3JSVC

Crystal structure of mouse nemo cozi in complex with lys63-linked di-ubiquitin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
QLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/transcription
molecule keywords Ubiquitin
publication title Crystal structure of the NEMO ubiquitin-binding domain in complex with Lys 63-linked di-ubiquitin
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 83
sequence length 83
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 3jsvC00
3FX0A 3F89A 3JSVC 4BWNA 2ZVOB 4OWFA 2V4HA 2ZVNB
chains in the Genus database with same CATH superfamily
3WU2H 3H6PA 3U59A 1VDFA 1FDOA 3H1KG 1GW4A 1VF5B 3U1CA 1SQVD 3IFMA 4IFFA 4PD4D 2YMYA 1S5LH 1DEEG 5AVRB 1ZW0A 1KQLA 3H1JJ 1BDCA 3MD0A 2ZT9C 3Q3DA 3HUSB 1LTAC 2JR8A 4H13D 1RHZB 2WWWA 1M56D 5APYA 1CSBA 4GKGA 5APXA 3CCRP 2P58A 3Q5RA 1FBMA 1WRGA 1W5CE 2NPSC 1CW5A 3HE5A 4PV1B 2FY8A 1QL1A 4C7RA 1NO4A 2IZ0A 5AVUB 1VQNP 2R44A 1FZFA 5KAFE 3L73E 2OQQA 5GTIE 1PGOA 2P7JA 2WPSA 1D7MA 4RKUJ 1KFNA 3V5BA 2N1TD 1H88A 4I2LC 2W8ZA 1T3JA 1LTSC 1KD1Q 1VQ6P 3K5BA 2XDJA 2OYHA 3L4FA 1L0LJ 1KILD 4CPGA 4R4LA 2D2CB 1KV4A 1S5LX 1A02F 1KB9I 1HVVA 3A3YB 2WQYC 4NPDA 3VTPC 3NTNA 5AW7B 3MTUE 3HTKA 1FZEA 3A0BE 2BCCG 1KYOE 2KSJA 2O01H 4Y99B 1IFIA 3L70D 1IFNA 3CX5D 2WITA 3RL0C 2ZAEB 1VQ8P 1JCCA 1W2EA 1BCCG 1VQOP 4N78D 1FC2C 3H1LJ 4L75A 1ZV8A 2YKPA 1GTWA 4YPCA 2W83C 2A06G 1T6AA 2KNCA 2AEJA 2NPSD 2FYNC 4TLFA 3VMAA 3CXHI 4L73A 3AE2C 3RK3D 3L74J 3HE4A 2FFDA 3SFEC 1RF0A 1P84D 2HPCB 1S9KD 4I6MC 3H1JG 2O01N 2I1KA 1EQ7A 1L0NJ 2AEFA 1N86A 3AE8C 2C0WA 3JC22 2E75C 5BU8B 3O6QB 1CI6A 1K04A 4IFDK 5CHXA 1OMIA 4OWFA 1MFZA 1SFCB 3L72E 3B5ND 1J1DB 2ITAA 4BRYB 3WU2E 2H89C 2OARA 3C1LA 4ZNCA 3VMYA 3PJSK 1S5LE 1M1JC 3H1HD 1PIXA 2WT7B 2Y0DA 3A5TA 1KB9D 1KQGB 2K9JB 1GU4A 2FFDC 3TNUA 3F5HA 2E76C 1N73C 3RL0D 4N6JA 3USSA 1VQPP 2K9YA 2A45I 3NXSA 1PPJG 3P8CE 1QL2A 3CWBD 2I1JA 4U3FD 1ZRTE 2W6JH 1KYOI 1KILB 1T2KC 3CLQA 3N4XA 1N7SA 2JJLA 3MIWA 2WPVB 1VPCA 1G1IA 3P8MC 3D71A 3P7KA 4D6TG 3LW5H 5KLVE 2ZYDA 4PJ0E 5TJHA 3CXHD 1UIIA 2FYUJ 3H1LG 2E75D 1PFIA 2HR3A 2HLOA 2WSSH 3M0DC 3RBZA 3BATA 5E79H 3H1JD 1YIJP 4GT1A 1VQMP 2AEMA 3CCQP 1R8EA 3ZDMA 2XKMA 1IFDA 2QEXP 4B86A 1YTZI 3E7KA 5CCHC 3H1IG 1L4AC 2NPSB 1EDLA 3CCMP 5CCGA 3L75G 1PP9D 1PGPA 3GHGA 1L0NG 3RK3B 2W90A 4ASWA 1JY2P 3FXDA 1ZMEC 3TGUE 3QWOC 1BGYE 1QVFO 3PTZA 1KORA 3H32A 1OIPA 1VF5D 2JP3A 5EFWB 2K1AA 1GW3A 3GW6A 3T97A 4DZOA 1NAYA 5KAIE 4IFMA 1LT9C 3Q2YA 3SWFA 2M5AA 1SFCA 5AVWB 4UB8H 1L0LD 1SQVG 1PPJD 5APSA 1LT1A 4IL6E 2ZXXA 2YO2A 3IAOA 3HE5B 2WVRA 5CCGC 3RL0B 2V7QH 2WSFJ 5AVSB 3H1KE 1HGVA 1SQPJ 1LP1A 1SQQJ 2JKVA 4PV1D 1ZP0C 4YXDC 2PAJA 3GF7A 1DD3A 1L2PA 3B4SA 5CBOA 1S3JA 3M9BA 1M1KQ 4OVNF 2OYOA 1IC2A 1U7JA 2HYNA 3CCJP 1LTGC 2OYHB 3H1LD 1A02J 2KP8A 2Q9IA 2FYNB 1NTZE 1EDKA 4LC1A 3NFQA 1K9MQ 1N7SD 1J1EB 1BE3E 1OW7A 2C9NY 2D2CD 3MUDC 3MGNA 2QJYC 3HTKB 2HG5D 1YHQP 3V2QA 1NTZK 3L74D 1VQ9P 2JWDA 2Q3EA 2E75B 4H0LD 2AXCA 3AE5C 5KJ7A 5KKZC 1LTBC 5KLIC 2W6AA 1RH5B 1J2JB 1PL5A 2W6BA 1NTME 3L72D 4YXWH 4GODA 3L36A 3E1RA 3G9RA 4U3FJ 1OW6A 3CL3D 1IK9A 1QLED 4HYTB 1XTGB 2LR2A 1SLQA 1E79H 1KN7A 1JO5A 3BCCE 1YTZT 1NTMK 4N3YB 2OTJP 4HB1A 3W68A 3OJAB 5AW1B 1BDDA 4XA4A 2YMKA 2FFDB 3AE9C 2E76B 4HH2A 3FX0A 3M91A 2J5UA 2CPSA 3L71E 2I8DA 2BCCE 1MFTA 1JY3P 2WPQA 5KJ7C 3HRNA 1CI6B 1USEA 3V2NA 2CPBA 2XNXA 1RE4A 3M9QA 3SWYA 3WUVA 1MKMA 1LTTC 3JCUE 3S9OA 1USDA 4EDFA 1SFCD 4U7JA 2J59M 1NVOA 5KLVD 1RQVA 4I1LA 3WUTA 1Z56A 1PP9J 2E74C 3AEDC 4YTPC 1SQPG 1VQ4P 4WBAA 2A06E 3SWKA 1OW8A 4Y28J 1KZUB 4WY4C 3L73J 1AA0A 3TNUB 1Q81Q 3OAKA 1FE6A 3FXEA 1QVGO 4PD4H 2FYUD 1EZVE 1H8AA 1DIPA 1JM0A 1HUCA 1S72P 5AW2B 1Q7YQ 1OZHA 1IZNB 3PRJA 1GK6A 1KMIZ 2IZ1A 3H1HG 5GTHH 1RE4C 2P10A 2C9LY 1N7SB 4C7NA 3TGUD 2IBZD 2H43A 1IFMA 1BGYD 1M90Q 1YITP 1YYCA 3V6IA 2DW3A 2P1JA 1JMBA 3O8ZA 3OA7A 4H0LB 3RK2C 5DJUB 3KDPB 3CWBG 1YQ4C 4U3FG 4TT3H 5AW4B 2O1KA 3N7NA 3RL0g 4W80A 2ZVNB 1SQBE 2ZXEB 2ZT9D 1S2EA 2XV5A 2OTLP 1DD4A 4LLHA 1JEKA 2YNYA 1Q90D 3GMAA 3AEBC 1SQBK 3TDKA 2Q6QA 4OH8B 4AQRD 1FDMA 2XZRA 1RF1C 3GHGB 1K05A 2Q5UA 1M1JA 1NTKE 1H0TA 2KI7B 2HODA 4BWNA 2WSCJ 1LGHB 1N73A 2NRGA 5CJ0A 4D6TE 3Q1MA 3VN0A 1ZN5A 3H32B 2QJPC 1NTKK 2R3SA 4DOJA 3CCSP 1SQPD 1IFPA 2Q7CA 1SQQD 3CX5H 3L72J 3AE6C 3T97B 1URQC 4Z1MH 1NTZD 5AW5B 3CD6P 4HKZH 1PP9G 1BE3D 2XNDH 4NPFX 2M5AB 1R5SA 1FJPA 3S4RA 1NKZB 1AVYA 1HJBA 2QJYB 4K35A 3IR9A 1EZVI 2LKMA 4JPZB 3H1IE 2YXQB 5AVXB 3RK2D 3M06A 2Y9YA 4JYCA 1ZOYC 3L75E 5KLIB 1L0NE 2R5BA 1P84H 1GL2A 1LP1B 1DX7A 2KS1A 2WSFH 3WMM0 3NMDA 2QVAA 3M0DA 3AEAC 3BRVB 1MZ9A 2YIUC 1L0NK 3D6YA 3HD7A 5K5GB 1L0LG 4W7YA 3Q5SA 1NU1E 3TYYA 3G4SP 1OVVA 5CCHA 1NHLA 1L4AA 5KLVJ 4NPEA 1NU1K 1SQVE 2IPPA 1LTJC 3H25A 2O1JA 1Y9BA 1AQTA 1KB9H 1N2DC 5AVYB 3HUSC 1OFCX 1NJIQ 1SQVK 1GL2C 1OXZA 2ZT9B 1OVUA 4WVZA 1OWAA 2PRRA 1SQXE 1X8YA 1VQ7P 5AVZB 5BU5A 3MZWB 1JOCA 3I56P 1HTLC 1LT9A 3LIDA 3HD7C 1FZGA 2LXBA 1YQ3C 1SQXK 1AJYA 2P67A 2B87A 3L74G 2Q3IA 3U1AA 2IYPA 4WY4B 3TGUJ 1BGYJ 3PP5A 4GOEA 3VYIA 3FGAD 1PGJA 3L72G 2E76D 2PGDA 3L73D 4H44C 3CXHH 2H88C 1PGQA 3KPEA 1FS0E 1T3UA 3TF5A 3G3ZA 1VQKP 2H7HA 2MJZA 3CMAP 1NYHA 2QSIA 3KHUA 1FZCA 1T2KD 1LJ2A 3LIEA 1JTHB 3KXDA 5AVVB 3MUDA 2Y9ZA 3H1KJ 1E5WA 1TU3F 3RK2B 2OYIA 1Q82Q 1Q86Q 4OGQC 1KYOD 2IFMA 2KUBA 3MHVA 3L70E 4ZKUA 3CX5E 2JO1A 2YXRB 1FU1A 5KAFH 1GL2D 1FDIA 4N78E 1N7LA 1U7MA 2WMMA 4I7ZC 2QIWA 2POHA 4KHXA 1NTZJ 3CC7P 2C0XA 5KLVG 1BE3J 2JDIH 3CMEP 2KOGA 1RF1B 1HH0A 1NTKD 1S4XA 3CC2P 2KLVA 5CCHD 3FWLA 2MKVA 4C7NB 1L4AD 3BASA 3RK3E 3GG2A 2K37A 4RO0A 3A0HH 4LGDE 1P84E 3IF4A 1FZCC 3A0BH 3AEGC 2FYUG 1SS1A 2Z5IA 2N1TA 2OYIC 2QJPB 1NTMJ 2GUSA 4DT0A 1Y8AA 2IFNA 4A7PA 1DH3A 1GZLA 1FZBA 3CCUP 4H13C 3FWNA 2FXPA 4ZMDA 3BCCJ 1JY2N 2AXTH 3AE7C 2SPZA 3EFFK 3LW5J 2QE7H 1RQUA 2E5TA 4ASVA 3TGUG 2IBZG 1BGYG 1G1JA 3GLMA 3H1HE 1NH4A 2B89A 3L71J 4OGQD 1M1JB 2BEZF 3VP8A 1H0TB 4HJGH 1EDJA 2UWJE 2V4HA 2BCCJ 2HODB 4WY4A 1LNQA 1QX8A 5CCGD 1EXJA 1N73B 3CCVP 2N1TC 3VMXA 2WSCH 3RBXA 1NU1D 3L35A 5E79E 3CWBE 3P8CD 1KQFB 1KILC 1KC8Q 3UIAA 1H89A 1EC5A 3M9HA 1ZRTD 2FXMA 5H2FH 3CX5I 5AW8B 4EI2A 4EOTA 1ZR2A 1BCCE 1CZQA 3EWKA 4M3LA 2ZYGA 1VQLP 2KZIA 3QH9A 1LTJB 1X0TA 1HBWA 4RJTA 2KSEA 1WMKA 1JTHA 4KT0J 2YO3A 3CXHE 4QMAA 1SQQG 4JYBA 3GF3A 1SQXD 1GL2B 2GUVA 1NTZG 2N9YB 3B5NA 2KS1B 1BE3G 5AVTB 3H1JE 5B66H 2M3EA 1P84I 2Y0CA 3HD7B 2WTYA 1JUNA 1AV1A 2G3AA 1RY3A 2V7QJ 4KJMA 4UB8E 3RK3C 5M1BA 1LWUA 1Q2NA 1L4AB 2QJKC 1PP9E 2XU6A 2BEQD 1OX3A 2RMZA 2E5YA 3L37A 2KLUA 1RF1A 1NTMG 1LTIC 1PZQA 1AVOA 2WPRA 2Z4EA 4PJ0H 2H8PD 1Y47A 3RGUA 4WWIA 4H44B 1KFMA 3BCCG 1SQBJ 1NAFA 3ABVC 1GDTA 3Q5PA 4L74A 4WB4A 5BVZA 1HF9A 5KJ7D 1EDIA 3B5NC 3F89A 3I55P 1X9VA 1URQA 1AFOA 3JSVC 5AW0B 5AW9B 2WSEJ 4JQ0D 3L71G 1R5LA 3A0HE 1MV8A 1LT9B 5TISH 1WT6A 3D6ZA 2M8RA 1L0LE 3IN6A 1NTKJ 1SP4A 3EQ2A 3SSUA 3KZIH 1PPJE 1JY3N 1YJ9P 2OGUA 2ZJSE 2B87B 2RKLA 3WUUA 4OGQB 1AQ5A 1X22A 5AVQB 2E74D 1LWUC 4D6TJ 2QRXA 1OVRA 2E42A 1L0LK 2ZFCA 4WY4D 3W67A 1VL2A 3H1KD 2RN0A 2FYZA 2RH0A 3TK1A 2NZ2A 2AXTE 4UB6H 4I7ZB 4ZKPA 1IFJA 3V4QA 3BRTB 2Z5HA 4AUWA 3BVHA 2OYHC 4JBZA 5C39A 1IK7A 3VOPA 3E1IA 3H1LE 5KAIH 1K73Q 5B5EH 2FBWC 5APWA 1J1EC 3H1IJ 1FZCB 1JY2O 2JWAA 1EZVG 3L75J 4IL6H 1JNMA 1W2BO 3L73G 3VP9A 1PV3A 2OYIB 2K88A 2KXPB 3L74E 5L8RJ 1LTJA 1UIXA 2KYVA 1RE3A 5KKZB 4H13B 2E43A 3HUSA 5H2FE 1NTMD 1HGZA 1NU1J 5CJ4A 1FOSE 3S1KA 2A45G 3II6A 3VMZA 3BCCD 3AEEC 5DJTB 2ZYAA 5AW6B 5CBNA 1SQVJ 1BSNA 1RF0C 1IJDB 1SQBG 1YJNP 4RESB 4W7ZA 2B88A 3I5CA 1X79B 2VRSA 3L71D 2N1TB 1VF5C 4GOFA 3KQGA 5B66E 2YKQA 4XFJA 2BCCD 3PH0A 2O3JA 4PD4E 1SQXJ 1S1CX 3AE3C 2GA1A 1RE3C 3A7OA 1NGMB 1SVFA 2WZ7A 1JMMA 1NTKG 1U57A 4JF7A 1BCCD 4IL6X 5GTHE 2Q1KA 1URQD 3R4YA 3AEFC 1KTMA 2R5DA 1YBKA 4MN4C 1M8OB 2LXCB 2O01J 2J58A 1GU5A 2L91A 2ZVOB 2IDBA 2E74B 2A06D 3TSIA 4PV1C 2QM7A 2M3BA 2Y0EA 4XE5B 3M0AA 1G2CB 5KLVK 5APUA 3A2AA 3V2RA 2FYUE 1EZVD 2IYOA 3EFGA 3V4WA 2KIKA 3KYQA 1YJWP 3OW2O 1FZAA 5TISE 2JEEA 3PHLA 3D70A 2IX7C 3KZIE 1NKNA 3AE1C 2FYUK 3JCUH 2QJKB 1N7SC 4C46A 2B9BA 4DJGA 2D2CC 1KILE 1ZXGA 2IBZE 1M7LA 2HPCA 2L5GB 3B71A 3L70J 2HFED 5CMZA 1T8ZA 5APVA 1DEBA 4H0LC 1GD2E 4UB6E 1NU1G 1N8RQ 3AE4C 1JY3O 4Y99C 2KZJA 3O6QA 1VQ5P 3B5NB 4BXLA 1SQBD 1NOHA 4AYCA 1FAVA 5GTIH 5B5EE 1FOSF 4BRYA 1MUUA 1QGKB 2QG4A 2M0BA 4L76A 3C8VA 3HD7D 4PD4I 2KB7P 1JB0J 3ITKA 3GHGC 1BSHA 1LWUB 2P2UA 2QM8A 1GMJA 2WT7A 2GM4A 3V2PA 2PFXA 2R32A 1SQXG 2K9JA 1YI2P 2A45H 5APTA 1KQSO 3CI9A 2N9BA 1GK4A 2FXOA 1S9KE 2CK3H 4GIFA 4D6TD 3CPWO 3G71P 1KYOH 2W27A 1ZLLA 2BASA 4K3AA 1SQPE 1SQQE 4H44D 1IO4A 3CCEP 3P32A 1KILA 2YKOA 3CC4P 4O9BA 1URQB 1SFCC 1NWQA 1K8AQ 3H1HJ 1SQPK 1SQQK 4DCKA 1J1DC 2OTKE 4EYYQ 1HJ0A 3SFDC 3MP7B 2WSEH 1FJKA 1HWTC 2G8YA 1M57D 3R2PA 2K3RA 3H1ID 2FKWB 3PLNA 2R3CA 3L75D 1L0ND 1EXIA 3G6EP 5KTBA 1KB9E 3CWBJ 3AECC 4GDOA 3C9IA 5AW3B 2QA4P 1G2CA 4EIJA 2IBZI 1JCDA 2YIUB 5APQA 1BCCJ 2KNCB 4R4MA 2KK7A 4U3FE 1XTCC 4IOIH 3L70G 3HE4B 3CCLP 2NPSA 3B8EB 1ZR4A 2PP6A 1QEXA
chains in the Genus database with same CATH topology
3FX0A 3F89A 3JSVC 4BWNA 2ZVOB 4OWFA 2V4HA 2ZVNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FX0 A;  3F89 A;  3JSV C;  4BWN A;  2ZVO B;  4OWF A;  2V4H A;  2ZVN B; 
#chains in the Genus database with same CATH topology
 3WU2 H;  3H6P A;  3U59 A;  1VDF A;  1FDO A;  3H1K G;  1GW4 A;  1VF5 B;  3U1C A;  1SQV D;  3IFM A;  4IFF A;  4PD4 D;  2YMY A;  1S5L H;  1DEE G;  5AVR B;  1ZW0 A;  1KQL A;  3H1J J;  1BDC A;  3MD0 A;  2ZT9 C;  3Q3D A;  3HUS B;  1LTA C;  2JR8 A;  4H13 D;  1RHZ B;  2WWW A;  1M56 D;  5APY A;  1CSB A;  4GKG A;  5APX A;  3CCR P;  2P58 A;  3Q5R A;  1FBM A;  1WRG A;  1W5C E;  2NPS C;  1CW5 A;  3HE5 A;  4PV1 B;  2FY8 A;  1QL1 A;  4C7R A;  1NO4 A;  2IZ0 A;  5AVU B;  1VQN P;  2R44 A;  1FZF A;  5KAF E;  3L73 E;  2OQQ A;  5GTI E;  1PGO A;  2P7J A;  2WPS A;  1D7M A;  4RKU J;  1KFN A;  3V5B A;  2N1T D;  1H88 A;  4I2L C;  2W8Z A;  1T3J A;  1LTS C;  1KD1 Q;  1VQ6 P;  3K5B A;  2XDJ A;  2OYH A;  3L4F A;  1L0L J;  1KIL D;  4CPG A;  4R4L A;  2D2C B;  1KV4 A;  1S5L X;  1A02 F;  1KB9 I;  1HVV A;  3A3Y B;  2WQY C;  4NPD A;  3VTP C;  3NTN A;  5AW7 B;  3MTU E;  3HTK A;  1FZE A;  3A0B E;  2BCC G;  1KYO E;  2KSJ A;  2O01 H;  4Y99 B;  1IFI A;  3L70 D;  1IFN A;  3CX5 D;  2WIT A;  3RL0 C;  2ZAE B;  1VQ8 P;  1JCC A;  1W2E A;  1BCC G;  1VQO P;  4N78 D;  1FC2 C;  3H1L J;  4L75 A;  1ZV8 A;  2YKP A;  1GTW A;  4YPC A;  2W83 C;  2A06 G;  1T6A A;  2KNC A;  2AEJ A;  2NPS D;  2FYN C;  4TLF A;  3VMA A;  3CXH I;  4L73 A;  3AE2 C;  3RK3 D;  3L74 J;  3HE4 A;  2FFD A;  3SFE C;  1RF0 A;  1P84 D;  2HPC B;  1S9K D;  4I6M C;  3H1J G;  2O01 N;  2I1K A;  1EQ7 A;  1L0N J;  2AEF A;  1N86 A;  3AE8 C;  2C0W A;  3JC2 2;  2E75 C;  5BU8 B;  3O6Q B;  1CI6 A;  1K04 A;  4IFD K;  5CHX A;  1OMI A;  4OWF A;  1MFZ A;  1SFC B;  3L72 E;  3B5N D;  1J1D B;  2ITA A;  4BRY B;  3WU2 E;  2H89 C;  2OAR A;  3C1L A;  4ZNC A;  3VMY A;  3PJS K;  1S5L E;  1M1J C;  3H1H D;  1PIX A;  2WT7 B;  2Y0D A;  3A5T A;  1KB9 D;  1KQG B;  2K9J B;  1GU4 A;  2FFD C;  3TNU A;  3F5H A;  2E76 C;  1N73 C;  3RL0 D;  4N6J A;  3USS A;  1VQP P;  2K9Y A;  2A45 I;  3NXS A;  1PPJ G;  3P8C E;  1QL2 A;  3CWB D;  2I1J A;  4U3F D;  1ZRT E;  2W6J H;  1KYO I;  1KIL B;  1T2K C;  3CLQ A;  3N4X A;  1N7S A;  2JJL A;  3MIW A;  2WPV B;  1VPC A;  1G1I A;  3P8M C;  3D71 A;  3P7K A;  4D6T G;  3LW5 H;  5KLV E;  2ZYD A;  4PJ0 E;  5TJH A;  3CXH D;  1UII A;  2FYU J;  3H1L G;  2E75 D;  1PFI A;  2HR3 A;  2HLO A;  2WSS H;  3M0D C;  3RBZ A;  3BAT A;  5E79 H;  3H1J D;  1YIJ P;  4GT1 A;  1VQM P;  2AEM A;  3CCQ P;  1R8E A;  3ZDM A;  2XKM A;  1IFD A;  2QEX P;  4B86 A;  1YTZ I;  3E7K A;  5CCH C;  3H1I G;  1L4A C;  2NPS B;  1EDL A;  3CCM P;  5CCG A;  3L75 G;  1PP9 D;  1PGP A;  3GHG A;  1L0N G;  3RK3 B;  2W90 A;  4ASW A;  1JY2 P;  3FXD A;  1ZME C;  3TGU E;  3QWO C;  1BGY E;  1QVF O;  3PTZ A;  1KOR A;  3H32 A;  1OIP A;  1VF5 D;  2JP3 A;  5EFW B;  2K1A A;  1GW3 A;  3GW6 A;  3T97 A;  4DZO A;  1NAY A;  5KAI E;  4IFM A;  1LT9 C;  3Q2Y A;  3SWF A;  2M5A A;  1SFC A;  5AVW B;  4UB8 H;  1L0L D;  1SQV G;  1PPJ D;  5APS A;  1LT1 A;  4IL6 E;  2ZXX A;  2YO2 A;  3IAO A;  3HE5 B;  2WVR A;  5CCG C;  3RL0 B;  2V7Q H;  2WSF J;  5AVS B;  3H1K E;  1HGV A;  1SQP J;  1LP1 A;  1SQQ J;  2JKV A;  4PV1 D;  1ZP0 C;  4YXD C;  2PAJ A;  3GF7 A;  1DD3 A;  1L2P A;  3B4S A;  5CBO A;  1S3J A;  3M9B A;  1M1K Q;  4OVN F;  2OYO A;  1IC2 A;  1U7J A;  2HYN A;  3CCJ P;  1LTG C;  2OYH B;  3H1L D;  1A02 J;  2KP8 A;  2Q9I A;  2FYN B;  1NTZ E;  1EDK A;  4LC1 A;  3NFQ A;  1K9M Q;  1N7S D;  1J1E B;  1BE3 E;  1OW7 A;  2C9N Y;  2D2C D;  3MUD C;  3MGN A;  2QJY C;  3HTK B;  2HG5 D;  1YHQ P;  3V2Q A;  1NTZ K;  3L74 D;  1VQ9 P;  2JWD A;  2Q3E A;  2E75 B;  4H0L D;  2AXC A;  3AE5 C;  5KJ7 A;  5KKZ C;  1LTB C;  5KLI C;  2W6A A;  1RH5 B;  1J2J B;  1PL5 A;  2W6B A;  1NTM E;  3L72 D;  4YXW H;  4GOD A;  3L36 A;  3E1R A;  3G9R A;  4U3F J;  1OW6 A;  3CL3 D;  1IK9 A;  1QLE D;  4HYT B;  1XTG B;  2LR2 A;  1SLQ A;  1E79 H;  1KN7 A;  1JO5 A;  3BCC E;  1YTZ T;  1NTM K;  4N3Y B;  2OTJ P;  4HB1 A;  3W68 A;  3OJA B;  5AW1 B;  1BDD A;  4XA4 A;  2YMK A;  2FFD B;  3AE9 C;  2E76 B;  4HH2 A;  3FX0 A;  3M91 A;  2J5U A;  2CPS A;  3L71 E;  2I8D A;  2BCC E;  1MFT A;  1JY3 P;  2WPQ A;  5KJ7 C;  3HRN A;  1CI6 B;  1USE A;  3V2N A;  2CPB A;  2XNX A;  1RE4 A;  3M9Q A;  3SWY A;  3WUV A;  1MKM A;  1LTT C;  3JCU E;  3S9O A;  1USD A;  4EDF A;  1SFC D;  4U7J A;  2J59 M;  1NVO A;  5KLV D;  1RQV A;  4I1L A;  3WUT A;  1Z56 A;  1PP9 J;  2E74 C;  3AED C;  4YTP C;  1SQP G;  1VQ4 P;  4WBA A;  2A06 E;  3SWK A;  1OW8 A;  4Y28 J;  1KZU B;  4WY4 C;  3L73 J;  1AA0 A;  3TNU B;  1Q81 Q;  3OAK A;  1FE6 A;  3FXE A;  1QVG O;  4PD4 H;  2FYU D;  1EZV E;  1H8A A;  1DIP A;  1JM0 A;  1HUC A;  1S72 P;  5AW2 B;  1Q7Y Q;  1OZH A;  1IZN B;  3PRJ A;  1GK6 A;  1KMI Z;  2IZ1 A;  3H1H G;  5GTH H;  1RE4 C;  2P10 A;  2C9L Y;  1N7S B;  4C7N A;  3TGU D;  2IBZ D;  2H43 A;  1IFM A;  1BGY D;  1M90 Q;  1YIT P;  1YYC A;  3V6I A;  2DW3 A;  2P1J A;  1JMB A;  3O8Z A;  3OA7 A;  4H0L B;  3RK2 C;  5DJU B;  3KDP B;  3CWB G;  1YQ4 C;  4U3F G;  4TT3 H;  5AW4 B;  2O1K A;  3N7N A;  3RL0 g;  4W80 A;  2ZVN B;  1SQB E;  2ZXE B;  2ZT9 D;  1S2E A;  2XV5 A;  2OTL P;  1DD4 A;  4LLH A;  1JEK A;  2YNY A;  1Q90 D;  3GMA A;  3AEB C;  1SQB K;  3TDK A;  2Q6Q A;  4OH8 B;  4AQR D;  1FDM A;  2XZR A;  1RF1 C;  3GHG B;  1K05 A;  2Q5U A;  1M1J A;  1NTK E;  1H0T A;  2KI7 B;  2HOD A;  4BWN A;  2WSC J;  1LGH B;  1N73 A;  2NRG A;  5CJ0 A;  4D6T E;  3Q1M A;  3VN0 A;  1ZN5 A;  3H32 B;  2QJP C;  1NTK K;  2R3S A;  4DOJ A;  3CCS P;  1SQP D;  1IFP A;  2Q7C A;  1SQQ D;  3CX5 H;  3L72 J;  3AE6 C;  3T97 B;  1URQ C;  4Z1M H;  1NTZ D;  5AW5 B;  3CD6 P;  4HKZ H;  1PP9 G;  1BE3 D;  2XND H;  4NPF X;  2M5A B;  1R5S A;  1FJP A;  3S4R A;  1NKZ B;  1AVY A;  1HJB A;  2QJY B;  4K35 A;  3IR9 A;  1EZV I;  2LKM A;  4JPZ B;  3H1I E;  2YXQ B;  5AVX B;  3RK2 D;  3M06 A;  2Y9Y A;  4JYC A;  1ZOY C;  3L75 E;  5KLI B;  1L0N E;  2R5B A;  1P84 H;  1GL2 A;  1LP1 B;  1DX7 A;  2KS1 A;  2WSF H;  3WMM 0;  3NMD A;  2QVA A;  3M0D A;  3AEA C;  3BRV B;  1MZ9 A;  2YIU C;  1L0N K;  3D6Y A;  3HD7 A;  5K5G B;  1L0L G;  4W7Y A;  3Q5S A;  1NU1 E;  3TYY A;  3G4S P;  1OVV A;  5CCH A;  1NHL A;  1L4A A;  5KLV J;  4NPE A;  1NU1 K;  1SQV E;  2IPP A;  1LTJ C;  3H25 A;  2O1J A;  1Y9B A;  1AQT A;  1KB9 H;  1N2D C;  5AVY B;  3HUS C;  1OFC X;  1NJI Q;  1SQV K;  1GL2 C;  1OXZ A;  2ZT9 B;  1OVU A;  4WVZ A;  1OWA A;  2PRR A;  1SQX E;  1X8Y A;  1VQ7 P;  5AVZ B;  5BU5 A;  3MZW B;  1JOC A;  3I56 P;  1HTL C;  1LT9 A;  3LID A;  3HD7 C;  1FZG A;  2LXB A;  1YQ3 C;  1SQX K;  1AJY A;  2P67 A;  2B87 A;  3L74 G;  2Q3I A;  3U1A A;  2IYP A;  4WY4 B;  3TGU J;  1BGY J;  3PP5 A;  4GOE A;  3VYI A;  3FGA D;  1PGJ A;  3L72 G;  2E76 D;  2PGD A;  3L73 D;  4H44 C;  3CXH H;  2H88 C;  1PGQ A;  3KPE A;  1FS0 E;  1T3U A;  3TF5 A;  3G3Z A;  1VQK P;  2H7H A;  2MJZ A;  3CMA P;  1NYH A;  2QSI A;  3KHU A;  1FZC A;  1T2K D;  1LJ2 A;  3LIE A;  1JTH B;  3KXD A;  5AVV B;  3MUD A;  2Y9Z A;  3H1K J;  1E5W A;  1TU3 F;  3RK2 B;  2OYI A;  1Q82 Q;  1Q86 Q;  4OGQ C;  1KYO D;  2IFM A;  2KUB A;  3MHV A;  3L70 E;  4ZKU A;  3CX5 E;  2JO1 A;  2YXR B;  1FU1 A;  5KAF H;  1GL2 D;  1FDI A;  4N78 E;  1N7L A;  1U7M A;  2WMM A;  4I7Z C;  2QIW A;  2POH A;  4KHX A;  1NTZ J;  3CC7 P;  2C0X A;  5KLV G;  1BE3 J;  2JDI H;  3CME P;  2KOG A;  1RF1 B;  1HH0 A;  1NTK D;  1S4X A;  3CC2 P;  2KLV A;  5CCH D;  3FWL A;  2MKV A;  4C7N B;  1L4A D;  3BAS A;  3RK3 E;  3GG2 A;  2K37 A;  4RO0 A;  3A0H H;  4LGD E;  1P84 E;  3IF4 A;  1FZC C;  3A0B H;  3AEG C;  2FYU G;  1SS1 A;  2Z5I A;  2N1T A;  2OYI C;  2QJP B;  1NTM J;  2GUS A;  4DT0 A;  1Y8A A;  2IFN A;  4A7P A;  1DH3 A;  1GZL A;  1FZB A;  3CCU P;  4H13 C;  3FWN A;  2FXP A;  4ZMD A;  3BCC J;  1JY2 N;  2AXT H;  3AE7 C;  2SPZ A;  3EFF K;  3LW5 J;  2QE7 H;  1RQU A;  2E5T A;  4ASV A;  3TGU G;  2IBZ G;  1BGY G;  1G1J A;  3GLM A;  3H1H E;  1NH4 A;  2B89 A;  3L71 J;  4OGQ D;  1M1J B;  2BEZ F;  3VP8 A;  1H0T B;  4HJG H;  1EDJ A;  2UWJ E;  2V4H A;  2BCC J;  2HOD B;  4WY4 A;  1LNQ A;  1QX8 A;  5CCG D;  1EXJ A;  1N73 B;  3CCV P;  2N1T C;  3VMX A;  2WSC H;  3RBX A;  1NU1 D;  3L35 A;  5E79 E;  3CWB E;  3P8C D;  1KQF B;  1KIL C;  1KC8 Q;  3UIA A;  1H89 A;  1EC5 A;  3M9H A;  1ZRT D;  2FXM A;  5H2F H;  3CX5 I;  5AW8 B;  4EI2 A;  4EOT A;  1ZR2 A;  1BCC E;  1CZQ A;  3EWK A;  4M3L A;  2ZYG A;  1VQL P;  2KZI A;  3QH9 A;  1LTJ B;  1X0T A;  1HBW A;  4RJT A;  2KSE A;  1WMK A;  1JTH A;  4KT0 J;  2YO3 A;  3CXH E;  4QMA A;  1SQQ G;  4JYB A;  3GF3 A;  1SQX D;  1GL2 B;  2GUV A;  1NTZ G;  2N9Y B;  3B5N A;  2KS1 B;  1BE3 G;  5AVT B;  3H1J E;  5B66 H;  2M3E A;  1P84 I;  2Y0C A;  3HD7 B;  2WTY A;  1JUN A;  1AV1 A;  2G3A A;  1RY3 A;  2V7Q J;  4KJM A;  4UB8 E;  3RK3 C;  5M1B A;  1LWU A;  1Q2N A;  1L4A B;  2QJK C;  1PP9 E;  2XU6 A;  2BEQ D;  1OX3 A;  2RMZ A;  2E5Y A;  3L37 A;  2KLU A;  1RF1 A;  1NTM G;  1LTI C;  1PZQ A;  1AVO A;  2WPR A;  2Z4E A;  4PJ0 H;  2H8P D;  1Y47 A;  3RGU A;  4WWI A;  4H44 B;  1KFM A;  3BCC G;  1SQB J;  1NAF A;  3ABV C;  1GDT A;  3Q5P A;  4L74 A;  4WB4 A;  5BVZ A;  1HF9 A;  5KJ7 D;  1EDI A;  3B5N C;  3F89 A;  3I55 P;  1X9V A;  1URQ A;  1AFO A;  3JSV C;  5AW0 B;  5AW9 B;  2WSE J;  4JQ0 D;  3L71 G;  1R5L A;  3A0H E;  1MV8 A;  1LT9 B;  5TIS H;  1WT6 A;  3D6Z A;  2M8R A;  1L0L E;  3IN6 A;  1NTK J;  1SP4 A;  3EQ2 A;  3SSU A;  3KZI H;  1PPJ E;  1JY3 N;  1YJ9 P;  2OGU A;  2ZJS E;  2B87 B;  2RKL A;  3WUU A;  4OGQ B;  1AQ5 A;  1X22 A;  5AVQ B;  2E74 D;  1LWU C;  4D6T J;  2QRX A;  1OVR A;  2E42 A;  1L0L K;  2ZFC A;  4WY4 D;  3W67 A;  1VL2 A;  3H1K D;  2RN0 A;  2FYZ A;  2RH0 A;  3TK1 A;  2NZ2 A;  2AXT E;  4UB6 H;  4I7Z B;  4ZKP A;  1IFJ A;  3V4Q A;  3BRT B;  2Z5H A;  4AUW A;  3BVH A;  2OYH C;  4JBZ A;  5C39 A;  1IK7 A;  3VOP A;  3E1I A;  3H1L E;  5KAI H;  1K73 Q;  5B5E H;  2FBW C;  5APW A;  1J1E C;  3H1I J;  1FZC B;  1JY2 O;  2JWA A;  1EZV G;  3L75 J;  4IL6 H;  1JNM A;  1W2B O;  3L73 G;  3VP9 A;  1PV3 A;  2OYI B;  2K88 A;  2KXP B;  3L74 E;  5L8R J;  1LTJ A;  1UIX A;  2KYV A;  1RE3 A;  5KKZ B;  4H13 B;  2E43 A;  3HUS A;  5H2F E;  1NTM D;  1HGZ A;  1NU1 J;  5CJ4 A;  1FOS E;  3S1K A;  2A45 G;  3II6 A;  3VMZ A;  3BCC D;  3AEE C;  5DJT B;  2ZYA A;  5AW6 B;  5CBN A;  1SQV J;  1BSN A;  1RF0 C;  1IJD B;  1SQB G;  1YJN P;  4RES B;  4W7Z A;  2B88 A;  3I5C A;  1X79 B;  2VRS A;  3L71 D;  2N1T B;  1VF5 C;  4GOF A;  3KQG A;  5B66 E;  2YKQ A;  4XFJ A;  2BCC D;  3PH0 A;  2O3J A;  4PD4 E;  1SQX J;  1S1C X;  3AE3 C;  2GA1 A;  1RE3 C;  3A7O A;  1NGM B;  1SVF A;  2WZ7 A;  1JMM A;  1NTK G;  1U57 A;  4JF7 A;  1BCC D;  4IL6 X;  5GTH E;  2Q1K A;  1URQ D;  3R4Y A;  3AEF C;  1KTM A;  2R5D A;  1YBK A;  4MN4 C;  1M8O B;  2LXC B;  2O01 J;  2J58 A;  1GU5 A;  2L91 A;  2ZVO B;  2IDB A;  2E74 B;  2A06 D;  3TSI A;  4PV1 C;  2QM7 A;  2M3B A;  2Y0E A;  4XE5 B;  3M0A A;  1G2C B;  5KLV K;  5APU A;  3A2A A;  3V2R A;  2FYU E;  1EZV D;  2IYO A;  3EFG A;  3V4W A;  2KIK A;  3KYQ A;  1YJW P;  3OW2 O;  1FZA A;  5TIS E;  2JEE A;  3PHL A;  3D70 A;  2IX7 C;  3KZI E;  1NKN A;  3AE1 C;  2FYU K;  3JCU H;  2QJK B;  1N7S C;  4C46 A;  2B9B A;  4DJG A;  2D2C C;  1KIL E;  1ZXG A;  2IBZ E;  1M7L A;  2HPC A;  2L5G B;  3B71 A;  3L70 J;  2HFE D;  5CMZ A;  1T8Z A;  5APV A;  1DEB A;  4H0L C;  1GD2 E;  4UB6 E;  1NU1 G;  1N8R Q;  3AE4 C;  1JY3 O;  4Y99 C;  2KZJ A;  3O6Q A;  1VQ5 P;  3B5N B;  4BXL A;  1SQB D;  1NOH A;  4AYC A;  1FAV A;  5GTI H;  5B5E E;  1FOS F;  4BRY A;  1MUU A;  1QGK B;  2QG4 A;  2M0B A;  4L76 A;  3C8V A;  3HD7 D;  4PD4 I;  2KB7 P;  1JB0 J;  3ITK A;  3GHG C;  1BSH A;  1LWU B;  2P2U A;  2QM8 A;  1GMJ A;  2WT7 A;  2GM4 A;  3V2P A;  2PFX A;  2R32 A;  1SQX G;  2K9J A;  1YI2 P;  2A45 H;  5APT A;  1KQS O;  3CI9 A;  2N9B A;  1GK4 A;  2FXO A;  1S9K E;  2CK3 H;  4GIF A;  4D6T D;  3CPW O;  3G71 P;  1KYO H;  2W27 A;  1ZLL A;  2BAS A;  4K3A A;  1SQP E;  1SQQ E;  4H44 D;  1IO4 A;  3CCE P;  3P32 A;  1KIL A;  2YKO A;  3CC4 P;  4O9B A;  1URQ B;  1SFC C;  1NWQ A;  1K8A Q;  3H1H J;  1SQP K;  1SQQ K;  4DCK A;  1J1D C;  2OTK E;  4EYY Q;  1HJ0 A;  3SFD C;  3MP7 B;  2WSE H;  1FJK A;  1HWT C;  2G8Y A;  1M57 D;  3R2P A;  2K3R A;  3H1I D;  2FKW B;  3PLN A;  2R3C A;  3L75 D;  1L0N D;  1EXI A;  3G6E P;  5KTB A;  1KB9 E;  3CWB J;  3AEC C;  4GDO A;  3C9I A;  5AW3 B;  2QA4 P;  1G2C A;  4EIJ A;  2IBZ I;  1JCD A;  2YIU B;  5APQ A;  1BCC J;  2KNC B;  4R4M A;  2KK7 A;  4U3F E;  1XTC C;  4IOI H;  3L70 G;  3HE4 B;  3CCL P;  2NPS A;  3B8E B;  1ZR4 A;  2PP6 A;  1QEX A; 
#chains in the Genus database with same CATH homology
 3FX0 A;  3F89 A;  3JSV C;  4BWN A;  2ZVO B;  4OWF A;  2V4H A;  2ZVN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...