  2O1K A;  4EOT A;  2QG4 A;  2R5D A;  1OVV A;  4HB1 A;  2CPS A;  3H1I G;  1E79 H;  3PRJ A;  2OYI C;  3C9I A;  2FBW C;  4HYT B;  1KTM A;  1JY3 P;  1X8Y A;  3M0A A;  1NTM E;  1H8A A;  3RK3 C;  1J1D B;  1RQV A;  1NTM D;  1ZRT D;  1NU1 K;  5CCG D;  1FDM A;  3V2R A;  2OYI B;  1PP9 G;  2ZYG A;  2MKV A;  1L4A D;  2KNC B;  1PZQ A;  2ZXE B;  2J58 A;  1HH0 A;  2OQQ A;  3CMA P;  1L2P A;  2WZ7 A;  3CX5 E;  4EDF A;  1YQ3 C;  1H0T A;  2C9L Y;  4K35 A;  1Q81 Q;  4GDO A;  1N7S C;  1GU5 A;  3CX5 D;  3CL3 D;  1YTZ T;  5AVX B;  4C7N A;  1FOS F;  2Q7C A;  3GHG A;  1NWQ A;  3M0D C;  2YIU C;  2Q3E A;  5AW7 B;  1PIX A;  1J1E C;  1T3J A;  5BVZ A;  4Y99 C;  2NPS D;  4AUW A;  4DOJ A;  2K9J A;  3H25 A;  1G1J A;  2Q5U A;  4JF7 A;  1N7S B;  1URQ C;  4H44 C;  1KFN A;  1BCC J;  4GKG A;  2M3E A;  3L73 J;  4K3A A;  3C1L A;  4WBA A;  1MFT A;  5AW2 B;  1PPJ E;  1VQ8 P;  3AE6 C;  1AVO A;  1NTZ E;  1Y47 A;  1GZL A;  1HGV A;  5GTH E;  1WMK A;  3E1R A;  3M91 A;  3CX5 I;  1OW6 A;  1PPJ D;  3OW2 O;  5CJ0 A;  5KAI H;  1NTZ D;  2W6A A;  2NRG A;  1OIP A;  3F89 A;  3G4S P;  2PGD A;  3TGU E;  2LXC B;  3CCU P;  3D71 A;  3HTK B;  2H7H A;  1RF1 A;  4IL6 H;  1SLQ A;  2YNY A;  3TGU D;  2HG5 D;  2A06 G;  2RH0 A;  1BE3 G;  4UB8 E;  3CWB G;  1HJB A;  5APW A;  3EFF K;  1DIP A;  4R4M A;  5B66 H;  1WT6 A;  4WY4 C;  3H32 B;  5TIS H;  1H89 A;  1DEB A;  2G3A A;  2MJZ A;  1DEE G;  3L70 E;  1IFD A;  1YYC A;  2WPS A; 
#chains in the Genus database with same CATH homology
 2ZVO B;  3JSV C;  4BWN A;  4OWF A;  2ZVN B;  3F89 A;  3FX0 A;  2V4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...