3JSVC

Crystal structure of mouse nemo cozi in complex with lys63-linked di-ubiquitin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
QLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the NEMO ubiquitin-binding domain in complex with Lys 63-linked di-ubiquitin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transcription
molecule keywords Ubiquitin
total genus 26
structure length 83
sequence length 83
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 3jsvC00
2V4HA 4OWFA 4BWNA 3JSVC 3FX0A 2ZVOB 3F89A 2ZVNB
chains in the Genus database with same CATH superfamily
3EWKA 3KDPB 1KZUB 2RKLA 4IL6E 3NXSA 1SFCD 2AEJA 2FYUJ 2YXRB 1NTKD 2IFMA 1LTBC 3L71G 4OH8B 4ZNCA 3I56P 1EDLA 4OGQC 3PHLA 1LTTC 3TF5A 2AEFA 4PJ0E 1QL2A 3CCVP 1CI6A 1L0ND 3W67A 2CPSA 3AE1C 2QJYC 2PRRA 3H1JE 3H1JJ 1IFPA 1AA0A 3L74D 3L74J 3P8CD 2P67A 4EDFA 3C8VA 1QLED 1KILB 3CXHH 4K35A 2Q5UA 1VQ7P 3TK1A 3AEAC 3OA7A 3AEBC 3CCUP 1SQXJ 3GHGC 4L75A 3M0AA 1N86A 1IFMA 3CC2P 1X0TA 3H1JG 3AE3C 5APQA 1VPCA 3AEGC 3NMDA 1JY2O 1FU1A 2Q7CA 2KS1A 2NPSB 1QVGO 2WZ7A 4N6JA 5E79E 3H1LG 5KAFH 2XV5A 3H32B 1L0LD 2ZXEB 4H13B 2OTJP 3HUSA 1KQGB 3EFGA 1S1CX 2BEZF 1KFMA 3L70E 4H0LB 4NPDA 3RL0g 1JM0A 5GTHE 3TNUB 2R44A 3TGUD 2HYNA 2ZJSE 1OX3A 3BRVB 2K88A 4EYYQ 1VQOP 3H25A 3L72E 1JOCA 4Y99B 2WSFJ 2XNDH 4L76A 2LXBA 1NTKG 4YPCA 3RBXA 1YITP 1Q81Q 1LNQA 5GTIE 3M9BA 1SQPE 3V2QA 3D70A 1NU1D 2WTYA 1FDIA 1VF5B 2A45H 3B5NC 4ASWA 2C9LY 1W2EA 3GHGA 2WMMA 1HGVA 1EZVG 1EDKA 1R5SA 3AE2C 4WY4A 1RE4A 1JUNA 2YKPA 1YJWP 4QMAA 1OXZA 5DJTB 4EI2A 2Q9IA 3CLQA 1DX7A 3W68A 1H8AA 4C7RA 1AVOA 5B5EH 1NTMG 1L4AB 1OW7A 2FYUG 3L71J 3SWKA 2QG4A 3VP9A 2M5AB 3P8MC 3CCQP 1LTJA 1KORA 2Q3IA 1P84H 3CCSP 2KLUA 1QL1A 1NYHA 3GLMA 4JPZB 3A7OA 3Q5SA 2Z4EA 1FDMA 3H1LD 3D71A 1DH3A 3CCJP 1EZVD 1ZP0C 5CMZA 3PLNA 4L74A 3BVHA 1SFCB 2W8ZA 2AXCA 3IFMA 1JCDA 1SVFA 3CD6P 4CPGA 1PP9G 5M1BA 4PV1B 2KSJA 2R3SA 4HKZH 4DJGA 1P84I 1NTMJ 1SQBG 1AVYA 2L5GB 2FYNC 2G3AA 2J59M 2O3JA 3ITKA 3PH0A 3U1AA 2BASA 3VMYA 1KILD 3T97B 2N1TB 5TISE 1GMJA 3BATA 2E75B 1JY3P 1SP4A 1GTWA 3II6A 1DD3A 4BRYB 3HE4B 3CX5I 1K73Q 1DIPA 2KIKA 1PPJG 1RY3A 5KLIC 2O1KA 2E5TA 1K05A 2WPRA 2D2CB 3Q1MA 2OTKE 4JQ0D 1YQ4C 1T6AA 4MN4C 5AVTB 4WY4D 1K8AQ 2K9YA 3CI9A 1J1DB 3H1IG 4PV1C 2E43A 2FKWB 3A2AA 3JC22 4LC1A 1ZR4A 3F5HA 3HTKA 1Y8AA 3TGUE 3TGUJ 1EC5A 3Q2YA 2KNCA 3WMM0 4C46A 5AW1B 3V5BA 2Q1KA 4U3FE 2GA1A 1FAVA 2E5YA 1VQ8P 1LT9B 1DD4A 1NTZE 2PGDA 3H1HE 3WUUA 1BE3J 1OVVA 4H13C 4AYCA 1JMMA 4GODA 1KYOE 2P2UA 2B87B 1YTZT 1L4AC 3A0HE 1RE3C 2HR3A 1YYCA 1N73B 1X79B 2W90A 1JB0J 1OZHA 1SQBD 3CXHE 1OW6A 4GKGA 1KYOH 2B87A 2IBZG 1H89A 2A06D 3RK3E 4NPEA 1HJ0A 1BCCG 1FDOA 2JWDA 3CCEP 1YBKA 1LWUB 2M8RA 3EQ2A 5AW0B 1URQB 3RL0C 1SQQE 2FXPA 2CK3H 3H1KJ 1HGZA 1KILC 3RGUA 4AUWA 3P8CE 2ZYAA 1HH0A 1KILA 2KOGA 3BCCD 4XA4A 2MKVA 3RK2D 3SFEC 1FZFA 4ZMDA 3IAOA 1ZMEC 1NVOA 1SQBJ 1IFNA 3R2PA 2AXTH 5AVUB 3CCMP 1OWAA 4KT0J 4TT3H 1N7SD 3Q3DA 1FZCB 3CMEP 1U57A 3S9OA 3V4WA 2GUSA 2O01N 2WPSA 1HBWA 2ZT9B 3C1LA 5KLVD 1EXJA 2K37A 1SFCC 2IBZI 1GU4A 1KB9E 1FZAA 3I5CA 1GL2A 1LJ2A 3E7KA 1K9MQ 3VMXA 2QM7A 1NO4A 1U7MA 3GMAA 1VQ9P 1MFTA 3KQGA 1IO4A 2SPZA 1OW8A 1NTZD 3H1HD 1AV1A 1GW3A 1G1JA 1WMKA 1SS1A 3GF7A 3BCCE 3H1IJ 2Q3EA 3OJAB 3R4YA 4KHXA 4U3FG 1JNMA 1FZCC 2IX7C 1SQPK 1IJDB 2W83C 4WWIA 1KMIZ 3VOPA 2OYIA 2IYPA 3WUVA 1SQPD 1M1JB 2W6JH 2A06E 3LIDA 3CX5H 3L72D 1NTZK 4GOFA 4OGQB 1SQVE 3WUTA 1SQVJ 3USSA 1BCCE 1RF1C 1GD2E 1A02J 1PIXA 1QEXA 2P7JA 1YTZI 3CL3D 3H1KE 3S1KA 1SQQJ 2P58A 3L70D 1KQLA 4A7PA 2JP3A 2M5AA 2I1JA 2K9JB 3U59A 1PP9J 1RF0C 1T3JA 4R4LA 3CCRP 1WRGA 4HYTB 3P7KA 5KLVK 1Q7YQ 2OYHC 1VQKP 3KXDA 2OYOA 1EDIA 4H0LC 1S5LE 2HODA 2AEMA 1N7SA 2ZAEB 2W27A 3H1KG 1JY3O 2KXPB 1NKZB 3H1LE 4H44B 4RO0A 4YTPC 1MZ9A 4ASVA 3AEDC 1FZEA 1M56D 2YNYA 5EFWB 4JYCA 1SQXE 2J5UA 3HD7A 3SWFA 1KC8Q 4H13D 2WPQA 1GL2D 1K04A 2FFDA 1URQD 4OVNF 1KB9D 3RK3B 1KD1Q 1LTAC 1NU1G 1XTGB 4K3AA 1L0LK 4AQRD 1S72P 1KILE 3VMAA 4D6TJ 1OMIA 3PRJA 1WT6A 2QJYB 4LGDE 3L36A 1X8YA 1RE4C 3NFQA 1NU1E 2YIUC 4XE5B 1NU1J 4ZKPA 3TGUG 2NZ2A 2FFDC 2O1JA 2OYIC 2QA4P 5BU8B 5KKZB 1BGYG 2YMYA 2B9BA 4IL6X 2LR2A 1FE6A 2ZVOB 3AEEC 1G2CA 4U3FJ 5APXA 5AVRB 3U1CA 2FYNB 2OTLP 1Z56A 2V7QJ 2QVAA 2ZYGA 1A02F 2QSIA 5AW5B 5BU5A 1L0NK 2R32A 1EXIA 1EQ7A 2QEXP 1AJYA 4TLFA 3CC7P 1T2KC 2LKMA 1SQBK 1ZN5A 2OYHA 1HWTC 3RK2C 4U7JA 1LT9A 2IZ1A 3E1RA 3CWBE 1SQQG 4D6TE 2WT7A 1MKMA 1ZW0A 3FGAD 4BWNA 1FBMA 4IL6H 4Y28J 3D6ZA 3GF3A 3M0DA 5APUA 3B8EB 3A0BE 5APVA 3HD7D 3MUDA 5APYA 3AECC 3V4QA 1R8EA 1EDJA 4WY4C 3CX5D 3ZDMA 1URQC 1JTHA 3AE8C 1URQA 2FYUK 2KB7P 2XZRA 1USEA 3PTZA 1PL5A 2R5BA 4XFJA 5CCHA 1JO5A 3H6PA 5AVWB 1NOHA 2AXTE 2KYVA 1LTGC 2LXCB 3L73G 2KLVA 2K3RA 3QH9A 2KP8A 5KAIE 1NWQA 3RK3C 1PGJA 3SSUA 3V2PA 2ZXXA 1PPJE 1Q82Q 2I8DA 5AW4B 1GK6A 1RHZB 1BGYD 1MFZA 1YHQP 1CW5A 4N3YB 4H44D 3ABVC 4IOIH 4I7ZC 1LT9C 3G9RA 1SQVK 3M9HA 1KFNA 2OARA 3NTNA 3H1IE 4RJTA 1EZVI 2QE7H 3HUSC 1CZQA 2E74B 2PFXA 1T8ZA 3FWLA 4IFDK 4I7ZB 5AVVB 3S4RA 3TNUA 1S2EA 1UIIA 5CBOA 4I1LA 1G1IA 2N9BA 3RK3D 4HJGH 5KLVJ 3G6EP 1BGYJ 1W5CE 3A0BH 1VF5D 3L75G 1QGKB 2DW3A 1RH5B 1DEEG 4PD4E 4Z1MH 3CPWO 3EFFK 3KZIH 2BCCD 3VTPC 3N4XA 3L4FA 2JKVA 1SQVG 2D2CC 5CCGA 1PP9E 1RF1B 2WQYC 3GHGB 2Y0CA 3L75E 2BEQD 2R3CA 3B5ND 2NRGA 1FC2C 3BCCJ 2OYIB 4IFMA 3JCUH 1HVVA 1SQBE 2YIUB 3A3YB 1X22A 2KI7B 3MP7B 1Y9BA 1SLQA 2E75C 3H1KD 1E5WA 1MV8A 1Q90D 1S4XA 2JWAA 1N8RQ 3GG2A 4GDOA 2H8PD 1YIJP 1FJPA 2Z5HA 1RE3A 1L4AA 4JBZA 3L70G 4UB8H 2PP6A 4HB1A 5CCHD 1LTJB 2WVRA 2K1AA 2KS1B 2NPSA 2WSFH 4M3LA 5AVYB 3VYIA 1S9KE 3L37A 2K9JA 1M90Q 3MIWA 2KSEA 1Y47A 3RK2B 3IR9A 3SWYA 1NU1K 5TJHA 3G3ZA 2J58A 5AW6B 3AEFC 2IBZD 3F89A 1PFIA 2FY8A 5APSA 4DZOA 2FYUE 2QJPB 2XNXA 2C0WA 2IPPA 2JEEA 3HE5B 1LGHB 3L75D 1KQSO 1JY2P 3IN6A 4UB6E 5B66H 1RF0A 1J1EB 1HUCA 1RQVA 2RN0A 2QJKC 2WSEH 2ZT9C 4IFFA 1EZVE 3D6YA 1VL2A 3L74E 3L70J 5KKZC 1KV4A 4OWFA 5BVZA 1JY3N 1H88A 3TYYA 3VN0A 3B4SA 2YMKA 3L73J 1S9KD 3E1IA 2ZFCA 3OAKA 3HE4A 3O6QA 1NTKK 2RMZA 5AW3B 5TISH 4GT1A 1R5LA 3CXHI 2VRSA 5AW7B 3M9QA 3RL0B 2MJZA 1LWUC 5CCGD 3L73D 1UIXA 1M1JC 2ZT9D 3AE9C 3B5NA 3H32A 5CBNA 1GDTA 1USDA 4Y99C 3HRNA 3JCUE 3M0DC 1P84D 4HH2A 2FYZA 1FZBA 1OIPA 4I6MC 1FS0E 2Y0DA 3Q5RA 5AVXB 2E76C 2E74D 1N73C 3M91A 4OGQD 1LP1B 2A45I 1L4AD 1FZGA 2KNCB 2QM8A 1FOSE 4D6TG 1GL2C 1YJ9P 2CPBA 4I2LC 2NPSD 3FXDA 3MZWB 1IFIA 1NTKE 2O01H 1SQQK 2P10A 2XU6A 4PD4H 3RBZA 2OYHB 1IFDA 3AE5C 1VQLP 1BE3E 2JJLA 1VQMP 1JY2N 2YO3A 2BCCG 2ITAA 3BASA 1N73A 1BSHA 3B71A 3IF4A 2WT7B 2KK7A 4EOTA 3TSIA 2A45G 2R5DA 4PV1D 3VP8A 1SQXK 1KYOD 5AVSB 2HG5D 1AQTA 1KYOI 1LWUA 2N1TA 2JR8A 1NTME 3L71E 1VQPP 3V2RA 3BRTB 1QVFO 2M0BA 4KJMA 5K5GB 3KZIE 3P32A 3UIAA 4D6TD 4L73A 5GTIH 2E75D 2IYOA 3O8ZA 4JYBA 1J2JB 1ZOYC 1H0TA 1VDFA 2HPCA 3CMAP 2BCCJ 2G8YA 4H0LD 3FX0A 2D2CD 1PP9D 4C7NB 1IZNB 1IC2A 3GW6A 1S5LH 1YI2P 1Q2NA 1BGYE 1PGOA 4UB8E 2QJPC 3AE6C 4UB6H 5B66E 1DEBA 1NJIQ 3WU2H 3KPEA 1GL2B 4PD4I 2E74C 2N9YB 5AW9B 1PGPA 1AFOA 4PD4D 2H88C 2JO1A 1JMBA 2YKOA 4WB4A 2WITA 5E79H 4RESB 5KAFE 1L0LE 5KJ7D 2E42A 1MUUA 2OGUA 3CX5E 5APWA 1SQQD 1ZXGA 2ZVNB 2YXQB 1L0LG 1T2KD 2C9NY 1CI6B 3CC4P 3RL0D 1RF1A 2E76D 3L73E 3CCLP 1Q86Q 4DOJA 3L72J 1JCCA 2GUVA 5KTBA 5KLIB 3L35A 3MGNA 1LTSC 1M8OB 3AE4C 4PJ0H 3H1JD 4ZKUA 1L0NJ 1XTCC 5APTA 1L0NE 2N1TD 2WSCJ 1W2BO 5CCGC 1GU5A 2QRXA 2QIWA 1IFJA 1OVUA 2N1TC 2YO2A 1IK7A 1LT1A 2ZYDA 1N7LA 3TDKA 1S3JA 3K5BA 3WU2E 3A5TA 1FZCA 1NTKJ 1NTMD 2C0XA 2QJKB 1TU3F 2XKMA 2P1JA 1D7MA 2W6BA 1L0NG 1NTZJ 2H89C 3H1HJ 4WBAA 1BDDA 3G71P 1OVRA 1ZRTE 2WPVB 2HODB 3BCCG 1NTMK 3HUSB 3Q5PA 2JDIH 3A0HH 2Y0EA 3LW5J 5AW2B 2O01J 2IBZE 2KZIA 2UWJE 3HE5A 3SFDC 1X9VA 5CJ4A 1YJNP 1J1DC 2A06G 1KN7A 1LTJC 3PP5A 1GK4A 2RH0A 2Y9ZA 2IFNA 3VMZA 3V2NA 2V4HA 4DT0A 5KJ7A 2M3EA 4RKUJ 5H2FH 1GZLA 2XDJA 1BE3G 2WSCH 3CWBD 5KAIH 2W6AA 1M1JA 5CCHC 4WY4B 4GIFA 2BCCE 1VQ4P 4W80A 3O6QB 2H43A 1VQNP 5AW8B 1M7LA 2POHA 4B86A 2H7HA 3MUDC 2L91A 5KLVE 3C9IA 1U7JA 3B5NB 4W7ZA 1CSBA 1BCCJ 1GW4A 2HFED 3M06A 3V6IA 1G2CB 1HF9A 1OFCX 2IDBA 3AE7C 3H1ID 2WSEJ 1KTMA 2WWWA 5CJ0A 1N2DC 4YXWH 1KB9I 5DJUB 1ZLLA 5KLVG 1SQXG 5B5EE 3L75J 1LP1A 3L72G 2M3BA 1HTLC 3LIEA 1NAYA 1BSNA 1N7SB 1PPJD 1SFCA 2WSSH 3L74G 3MHVA 3PJSK 1PZQA 1SQPG 2FXOA 3H1LJ 2Z5IA 1PV3A 4O9BA 1L0LJ 4LLHA 1VQ5P 2IZ0A 4YXDC 3N7NA 1T3UA 3HD7B 1LTIC 1NHLA 2E76B 2FXMA 1KB9H 2FBWC 4U3FD 3L71D 1PGQA 1ZRTD 3KHUA 4N78E 5AVQB 1ZR2A 1NTZG 2NPSC 3H1HG 3T97A 4W7YA 1BCCD 1HJBA 2FFDB 1SQVD 1SQXD 2YKQA 1S5LX 3JSVC 3QWOC 1ZV8A 4WVZA 4NPFX 1JTHB 4BRYA 1NAFA 2KZJA 3CXHD 1JEKA 1NH4A 1VF5C 2Q6QA 5H2FE 5KJ7C 2PAJA 1SQPJ 1KQFB 2KUBA 5CHXA 3FWNA 3I55P 5L8RJ 4JF7A 4R4MA 1NKNA 3CWBJ 5C39A 2B88A 4DCKA 3OW2O 3FXEA 1QX8A 1H0TB 1FOSF 1NGMB 5AVZB 2HPCB 1VQ6P 4GOEA 2FYUD 3MD0A 1E79H 1IK9A 3HD7C 4C7NA 1YQ3C 3HTKB 1AQ5A 1BE3D 3CWBG 1FJKA 1J1EC 3MTUE 4H44C 2GM4A 4N78D 2B89A 2I1KA 3LW5H 1P84E 4BXLA 1RQUA 3KYQA 1M1KQ 1N7SC 4EIJA 1M57D 2HLOA 2Y9YA 2V7QH 1BDCA 2OQQA 3G4SP 1L2PA 5GTHH
chains in the Genus database with same CATH topology
2V4HA 4OWFA 4BWNA 3JSVC 3FX0A 2ZVOB 3F89A 2ZVNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V4H A;  4OWF A;  4BWN A;  3JSV C;  3FX0 A;  2ZVO B;  3F89 A;  2ZVN B; 
#chains in the Genus database with same CATH topology
 3EWK A;  3KDP B;  1KZU B;  2RKL A;  4IL6 E;  3NXS A;  1SFC D;  2AEJ A;  2FYU J;  2YXR B;  1NTK D;  2IFM A;  1LTB C;  3L71 G;  4OH8 B;  4ZNC A;  3I56 P;  1EDL A;  4OGQ C;  3PHL A;  1LTT C;  3TF5 A;  2AEF A;  4PJ0 E;  1QL2 A;  3CCV P;  1CI6 A;  1L0N D;  3W67 A;  2CPS A;  3AE1 C;  2QJY C;  2PRR A;  3H1J E;  3H1J J;  1IFP A;  1AA0 A;  3L74 D;  3L74 J;  3P8C D;  2P67 A;  4EDF A;  3C8V A;  1QLE D;  1KIL B;  3CXH H;  4K35 A;  2Q5U A;  1VQ7 P;  3TK1 A;  3AEA C;  3OA7 A;  3AEB C;  3CCU P;  1SQX J;  3GHG C;  4L75 A;  3M0A A;  1N86 A;  1IFM A;  3CC2 P;  1X0T A;  3H1J G;  3AE3 C;  5APQ A;  1VPC A;  3AEG C;  3NMD A;  1JY2 O;  1FU1 A;  2Q7C A;  2KS1 A;  2NPS B;  1QVG O;  2WZ7 A;  4N6J A;  5E79 E;  3H1L G;  5KAF H;  2XV5 A;  3H32 B;  1L0L D;  2ZXE B;  4H13 B;  2OTJ P;  3HUS A;  1KQG B;  3EFG A;  1S1C X;  2BEZ F;  1KFM A;  3L70 E;  4H0L B;  4NPD A;  3RL0 g;  1JM0 A;  5GTH E;  3TNU B;  2R44 A;  3TGU D;  2HYN A;  2ZJS E;  1OX3 A;  3BRV B;  2K88 A;  4EYY Q;  1VQO P;  3H25 A;  3L72 E;  1JOC A;  4Y99 B;  2WSF J;  2XND H;  4L76 A;  2LXB A;  1NTK G;  4YPC A;  3RBX A;  1YIT P;  1Q81 Q;  1LNQ A;  5GTI E;  3M9B A;  1SQP E;  3V2Q A;  3D70 A;  1NU1 D;  2WTY A;  1FDI A;  1VF5 B;  2A45 H;  3B5N C;  4ASW A;  2C9L Y;  1W2E A;  3GHG A;  2WMM A;  1HGV A;  1EZV G;  1EDK A;  1R5S A;  3AE2 C;  4WY4 A;  1RE4 A;  1JUN A;  2YKP A;  1YJW P;  4QMA A;  1OXZ A;  5DJT B;  4EI2 A;  2Q9I A;  3CLQ A;  1DX7 A;  3W68 A;  1H8A A;  4C7R A;  1AVO A;  5B5E H;  1NTM G;  1L4A B;  1OW7 A;  2FYU G;  3L71 J;  3SWK A;  2QG4 A;  3VP9 A;  2M5A B;  3P8M C;  3CCQ P;  1LTJ A;  1KOR A;  2Q3I A;  1P84 H;  3CCS P;  2KLU A;  1QL1 A;  1NYH A;  3GLM A;  4JPZ B;  3A7O A;  3Q5S A;  2Z4E A;  1FDM A;  3H1L D;  3D71 A;  1DH3 A;  3CCJ P;  1EZV D;  1ZP0 C;  5CMZ A;  3PLN A;  4L74 A;  3BVH A;  1SFC B;  2W8Z A;  2AXC A;  3IFM A;  1JCD A;  1SVF A;  3CD6 P;  4CPG A;  1PP9 G;  5M1B A;  4PV1 B;  2KSJ A;  2R3S A;  4HKZ H;  4DJG A;  1P84 I;  1NTM J;  1SQB G;  1AVY A;  2L5G B;  2FYN C;  2G3A A;  2J59 M;  2O3J A;  3ITK A;  3PH0 A;  3U1A A;  2BAS A;  3VMY A;  1KIL D;  3T97 B;  2N1T B;  5TIS E;  1GMJ A;  3BAT A;  2E75 B;  1JY3 P;  1SP4 A;  1GTW A;  3II6 A;  1DD3 A;  4BRY B;  3HE4 B;  3CX5 I;  1K73 Q;  1DIP A;  2KIK A;  1PPJ G;  1RY3 A;  5KLI C;  2O1K A;  2E5T A;  1K05 A;  2WPR A;  2D2C B;  3Q1M A;  2OTK E;  4JQ0 D;  1YQ4 C;  1T6A A;  4MN4 C;  5AVT B;  4WY4 D;  1K8A Q;  2K9Y A;  3CI9 A;  1J1D B;  3H1I G;  4PV1 C;  2E43 A;  2FKW B;  3A2A A;  3JC2 2;  4LC1 A;  1ZR4 A;  3F5H A;  3HTK A;  1Y8A A;  3TGU E;  3TGU J;  1EC5 A;  3Q2Y A;  2KNC A;  3WMM 0;  4C46 A;  5AW1 B;  3V5B A;  2Q1K A;  4U3F E;  2GA1 A;  1FAV A;  2E5Y A;  1VQ8 P;  1LT9 B;  1DD4 A;  1NTZ E;  2PGD A;  3H1H E;  3WUU A;  1BE3 J;  1OVV A;  4H13 C;  4AYC A;  1JMM A;  4GOD A;  1KYO E;  2P2U A;  2B87 B;  1YTZ T;  1L4A C;  3A0H E;  1RE3 C;  2HR3 A;  1YYC A;  1N73 B;  1X79 B;  2W90 A;  1JB0 J;  1OZH A;  1SQB D;  3CXH E;  1OW6 A;  4GKG A;  1KYO H;  2B87 A;  2IBZ G;  1H89 A;  2A06 D;  3RK3 E;  4NPE A;  1HJ0 A;  1BCC G;  1FDO A;  2JWD A;  3CCE P;  1YBK A;  1LWU B;  2M8R A;  3EQ2 A;  5AW0 B;  1URQ B;  3RL0 C;  1SQQ E;  2FXP A;  2CK3 H;  3H1K J;  1HGZ A;  1KIL C;  3RGU A;  4AUW A;  3P8C E;  2ZYA A;  1HH0 A;  1KIL A;  2KOG A;  3BCC D;  4XA4 A;  2MKV A;  3RK2 D;  3SFE C;  1FZF A;  4ZMD A;  3IAO A;  1ZME C;  1NVO A;  1SQB J;  1IFN A;  3R2P A;  2AXT H;  5AVU B;  3CCM P;  1OWA A;  4KT0 J;  4TT3 H;  1N7S D;  3Q3D A;  1FZC B;  3CME P;  1U57 A;  3S9O A;  3V4W A;  2GUS A;  2O01 N;  2WPS A;  1HBW A;  2ZT9 B;  3C1L A;  5KLV D;  1EXJ A;  2K37 A;  1SFC C;  2IBZ I;  1GU4 A;  1KB9 E;  1FZA A;  3I5C A;  1GL2 A;  1LJ2 A;  3E7K A;  1K9M Q;  3VMX A;  2QM7 A;  1NO4 A;  1U7M A;  3GMA A;  1VQ9 P;  1MFT A;  3KQG A;  1IO4 A;  2SPZ A;  1OW8 A;  1NTZ D;  3H1H D;  1AV1 A;  1GW3 A;  1G1J A;  1WMK A;  1SS1 A;  3GF7 A;  3BCC E;  3H1I J;  2Q3E A;  3OJA B;  3R4Y A;  4KHX A;  4U3F G;  1JNM A;  1FZC C;  2IX7 C;  1SQP K;  1IJD B;  2W83 C;  4WWI A;  1KMI Z;  3VOP A;  2OYI A;  2IYP A;  3WUV A;  1SQP D;  1M1J B;  2W6J H;  2A06 E;  3LID A;  3CX5 H;  3L72 D;  1NTZ K;  4GOF A;  4OGQ B;  1SQV E;  3WUT A;  1SQV J;  3USS A;  1BCC E;  1RF1 C;  1GD2 E;  1A02 J;  1PIX A;  1QEX A;  2P7J A;  1YTZ I;  3CL3 D;  3H1K E;  3S1K A;  1SQQ J;  2P58 A;  3L70 D;  1KQL A;  4A7P A;  2JP3 A;  2M5A A;  2I1J A;  2K9J B;  3U59 A;  1PP9 J;  1RF0 C;  1T3J A;  4R4L A;  3CCR P;  1WRG A;  4HYT B;  3P7K A;  5KLV K;  1Q7Y Q;  2OYH C;  1VQK P;  3KXD A;  2OYO A;  1EDI A;  4H0L C;  1S5L E;  2HOD A;  2AEM A;  1N7S A;  2ZAE B;  2W27 A;  3H1K G;  1JY3 O;  2KXP B;  1NKZ B;  3H1L E;  4H44 B;  4RO0 A;  4YTP C;  1MZ9 A;  4ASV A;  3AED C;  1FZE A;  1M56 D;  2YNY A;  5EFW B;  4JYC A;  1SQX E;  2J5U A;  3HD7 A;  3SWF A;  1KC8 Q;  4H13 D;  2WPQ A;  1GL2 D;  1K04 A;  2FFD A;  1URQ D;  4OVN F;  1KB9 D;  3RK3 B;  1KD1 Q;  1LTA C;  1NU1 G;  1XTG B;  4K3A A;  1L0L K;  4AQR D;  1S72 P;  1KIL E;  3VMA A;  4D6T J;  1OMI A;  3PRJ A;  1WT6 A;  2QJY B;  4LGD E;  3L36 A;  1X8Y A;  1RE4 C;  3NFQ A;  1NU1 E;  2YIU C;  4XE5 B;  1NU1 J;  4ZKP A;  3TGU G;  2NZ2 A;  2FFD C;  2O1J A;  2OYI C;  2QA4 P;  5BU8 B;  5KKZ B;  1BGY G;  2YMY A;  2B9B A;  4IL6 X;  2LR2 A;  1FE6 A;  2ZVO B;  3AEE C;  1G2C A;  4U3F J;  5APX A;  5AVR B;  3U1C A;  2FYN B;  2OTL P;  1Z56 A;  2V7Q J;  2QVA A;  2ZYG A;  1A02 F;  2QSI A;  5AW5 B;  5BU5 A;  1L0N K;  2R32 A;  1EXI A;  1EQ7 A;  2QEX P;  1AJY A;  4TLF A;  3CC7 P;  1T2K C;  2LKM A;  1SQB K;  1ZN5 A;  2OYH A;  1HWT C;  3RK2 C;  4U7J A;  1LT9 A;  2IZ1 A;  3E1R A;  3CWB E;  1SQQ G;  4D6T E;  2WT7 A;  1MKM A;  1ZW0 A;  3FGA D;  4BWN A;  1FBM A;  4IL6 H;  4Y28 J;  3D6Z A;  3GF3 A;  3M0D A;  5APU A;  3B8E B;  3A0B E;  5APV A;  3HD7 D;  3MUD A;  5APY A;  3AEC C;  3V4Q A;  1R8E A;  1EDJ A;  4WY4 C;  3CX5 D;  3ZDM A;  1URQ C;  1JTH A;  3AE8 C;  1URQ A;  2FYU K;  2KB7 P;  2XZR A;  1USE A;  3PTZ A;  1PL5 A;  2R5B A;  4XFJ A;  5CCH A;  1JO5 A;  3H6P A;  5AVW B;  1NOH A;  2AXT E;  2KYV A;  1LTG C;  2LXC B;  3L73 G;  2KLV A;  2K3R A;  3QH9 A;  2KP8 A;  5KAI E;  1NWQ A;  3RK3 C;  1PGJ A;  3SSU A;  3V2P A;  2ZXX A;  1PPJ E;  1Q82 Q;  2I8D A;  5AW4 B;  1GK6 A;  1RHZ B;  1BGY D;  1MFZ A;  1YHQ P;  1CW5 A;  4N3Y B;  4H44 D;  3ABV C;  4IOI H;  4I7Z C;  1LT9 C;  3G9R A;  1SQV K;  3M9H A;  1KFN A;  2OAR A;  3NTN A;  3H1I E;  4RJT A;  1EZV I;  2QE7 H;  3HUS C;  1CZQ A;  2E74 B;  2PFX A;  1T8Z A;  3FWL A;  4IFD K;  4I7Z B;  5AVV B;  3S4R A;  3TNU A;  1S2E A;  1UII A;  5CBO A;  4I1L A;  1G1I A;  2N9B A;  3RK3 D;  4HJG H;  5KLV J;  3G6E P;  1BGY J;  1W5C E;  3A0B H;  1VF5 D;  3L75 G;  1QGK B;  2DW3 A;  1RH5 B;  1DEE G;  4PD4 E;  4Z1M H;  3CPW O;  3EFF K;  3KZI H;  2BCC D;  3VTP C;  3N4X A;  3L4F A;  2JKV A;  1SQV G;  2D2C C;  5CCG A;  1PP9 E;  1RF1 B;  2WQY C;  3GHG B;  2Y0C A;  3L75 E;  2BEQ D;  2R3C A;  3B5N D;  2NRG A;  1FC2 C;  3BCC J;  2OYI B;  4IFM A;  3JCU H;  1HVV A;  1SQB E;  2YIU B;  3A3Y B;  1X22 A;  2KI7 B;  3MP7 B;  1Y9B A;  1SLQ A;  2E75 C;  3H1K D;  1E5W A;  1MV8 A;  1Q90 D;  1S4X A;  2JWA A;  1N8R Q;  3GG2 A;  4GDO A;  2H8P D;  1YIJ P;  1FJP A;  2Z5H A;  1RE3 A;  1L4A A;  4JBZ A;  3L70 G;  4UB8 H;  2PP6 A;  4HB1 A;  5CCH D;  1LTJ B;  2WVR A;  2K1A A;  2KS1 B;  2NPS A;  2WSF H;  4M3L A;  5AVY B;  3VYI A;  1S9K E;  3L37 A;  2K9J A;  1M90 Q;  3MIW A;  2KSE A;  1Y47 A;  3RK2 B;  3IR9 A;  3SWY A;  1NU1 K;  5TJH A;  3G3Z A;  2J58 A;  5AW6 B;  3AEF C;  2IBZ D;  3F89 A;  1PFI A;  2FY8 A;  5APS A;  4DZO A;  2FYU E;  2QJP B;  2XNX A;  2C0W A;  2IPP A;  2JEE A;  3HE5 B;  1LGH B;  3L75 D;  1KQS O;  1JY2 P;  3IN6 A;  4UB6 E;  5B66 H;  1RF0 A;  1J1E B;  1HUC A;  1RQV A;  2RN0 A;  2QJK C;  2WSE H;  2ZT9 C;  4IFF A;  1EZV E;  3D6Y A;  1VL2 A;  3L74 E;  3L70 J;  5KKZ C;  1KV4 A;  4OWF A;  5BVZ A;  1JY3 N;  1H88 A;  3TYY A;  3VN0 A;  3B4S A;  2YMK A;  3L73 J;  1S9K D;  3E1I A;  2ZFC A;  3OAK A;  3HE4 A;  3O6Q A;  1NTK K;  2RMZ A;  5AW3 B;  5TIS H;  4GT1 A;  1R5L A;  3CXH I;  2VRS A;  5AW7 B;  3M9Q A;  3RL0 B;  2MJZ A;  1LWU C;  5CCG D;  3L73 D;  1UIX A;  1M1J C;  2ZT9 D;  3AE9 C;  3B5N A;  3H32 A;  5CBN A;  1GDT A;  1USD A;  4Y99 C;  3HRN A;  3JCU E;  3M0D C;  1P84 D;  4HH2 A;  2FYZ A;  1FZB A;  1OIP A;  4I6M C;  1FS0 E;  2Y0D A;  3Q5R A;  5AVX B;  2E76 C;  2E74 D;  1N73 C;  3M91 A;  4OGQ D;  1LP1 B;  2A45 I;  1L4A D;  1FZG A;  2KNC B;  2QM8 A;  1FOS E;  4D6T G;  1GL2 C;  1YJ9 P;  2CPB A;  4I2L C;  2NPS D;  3FXD A;  3MZW B;  1IFI A;  1NTK E;  2O01 H;  1SQQ K;  2P10 A;  2XU6 A;  4PD4 H;  3RBZ A;  2OYH B;  1IFD A;  3AE5 C;  1VQL P;  1BE3 E;  2JJL A;  1VQM P;  1JY2 N;  2YO3 A;  2BCC G;  2ITA A;  3BAS A;  1N73 A;  1BSH A;  3B71 A;  3IF4 A;  2WT7 B;  2KK7 A;  4EOT A;  3TSI A;  2A45 G;  2R5D A;  4PV1 D;  3VP8 A;  1SQX K;  1KYO D;  5AVS B;  2HG5 D;  1AQT A;  1KYO I;  1LWU A;  2N1T A;  2JR8 A;  1NTM E;  3L71 E;  1VQP P;  3V2R A;  3BRT B;  1QVF O;  2M0B A;  4KJM A;  5K5G B;  3KZI E;  3P32 A;  3UIA A;  4D6T D;  4L73 A;  5GTI H;  2E75 D;  2IYO A;  3O8Z A;  4JYB A;  1J2J B;  1ZOY C;  1H0T A;  1VDF A;  2HPC A;  3CMA P;  2BCC J;  2G8Y A;  4H0L D;  3FX0 A;  2D2C D;  1PP9 D;  4C7N B;  1IZN B;  1IC2 A;  3GW6 A;  1S5L H;  1YI2 P;  1Q2N A;  1BGY E;  1PGO A;  4UB8 E;  2QJP C;  3AE6 C;  4UB6 H;  5B66 E;  1DEB A;  1NJI Q;  3WU2 H;  3KPE A;  1GL2 B;  4PD4 I;  2E74 C;  2N9Y B;  5AW9 B;  1PGP A;  1AFO A;  4PD4 D;  2H88 C;  2JO1 A;  1JMB A;  2YKO A;  4WB4 A;  2WIT A;  5E79 H;  4RES B;  5KAF E;  1L0L E;  5KJ7 D;  2E42 A;  1MUU A;  2OGU A;  3CX5 E;  5APW A;  1SQQ D;  1ZXG A;  2ZVN B;  2YXQ B;  1L0L G;  1T2K D;  2C9N Y;  1CI6 B;  3CC4 P;  3RL0 D;  1RF1 A;  2E76 D;  3L73 E;  3CCL P;  1Q86 Q;  4DOJ A;  3L72 J;  1JCC A;  2GUV A;  5KTB A;  5KLI B;  3L35 A;  3MGN A;  1LTS C;  1M8O B;  3AE4 C;  4PJ0 H;  3H1J D;  4ZKU A;  1L0N J;  1XTC C;  5APT A;  1L0N E;  2N1T D;  2WSC J;  1W2B O;  5CCG C;  1GU5 A;  2QRX A;  2QIW A;  1IFJ A;  1OVU A;  2N1T C;  2YO2 A;  1IK7 A;  1LT1 A;  2ZYD A;  1N7L A;  3TDK A;  1S3J A;  3K5B A;  3WU2 E;  3A5T A;  1FZC A;  1NTK J;  1NTM D;  2C0X A;  2QJK B;  1TU3 F;  2XKM A;  2P1J A;  1D7M A;  2W6B A;  1L0N G;  1NTZ J;  2H89 C;  3H1H J;  4WBA A;  1BDD A;  3G71 P;  1OVR A;  1ZRT E;  2WPV B;  2HOD B;  3BCC G;  1NTM K;  3HUS B;  3Q5P A;  2JDI H;  3A0H H;  2Y0E A;  3LW5 J;  5AW2 B;  2O01 J;  2IBZ E;  2KZI A;  2UWJ E;  3HE5 A;  3SFD C;  1X9V A;  5CJ4 A;  1YJN P;  1J1D C;  2A06 G;  1KN7 A;  1LTJ C;  3PP5 A;  1GK4 A;  2RH0 A;  2Y9Z A;  2IFN A;  3VMZ A;  3V2N A;  2V4H A;  4DT0 A;  5KJ7 A;  2M3E A;  4RKU J;  5H2F H;  1GZL A;  2XDJ A;  1BE3 G;  2WSC H;  3CWB D;  5KAI H;  2W6A A;  1M1J A;  5CCH C;  4WY4 B;  4GIF A;  2BCC E;  1VQ4 P;  4W80 A;  3O6Q B;  2H43 A;  1VQN P;  5AW8 B;  1M7L A;  2POH A;  4B86 A;  2H7H A;  3MUD C;  2L91 A;  5KLV E;  3C9I A;  1U7J A;  3B5N B;  4W7Z A;  1CSB A;  1BCC J;  1GW4 A;  2HFE D;  3M06 A;  3V6I A;  1G2C B;  1HF9 A;  1OFC X;  2IDB A;  3AE7 C;  3H1I D;  2WSE J;  1KTM A;  2WWW A;  5CJ0 A;  1N2D C;  4YXW H;  1KB9 I;  5DJU B;  1ZLL A;  5KLV G;  1SQX G;  5B5E E;  3L75 J;  1LP1 A;  3L72 G;  2M3B A;  1HTL C;  3LIE A;  1NAY A;  1BSN A;  1N7S B;  1PPJ D;  1SFC A;  2WSS H;  3L74 G;  3MHV A;  3PJS K;  1PZQ A;  1SQP G;  2FXO A;  3H1L J;  2Z5I A;  1PV3 A;  4O9B A;  1L0L J;  4LLH A;  1VQ5 P;  2IZ0 A;  4YXD C;  3N7N A;  1T3U A;  3HD7 B;  1LTI C;  1NHL A;  2E76 B;  2FXM A;  1KB9 H;  2FBW C;  4U3F D;  3L71 D;  1PGQ A;  1ZRT D;  3KHU A;  4N78 E;  5AVQ B;  1ZR2 A;  1NTZ G;  2NPS C;  3H1H G;  3T97 A;  4W7Y A;  1BCC D;  1HJB A;  2FFD B;  1SQV D;  1SQX D;  2YKQ A;  1S5L X;  3JSV C;  3QWO C;  1ZV8 A;  4WVZ A;  4NPF X;  1JTH B;  4BRY A;  1NAF A;  2KZJ A;  3CXH D;  1JEK A;  1NH4 A;  1VF5 C;  2Q6Q A;  5H2F E;  5KJ7 C;  2PAJ A;  1SQP J;  1KQF B;  2KUB A;  5CHX A;  3FWN A;  3I55 P;  5L8R J;  4JF7 A;  4R4M A;  1NKN A;  3CWB J;  5C39 A;  2B88 A;  4DCK A;  3OW2 O;  3FXE A;  1QX8 A;  1H0T B;  1FOS F;  1NGM B;  5AVZ B;  2HPC B;  1VQ6 P;  4GOE A;  2FYU D;  3MD0 A;  1E79 H;  1IK9 A;  3HD7 C;  4C7N A;  1YQ3 C;  3HTK B;  1AQ5 A;  1BE3 D;  3CWB G;  1FJK A;  1J1E C;  3MTU E;  4H44 C;  2GM4 A;  4N78 D;  2B89 A;  2I1K A;  3LW5 H;  1P84 E;  4BXL A;  1RQU A;  3KYQ A;  1M1K Q;  1N7S C;  4EIJ A;  1M57 D;  2HLO A;  2Y9Y A;  2V7Q H;  1BDC A;  2OQQ A;  3G4S P;  1L2P A;  5GTH H; 
#chains in the Genus database with same CATH homology
 2V4H A;  4OWF A;  4BWN A;  3JSV C;  3FX0 A;  2ZVO B;  3F89 A;  2ZVN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...