2E74B

Crystal structure of the cytochrome b6f complex from m.laminosus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Cytochrome b6
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
total genus 40
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2e74B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e74B01
2ZT9B 4H13B 2FYNC 4I7ZB 2QJKC 2K9YA 1Q90D 2E76B 2QJYC 4PV1B 1ZRTE 5L8RJ 4OGQB 2WSFJ 2E74B 4H44B 2D2CB 3LW5J 4RKUJ 2YIUC 2O01J 1JB0J 2QSIA 1VF5B 4KT0J 1S5LX 2QIWA 2WPVB 2WSCJ 4Y28J 2QJPC 2E75B 4IL6X 3C8VA 4H0LB 5KKZC 5KLIC 2WSEJ
chains in the Genus database with same CATH superfamily
2ITDC 1XOUA 5GONB 2NPSB 3FGAD 3UKMA 5AVRB 2JEUA 2B9ZA 1QX8A 4DV1O 2N74A 3RK2D 4B3MB 4LP8A 1VQNP 3L70J 2QG4A 1COWG 1DEBA 1H2MA 4QPJA 1Q86Q 5KMGB 1NO4A 2ITCC 1R3LC 2JDIG 3HKCA 1N36B 3KDPB 3IFMA 4D7SA 3V2RA 1EN5A 3X2QC 1K34A 4DR6O 1G1XB 1P4RA 4FLYA 1L0LD 1KORA 4EIJA 4XDJA 1L1FA 4WVZA 3ASOC 1JM0A 3H1HD 1GO3F 4R8CA 3WFVA 4B3MO 1AA0A 1NTKJ 2LQTA 3SFDC 1TVKB 1HBWA 3H1KH 3P8CD 4C7UA 3AG7A 1M93A 1VQ5P 2FYUJ 4PI2A 2BCCE 4PJ0Z 5KLIB 3OW2U 3KG2A 1RPOA 1N36O 2L91A 1K97A 1MOFA 3RYHA 3ABMC 3H1ID 3N2GA 1PM9A 4B3TB 5IJ9B 2WLKA 3CXCU 4CS3A 2KZIA 3VN0A 3G71V 1L0NE 3S3XA 1OCRC 4JTDB 3L75E 1S0VA 4RAIA 1KU9A 5APYA 4PDRA 4JYAO 3OFNG 1K5QA 3N7NA 2H7HA 3LW5J 1KKCA 3CS5A 1RE4A 5LMNB 3CCSV 1AQ5A 3BRTB 2YKOA 2Z5HA 4WY4A 3TCUA 3G6EP 4MT8A 1IVSA 4IIJA 1MZEA 1KMIZ 4O2BA 4JI5B 2XNDG 2ODMA 4B3TO 4RESB 2OYHA 2XAHA 1N2DC 3JASA 3CMAP 4JZ2A 4L8JA 3A0BH 3ABUA 3BAAA 2IDBA 2HYNA 3H1JJ 3ZMUA 3A5TA 2Y69B 5JCOA 1L4AB 2QWNB 3AG3B 5L3EA 1QVFU 3FD9A 4K8ZA 4K0KO 4H44B 3AE6C 3CWBH 5LMNO 5JJNB 1LT9B 4HJGH 3HD7D 5APSA 1NU1D 1OW8A 3M9HA 4WB4A 1N33B 4JPZB 2EIKB 2WSFH 2QJPC 4JPRA 4W7ZA 5GTHZ 3CCJV 2Q73A 2YO3A 2ZVOB 4ZKPA 1N7SA 2QWQB 1IO4A 1ZL8B 1NAYA 4U3FJ 4Q20A 1NKDA 2YXRB 1YXBA 2N9YB 4LBEC 1GL2A 2NLJC 4GOFA 1JMMA 1F4MA 1FXKC 3OTFA 4PV1B 1ZRTE 5CJ0A 1YVWA 2W0FC 3RGBA 4BIOA 2WPRA 5KLVH 3L72G 1HNXO 3KQGA 2AZ0A 1T8ZA 1N33O 1OIPA 4KP4A 5E1AC 2FYZA 3RYCB 1SQBE 3ABKB 5AW1B 2MW2B 4MVOA 4D6TH 2RQ6A 3B2EE 1L0NK 2N1TD 2WITA 3P8MC 1JY3N 1F51A 2BTQB 3UT5B 3MHVA 3AG2C 4ASWA 4NXMB 1OCZB 1QCEA 2QE7H 2KYVA 2EIJB 2ETNA 3STZC 3K3WA 1IJDB 2UUBO 2XV5A 2P2UA 1JNMA 4X64O 1A32A 4ICGA 4F6RB 3H6PA 2AGAA 3FYEB 1MZFA 2IX7C 1FXHA 3CI9A 1S77D 1WPXA 4MVMA 4FM0A 3A0HH 3BRVB 4Y28J 1M57C 4X1IA 4F4LA 1YZBA 2Q7GA 2WLMA 1N32B 4XBFA 1PP9J 1FFXB 1MFTA 3ZEDA 5IYZB 5GTHE 3WB0A 1J1EC 1HWTC 2P67A 4NXMO 2DYRC 4DYLA 4O4HA 2WZ7A 1SQVD 4H0LC 1NGMB 2E75D 2K88A 2Y4UA 1CXZB 5LGNA 3L74E 4RKUJ 3DGEA 1VQOV 1DIPA 2XAJA 3U0ZA 5B1AC 3SYPA 3TGUJ 3BY6A 4YHHB 1NTMK 3L71J 1L0NJ 4AI8A 3CC7V 4KUMA 4B3SB 4IGGA 2E74D 4QMAA 3OW2O 5KKZC 3GW6A 4CC5A 5KAFE 1GU4A 5KHIA 3HE4A 4NPEA 5E79E 4IHJA 5APXA 1CW5A 1RF1B 4DV5B 3R65A 1SETA 2WT7A 2QSAA 2MKVA 2RKLA 4I2LC 1KYOD 2CAZC 4R7CA 4CS2A 1OX3A 2HODA 1SA0A 2ZIMA 3E22A 2IBZH 1HJ0A 4JI6O 4JF3A 4JI4B 1E1RG 2QWPB 4U3JB 1SQBK 5AVZB 4H13D 5APUA 3JAMN 2JRIA 1HNZB 1BGYG 4J7JA 1RHZB 1AJPA 1ZXGA 2ZM6B 4RO0A 3A2FA 3HKCB 1BE3G 3IR9A 3JCUH 2YI9A 3SPIA 2LR2A 5H5NA 2O1JA 2PI4A 1M56C 1I5YA 4NVPA 4YY3O 2VQFB 1IC2A 4LNUA 2FMLA 1IBLB 3B5NB 1OW7A 3CCUV 4J10A 4DJGA 4MVUA 2E5YA 3HUSA 4AILC 2WAMA 4HKZH 2P1JA 1RE3C 1S9KD 4O4IA 1YIJP 2DW3A 3JCZA 2E43A 4QGPA 3GG2A 4WFGA 4JI4O 2F4VO 3PHLA 4DZOA 1QVFO 2OCCB 1NTMJ 1YHQP 5LL6Y 1ZP0C 4CH5A 1QLEB 2KSDA 2UU9O 1EDIA 1EZJA 2RNBA 2AXTH 2Y0CA 2MK3A 3CSXA 4UB8H 4ZMDA 3L70H 3VQYA 1GN4A 2OCHA 2YIBD 2HFED 3RYHB 2VQFO 1HGVA 1E79H 1FS0G 2AZ2A 2JR8A 2HJDA 5EZYA 1OJHA 4PD4D 1WT6A 4WY4D 4DV7B 1SLQA 1SQQK 3TXSA 1GN6A 4I50A 1M9NA 3CMEV 1G6UA 2WLHA 5BR8O 4ABMA 2PAJA 3CCQV 4TV9A 1JOYA 3ABVC 3L37A 5AVQB 4I4TB 2UXNA 3W7UA 1VQ9P 3H1KE 5CA1A 2LXBA 3OUFA 1PPJG 4LFAB 1S72V 1UPGA 4LF4B 2YXLA 1HNWB 3L72D 2XHBA 3CX5F 4IIJB 5F2VO 2ZDIA 2ZYAA 4O2BB 1NKNA 2FXPA 1HF9A 5J9PC 1K73Q 2IBZI 2OYHB 1H8HG 3JASB 2XOKG 4JYYA 4UV8A 1LT1A 3OMIB 4DV7O 1T3JA 4TLFA 3OJAB 3BCCJ 4WBAA 2NPSC 1WPBA 1SQXD 3BVHA 1KD1Q 1EC5A 4UVCA 3CCVP 1IFJA 3MHHC 1QHTA 5KA5A 1US6A 1PIXA 3FB7C 3LW5H 3NMDA 1KB9F 3G4SV 4LF4O 1HNWO 3IAYA 1Z56A 1N7SB 3KZIZ 3CX5H 2GUZA 1H2GA 4DV3B 1W59A 2K37A 4HYTB 3AK2A 1LTSC 1JJ2U 1SQQJ 5EIBC 4OPHA 1URQB 3NR7A 4OPAA 3JD1A 3A0BE 3D71A 4YIPA 1M8OB 2JIZG 2NZ2A 4HH2A 3H1JH 1K9MW 2UWJE 1HUCA 3CWBE 4BR6A 2YIAA 2POHA 1NS1A 1EBOA 4M3LA 3ZRXA 5DM6V 4P9PA 1WJZA 2N04A 2WA3A 1PL5A 3OAAG 2ZYGA 2WPQA 2HHHO 1ORQC 1QQCA 2EBOA 5KLIC 3M06A 2I8DA 4DV3O 3ZHUA 1RP3B 2GTAA 5CCHD 1ZMEC 4QJFB 2A45G 1LWUA 3E2EA 1NI8A 2M7WA 4JAUA 5B5EH 2OYIB 3F7VC 5BZBA 2BCCD 1K73W 4DUYO 1VMGA 1M4UA 1IFNA 2UXDB 5J2UB 3ETEA 5JH7A 4Q6GA 1FJGB 1AV1A 2M8RA 4LF7B 4XFJA 2GM4A 2QEXP 4JAAA 1EZVG 3D36A 4X1IB 1KD1W 3L75D 1GU5A 4D6TE 1P7BA 5D5PA 1D7MA 2OTLP 3CCLV 3H1LG 4A5UB 4O4HB 3HKDA 3E35A 2A0LA 5GW7A 3WU2Z 3OTOB 3TNUB 1S1CX 1R6KA 4W4LA 4UVBA 1OWAA 2UXDO 2Y69C 1FOSE 1YTFB 3B8MA 1L4AC 3KXDA 3L73J 3AG3C 1N7LA 3CX5I 5CA3A 2KXPB 2R3SA 2BSKA 1FJGO 1KQGB 3ZHRA 1YJWV 4LF7O 1EXJA 2AEMA 4Z1MH 4FPPA 2CGNA 1LT9C 5KAIZ 1UFIA 2JGUA 3E8FA 5GTIZ 2EIKC 1ZLZA 2BTOA 5IY5B 5KTBA 4I9QA 5H2FZ 4I6MC 1PP9H 3C3TA 5AVUB 4JI1B 4FLWA 4DRXA 3B8NA 4CH3A 3OTOO 5L8RJ 1AP5A 1BT8A 3BA9A 2GV9A 1KB9I 2HODB 3IF4A 1SA0B 4PDLA 4KJMA 3E22B 1GM8A 1GD2E 4PV1C 3FWNA 5KX5A 2PP6A 2A06G 3E8HA 3K04A 1GK6A 1YI2P 3I56V 1IBMB 3ZMZA 3FXDA 3FX7A 2Y48A 1Y74A 1R8EA 2BEZF 4DCKA 1CPYA 5KHHA 4O2AA 2XAFA 1ZRTD 3TGUH 3L71H 3TYYA 1DH3A 1L0NH 3ABKC 1UIXA 1SFCB 3Q5SA 4W7YA 4JI1O 1I7FA 2XZRA 2BOCC 3HKBA 1IBKB 1OCZC 1EQ7A 4EB6A 1AQTA 1JY3P 1HGZA 3M0DA 5CBOA 1MABG 2EIJC 4MVRA 2PGDA 1GTOA 2IBZE 5LOVA 2F95B 1VDFA 2KLVA 2YXYA 4I55A 4UCOA 1NTZK 4ZOLA 1GDTA 1HR0B 1NVPB 5C8YA 2H8PD 2FYNB 3L4FA 3ETQA 3JCUE 5APWA 2OTJP 2FXOA 4I5SA 1ZUQA 1IXBA 3SYAA 5IE9A 1I08A 1H0TA 1VF6A 3T4DA 4L74A 1IBKO 4ASUG 5B1NA 1JEKA 1WA8A 3RT3C 4I50B 1WRGA 2ZYDA 4W80A 5BU5A 3CCJP 1DK1A 1EFRG 2VQEB 1JB0J 3APQA 2NRGA 2QRXA 3GHGA 2AW9A 3AEAC 4TV9B 4EDFA 5H6QA 1HR0O 1SQPK 2KSEA 4YTPC 3GVMA 3AE8C 2QVAA 1VQMP 3HTKA 4PJ0H 2AXTE 1QGKB 2I1KA 1NTMH 1L0LG 1M57D 3ITKA 4UB8E 1L8DA 2O1KA 2CUGA 3L70E 2GUSA 3L74D 3H1HG 4FLUA 1Y66A 4RWUA 1LUWA 2WPSA 1M90W 1WLEA 1LR1A 2DE0X 1FD9A 4BW5A 5C39A 1RF1C 5DJUB 3TXQA 2VQEO 4A7PA 1NTZJ 2YMKA 3A3YB 1U97A 4L75A 1R3IC 4IOIH 4D6TJ 3VP9A 1GKFA 3JALA 2OIEA 3H1IG 2DWDC 1USEA 4CS4A 4WCEV 2R5BA 1HJBA 2ZCEA 1LTGC 2V7QJ 3TF5A 3QF7A 3WUTA 1SVFA 4ZNCA 3T1YO 3HD7A 1GN3A 2GUZB 3W67A 5LYJA 3UQ8A 4MN4C 1MSDA 3C90A 3JAKA 4FLVA 3B5NC 1CI6B 1LNQA 1RQUA 2B9BA 1OCOB 2G3AA 3FWLA 4DW1A 3U11A 5A9GA 1SQPJ 2RN0A 1Q2NA 1R1BA 3BCCH 1X0TA 1ZAUA 2FKXA 4X9QA 3OAKA 2OCCC 2W6JH 3LSQA 5GTHH 1QLEC 4X20A 4J41A 1WB8A 3CX5E 2QWOB 2X6BA 5AW8B 1NYHA 1LGHB 1BL8A 2KOGA 4O4JA 1U96A 1LWUB 1P84H 2O57A 4OGQB 1NU1G 1PV3A 2N1TA 3W68A 1OZHA 1OXZA 1SQQH 1XHXA 1JJOA 3P3NA 4C46A 2ZNJA 3H1JE 2YC0A 1VEWA 3LNMB 2WPVB 3ZIAG 1IFIA 2WSCJ 5JH7B 2FFDA 3E7KA 2A9HA 2VRSA 2ZE6A 2R72A 3J7AU 3UM7A 2X6AA 2WLIA 3Q1MA 4YXWG 3V4QA 1R6TA 1KILC 2A06D 2QJYB 2AHYA 2HJFC 1J2JB 4PELA 5J2TA 1LTTC 2EJRA 3AE3C 1B06A 3SSUA 1H89A 4N6JA 3J81N 2E76B 1OMIA 2EJ7A 4N21A 3H1KD 2R9IA 3HKDB 4BIZA 1BCCJ 1K05A 2OYHC 1YF2A 5B5EE 4F6EA 2ADQB 1H38A 1MMMA 4UXNA 1KILE 2P10A 5KJ7C 5LA6A 2DWEC 4X88A 2A45H 2XKMA 2IPPA 1FDMA 2Z5UA 1FC2C 3B8EB 2QM7A 4OVNF 2LP7A 4UFZA 2Q7EA 3T1CA 3FFQA 4WFAV 2PF4E 2Z0AA 3E1RA 2D3OW 1AI7A 2HP8A 1N7SC 1FZCB 3AG1B 2B1IA 4DO2A 3O8ZA 5KUMA 3ZRWA 1KZUB 3RL0B 2LW7A 4DRXB 1URQC 4FM1A 1YCIA 1IFMA 2NPSD 1X9VA 4LLHA 5KX5B 1NHLA 4LCUC 2IJKA 4ZIBA 1SQGA 1MUUA 5TISZ 3CL3D 3L73H 1P84I 1SQVG 3CXHH 4EI2A 1RF0A 4O2AB 4WFEA 4CBCA 3CJHA 2YUAA 1T2KC 5KHGA 3CCQP 3G80A 4I7ZB 3CWBD 2YXHA 2W90A 4O4LA 1W2EA 1PP9E 2XT9A 1NBMG 2PTMA 3V5BA 1ZV8A 3CRMA 4JYAB 2PZSA 3TK1A 4EB6B 1FZBA 1PL0A 2UUCB 2LJ2A 3WUVA 2OYIC 1XEQA 3O9OA 2QWRB 1XMOO 3CC4V 2QIWA 1FZEA 1IFPA 1KP2A 1BDCA 1GMGA 2DYSB 3LIDA 4I55B 4UB6Z 4ZOLB 1BSMA 5B3SB 2CTQA 2YSUB 2OWOA 1QBZA 1SF9A 4PA9A 2F93B 2Q1KA 1BQ0A 3HPLC 4DV2B 5AW0B 1YYCA 2A3QA 3TGUE 4QE9A 3L71E 4GOEA 4BIUA 5APVA 3ZJZA 2C2AA 1ZN5A 5KLVD 4OXSA 1NTKG 1W0JG 1H0TB 2K1EA 4PHZA 1PFIA 1MNGA 2YIBA 5BMVA 2FYUG 2KI7B 4K0KB 2UXCB 4CPGA 3G4SP 3K58A 2UUCO 1SZTA 3LUTB 4GX0A 4OWFA 4EOTA 1XREA 2ZINA 1EN4A 2Y0EA 3Q5PA 3EQ2A 4L87A 4PI0A 1AJYA 2W6AA 1FXVA 1FU1A 4DV2O 2F1MA 4MS2A 5AVTB 1XDCA 5JVDA 4BAYA 1G2CA 5K1PA 4GX5A 1JY2O 4HAMA 1NH4A 5AW6B 3FAVA 4U7NA 5LP6A 2JK5C 3RBZA 2GUVA 2W8ZA 2UXCO 2XTAA 1KQLA 4RO2A 4R50A 1HNXB 3BFRA 4JI2B 1N73B 3UO3A 5B1OA 1VQ8V 4PJ0E 3DC5A 2Q7CA 2JJ1G 1NTME 1IURA 1WMKA 4AYCA 4BXLA 3U1AA 2LO1A 5LYJB 3QNEA 4K35A 2QDOA 2WSSH 3RVZA 3IC7A 3JAKB 4X1KA 5CA0A 1SFCC 1FOSF 2RMKB 2UUBB 4X64B 2OGUA 3A8TA 3K5BA 1T5EA 3BRCA 4JI2O 3CCEP 4JF7A 1G8MA 4DW0A 3U10A 3A0RA 1JCCA 1K04A 3KHUA 4PV1D 4U3FG 3CCLP 1MG1A 1E5WA 1BSNA 1NTZH 4TOIA 1NH2B 1Q7YW 5KHJA 4MTOA 4R4LA 3KZIH 1KBHA 4X20B 2V7QH 1SQXG 1D5NA 1IK7A 2IJHA 3CP1A 2E3CA 2FYNC 2KSJA 2IBZD 2P6JA 1WP8A 1PPJE 2WLNA 2FXMA 1JMBA 2VWKA 4O4JB 1BDDA 1KP3A 3JSLA 5FLXN 2N1TB 1NKZB 1VQPV 3SWKA 3ZHVA 5CCHA 1FPOA 2WLLA 2BEQD 5AW4B 2EILB 1VQKV 3BCCE 1YTZT 2FFDB 4IL6Z 2RH0A 4FIPC 1R5LA 2JWAA 1SQPH 1S4XA 3QVNA 4C7NA 4UUJC 2KLUA 4CZZA 3SPCA 1O9GA 1YEWA 4TUYA 1OVUA 1AP6A 1RY3A 3JARA 2Q3EA 4J80A 1WAZA 1TU3F 2B88A 3B40A 4JI0O 1FDIA 3U1CA 4GKKB 1RH5B 2N9BA 3I56P 1P84E 3WMM0 4JI6B 2P5OA 4HNAA 1SQQE 2ZT9D 1F4NA 5LA6B 3L70D 1S5JA 5ITZA 3M0AA 2V4DA 1GW3A 1YBKA 3CC2P 3VYIA 1Y6XA 5CCGD 1DEEG 4DR7O 5EFWB 1R73A 5APTA 3ASNB 2WSCH 4IFFA 4DV4B 4FJCC 3UIAA 4YY3B 1PNMA 2BCCG 2L5GB 1G4YB 1XQ8A 1S3JA 2ZE5A 4I0XA 1VQ4P 1H8EG 4GKKO 3DXRA 2E74B 1ZOYC 4YXWH 3NXSA 3ZRWB 2QKCA 3WU2H 1JTHA 4X8AA 5FPOA 1HDJA 1NTKD 2F4VB 3L75G 4B3RB 1BCCH 2ZKOA 1BHAA 4RQEA 1OCOC 2FYUD 2P22C 1M1JC 2UU9B 3CCMV 3AEFC 1H2LA 2PI5A 1GRJA 3WB2A 1BGYJ 2XASA 2YKPA 5KAIH 3ZRSA 1BE3J 5GTIH 4DV4O 4ZKUA 3B77A 2EX3A 3OA7A 2HPCA 4H13B 3PTZA 1B04A 4GLXA 2KIKA 5H2FH 2K9YA 4IFMA 3VMYA 2JJ2G 3GLMA 5CBNA 3K03A 1DX7A 2I1JA 2RDCA 5BR8B 1ZR4A 3B5ND 4N3YB 4TT3G 2LGQA 1LWUC 4OGQC 2YIDA 4B3RO 1R3KC 1IZNB 3P7KA 3APOA 3D6YA 3CX5D 5DECA 5LHGA 3V4WA 2JVDA 3F5TA 5HFMA 1OZ0A 3VMXA 3L73E 2YS8A 1JY2N 4XA4A 2OT5A 3CXHE 4KXRA 3N2GB 1IZ3A 4FLZA 5L3DA 1TA8A 4FZ1A 3QWOC 1K9MQ 1OVRA 2JDIH 3H1JD 2QJYC 2IYPA 4B86A 3BPZA 5AVVB 1JO5A 1G1JA 2FTKA 5BMVB 2E76C 1NWQA 3OGCC 3QG5A 1FYJA 1KB9D 2HG5C 2WVRA 4KFMA 2WTYA 1AJNA 4FFBA 4WY4B 3SPHA 1VQNV 1J1DB 2KS1A 1ROPA 1JPXA 1F23A 4RJTA 4U3FD 1V55B 3OT7A 1VF5D 4X89A 1AB3A 1KILD 1N0NA 3DTUB 1SQBG 2GA1A 3T97A 3SYOA 2M3EA 1H8AA 3CRAA 5JVDB 1G2CB 3RGUA 3ZMVA 2IH1C 3FAVB 1GZLA 2M6YA 5LP6B 5CMZA 1FZCC 2J5UA 1VQLP 4QNHB 1KYOH 3AE7C 2K9JA 3F89A 3RL0C 4BWNA 5KJ7D 5IJ0A 1GH6A 1Q5OA 1XILA 1AI6A 2D2CD 1VQ7V 1CP9A 2PUSA 2HHHB 4J7KA 1PNLA 5APQA 2NNUA 3HKEA 2IU3A 4JYCA 1G1IA 1WB7A 5BVZA 3BA8A 1GL2B 1V9PA 1KECA 2Y0IA 1WN7A 1PGOA 2XNDH 5JQGA 3RVYA 4YIOA 2ITAA 4X1KB 4DUYB 4LWSA 2A7WA 3ZHTA 4I7ZC 1LJ2A 2BOBC 2ZR2A 1URQD 4PA7A 2EZPA 3M0DC 4JI3B 3EFGA 3L74G 5EC1C 3I55P 4LFCB 1AROP 5FNVA 1PP9D 3CCRV 5EYPA 2DYSC 3M91A 4WBNA 5EK0A 5B3SC 1YJNV 1M7LA 1NR7A 3EXAA 4EFEA 2JS3A 3ZMSA 4H33A 1Q82Q 4TQFA 1WNSA 2PYLA 3E8GA 4PD4H 4GYCB 3JYCA 3RWRD 3H25A 2WWWA 1UIIA 1K4DC 2NN4A 3QO7A 3K06A 3ABTA 3QTCA 2CK3G 1KV4A 3ZCCA 3C1LA 2M5AA 1BS3A 2YXQB 2Z5IA 2Q9LA 2WLLB 4JI3O 3TGUD 4FM2A 3W7WA 1HP8A 3L71D 1L0ND 4LFCO 2WA4A 3C3SA 1RE3A 1FAFA 1NTZE 3L72H 2QJKB 2WSEJ 5LGTA 4TUYB 3KZIE 3EFFK 4K3AA 3H1IE 1Y76A 1HWYA 3H1LJ 3O6QA 3NTNA 1BQZA 3FXEA 2KG7A 1CZQA 3SWYA 2O01J 3E8BA 4HNAB 2KNCA 1SP4A 2KK7A 5FL7G 4H44C 5ITZB 2EULA 3SR2C 3W7SA 1DD3A 1J95A 1L2PA 2XU6A 1JQ0A 4TV8A 4E4EA 1YITV 1N73C 3LSUA 1SQPE 1M1KQ 1IDSA 3JSNA 2B87A 4JZGA 3HE4B 1XMQB 3JC22 2A79B 4IHJB 4XDKA 2ZQMA 2LFSA 3LDCA 3RN4A 4I0XB 3QH9A 2K9PA 2WT7B 4FMTA 5B66Z 3SPJA 3N27A 1JTHB 3V2PA 3ZHQA 4L73A 3LDDA 1NTMD 2BASA 1Q82W 2E42A 2QM8A 3MHSC 1Y67A 1HTLC 2FL4A 3G71P 3E83A 3MUDC 2C9NY 2NPSA 5GONA 3OUSA 1M90Q 2QKAA 3H1KG 2JS5A 4TWKA 2W6BA 1N86A 4LNUB 1L0LK 1Z2GA 3VQWA 1XMQO 1Q81Q 4PA6A 4DXWA 3CCSP 3AG4B 4X1YA 3HUSB 3GMAA 1M5IA 2VS0A 1GW4A 4O4IB 4DR3B 2JGDA 1SQBD 1BHBA 1SFCD 3K0DA 5CJ4A 1X4TA 5KMGA 1HVVA 3WU2E 3OMNB 2Q68A 2N1TC 1TAEA 1BCCE 2YMYA 4DV6B 4EKWA 4LF5O 5TISH 4JTAB 2EILC 3BABA 3RBXA 2FFDC 5KAIE 1NR1A 2Q7HA 1QLNA 5GTIE 5L3BA 1NVPD 3K9AA 1BGYH 2YIUB 5EZYB 1BE3H 5H2FE 1BZKA 1M1KW 3K08A 4LH6A 1XUQA 3JATA 3ZHSA 4DR3O 3BCCD 1GN2A 2P7JA 1NT2B 1NAFA 1VQ8P 1KFMA 2IM9A 3K5LA 4DV6O 4FFBB 2DOSA 4XDLA 3SJAC 5CA1B 4UCSA 3N4XA 5IYBO 4PA4A 2KS1B 4UB6H 3B4SA 5LHHA 4TT3H 2EIMB 1YQ3C 3CWBG 3WUUA 2IZ0A 3L36A 3T1YB 1L0LJ 1OHHG 4MVZA 4LF8B 1K7DA 1P84D 2MJZA 1B3QA 2Q69A 1SQQD 3H1HJ 3ASNC 2EINB 2M0BA 5AW9B 1KC8Q 3Q5RA 1OFCX 4H0LD 1J5EB 1SESA 3FB6C 1PZQA 1Q81W 5EBWC 1GMJA 3GWOA 2C0WA 1YIJV 1PD3A 1MSWD 1NU1K 2K9JB 2Q8VA 2YNYA 2YEVA 4ZBMA 5IJ0B 1JCDA 1D2DA 3H1IJ 2JJLA 2NR5A 5KLVG 4LF8O 1FJKA 4JTCB 1L4AA 4GZRB 4MW3A 1JR9A 3HKEB 4FFKA 2KZJA 1VQPP 1PPJH 2HR3A 1VQ6V 1P84F 1VF7A 1K33A 5K1XA 2JO1A 2LKMA 4H13C 4D6TG 1VQKP 1J5EO 4UVAA 2IW5A 1I0HA 1KYOE 3Q4HA 2QE7G 3AEGC 4MW8A 4G28B 5IT9N 4LFBB 3M8AA 1GM7A 5H9CA 4GUNA 1VQ9V 2ZAEB 1NQTA 1R6NA 5FNVB 3KPEA 1R3JC 5EYPB 3Q3DA 2R70A 1M56D 1VQOP 1LP1A 3FKSG 1SQFA 3IC9A 2GSMB 4XE5B 3KCYA 2ZFCA 3R2PA 1JY2P 2CTWA 4KHPO 2HVKC 3DC6A 3ZRVA 4NPFX 1NU1J 4WFHA 3CC7P 1S9KE 1MA1A 3AECC 2RCVA 3RYCA 3OMAB 3L73D 4WWIA 2C9LY 4ZHQA 5L3FA 1KC8W 3R4YA 2HFEC 4HYOA 4LFBO 1VP7A 3CCVV 2BTQA 3AEBC 3OEEG 1RE4C 4YJ2A 1X59A 3MP7B 4WY4C 1Z5WA 1J1DC 3RK3B 5LXTA 1UJWB 2CPSA 2JKVA 3IAOA 1IXMA 1DF4A 2ZIOA 3AEIA 2J59M 4R6ZA 1Z5VA 5LMUB 1SQVK 5TJHA 3O6QB 4DT0A 1A02J 4PD4E 3VBBA 2IH3C 2R9RB 2KG7B 1XTGB 1PKXA 2RJZA 2H94A 5JCOC 5LP6C 2E76D 2HVJC 3ML0A 2KNCB 1FFXA 3OD4A 2BSKB 1FZFA 1QNMA 4IL6H 5JWPA 3CCUP 4U7JA 3CXHF 2IBZG 2LW1A 4TV8B 2UXXA 3L72E 3STLC 2P7TC 4MTFA 1EZVH 4JQ0D 5LMUO 5LHIA 5CCGA 2WSEH 4JI8B 2RMZA 4QIWF 2JP3A 3IGAC 4DV0B 1RM1B 2XAGA 5KA6A 1GL2C 1MZ9A 2AXCA 1S2EA 2H88C 2K3RA 4KHXA 3H1LH 1K8AQ 1XMOB 2E5LB 3VQXA 2DW4A 2IZ1A 4NTXA 2W27A 2O01H 1GK4A 3NFQA 1PGQA 4EFBA 5LBQA 1KQFB 3M9BA 4JAVA 2QEXV 4LF9B 1Y74B 3RK2B 2W6IG 1CSBA 3CMEP 1SQVJ 3MDSA 2H43A 1LTBC 1EDLA 1DLBA 3V2QA 3FYIB 4NXNO 1ZSPA 4GX1A 2OTLV 5BU8B 2FKWB 4KL1A 3H32A 3L70G 5EIBD 4JI8O 1VIBA 4U3JA 2P4KA 4X1YB 3HRNA 3HKBB 4DV0O 3E1IA 2JGDB 2QKSA 1E79G 3H9VA 2F43G 1S72P 1QVGU 3SPGA 2E5LO 5LOVB 5EC2C 5AVSB 1BMFG 2PGGA 3BASA 3CD6V 2ZR3A 5DEDA 1XTCC 5CCHC 1AVYA 1XNRO 3CPWU 5C8YB 3E89A 4J7ZA 1XNQB 4LF9O 1SS1A 3B5NA 2ZE8A 3HR0A 4PDMA 4WFBV 1K4CC 1V54B 2A06H 3S3WA 1N0JA 2QJKC 4N78E 2A45I 2Y4TA 4J9YB 3A2AA 3VMZA 3JATB 1X8YA 1WA8B 3M7MX 3H01A 4I1LA 3F5WC 3AE5C 1Q7YQ 1VQ7P 2R9AA 1NTZD 1EM1A 1S5LX 2XDJA 3GHGB 4D6TD 2GTSA 1ZX3A 1TUBA 4DK0A 1EZVI 1K8AW 2PFXA 3BVOA 1QR8A 4BW9A 1XNQO 1EDJA 3HTKB 1YI2V 5DN6G 3W7XA 5TISE 3BHPA 1U7MA 4UCVA 3V2NA 1ZR2A 1AVOA 3CYOA 4J11A 1BGYE 5IY5C 5CB4A 4ZI7A 4FLTA 2LGWA 4G2KA 4I4TA 3O65A 4MTGA 5EBMC 1BE3E 1SQXK 4NKGB 2Q9IA 2F66C 5FPRA 4HB1A 3C9IA 4NPDA 1KILA 1LTJA 3PJSK 3RYIA 3CXHI 1SKVA 3CCRP 1SQPD 1L4AD 1YJNP 3JALB 4J42A 1QL1A 4H44D 1RFYA 3CE2A 2YEVB 3QO8A 4IL6X 1FZGA 3H1JG 1Q86W 4UB6E 5AW5B 5CMUA 2AHZA 5IYDO 3TDKA 5KJ7A 3HD7B 1DGSA 1RPRA 1Y47A 5HFLA 1AFOA 3VTPC 1Q90D 4JI7B 2OTJV 1L0LH 1AR4A 4RQFA 1U57A 3AG4C 3H1HH 1XBLA 3HUSC 1S5LZ 1FS0E 4Z2WA 5AW3B 3II6A 3L72J 3Q4HB 3GB7C 1FJPA 1AVMA 5L3GA 4JI5O 2V4HA 4FZ0A 2QM4A 2IYOA 1GAXA 1KKDA 2O01N 3OE7G 1URQA 2OARA 1XL4A 1VQMV 1NZ6A 3H1IH 2G38A 4LC1A 4JI7O 1NH2D 5IWAB 1SQXJ 2HLOA 1LP1B 4IFDK 4JI0B 4AQYB 1YJWP 1BCCD 3GWKC 3SFEC 3WB1A 4B08A 2YIUC 3LIEA 4NYKA 2BE3A 1KUQA 3EWKA 1QU7A 1YITP 2H8PC 3VP8A 2X7RB 4ZHQB 3WG7B 5KAFZ 1JA8A 4ZKIA 1T3UA 5E79Z 1N34B 5DJTB 3HE5A 4D7TA 4DR7B 4EYYQ 4YJ2B 2WLIB 3ETGA 3OR7C 5LXTB 2OYIA 1N4CA 3D3IA 3K79A 3SWFA 2EIMC 1JMKC 4Z1MG 5J2TB 5IWAO 1AJQA 2ZDIC 1KTMA 3CHXA 5J2UA 3FB5C 4AQYO 4PDVA 2R3CA 2EINC 1GM9A 1SZXA 3BATA 1I5XA 1Q6HA 4JV5B 1AILA 2XUMA 1A02F 3ABLB 1PP9G 3K5MA 1S5LE 4CC6A 1NU1H 1N34O 2E75B 1QVGO 2J58A 3KYQA 3K9SA 1TGOA 2LXCB 1W0KG 3CLQA 3KCXA 4P2ZA 4DR4B 5JJJB 3VQVA 1DTOA 2ZT9B 3RYFA 3CPWO 4X62B 3TNUA 1N8RQ 4GCZA 1KFNA 1VL2A 2BCCJ 2YICA 4OH8B 2O3JA 2EZOA 1LUVA 3TGUG 3L71G 4MTXA 1L0NG 3N2KA 4JV5O 3S4RA 1H2KA 1X79B 3G6BA 3OM3B 1NJIQ 1OCCB 2X6CA 3L75J 1N32O 3CEIA 4AUWA 2IFMA 3MAQA 5H6RA 3EHBB 3C8VA 4X65B 2G8YA 1E1QG 4DR4O 1IK9A 4GT1A 4IL6E 3FX0A 2B89A 3LSSA 3MZWB 5LGUA 4X62O 2DJVA 1K92A 3P32A 5L3CA 3CJHB 4HZ3A 1YQ4C 1YJ9V 1EZVE 2ZXXA 4O4LB 3H32B 4YXDC 3EVKA 3R66A 3ZN1A 2QA4V 4GODA 5B66H 1Q43A 4YHHO 3S1KA 4YJ3A 3SJQC 1ZWIC 2DN9A 1OVVA 4B3SO 3H1LE 3AEDC 2QTSA 2P06A 1FXKA 4X65O 1SFCA 1JVMA 4RUFA 2GHYA 2Q4PA 2ZXWB 3SYCA 3SYQA 4DR1B 1YDXA 4DV5O 4U7OA 1QLED 4LR3A 3D36C 3V6IA 1W5CE 3RK3C 1QR9A 2DMXA 4HBNA 1XHZA 1FDOA 3ETDA 3G3ZA 1NTMG 3JAWA 1SQVH 1DD4A 2OQQA 3PH0A 4NTWA 1KYOF 1N8RW 5B1BB 2Q5ZA 4O9BA 1HNZO 2B1GA 3JD0A 2ZM6O 1FE6A 3RK3E 1H2NA 1JCHA 4LH7A 4CH6A 4DK1A 1ENVA 1TUBB 1VQ6P 1HW7A 1IBLO 5AW7B 1KQSU 3A0BZ 1NJIW 4DR1O 4NR1A 3VOUA 3L9DA 4IYIA 4BWAA 2JEEA 2A06E 3CB2A 1I94B 2CH7A 1SQBJ 3ZMTA 4RUEA 4GKJB 2QR4A 5CBFA 5CB4B 4ZI7B 5CN0A 3AG1C 2HKOA 1VF5B 2JWDA 1PNKA 5K5GB 1KILB 1LTJB 1NTKH 3RYIB 1RM1C 2YO2A 4GIFA 3OR6C 4OX9B 2AEJA 2OTKE 1NOHA 2FYUH 1VQ5V 3D6ZA 1D5AA 2P4VA 1YTZI 4X66B 3BCCG 1GTWA 4Y99B 1I94O 2SPZA 3RK2C 2FBWC 2W6JG 3M99B 4PD4F 1N7SD 2W83C 2D2CB 2WLJA 2PRRA 4GKJO 2KB1A 5CA0B 2X0LA 1TUEB 5IDJA 4BRYA 1GL2D 2Y0PA 4H37A 4LFAO 4I9WA 1HH0A 4OX9O 3OGIB 4QPKA 5CHXA 1FFTB 3L74J 1SQQG 3F5HA 3TETA 3G6EV 1SS3A 1K5SA 1WP7A 2CDYA 3THOA 1URFA 4X66O 3MIWA 4IYHA 1ZTEA 3LNNA 1CI6A 1PGJA 1PL4A 4MVQA 1M1JA 1T2KD 3CRRA 3CMAV 1V54C 1L0LE 4DUZB 3DSQA 4JASA 2JEXA 2Z4EA 4FVMA 3A0HZ 3JD4A 1XL6A 1VF6C 3X2QB 1FKAO 1X22A 3H1HE 3IN6A 5AW2B 4DOJA 3BEHA 2KP8A 1KB9H 4IT5A 3K5OA 1W2BU 1H2SB 1VPCA 3M9QA 2P58A 3P8CE 1Y4MA 4N78D 2QJ1A 3GHGC 3HE5B 3ASOB 3I5DA 4C7NB 1RSOA 1PV0A 4U3FH 2F23A 1KYOI 4L76A 1IX9A 3JARB 1GK9A 2ZXEB 2CTPA 3G67A 5CBHA 4DR5B 3JSVC 1QL2A 2VRZA 2Y9ZA 3S9OA 4DUZO 3K0GA 1Q8IA 5KLVE 4EEQA 1ZW0A 1SQXH 3K57A 3ABMB 4N23A 1JFFA 4WF9V 3CCEV 1S5HC 4YPCA 2YI8A 1OCRB 4W4KA 3KKYA 3MD0A 1AI5A 1YTFD 3UO2A 2Q67A 1BGYD 2OIGA 1FAVA 3USSA 2XNXA 1BE3D 2W0XA 4LGDE 1JX9A 5BY1A 4J9ZB 3RYFB 4TSFG 4DR5O 3L73G 4NB5A 2PYJA 3HD7C 3CC4P 2PY5A 2P90A 2UUAB 5KHKA 3VMAA 3CD6P 3DXRB 2Q6AA 2WMMA 3ZBHA 3A7OA 4UCTA 3N2KB 3A0HE 1P7GA 4R4MA 3JCUZ 3RW0A 1MV8A 2IFNA 2RN9A 1NU1E 4LF5B 1FZCA 1P49A 3TJTA 4PD4I 4JGSA 3MGNA 1XI1A 1USDA 1KQSO 5IYCO 1NVOA 3H1KJ 1B6QA 1JUNA 2DQ0A 2HPCB 1Y8AA 3K59A 2UUAO 1BSHA 2QJPB 2H3OA 3PP5A 1OV9A 3FB8C 2BCCH 2AXTZ 1VARA 4UB8Z 3T1HB 4GDOA 4AHCA 3QO5A 4YJ3B 3VOPA 2VWJA 3LDEA 1T6AA 3IFXA 4GKGA 3B71A 3PLNA 5AVXB 3WG7C 1FXKB 1PPJD 1R5SA 2CGOA 4QE7A 3L75H 3UCSC 2L6LA 4P9OA 3CC2V 1F7YA 4E2LA 2AEFA 4B7EA 4MSWC 4AQRD 1LTIC 5KLVK 2OYQA 3K5NA 2ATKC 1TVKA 5CBGA 2Q3IA 2Q0OC 3ZDMA 3Q2YA 3F7YC 2KB7P 3JAWB 1VQ4V 2DQ3A 4KT0J 4UCUA 5B66E 3T1HO 2CE4A 3AE4C 1IBMO 3SDLA 3OEHG 3GF7A 3AG2B 4GX2A 2IJIA 3L35A 1FZAA 4DR2B 5IJ9A 2M3BA 3ABLC 1IFDA 2E75C 5KUKA 3CWBJ 2HLDG 3D8CA 1SERA 1Q3EA 2IU0A 1K3EA 3T97B 2IJJA 2ADPA 2WSFJ 4LF6B 2ZT9C 3SGIA 3TSIA 2CH7B 4UCRA 1QEXA 1M57B 1MFZA 1SRYA 1SQVE 3P3PA 2R44A 3PRJA 5CCGC 1DF5A 2E74C 5M1BA 4JBZA 1J1EB 2WSSG 2OYOA 2DYRB 5AG2A 4DR2O 1YHQV 4JYBA 2ZNIA 3B09A 3E86A 4H0LB 1W2BO 1OCCC 2YKQA 3AE2C 3AK3A 3AE1C 2WQYC 5KLVJ 2UXBB 3D70A 2B5UA 5B1AB 2Q6QA 4LF6O 1NTZG 3RL0g 1KN7A 2L35A 1RF0C 1LT9A 3JD3A 4KHPB 4P30A 2ZVNB 3AEEC 1N73A 5JQGB 2ZE7A 3J80N 3CRQA 4LWSB 2V7QG 2KUBA 1SQBH 4BRYB 5KKZB 2C0XA 1EN6A 1LTAC 2QGNA 3CRCA 1ZL8A 2Y9YA 4WFFA 1NTKE 2CTRA 2FYUE 3I5CA 3W7TA 1O9HA 1EZVD 3U59A 5BXZA 2ILMA 4WBNB 5B5EZ 5JJEB 2UXBO 3MTUE 2ZXWC 2ZD9A 3SJBC 1FBMA 3H1LD 2LFRA 1THZA 1M1JB 1SQPG 3MUDA 1AR5A 4UV9A 2QSIA 3ICXA 1Y9BA 1VQLV 1M56B 1S5LH 2Q0AA 3CXHD 4OGQD 2H89C 4MVSA 2M5AB 5B1BC 5D5QA 3UT5A 5C93A 2KKWA 4G27B 1YSCA 2YDEA 3ZN0A 2E5TA 1CEZA 2HEPA 2R32A 3D3QA 1RSOB 2FY8A 3L74H 3SJCC 1OW6A 1AR1B 1EXIA 5AVYB 4F6RA 1V55C 1Y76B 5EBLC 5AVWB 5A2QN 1EDKA 2K1AA 3ZX6A 3RK3D 4FK5C 3AE9C 2N05A 3CCMP 1Q6UA 4C7RA 1JFFB 2GDSA 2HG5D 5IYZA 1VF5C 5KAFH 1KB9E 4CH4A 5E79H 3JD2A 1LTJC 2Z3YA 3PN1A 1MKMA 1YJ9P 1H88A 3T2MA 2KQXA 2ARHA 2CK3H 2R5DA 4TQDA 3I55V 1SC5B 2Y0DA 4ASVA 2QA4P 1BCCG 3RFRA 1JY3O 2WPDG 2B87B 2Q5UA 2FB5A 4PA3A 4NTYA 4B7KA 4NXNB 1PGPA 1AI4A 4U3FE 2CPBA 1ZLLA 2QTOA 4DV1B 1Q6IA 4FLXA 4Z1VA 3AK1A 3P30A 1RQVA 4Y99C 1JOCA 3T4ZA 1NTKK 3ZS8C 2D2CC 4K8XA 1SQXE 2ZJSE 2XAQA 2FYUK 3RL0D 3IJ4A 2V1DA 3GF3A 2GBOA 3HB3B 1U7JA 1S76D 3G9RA 1XNRB 4DR6B 1RF1A
chains in the Genus database with same CATH topology
3AE1C 3FGAD 1ZMEC 2WQYC 1OW7A 3Q3DA 3AE3C 2QJKC 2E76B 1OMIA 4PV1B 1ZRTE 3D70A 1KTMA 3GMAA 1K05A 2E74B 1ZOYC 3RL0g 2P10A 1KILE 4I7ZC 3AEEC 1JB0J 3AECC 3AE5C 1VF5B 1ZP0C 3AEAC 1S5LX 4XFJA 3R4YA 4YTPC 3AE8C 4R4MA 2E75B 3AEFC 3AEBC 3D6ZA 1WMKA 3IAOA 2ZT9B 4H13B 1KORA 2K9YA 1VL2A 3GLMA 2FBWC 3H25A 1S1CX 2D2CB 3SFDC 2YMKA 3ABVC 2QSIA 4OGQC 1Y9BA 1KQGB 4GDOA 2E76D 3D6YA 1K04A 4PV1D 4Y28J 4Z1MH 1EXJA 2V7QJ 4OGQD 2H89C 4H44D 4IL6X 4U7JA 4TT3H 3C8VA 3B71A 1YQ3C 2FXPA 2G8YA 1HF9A 2WSEJ 4R4LA 1IK7A 2FYNC 1NGMB 4H0LC 4I7ZB 2E75D 1Q90D 1OW6A 2QJYC 1YQ4C 3O6QA 1EXIA 5L8RJ 3Q5RA 4RKUJ 3LW5J 4H0LD 2JP3A 1RQUA 2G3AA 4YXDC 1U57A 3Q2YA 1DIPA 2E76C 3AE9C 2O01J 2H88C 4PV1C 1GMJA 4KT0J 2BEQD 3IN6A 2QIWA 3AE4C 1PIXA 4H44C 3GF7A 2E74D 1DD3A 1VF5C 1KMIZ 3AEDC 2BEZF 1R8EA 1KQFB 5KKZC 1MKMA 1VF5D 1UIXA 2E75C 3Q5SA 2IDBA 1NYHA 1TU3F 3D71A 2MKVA 1FDIA 1PV3A 4OGQB 2NZ2A 2ZT9C 1FDOA 2JO1A 2WSFJ 4H44B 4H13C 3T97B 3AE6C 1DD4A 1HJ0A 2OQQA 2J5UA 3S9OA 3SFEC 2YIUC 1RQVA 2ZT9D 3AE7C 4H13D 1OW8A 3EWKA 2D2CC 2WPVB 2WSCJ 3AEGC 2E74C 5M1BA 2QJPC 3RK3E 3Q5PA 1PL5A 2D2CD 3GF3A 1AJYA 4H0LB 3Q1MA 5KLIC 3G9RA 3AE2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZT9 B;  4H13 B;  2FYN C;  4I7Z B;  2QJK C;  2K9Y A;  1Q90 D;  2E76 B;  2QJY C;  4PV1 B;  1ZRT E;  5L8R J;  4OGQ B;  2WSF J;  2E74 B;  4H44 B;  2D2C B;  3LW5 J;  4RKU J;  2YIU C;  2O01 J;  1JB0 J;  2QSI A;  1VF5 B;  4KT0 J;  1S5L X;  2QIW A;  2WPV B;  2WSC J;  4Y28 J;  2QJP C;  2E75 B;  4IL6 X;  3C8V A;  4H0L B;  5KKZ C;  5KLI C;  2WSE J; 
#chains in the Genus database with same CATH topology
 2ITD C;  1XOU A;  5GON B;  2NPS B;  3FGA D;  3UKM A;  5AVR B;  2JEU A;  2B9Z A;  1QX8 A;  4DV1 O;  2N74 A;  3RK2 D;  4B3M B;  4LP8 A;  1VQN P;  3L70 J;  2QG4 A;  1COW G;  1DEB A;  1H2M A;  4QPJ A;  1Q86 Q;  5KMG B;  1NO4 A;  2ITC C;  1R3L C;  2JDI G;  3HKC A;  1N36 B;  3KDP B;  3IFM A;  4D7S A;  3V2R A;  1EN5 A;  3X2Q C;  1K34 A;  4DR6 O;  1G1X B;  1P4R A;  4FLY A;  1L0L D;  1KOR A;  4EIJ A;  4XDJ A;  1L1F A;  4WVZ A;  3ASO C;  1JM0 A;  3H1H D;  1GO3 F;  4R8C A;  3WFV A;  4B3M O;  1AA0 A;  1NTK J;  2LQT A;  3SFD C;  1TVK B;  1HBW A;  3H1K H;  3P8C D;  4C7U A;  3AG7 A;  1M93 A;  1VQ5 P;  2FYU J;  4PI2 A;  2BCC E;  4PJ0 Z;  5KLI B;  3OW2 U;  3KG2 A;  1RPO A;  1N36 O;  2L91 A;  1K97 A;  1MOF A;  3RYH A;  3ABM C;  3H1I D;  3N2G A;  1PM9 A;  4B3T B;  5IJ9 B;  2WLK A;  3CXC U;  4CS3 A;  2KZI A;  3VN0 A;  3G71 V;  1L0N E;  3S3X A;  1OCR C;  4JTD B;  3L75 E;  1S0V A;  4RAI A;  1KU9 A;  5APY A;  4PDR A;  4JYA O;  3OFN G;  1K5Q A;  3N7N A;  2H7H A;  3LW5 J;  1KKC A;  3CS5 A;  1RE4 A;  5LMN B;  3CCS V;  1AQ5 A;  3BRT B;  2YKO A;  2Z5H A;  4WY4 A;  3TCU A;  3G6E P;  4MT8 A;  1IVS A;  4IIJ A;  1MZE A;  1KMI Z;  4O2B A;  4JI5 B;  2XND G;  2ODM A;  4B3T O;  4RES B;  2OYH A;  2XAH A;  1N2D C;  3JAS A;  3CMA P;  4JZ2 A;  4L8J A;  3A0B H;  3ABU A;  3BAA A;  2IDB A;  2HYN A;  3H1J J;  3ZMU A;  3A5T A;  2Y69 B;  5JCO A;  1L4A B;  2QWN B;  3AG3 B;  5L3E A;  1QVF U;  3FD9 A;  4K8Z A;  4K0K O;  4H44 B;  3AE6 C;  3CWB H;  5LMN O;  5JJN B;  1LT9 B;  4HJG H;  3HD7 D;  5APS A;  1NU1 D;  1OW8 A;  3M9H A;  4WB4 A;  1N33 B;  4JPZ B;  2EIK B;  2WSF H;  2QJP C;  4JPR A;  4W7Z A;  5GTH Z;  3CCJ V;  2Q73 A;  2YO3 A;  2ZVO B;  4ZKP A;  1N7S A;  2QWQ B;  1IO4 A;  1ZL8 B;  1NAY A;  4U3F J;  4Q20 A;  1NKD A;  2YXR B;  1YXB A;  2N9Y B;  4LBE C;  1GL2 A;  2NLJ C;  4GOF A;  1JMM A;  1F4M A;  1FXK C;  3OTF A;  4PV1 B;  1ZRT E;  5CJ0 A;  1YVW A;  2W0F C;  3RGB A;  4BIO A;  2WPR A;  5KLV H;  3L72 G;  1HNX O;  3KQG A;  2AZ0 A;  1T8Z A;  1N33 O;  1OIP A;  4KP4 A;  5E1A C;  2FYZ A;  3RYC B;  1SQB E;  3ABK B;  5AW1 B;  2MW2 B;  4MVO A;  4D6T H;  2RQ6 A;  3B2E E;  1L0N K;  2N1T D;  2WIT A;  3P8M C;  1JY3 N;  1F51 A;  2BTQ B;  3UT5 B;  3MHV A;  3AG2 C;  4ASW A;  4NXM B;  1OCZ B;  1QCE A;  2QE7 H;  2KYV A;  2EIJ B;  2ETN A;  3STZ C;  3K3W A;  1IJD B;  2UUB O;  2XV5 A;  2P2U A;  1JNM A;  4X64 O;  1A32 A;  4ICG A;  4F6R B;  3H6P A;  2AGA A;  3FYE B;  1MZF A;  2IX7 C;  1FXH A;  3CI9 A;  1S77 D;  1WPX A;  4MVM A;  4FM0 A;  3A0H H;  3BRV B;  4Y28 J;  1M57 C;  4X1I A;  4F4L A;  1YZB A;  2Q7G A;  2WLM A;  1N32 B;  4XBF A;  1PP9 J;  1FFX B;  1MFT A;  3ZED A;  5IYZ B;  5GTH E;  3WB0 A;  1J1E C;  1HWT C;  2P67 A;  4NXM O;  2DYR C;  4DYL A;  4O4H A;  2WZ7 A;  1SQV D;  4H0L C;  1NGM B;  2E75 D;  2K88 A;  2Y4U A;  1CXZ B;  5LGN A;  3L74 E;  4RKU J;  3DGE A;  1VQO V;  1DIP A;  2XAJ A;  3U0Z A;  5B1A C;  3SYP A;  3TGU J;  3BY6 A;  4YHH B;  1NTM K;  3L71 J;  1L0N J;  4AI8 A;  3CC7 V;  4KUM A;  4B3S B;  4IGG A;  2E74 D;  4QMA A;  3OW2 O;  5KKZ C;  3GW6 A;  4CC5 A;  5KAF E;  1GU4 A;  5KHI A;  3HE4 A;  4NPE A;  5E79 E;  4IHJ A;  5APX A;  1CW5 A;  1RF1 B;  4DV5 B;  3R65 A;  1SET A;  2WT7 A;  2QSA A;  2MKV A;  2RKL A;  4I2L C;  1KYO D;  2CAZ C;  4R7C A;  4CS2 A;  1OX3 A;  2HOD A;  1SA0 A;  2ZIM A;  3E22 A;  2IBZ H;  1HJ0 A;  4JI6 O;  4JF3 A;  4JI4 B;  1E1R G;  2QWP B;  4U3J B;  1SQB K;  5AVZ B;  4H13 D;  5APU A;  3JAM N;  2JRI A;  1HNZ B;  1BGY G;  4J7J A;  1RHZ B;  1AJP A;  1ZXG A;  2ZM6 B;  4RO0 A;  3A2F A;  3HKC B;  1BE3 G;  3IR9 A;  3JCU H;  2YI9 A;  3SPI A;  2LR2 A;  5H5N A;  2O1J A;  2PI4 A;  1M56 C;  1I5Y A;  4NVP A;  4YY3 O;  2VQF B;  1IC2 A;  4LNU A;  2FML A;  1IBL B;  3B5N B;  1OW7 A;  3CCU V;  4J10 A;  4DJG A;  4MVU A;  2E5Y A;  3HUS A;  4AIL C;  2WAM A;  4HKZ H;  2P1J A;  1RE3 C;  1S9K D;  4O4I A;  1YIJ P;  2DW3 A;  3JCZ A;  2E43 A;  4QGP A;  3GG2 A;  4WFG A;  4JI4 O;  2F4V O;  3PHL A;  4DZO A;  1QVF O;  2OCC B;  1NTM J;  1YHQ P;  5LL6 Y;  1ZP0 C;  4CH5 A;  1QLE B;  2KSD A;  2UU9 O;  1EDI A;  1EZJ A;  2RNB A;  2AXT H;  2Y0C A;  2MK3 A;  3CSX A;  4UB8 H;  4ZMD A;  3L70 H;  3VQY A;  1GN4 A;  2OCH A;  2YIB D;  2HFE D;  3RYH B;  2VQF O;  1HGV A;  1E79 H;  1FS0 G;  2AZ2 A;  2JR8 A;  2HJD A;  5EZY A;  1OJH A;  4PD4 D;  1WT6 A;  4WY4 D;  4DV7 B;  1SLQ A;  1SQQ K;  3TXS A;  1GN6 A;  4I50 A;  1M9N A;  3CME V;  1G6U A;  2WLH A;  5BR8 O;  4ABM A;  2PAJ A;  3CCQ V;  4TV9 A;  1JOY A;  3ABV C;  3L37 A;  5AVQ B;  4I4T B;  2UXN A;  3W7U A;  1VQ9 P;  3H1K E;  5CA1 A;  2LXB A;  3OUF A;  1PPJ G;  4LFA B;  1S72 V;  1UPG A;  4LF4 B;  2YXL A;  1HNW B;  3L72 D;  2XHB A;  3CX5 F;  4IIJ B;  5F2V O;  2ZDI A;  2ZYA A;  4O2B B;  1NKN A;  2FXP A;  1HF9 A;  5J9P C;  1K73 Q;  2IBZ I;  2OYH B;  1H8H G;  3JAS B;  2XOK G;  4JYY A;  4UV8 A;  1LT1 A;  3OMI B;  4DV7 O;  1T3J A;  4TLF A;  3OJA B;  3BCC J;  4WBA A;  2NPS C;  1WPB A;  1SQX D;  3BVH A;  1KD1 Q;  1EC5 A;  4UVC A;  3CCV P;  1IFJ A;  3MHH C;  1QHT A;  5KA5 A;  1US6 A;  1PIX A;  3FB7 C;  3LW5 H;  3NMD A;  1KB9 F;  3G4S V;  4LF4 O;  1HNW O;  3IAY A;  1Z56 A;  1N7S B;  3KZI Z;  3CX5 H;  2GUZ A;  1H2G A;  4DV3 B;  1W59 A;  2K37 A;  4HYT B;  3AK2 A;  1LTS C;  1JJ2 U;  1SQQ J;  5EIB C;  4OPH A;  1URQ B;  3NR7 A;  4OPA A;  3JD1 A;  3A0B E;  3D71 A;  4YIP A;  1M8O B;  2JIZ G;  2NZ2 A;  4HH2 A;  3H1J H;  1K9M W;  2UWJ E;  1HUC A;  3CWB E;  4BR6 A;  2YIA A;  2POH A;  1NS1 A;  1EBO A;  4M3L A;  3ZRX A;  5DM6 V;  4P9P A;  1WJZ A;  2N04 A;  2WA3 A;  1PL5 A;  3OAA G;  2ZYG A;  2WPQ A;  2HHH O;  1ORQ C;  1QQC A;  2EBO A;  5KLI C;  3M06 A;  2I8D A;  4DV3 O;  3ZHU A;  1RP3 B;  2GTA A;  5CCH D;  1ZME C;  4QJF B;  2A45 G;  1LWU A;  3E2E A;  1NI8 A;  2M7W A;  4JAU A;  5B5E H;  2OYI B;  3F7V C;  5BZB A;  2BCC D;  1K73 W;  4DUY O;  1VMG A;  1M4U A;  1IFN A;  2UXD B;  5J2U B;  3ETE A;  5JH7 A;  4Q6G A;  1FJG B;  1AV1 A;  2M8R A;  4LF7 B;  4XFJ A;  2GM4 A;  2QEX P;  4JAA A;  1EZV G;  3D36 A;  4X1I B;  1KD1 W;  3L75 D;  1GU5 A;  4D6T E;  1P7B A;  5D5P A;  1D7M A;  2OTL P;  3CCL V;  3H1L G;  4A5U B;  4O4H B;  3HKD A;  3E35 A;  2A0L A;  5GW7 A;  3WU2 Z;  3OTO B;  3TNU B;  1S1C X;  1R6K A;  4W4L A;  4UVB A;  1OWA A;  2UXD O;  2Y69 C;  1FOS E;  1YTF B;  3B8M A;  1L4A C;  3KXD A;  3L73 J;  3AG3 C;  1N7L A;  3CX5 I;  5CA3 A;  2KXP B;  2R3S A;  2BSK A;  1FJG O;  1KQG B;  3ZHR A;  1YJW V;  4LF7 O;  1EXJ A;  2AEM A;  4Z1M H;  4FPP A;  2CGN A;  1LT9 C;  5KAI Z;  1UFI A;  2JGU A;  3E8F A;  5GTI Z;  2EIK C;  1ZLZ A;  2BTO A;  5IY5 B;  5KTB A;  4I9Q A;  5H2F Z;  4I6M C;  1PP9 H;  3C3T A;  5AVU B;  4JI1 B;  4FLW A;  4DRX A;  3B8N A;  4CH3 A;  3OTO O;  5L8R J;  1AP5 A;  1BT8 A;  3BA9 A;  2GV9 A;  1KB9 I;  2HOD B;  3IF4 A;  1SA0 B;  4PDL A;  4KJM A;  3E22 B;  1GM8 A;  1GD2 E;  4PV1 C;  3FWN A;  5KX5 A;  2PP6 A;  2A06 G;  3E8H A;  3K04 A;  1GK6 A;  1YI2 P;  3I56 V;  1IBM B;  3ZMZ A;  3FXD A;  3FX7 A;  2Y48 A;  1Y74 A;  1R8E A;  2BEZ F;  4DCK A;  1CPY A;  5KHH A;  4O2A A;  2XAF A;  1ZRT D;  3TGU H;  3L71 H;  3TYY A;  1DH3 A;  1L0N H;  3ABK C;  1UIX A;  1SFC B;  3Q5S A;  4W7Y A;  4JI1 O;  1I7F A;  2XZR A;  2BOC C;  3HKB A;  1IBK B;  1OCZ C;  1EQ7 A;  4EB6 A;  1AQT A;  1JY3 P;  1HGZ A;  3M0D A;  5CBO A;  1MAB G;  2EIJ C;  4MVR A;  2PGD A;  1GTO A;  2IBZ E;  5LOV A;  2F95 B;  1VDF A;  2KLV A;  2YXY A;  4I55 A;  4UCO A;  1NTZ K;  4ZOL A;  1GDT A;  1HR0 B;  1NVP B;  5C8Y A;  2H8P D;  2FYN B;  3L4F A;  3ETQ A;  3JCU E;  5APW A;  2OTJ P;  2FXO A;  4I5S A;  1ZUQ A;  1IXB A;  3SYA A;  5IE9 A;  1I08 A;  1H0T A;  1VF6 A;  3T4D A;  4L74 A;  1IBK O;  4ASU G;  5B1N A;  1JEK A;  1WA8 A;  3RT3 C;  4I50 B;  1WRG A;  2ZYD A;  4W80 A;  5BU5 A;  3CCJ P;  1DK1 A;  1EFR G;  2VQE B;  1JB0 J;  3APQ A;  2NRG A;  2QRX A;  3GHG A;  2AW9 A;  3AEA C;  4TV9 B;  4EDF A;  5H6Q A;  1HR0 O;  1SQP K;  2KSE A;  4YTP C;  3GVM A;  3AE8 C;  2QVA A;  1VQM P;  3HTK A;  4PJ0 H;  2AXT E;  1QGK B;  2I1K A;  1NTM H;  1L0L G;  1M57 D;  3ITK A;  4UB8 E;  1L8D A;  2O1K A;  2CUG A;  3L70 E;  2GUS A;  3L74 D;  3H1H G;  4FLU A;  1Y66 A;  4RWU A;  1LUW A;  2WPS A;  1M90 W;  1WLE A;  1LR1 A;  2DE0 X;  1FD9 A;  4BW5 A;  5C39 A;  1RF1 C;  5DJU B;  3TXQ A;  2VQE O;  4A7P A;  1NTZ J;  2YMK A;  3A3Y B;  1U97 A;  4L75 A;  1R3I C;  4IOI H;  4D6T J;  3VP9 A;  1GKF A;  3JAL A;  2OIE A;  3H1I G;  2DWD C;  1USE A;  4CS4 A;  4WCE V;  2R5B A;  1HJB A;  2ZCE A;  1LTG C;  2V7Q J;  3TF5 A;  3QF7 A;  3WUT A;  1SVF A;  4ZNC A;  3T1Y O;  3HD7 A;  1GN3 A;  2GUZ B;  3W67 A;  5LYJ A;  3UQ8 A;  4MN4 C;  1MSD A;  3C90 A;  3JAK A;  4FLV A;  3B5N C;  1CI6 B;  1LNQ A;  1RQU A;  2B9B A;  1OCO B;  2G3A A;  3FWL A;  4DW1 A;  3U11 A;  5A9G A;  1SQP J;  2RN0 A;  1Q2N A;  1R1B A;  3BCC H;  1X0T A;  1ZAU A;  2FKX A;  4X9Q A;  3OAK A;  2OCC C;  2W6J H;  3LSQ A;  5GTH H;  1QLE C;  4X20 A;  4J41 A;  1WB8 A;  3CX5 E;  2QWO B;  2X6B A;  5AW8 B;  1NYH A;  1LGH B;  1BL8 A;  2KOG A;  4O4J A;  1U96 A;  1LWU B;  1P84 H;  2O57 A;  4OGQ B;  1NU1 G;  1PV3 A;  2N1T A;  3W68 A;  1OZH A;  1OXZ A;  1SQQ H;  1XHX A;  1JJO A;  3P3N A;  4C46 A;  2ZNJ A;  3H1J E;  2YC0 A;  1VEW A;  3LNM B;  2WPV B;  3ZIA G;  1IFI A;  2WSC J;  5JH7 B;  2FFD A;  3E7K A;  2A9H A;  2VRS A;  2ZE6 A;  2R72 A;  3J7A U;  3UM7 A;  2X6A A;  2WLI A;  3Q1M A;  4YXW G;  3V4Q A;  1R6T A;  1KIL C;  2A06 D;  2QJY B;  2AHY A;  2HJF C;  1J2J B;  4PEL A;  5J2T A;  1LTT C;  2EJR A;  3AE3 C;  1B06 A;  3SSU A;  1H89 A;  4N6J A;  3J81 N;  2E76 B;  1OMI A;  2EJ7 A;  4N21 A;  3H1K D;  2R9I A;  3HKD B;  4BIZ A;  1BCC J;  1K05 A;  2OYH C;  1YF2 A;  5B5E E;  4F6E A;  2ADQ B;  1H38 A;  1MMM A;  4UXN A;  1KIL E;  2P10 A;  5KJ7 C;  5LA6 A;  2DWE C;  4X88 A;  2A45 H;  2XKM A;  2IPP A;  1FDM A;  2Z5U A;  1FC2 C;  3B8E B;  2QM7 A;  4OVN F;  2LP7 A;  4UFZ A;  2Q7E A;  3T1C A;  3FFQ A;  4WFA V;  2PF4 E;  2Z0A A;  3E1R A;  2D3O W;  1AI7 A;  2HP8 A;  1N7S C;  1FZC B;  3AG1 B;  2B1I A;  4DO2 A;  3O8Z A;  5KUM A;  3ZRW A;  1KZU B;  3RL0 B;  2LW7 A;  4DRX B;  1URQ C;  4FM1 A;  1YCI A;  1IFM A;  2NPS D;  1X9V A;  4LLH A;  5KX5 B;  1NHL A;  4LCU C;  2IJK A;  4ZIB A;  1SQG A;  1MUU A;  5TIS Z;  3CL3 D;  3L73 H;  1P84 I;  1SQV G;  3CXH H;  4EI2 A;  1RF0 A;  4O2A B;  4WFE A;  4CBC A;  3CJH A;  2YUA A;  1T2K C;  5KHG A;  3CCQ P;  3G80 A;  4I7Z B;  3CWB D;  2YXH A;  2W90 A;  4O4L A;  1W2E A;  1PP9 E;  2XT9 A;  1NBM G;  2PTM A;  3V5B A;  1ZV8 A;  3CRM A;  4JYA B;  2PZS A;  3TK1 A;  4EB6 B;  1FZB A;  1PL0 A;  2UUC B;  2LJ2 A;  3WUV A;  2OYI C;  1XEQ A;  3O9O A;  2QWR B;  1XMO O;  3CC4 V;  2QIW A;  1FZE A;  1IFP A;  1KP2 A;  1BDC A;  1GMG A;  2DYS B;  3LID A;  4I55 B;  4UB6 Z;  4ZOL B;  1BSM A;  5B3S B;  2CTQ A;  2YSU B;  2OWO A;  1QBZ A;  1SF9 A;  4PA9 A;  2F93 B;  2Q1K A;  1BQ0 A;  3HPL C;  4DV2 B;  5AW0 B;  1YYC A;  2A3Q A;  3TGU E;  4QE9 A;  3L71 E;  4GOE A;  4BIU A;  5APV A;  3ZJZ A;  2C2A A;  1ZN5 A;  5KLV D;  4OXS A;  1NTK G;  1W0J G;  1H0T B;  2K1E A;  4PHZ A;  1PFI A;  1MNG A;  2YIB A;  5BMV A;  2FYU G;  2KI7 B;  4K0K B;  2UXC B;  4CPG A;  3G4S P;  3K58 A;  2UUC O;  1SZT A;  3LUT B;  4GX0 A;  4OWF A;  4EOT A;  1XRE A;  2ZIN A;  1EN4 A;  2Y0E A;  3Q5P A;  3EQ2 A;  4L87 A;  4PI0 A;  1AJY A;  2W6A A;  1FXV A;  1FU1 A;  4DV2 O;  2F1M A;  4MS2 A;  5AVT B;  1XDC A;  5JVD A;  4BAY A;  1G2C A;  5K1P A;  4GX5 A;  1JY2 O;  4HAM A;  1NH4 A;  5AW6 B;  3FAV A;  4U7N A;  5LP6 A;  2JK5 C;  3RBZ A;  2GUV A;  2W8Z A;  2UXC O;  2XTA A;  1KQL A;  4RO2 A;  4R50 A;  1HNX B;  3BFR A;  4JI2 B;  1N73 B;  3UO3 A;  5B1O A;  1VQ8 V;  4PJ0 E;  3DC5 A;  2Q7C A;  2JJ1 G;  1NTM E;  1IUR A;  1WMK A;  4AYC A;  4BXL A;  3U1A A;  2LO1 A;  5LYJ B;  3QNE A;  4K35 A;  2QDO A;  2WSS H;  3RVZ A;  3IC7 A;  3JAK B;  4X1K A;  5CA0 A;  1SFC C;  1FOS F;  2RMK B;  2UUB B;  4X64 B;  2OGU A;  3A8T A;  3K5B A;  1T5E A;  3BRC A;  4JI2 O;  3CCE P;  4JF7 A;  1G8M A;  4DW0 A;  3U10 A;  3A0R A;  1JCC A;  1K04 A;  3KHU A;  4PV1 D;  4U3F G;  3CCL P;  1MG1 A;  1E5W A;  1BSN A;  1NTZ H;  4TOI A;  1NH2 B;  1Q7Y W;  5KHJ A;  4MTO A;  4R4L A;  3KZI H;  1KBH A;  4X20 B;  2V7Q H;  1SQX G;  1D5N A;  1IK7 A;  2IJH A;  3CP1 A;  2E3C A;  2FYN C;  2KSJ A;  2IBZ D;  2P6J A;  1WP8 A;  1PPJ E;  2WLN A;  2FXM A;  1JMB A;  2VWK A;  4O4J B;  1BDD A;  1KP3 A;  3JSL A;  5FLX N;  2N1T B;  1NKZ B;  1VQP V;  3SWK A;  3ZHV A;  5CCH A;  1FPO A;  2WLL A;  2BEQ D;  5AW4 B;  2EIL B;  1VQK V;  3BCC E;  1YTZ T;  2FFD B;  4IL6 Z;  2RH0 A;  4FIP C;  1R5L A;  2JWA A;  1SQP H;  1S4X A;  3QVN A;  4C7N A;  4UUJ C;  2KLU A;  4CZZ A;  3SPC A;  1O9G A;  1YEW A;  4TUY A;  1OVU A;  1AP6 A;  1RY3 A;  3JAR A;  2Q3E A;  4J80 A;  1WAZ A;  1TU3 F;  2B88 A;  3B40 A;  4JI0 O;  1FDI A;  3U1C A;  4GKK B;  1RH5 B;  2N9B A;  3I56 P;  1P84 E;  3WMM 0;  4JI6 B;  2P5O A;  4HNA A;  1SQQ E;  2ZT9 D;  1F4N A;  5LA6 B;  3L70 D;  1S5J A;  5ITZ A;  3M0A A;  2V4D A;  1GW3 A;  1YBK A;  3CC2 P;  3VYI A;  1Y6X A;  5CCG D;  1DEE G;  4DR7 O;  5EFW B;  1R73 A;  5APT A;  3ASN B;  2WSC H;  4IFF A;  4DV4 B;  4FJC C;  3UIA A;  4YY3 B;  1PNM A;  2BCC G;  2L5G B;  1G4Y B;  1XQ8 A;  1S3J A;  2ZE5 A;  4I0X A;  1VQ4 P;  1H8E G;  4GKK O;  3DXR A;  2E74 B;  1ZOY C;  4YXW H;  3NXS A;  3ZRW B;  2QKC A;  3WU2 H;  1JTH A;  4X8A A;  5FPO A;  1HDJ A;  1NTK D;  2F4V B;  3L75 G;  4B3R B;  1BCC H;  2ZKO A;  1BHA A;  4RQE A;  1OCO C;  2FYU D;  2P22 C;  1M1J C;  2UU9 B;  3CCM V;  3AEF C;  1H2L A;  2PI5 A;  1GRJ A;  3WB2 A;  1BGY J;  2XAS A;  2YKP A;  5KAI H;  3ZRS A;  1BE3 J;  5GTI H;  4DV4 O;  4ZKU A;  3B77 A;  2EX3 A;  3OA7 A;  2HPC A;  4H13 B;  3PTZ A;  1B04 A;  4GLX A;  2KIK A;  5H2F H;  2K9Y A;  4IFM A;  3VMY A;  2JJ2 G;  3GLM A;  5CBN A;  3K03 A;  1DX7 A;  2I1J A;  2RDC A;  5BR8 B;  1ZR4 A;  3B5N D;  4N3Y B;  4TT3 G;  2LGQ A;  1LWU C;  4OGQ C;  2YID A;  4B3R O;  1R3K C;  1IZN B;  3P7K A;  3APO A;  3D6Y A;  3CX5 D;  5DEC A;  5LHG A;  3V4W A;  2JVD A;  3F5T A;  5HFM A;  1OZ0 A;  3VMX A;  3L73 E;  2YS8 A;  1JY2 N;  4XA4 A;  2OT5 A;  3CXH E;  4KXR A;  3N2G B;  1IZ3 A;  4FLZ A;  5L3D A;  1TA8 A;  4FZ1 A;  3QWO C;  1K9M Q;  1OVR A;  2JDI H;  3H1J D;  2QJY C;  2IYP A;  4B86 A;  3BPZ A;  5AVV B;  1JO5 A;  1G1J A;  2FTK A;  5BMV B;  2E76 C;  1NWQ A;  3OGC C;  3QG5 A;  1FYJ A;  1KB9 D;  2HG5 C;  2WVR A;  4KFM A;  2WTY A;  1AJN A;  4FFB A;  4WY4 B;  3SPH A;  1VQN V;  1J1D B;  2KS1 A;  1ROP A;  1JPX A;  1F23 A;  4RJT A;  4U3F D;  1V55 B;  3OT7 A;  1VF5 D;  4X89 A;  1AB3 A;  1KIL D;  1N0N A;  3DTU B;  1SQB G;  2GA1 A;  3T97 A;  3SYO A;  2M3E A;  1H8A A;  3CRA A;  5JVD B;  1G2C B;  3RGU A;  3ZMV A;  2IH1 C;  3FAV B;  1GZL A;  2M6Y A;  5LP6 B;  5CMZ A;  1FZC C;  2J5U A;  1VQL P;  4QNH B;  1KYO H;  3AE7 C;  2K9J A;  3F89 A;  3RL0 C;  4BWN A;  5KJ7 D;  5IJ0 A;  1GH6 A;  1Q5O A;  1XIL A;  1AI6 A;  2D2C D;  1VQ7 V;  1CP9 A;  2PUS A;  2HHH B;  4J7K A;  1PNL A;  5APQ A;  2NNU A;  3HKE A;  2IU3 A;  4JYC A;  1G1I A;  1WB7 A;  5BVZ A;  3BA8 A;  1GL2 B;  1V9P A;  1KEC A;  2Y0I A;  1WN7 A;  1PGO A;  2XND H;  5JQG A;  3RVY A;  4YIO A;  2ITA A;  4X1K B;  4DUY B;  4LWS A;  2A7W A;  3ZHT A;  4I7Z C;  1LJ2 A;  2BOB C;  2ZR2 A;  1URQ D;  4PA7 A;  2EZP A;  3M0D C;  4JI3 B;  3EFG A;  3L74 G;  5EC1 C;  3I55 P;  4LFC B;  1ARO P;  5FNV A;  1PP9 D;  3CCR V;  5EYP A;  2DYS C;  3M91 A;  4WBN A;  5EK0 A;  5B3S C;  1YJN V;  1M7L A;  1NR7 A;  3EXA A;  4EFE A;  2JS3 A;  3ZMS A;  4H33 A;  1Q82 Q;  4TQF A;  1WNS A;  2PYL A;  3E8G A;  4PD4 H;  4GYC B;  3JYC A;  3RWR D;  3H25 A;  2WWW A;  1UII A;  1K4D C;  2NN4 A;  3QO7 A;  3K06 A;  3ABT A;  3QTC A;  2CK3 G;  1KV4 A;  3ZCC A;  3C1L A;  2M5A A;  1BS3 A;  2YXQ B;  2Z5I A;  2Q9L A;  2WLL B;  4JI3 O;  3TGU D;  4FM2 A;  3W7W A;  1HP8 A;  3L71 D;  1L0N D;  4LFC O;  2WA4 A;  3C3S A;  1RE3 A;  1FAF A;  1NTZ E;  3L72 H;  2QJK B;  2WSE J;  5LGT A;  4TUY B;  3KZI E;  3EFF K;  4K3A A;  3H1I E;  1Y76 A;  1HWY A;  3H1L J;  3O6Q A;  3NTN A;  1BQZ A;  3FXE A;  2KG7 A;  1CZQ A;  3SWY A;  2O01 J;  3E8B A;  4HNA B;  2KNC A;  1SP4 A;  2KK7 A;  5FL7 G;  4H44 C;  5ITZ B;  2EUL A;  3SR2 C;  3W7S A;  1DD3 A;  1J95 A;  1L2P A;  2XU6 A;  1JQ0 A;  4TV8 A;  4E4E A;  1YIT V;  1N73 C;  3LSU A;  1SQP E;  1M1K Q;  1IDS A;  3JSN A;  2B87 A;  4JZG A;  3HE4 B;  1XMQ B;  3JC2 2;  2A79 B;  4IHJ B;  4XDK A;  2ZQM A;  2LFS A;  3LDC A;  3RN4 A;  4I0X B;  3QH9 A;  2K9P A;  2WT7 B;  4FMT A;  5B66 Z;  3SPJ A;  3N27 A;  1JTH B;  3V2P A;  3ZHQ A;  4L73 A;  3LDD A;  1NTM D;  2BAS A;  1Q82 W;  2E42 A;  2QM8 A;  3MHS C;  1Y67 A;  1HTL C;  2FL4 A;  3G71 P;  3E83 A;  3MUD C;  2C9N Y;  2NPS A;  5GON A;  3OUS A;  1M90 Q;  2QKA A;  3H1K G;  2JS5 A;  4TWK A;  2W6B A;  1N86 A;  4LNU B;  1L0L K;  1Z2G A;  3VQW A;  1XMQ O;  1Q81 Q;  4PA6 A;  4DXW A;  3CCS P;  3AG4 B;  4X1Y A;  3HUS B;  3GMA A;  1M5I A;  2VS0 A;  1GW4 A;  4O4I B;  4DR3 B;  2JGD A;  1SQB D;  1BHB A;  1SFC D;  3K0D A;  5CJ4 A;  1X4T A;  5KMG A;  1HVV A;  3WU2 E;  3OMN B;  2Q68 A;  2N1T C;  1TAE A;  1BCC E;  2YMY A;  4DV6 B;  4EKW A;  4LF5 O;  5TIS H;  4JTA B;  2EIL C;  3BAB A;  3RBX A;  2FFD C;  5KAI E;  1NR1 A;  2Q7H A;  1QLN A;  5GTI E;  5L3B A;  1NVP D;  3K9A A;  1BGY H;  2YIU B;  5EZY B;  1BE3 H;  5H2F E;  1BZK A;  1M1K W;  3K08 A;  4LH6 A;  1XUQ A;  3JAT A;  3ZHS A;  4DR3 O;  3BCC D;  1GN2 A;  2P7J A;  1NT2 B;  1NAF A;  1VQ8 P;  1KFM A;  2IM9 A;  3K5L A;  4DV6 O;  4FFB B;  2DOS A;  4XDL A;  3SJA C;  5CA1 B;  4UCS A;  3N4X A;  5IYB O;  4PA4 A;  2KS1 B;  4UB6 H;  3B4S A;  5LHH A;  4TT3 H;  2EIM B;  1YQ3 C;  3CWB G;  3WUU A;  2IZ0 A;  3L36 A;  3T1Y B;  1L0L J;  1OHH G;  4MVZ A;  4LF8 B;  1K7D A;  1P84 D;  2MJZ A;  1B3Q A;  2Q69 A;  1SQQ D;  3H1H J;  3ASN C;  2EIN B;  2M0B A;  5AW9 B;  1KC8 Q;  3Q5R A;  1OFC X;  4H0L D;  1J5E B;  1SES A;  3FB6 C;  1PZQ A;  1Q81 W;  5EBW C;  1GMJ A;  3GWO A;  2C0W A;  1YIJ V;  1PD3 A;  1MSW D;  1NU1 K;  2K9J B;  2Q8V A;  2YNY A;  2YEV A;  4ZBM A;  5IJ0 B;  1JCD A;  1D2D A;  3H1I J;  2JJL A;  2NR5 A;  5KLV G;  4LF8 O;  1FJK A;  4JTC B;  1L4A A;  4GZR B;  4MW3 A;  1JR9 A;  3HKE B;  4FFK A;  2KZJ A;  1VQP P;  1PPJ H;  2HR3 A;  1VQ6 V;  1P84 F;  1VF7 A;  1K33 A;  5K1X A;  2JO1 A;  2LKM A;  4H13 C;  4D6T G;  1VQK P;  1J5E O;  4UVA A;  2IW5 A;  1I0H A;  1KYO E;  3Q4H A;  2QE7 G;  3AEG C;  4MW8 A;  4G28 B;  5IT9 N;  4LFB B;  3M8A A;  1GM7 A;  5H9C A;  4GUN A;  1VQ9 V;  2ZAE B;  1NQT A;  1R6N A;  5FNV B;  3KPE A;  1R3J C;  5EYP B;  3Q3D A;  2R70 A;  1M56 D;  1VQO P;  1LP1 A;  3FKS G;  1SQF A;  3IC9 A;  2GSM B;  4XE5 B;  3KCY A;  2ZFC A;  3R2P A;  1JY2 P;  2CTW A;  4KHP O;  2HVK C;  3DC6 A;  3ZRV A;  4NPF X;  1NU1 J;  4WFH A;  3CC7 P;  1S9K E;  1MA1 A;  3AEC C;  2RCV A;  3RYC A;  3OMA B;  3L73 D;  4WWI A;  2C9L Y;  4ZHQ A;  5L3F A;  1KC8 W;  3R4Y A;  2HFE C;  4HYO A;  4LFB O;  1VP7 A;  3CCV V;  2BTQ A;  3AEB C;  3OEE G;  1RE4 C;  4YJ2 A;  1X59 A;  3MP7 B;  4WY4 C;  1Z5W A;  1J1D C;  3RK3 B;  5LXT A;  1UJW B;  2CPS A;  2JKV A;  3IAO A;  1IXM A;  1DF4 A;  2ZIO A;  3AEI A;  2J59 M;  4R6Z A;  1Z5V A;  5LMU B;  1SQV K;  5TJH A;  3O6Q B;  4DT0 A;  1A02 J;  4PD4 E;  3VBB A;  2IH3 C;  2R9R B;  2KG7 B;  1XTG B;  1PKX A;  2RJZ A;  2H94 A;  5JCO C;  5LP6 C;  2E76 D;  2HVJ C;  3ML0 A;  2KNC B;  1FFX A;  3OD4 A;  2BSK B;  1FZF A;  1QNM A;  4IL6 H;  5JWP A;  3CCU P;  4U7J A;  3CXH F;  2IBZ G;  2LW1 A;  4TV8 B;  2UXX A;  3L72 E;  3STL C;  2P7T C;  4MTF A;  1EZV H;  4JQ0 D;  5LMU O;  5LHI A;  5CCG A;  2WSE H;  4JI8 B;  2RMZ A;  4QIW F;  2JP3 A;  3IGA C;  4DV0 B;  1RM1 B;  2XAG A;  5KA6 A;  1GL2 C;  1MZ9 A;  2AXC A;  1S2E A;  2H88 C;  2K3R A;  4KHX A;  3H1L H;  1K8A Q;  1XMO B;  2E5L B;  3VQX A;  2DW4 A;  2IZ1 A;  4NTX A;  2W27 A;  2O01 H;  1GK4 A;  3NFQ A;  1PGQ A;  4EFB A;  5LBQ A;  1KQF B;  3M9B A;  4JAV A;  2QEX V;  4LF9 B;  1Y74 B;  3RK2 B;  2W6I G;  1CSB A;  3CME P;  1SQV J;  3MDS A;  2H43 A;  1LTB C;  1EDL A;  1DLB A;  3V2Q A;  3FYI B;  4NXN O;  1ZSP A;  4GX1 A;  2OTL V;  5BU8 B;  2FKW B;  4KL1 A;  3H32 A;  3L70 G;  5EIB D;  4JI8 O;  1VIB A;  4U3J A;  2P4K A;  4X1Y B;  3HRN A;  3HKB B;  4DV0 O;  3E1I A;  2JGD B;  2QKS A;  1E79 G;  3H9V A;  2F43 G;  1S72 P;  1QVG U;  3SPG A;  2E5L O;  5LOV B;  5EC2 C;  5AVS B;  1BMF G;  2PGG A;  3BAS A;  3CD6 V;  2ZR3 A;  5DED A;  1XTC C;  5CCH C;  1AVY A;  1XNR O;  3CPW U;  5C8Y B;  3E89 A;  4J7Z A;  1XNQ B;  4LF9 O;  1SS1 A;  3B5N A;  2ZE8 A;  3HR0 A;  4PDM A;  4WFB V;  1K4C C;  1V54 B;  2A06 H;  3S3W A;  1N0J A;  2QJK C;  4N78 E;  2A45 I;  2Y4T A;  4J9Y B;  3A2A A;  3VMZ A;  3JAT B;  1X8Y A;  1WA8 B;  3M7M X;  3H01 A;  4I1L A;  3F5W C;  3AE5 C;  1Q7Y Q;  1VQ7 P;  2R9A A;  1NTZ D;  1EM1 A;  1S5L X;  2XDJ A;  3GHG B;  4D6T D;  2GTS A;  1ZX3 A;  1TUB A;  4DK0 A;  1EZV I;  1K8A W;  2PFX A;  3BVO A;  1QR8 A;  4BW9 A;  1XNQ O;  1EDJ A;  3HTK B;  1YI2 V;  5DN6 G;  3W7X A;  5TIS E;  3BHP A;  1U7M A;  4UCV A;  3V2N A;  1ZR2 A;  1AVO A;  3CYO A;  4J11 A;  1BGY E;  5IY5 C;  5CB4 A;  4ZI7 A;  4FLT A;  2LGW A;  4G2K A;  4I4T A;  3O65 A;  4MTG A;  5EBM C;  1BE3 E;  1SQX K;  4NKG B;  2Q9I A;  2F66 C;  5FPR A;  4HB1 A;  3C9I A;  4NPD A;  1KIL A;  1LTJ A;  3PJS K;  3RYI A;  3CXH I;  1SKV A;  3CCR P;  1SQP D;  1L4A D;  1YJN P;  3JAL B;  4J42 A;  1QL1 A;  4H44 D;  1RFY A;  3CE2 A;  2YEV B;  3QO8 A;  4IL6 X;  1FZG A;  3H1J G;  1Q86 W;  4UB6 E;  5AW5 B;  5CMU A;  2AHZ A;  5IYD O;  3TDK A;  5KJ7 A;  3HD7 B;  1DGS A;  1RPR A;  1Y47 A;  5HFL A;  1AFO A;  3VTP C;  1Q90 D;  4JI7 B;  2OTJ V;  1L0L H;  1AR4 A;  4RQF A;  1U57 A;  3AG4 C;  3H1H H;  1XBL A;  3HUS C;  1S5L Z;  1FS0 E;  4Z2W A;  5AW3 B;  3II6 A;  3L72 J;  3Q4H B;  3GB7 C;  1FJP A;  1AVM A;  5L3G A;  4JI5 O;  2V4H A;  4FZ0 A;  2QM4 A;  2IYO A;  1GAX A;  1KKD A;  2O01 N;  3OE7 G;  1URQ A;  2OAR A;  1XL4 A;  1VQM V;  1NZ6 A;  3H1I H;  2G38 A;  4LC1 A;  4JI7 O;  1NH2 D;  5IWA B;  1SQX J;  2HLO A;  1LP1 B;  4IFD K;  4JI0 B;  4AQY B;  1YJW P;  1BCC D;  3GWK C;  3SFE C;  3WB1 A;  4B08 A;  2YIU C;  3LIE A;  4NYK A;  2BE3 A;  1KUQ A;  3EWK A;  1QU7 A;  1YIT P;  2H8P C;  3VP8 A;  2X7R B;  4ZHQ B;  3WG7 B;  5KAF Z;  1JA8 A;  4ZKI A;  1T3U A;  5E79 Z;  1N34 B;  5DJT B;  3HE5 A;  4D7T A;  4DR7 B;  4EYY Q;  4YJ2 B;  2WLI B;  3ETG A;  3OR7 C;  5LXT B;  2OYI A;  1N4C A;  3D3I A;  3K79 A;  3SWF A;  2EIM C;  1JMK C;  4Z1M G;  5J2T B;  5IWA O;  1AJQ A;  2ZDI C;  1KTM A;  3CHX A;  5J2U A;  3FB5 C;  4AQY O;  4PDV A;  2R3C A;  2EIN C;  1GM9 A;  1SZX A;  3BAT A;  1I5X A;  1Q6H A;  4JV5 B;  1AIL A;  2XUM A;  1A02 F;  3ABL B;  1PP9 G;  3K5M A;  1S5L E;  4CC6 A;  1NU1 H;  1N34 O;  2E75 B;  1QVG O;  2J58 A;  3KYQ A;  3K9S A;  1TGO A;  2LXC B;  1W0K G;  3CLQ A;  3KCX A;  4P2Z A;  4DR4 B;  5JJJ B;  3VQV A;  1DTO A;  2ZT9 B;  3RYF A;  3CPW O;  4X62 B;  3TNU A;  1N8R Q;  4GCZ A;  1KFN A;  1VL2 A;  2BCC J;  2YIC A;  4OH8 B;  2O3J A;  2EZO A;  1LUV A;  3TGU G;  3L71 G;  4MTX A;  1L0N G;  3N2K A;  4JV5 O;  3S4R A;  1H2K A;  1X79 B;  3G6B A;  3OM3 B;  1NJI Q;  1OCC B;  2X6C A;  3L75 J;  1N32 O;  3CEI A;  4AUW A;  2IFM A;  3MAQ A;  5H6R A;  3EHB B;  3C8V A;  4X65 B;  2G8Y A;  1E1Q G;  4DR4 O;  1IK9 A;  4GT1 A;  4IL6 E;  3FX0 A;  2B89 A;  3LSS A;  3MZW B;  5LGU A;  4X62 O;  2DJV A;  1K92 A;  3P32 A;  5L3C A;  3CJH B;  4HZ3 A;  1YQ4 C;  1YJ9 V;  1EZV E;  2ZXX A;  4O4L B;  3H32 B;  4YXD C;  3EVK A;  3R66 A;  3ZN1 A;  2QA4 V;  4GOD A;  5B66 H;  1Q43 A;  4YHH O;  3S1K A;  4YJ3 A;  3SJQ C;  1ZWI C;  2DN9 A;  1OVV A;  4B3S O;  3H1L E;  3AED C;  2QTS A;  2P06 A;  1FXK A;  4X65 O;  1SFC A;  1JVM A;  4RUF A;  2GHY A;  2Q4P A;  2ZXW B;  3SYC A;  3SYQ A;  4DR1 B;  1YDX A;  4DV5 O;  4U7O A;  1QLE D;  4LR3 A;  3D36 C;  3V6I A;  1W5C E;  3RK3 C;  1QR9 A;  2DMX A;  4HBN A;  1XHZ A;  1FDO A;  3ETD A;  3G3Z A;  1NTM G;  3JAW A;  1SQV H;  1DD4 A;  2OQQ A;  3PH0 A;  4NTW A;  1KYO F;  1N8R W;  5B1B B;  2Q5Z A;  4O9B A;  1HNZ O;  2B1G A;  3JD0 A;  2ZM6 O;  1FE6 A;  3RK3 E;  1H2N A;  1JCH A;  4LH7 A;  4CH6 A;  4DK1 A;  1ENV A;  1TUB B;  1VQ6 P;  1HW7 A;  1IBL O;  5AW7 B;  1KQS U;  3A0B Z;  1NJI W;  4DR1 O;  4NR1 A;  3VOU A;  3L9D A;  4IYI A;  4BWA A;  2JEE A;  2A06 E;  3CB2 A;  1I94 B;  2CH7 A;  1SQB J;  3ZMT A;  4RUE A;  4GKJ B;  2QR4 A;  5CBF A;  5CB4 B;  4ZI7 B;  5CN0 A;  3AG1 C;  2HKO A;  1VF5 B;  2JWD A;  1PNK A;  5K5G B;  1KIL B;  1LTJ B;  1NTK H;  3RYI B;  1RM1 C;  2YO2 A;  4GIF A;  3OR6 C;  4OX9 B;  2AEJ A;  2OTK E;  1NOH A;  2FYU H;  1VQ5 V;  3D6Z A;  1D5A A;  2P4V A;  1YTZ I;  4X66 B;  3BCC G;  1GTW A;  4Y99 B;  1I94 O;  2SPZ A;  3RK2 C;  2FBW C;  2W6J G;  3M99 B;  4PD4 F;  1N7S D;  2W83 C;  2D2C B;  2WLJ A;  2PRR A;  4GKJ O;  2KB1 A;  5CA0 B;  2X0L A;  1TUE B;  5IDJ A;  4BRY A;  1GL2 D;  2Y0P A;  4H37 A;  4LFA O;  4I9W A;  1HH0 A;  4OX9 O;  3OGI B;  4QPK A;  5CHX A;  1FFT B;  3L74 J;  1SQQ G;  3F5H A;  3TET A;  3G6E V;  1SS3 A;  1K5S A;  1WP7 A;  2CDY A;  3THO A;  1URF A;  4X66 O;  3MIW A;  4IYH A;  1ZTE A;  3LNN A;  1CI6 A;  1PGJ A;  1PL4 A;  4MVQ A;  1M1J A;  1T2K D;  3CRR A;  3CMA V;  1V54 C;  1L0L E;  4DUZ B;  3DSQ A;  4JAS A;  2JEX A;  2Z4E A;  4FVM A;  3A0H Z;  3JD4 A;  1XL6 A;  1VF6 C;  3X2Q B;  1FKA O;  1X22 A;  3H1H E;  3IN6 A;  5AW2 B;  4DOJ A;  3BEH A;  2KP8 A;  1KB9 H;  4IT5 A;  3K5O A;  1W2B U;  1H2S B;  1VPC A;  3M9Q A;  2P58 A;  3P8C E;  1Y4M A;  4N78 D;  2QJ1 A;  3GHG C;  3HE5 B;  3ASO B;  3I5D A;  4C7N B;  1RSO A;  1PV0 A;  4U3F H;  2F23 A;  1KYO I;  4L76 A;  1IX9 A;  3JAR B;  1GK9 A;  2ZXE B;  2CTP A;  3G67 A;  5CBH A;  4DR5 B;  3JSV C;  1QL2 A;  2VRZ A;  2Y9Z A;  3S9O A;  4DUZ O;  3K0G A;  1Q8I A;  5KLV E;  4EEQ A;  1ZW0 A;  1SQX H;  3K57 A;  3ABM B;  4N23 A;  1JFF A;  4WF9 V;  3CCE V;  1S5H C;  4YPC A;  2YI8 A;  1OCR B;  4W4K A;  3KKY A;  3MD0 A;  1AI5 A;  1YTF D;  3UO2 A;  2Q67 A;  1BGY D;  2OIG A;  1FAV A;  3USS A;  2XNX A;  1BE3 D;  2W0X A;  4LGD E;  1JX9 A;  5BY1 A;  4J9Z B;  3RYF B;  4TSF G;  4DR5 O;  3L73 G;  4NB5 A;  2PYJ A;  3HD7 C;  3CC4 P;  2PY5 A;  2P90 A;  2UUA B;  5KHK A;  3VMA A;  3CD6 P;  3DXR B;  2Q6A A;  2WMM A;  3ZBH A;  3A7O A;  4UCT A;  3N2K B;  3A0H E;  1P7G A;  4R4M A;  3JCU Z;  3RW0 A;  1MV8 A;  2IFN A;  2RN9 A;  1NU1 E;  4LF5 B;  1FZC A;  1P49 A;  3TJT A;  4PD4 I;  4JGS A;  3MGN A;  1XI1 A;  1USD A;  1KQS O;  5IYC O;  1NVO A;  3H1K J;  1B6Q A;  1JUN A;  2DQ0 A;  2HPC B;  1Y8A A;  3K59 A;  2UUA O;  1BSH A;  2QJP B;  2H3O A;  3PP5 A;  1OV9 A;  3FB8 C;  2BCC H;  2AXT Z;  1VAR A;  4UB8 Z;  3T1H B;  4GDO A;  4AHC A;  3QO5 A;  4YJ3 B;  3VOP A;  2VWJ A;  3LDE A;  1T6A A;  3IFX A;  4GKG A;  3B71 A;  3PLN A;  5AVX B;  3WG7 C;  1FXK B;  1PPJ D;  1R5S A;  2CGO A;  4QE7 A;  3L75 H;  3UCS C;  2L6L A;  4P9O A;  3CC2 V;  1F7Y A;  4E2L A;  2AEF A;  4B7E A;  4MSW C;  4AQR D;  1LTI C;  5KLV K;  2OYQ A;  3K5N A;  2ATK C;  1TVK A;  5CBG A;  2Q3I A;  2Q0O C;  3ZDM A;  3Q2Y A;  3F7Y C;  2KB7 P;  3JAW B;  1VQ4 V;  2DQ3 A;  4KT0 J;  4UCU A;  5B66 E;  3T1H O;  2CE4 A;  3AE4 C;  1IBM O;  3SDL A;  3OEH G;  3GF7 A;  3AG2 B;  4GX2 A;  2IJI A;  3L35 A;  1FZA A;  4DR2 B;  5IJ9 A;  2M3B A;  3ABL C;  1IFD A;  2E75 C;  5KUK A;  3CWB J;  2HLD G;  3D8C A;  1SER A;  1Q3E A;  2IU0 A;  1K3E A;  3T97 B;  2IJJ A;  2ADP A;  2WSF J;  4LF6 B;  2ZT9 C;  3SGI A;  3TSI A;  2CH7 B;  4UCR A;  1QEX A;  1M57 B;  1MFZ A;  1SRY A;  1SQV E;  3P3P A;  2R44 A;  3PRJ A;  5CCG C;  1DF5 A;  2E74 C;  5M1B A;  4JBZ A;  1J1E B;  2WSS G;  2OYO A;  2DYR B;  5AG2 A;  4DR2 O;  1YHQ V;  4JYB A;  2ZNI A;  3B09 A;  3E86 A;  4H0L B;  1W2B O;  1OCC C;  2YKQ A;  3AE2 C;  3AK3 A;  3AE1 C;  2WQY C;  5KLV J;  2UXB B;  3D70 A;  2B5U A;  5B1A B;  2Q6Q A;  4LF6 O;  1NTZ G;  3RL0 g;  1KN7 A;  2L35 A;  1RF0 C;  1LT9 A;  3JD3 A;  4KHP B;  4P30 A;  2ZVN B;  3AEE C;  1N73 A;  5JQG B;  2ZE7 A;  3J80 N;  3CRQ A;  4LWS B;  2V7Q G;  2KUB A;  1SQB H;  4BRY B;  5KKZ B;  2C0X A;  1EN6 A;  1LTA C;  2QGN A;  3CRC A;  1ZL8 A;  2Y9Y A;  4WFF A;  1NTK E;  2CTR A;  2FYU E;  3I5C A;  3W7T A;  1O9H A;  1EZV D;  3U59 A;  5BXZ A;  2ILM A;  4WBN B;  5B5E Z;  5JJE B;  2UXB O;  3MTU E;  2ZXW C;  2ZD9 A;  3SJB C;  1FBM A;  3H1L D;  2LFR A;  1THZ A;  1M1J B;  1SQP G;  3MUD A;  1AR5 A;  4UV9 A;  2QSI A;  3ICX A;  1Y9B A;  1VQL V;  1M56 B;  1S5L H;  2Q0A A;  3CXH D;  4OGQ D;  2H89 C;  4MVS A;  2M5A B;  5B1B C;  5D5Q A;  3UT5 A;  5C93 A;  2KKW A;  4G27 B;  1YSC A;  2YDE A;  3ZN0 A;  2E5T A;  1CEZ A;  2HEP A;  2R32 A;  3D3Q A;  1RSO B;  2FY8 A;  3L74 H;  3SJC C;  1OW6 A;  1AR1 B;  1EXI A;  5AVY B;  4F6R A;  1V55 C;  1Y76 B;  5EBL C;  5AVW B;  5A2Q N;  1EDK A;  2K1A A;  3ZX6 A;  3RK3 D;  4FK5 C;  3AE9 C;  2N05 A;  3CCM P;  1Q6U A;  4C7R A;  1JFF B;  2GDS A;  2HG5 D;  5IYZ A;  1VF5 C;  5KAF H;  1KB9 E;  4CH4 A;  5E79 H;  3JD2 A;  1LTJ C;  2Z3Y A;  3PN1 A;  1MKM A;  1YJ9 P;  1H88 A;  3T2M A;  2KQX A;  2ARH A;  2CK3 H;  2R5D A;  4TQD A;  3I55 V;  1SC5 B;  2Y0D A;  4ASV A;  2QA4 P;  1BCC G;  3RFR A;  1JY3 O;  2WPD G;  2B87 B;  2Q5U A;  2FB5 A;  4PA3 A;  4NTY A;  4B7K A;  4NXN B;  1PGP A;  1AI4 A;  4U3F E;  2CPB A;  1ZLL A;  2QTO A;  4DV1 B;  1Q6I A;  4FLX A;  4Z1V A;  3AK1 A;  3P30 A;  1RQV A;  4Y99 C;  1JOC A;  3T4Z A;  1NTK K;  3ZS8 C;  2D2C C;  4K8X A;  1SQX E;  2ZJS E;  2XAQ A;  2FYU K;  3RL0 D;  3IJ4 A;  2V1D A;  3GF3 A;  2GBO A;  3HB3 B;  1U7J A;  1S76 D;  3G9R A;  1XNR B;  4DR6 B;  1RF1 A; 
#chains in the Genus database with same CATH homology
 3AE1 C;  3FGA D;  1ZME C;  2WQY C;  1OW7 A;  3Q3D A;  3AE3 C;  2QJK C;  2E76 B;  1OMI A;  4PV1 B;  1ZRT E;  3D70 A;  1KTM A;  3GMA A;  1K05 A;  2E74 B;  1ZOY C;  3RL0 g;  2P10 A;  1KIL E;  4I7Z C;  3AEE C;  1JB0 J;  3AEC C;  3AE5 C;  1VF5 B;  1ZP0 C;  3AEA C;  1S5L X;  4XFJ A;  3R4Y A;  4YTP C;  3AE8 C;  4R4M A;  2E75 B;  3AEF C;  3AEB C;  3D6Z A;  1WMK A;  3IAO A;  2ZT9 B;  4H13 B;  1KOR A;  2K9Y A;  1VL2 A;  3GLM A;  2FBW C;  3H25 A;  1S1C X;  2D2C B;  3SFD C;  2YMK A;  3ABV C;  2QSI A;  4OGQ C;  1Y9B A;  1KQG B;  4GDO A;  2E76 D;  3D6Y A;  1K04 A;  4PV1 D;  4Y28 J;  4Z1M H;  1EXJ A;  2V7Q J;  4OGQ D;  2H89 C;  4H44 D;  4IL6 X;  4U7J A;  4TT3 H;  3C8V A;  3B71 A;  1YQ3 C;  2FXP A;  2G8Y A;  1HF9 A;  2WSE J;  4R4L A;  1IK7 A;  2FYN C;  1NGM B;  4H0L C;  4I7Z B;  2E75 D;  1Q90 D;  1OW6 A;  2QJY C;  1YQ4 C;  3O6Q A;  1EXI A;  5L8R J;  3Q5R A;  4RKU J;  3LW5 J;  4H0L D;  2JP3 A;  1RQU A;  2G3A A;  4YXD C;  1U57 A;  3Q2Y A;  1DIP A;  2E76 C;  3AE9 C;  2O01 J;  2H88 C;  4PV1 C;  1GMJ A;  4KT0 J;  2BEQ D;  3IN6 A;  2QIW A;  3AE4 C;  1PIX A;  4H44 C;  3GF7 A;  2E74 D;  1DD3 A;  1VF5 C;  1KMI Z;  3AED C;  2BEZ F;  1R8E A;  1KQF B;  5KKZ C;  1MKM A;  1VF5 D;  1UIX A;  2E75 C;  3Q5S A;  2IDB A;  1NYH A;  1TU3 F;  3D71 A;  2MKV A;  1FDI A;  1PV3 A;  4OGQ B;  2NZ2 A;  2ZT9 C;  1FDO A;  2JO1 A;  2WSF J;  4H44 B;  4H13 C;  3T97 B;  3AE6 C;  1DD4 A;  1HJ0 A;  2OQQ A;  2J5U A;  3S9O A;  3SFE C;  2YIU C;  1RQV A;  2ZT9 D;  3AE7 C;  4H13 D;  1OW8 A;  3EWK A;  2D2C C;  2WPV B;  2WSC J;  3AEG C;  2E74 C;  5M1B A;  2QJP C;  3RK3 E;  3Q5P A;  1PL5 A;  2D2C D;  3GF3 A;  1AJY A;  4H0L B;  3Q1M A;  5KLI C;  3G9R A;  3AE2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...