2E74B

Crystal structure of the cytochrome b6f complex from m.laminosus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
total genus 40
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2e74B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e74B01
4I7ZB 2QJKC 2QJPC 2FYNC 2E75B 1ZRTE 4H44B 2E76B 4Y28J 1JB0J 4IL6X 4H0LB 2WSFJ 3LW5J 4KT0J 2QJYC 2WSCJ 4PV1B 2ZT9B 2D2CB 5KKZC 2YIUC 1Q90D 3C8VA 2O01J 2E74B 2WSEJ 5KLIC 2QSIA 4RKUJ 2WPVB 2K9YA 5L8RJ 4OGQB 2QIWA 1S5LX 1VF5B 4H13B
chains in the Genus database with same CATH superfamily
1YITP 5KMGB 3L4FA 1VQ7P 2KKWA 2A9HA 1BE3E 1K9MQ 1WPXA 4K0KB 3QO7A 3C3TA 3NXSA 2J59M 5IYZA 2Q4PA 3JD4A 5KUMA 2CPSA 2YMYA 1SA0A 3SSUA 3CB2A 5JJNB 2WSCJ 1KILC 4I0XB 2JWDA 3SYPA 1L0NE 1K73Q 2X7RB 2IJKA 3ABVC 2HKOA 4FZ1A 4YJ3B 1OCOC 3SPIA 1DF5A 4CS2A 1PP9E 2AXTZ 1KYOH 3A0HZ 1JQ0A 1WAZA 2QIWA 2DQ3A 1KZUB 5LP6C 4MT8A 2HLOA 3CC2P 1ZXGA 2YC0A 3B4SA 3CCVV 3L73J 3AEGC 1HTLC 4YY3O 2WLHA 5KHIA 1XMOB 2N1TC 1WB7A 3H1JG 2ZE7A 1SQBH 2FXMA 3N2KA 4WY4A 1OX3A 1Z2GA 4G28B 1LTJB 1R6NA 3AEDC 3SDLA 4NB5A 2JP3A 3JALB 2JJ1G 3H1JE 2ZAEB 5KJ7C 3ZHVA 4M3LA 1JOYA 2HP8A 3ASNB 3CCQV 2IDBA 2G38A 4MVSA 1SQFA 4UUJC 1L0LG 5IJ9A 4EYYQ 2Y9ZA 1W59A 5KHKA 3VTPC 4DYLA 3W7XA 3PH0A 3CC4V 4JZ2A 1VDFA 1HWTC 3S3XA 1KFNA 2Q7CA 1GTOA 4XDJA 1M7LA 2WQYC 1L1FA 4GKGA 3H1IH 1GRJA 1WP7A 1SQPK 4R50A 4JYAO 3G71P 2IBZE 1YHQV 4DR6O 4DV1O 5E79Z 2PP6A 2OCCB 2NPSC 2WLIB 2UXBO 4GKJB 2ZT9C 1K97A 2Q5UA 3SYCA 1AFOA 1PL0A 1OCRB 5LGNA 5FLXN 3L70H 4X66B 4EI2A 1TVKA 3R66A 2JDIG 5CCGC 1FOSF 1Q43A 4DV4B 5EBLC 2OYIC 4AQRD 2YIDA 5AW8B 4O4JA 5KLVD 2KZIA 4DCKA 1GAXA 2KZJA 3E1IA 2A7WA 3L74J 4PV1D 5GTIZ 4GT1A 2IH1C 5EBWC 2IJJA 1JTHA 3JASA 5AVRB 3RK2B 4MVOA 2JGUA 1FJGO 1VF6A 2E3CA 5EBMC 2R72A 2K9YA 1M56B 2Y9YA 2YUAA 2E5TA 2Q6QA 4GODA 3OW2U 3D36C 2Y69B 1RFYA 5ITZA 2WSCH 2Z3YA 1H2MA 1NU1K 3CPWO 3ABMC 3IGAC 2WITA 4DK0A 1NTKJ 5GONA 3BATA 2EX3A 2ZDIC 3CWBD 1M1JB 3CYOA 3RN4A 3V2RA 1NVPD 3PHLA 4I4TA 1XTGB 2YXQB 4DV3B 1SFCD 5APQA 3UIAA 4AUWA 4J80A 1TU3F 1GW4A 1XILA 2M7WA 4LF4B 3K5OA 3IN6A 2UUCB 3K5BA 4BIOA 2DOSA 2GUSA 3JCUE 5CA0A 5DM6V 3U11A 2RKLA 2P5OA 2YS8A 5BMVA 1IBKB 3JARA 4HAMA 5BXZA 3IR9A 1T8ZA 3RK3D 1JEKA 2H88C 1IO4A 1JB0J 1RQUA 3N7NA 1EN5A 5F2VO 5KHGA 1KD1W 2WA4A 3CCRV 3W7TA 2VRSA 1KU9A 2XV5A 2WA3A 4EB6A 1RPRA 3FGAD 1FAVA 1BDCA 3JAKB 2KK7A 2P10A 5CCHC 3VQYA 2EIMC 1P4RA 2FKXA 3JD0A 3ZHUA 5EC2C 4FLXA 4FLTA 4YPCA 2F95B 1PGOA 5B1BB 1DD4A 5KAIZ 1SQXD 3CEIA 2FXOA 1Q8IA 2J5UA 2WSFH 3SFEC 2E74C 2A06G 4KHPB 1RF1B 4CH5A 1MZFA 1Q6UA 1QVFO 2YXHA 5CA1B 2LKMA 1H8EG 2L5GB 4X64O 5CBHA 5CBFA 1IK7A 3B8MA 4FFBA 3GB7C 1OW6A 1BQ0A 4PD4H 3ZHSA 3H1LE 1VQ9P 3H01A 1EZJA 3ETQA 4BW5A 4UB8E 2JR8A 2HPCA 2B1GA 1HNWO 5IYZB 4Q6GA 4OXSA 2ZXXA 2JO1A 5DJUB 2OTJP 1VF5D 1EZVH 1SA0B 4RQEA 1FXKB 5AVZB 1VQ5V 1NU1H 3E35A 3G4SV 1YI2P 2F1MA 1GN2A 4O2BB 3J81N 3TGUD 2R3CA 3BCCD 5HFLA 5KLIB 2AW9A 3QNEA 3CX5D 5H2FE 2OQQA 2CPBA 3CHXA 1IFPA 5L3CA 1IBMB 2AHYA 5BR8O 2YIUC 1YF2A 2W0XA 1XMQO 1SVFA 1SETA 1HJBA 3O8ZA 4GX2A 1RF0A 1SFCC 2C2AA 1KB9E 2QTSA 2BE3A 1ZR4A 4ZBMA 2NN4A 3B8NA 2GSMB 3JCUZ 2PRRA 2BCCG 1X8YA 4OX9O 1US6A 2KYVA 4EFBA 4WY4B 4L87A 2JJLA 4H44D 5APSA 4GX1A 2FY8A 3SPGA 1HP8A 2QSAA 2ZQMA 4UCUA 3MAQA 1JMBA 1WB8A 3RK3C 4HH2A 1QLEB 1KC8W 3L36A 2YIBD 2BOCC 3H1HG 2P22C 1NTMG 2Z5IA 4TT3H 2DYRB 5IJ9B 5GW7A 4X8AA 3WB2A 1OVRA 1RQVA 5LGUA 4FZ0A 1K34A 4JYBA 1NKZB 4MVRA 3T4ZA 4DUYO 1AI7A 3OGCC 4BXLA 1AV1A 1Q82W 1BE3J 2W6JH 3L75D 1X4TA 3FB6C 2ZR2A 5J2UA 5BU5A 1Q7YQ 2XNDH 4OWFA 3J7AU 5EZYA 3RVYA 5AW5B 3P7KA 1LR1A 2VQFB 5AVXB 2IFNA 3VMYA 1S5LH 1L0NJ 3MDSA 1JUNA 4LFCB 2O01J 3HKBA 1NS1A 1JVMA 3RL0g 1KP2A 1JY2N 1NTZG 3HE5A 1ZR2A 1V55B 2WSSG 1TVKB 1N0NA 4OPHA 3LSUA 3L72G 1PP9J 3JATA 5DECA 3HD7A 1GH6A 4O4JB 4UB8Z 4FLWA 3CC7P 3L37A 3LW5H 4BIZA 1J1EC 1SQGA 1L8DA 1JTHB 2JVDA 1IFDA 5CB4A 1D5AA 1AI4A 3WFVA 4LF6B 2IZ0A 2AGAA 3QF7A 1IZNB 2EIJB 2DW4A 5H2FZ 4KP4A 2RDCA 3V5BA 4B7KA 5ITZB 4MVMA 1GMJA 4JQ0D 2FYUG 5B66E 1IBLO 5GONB 3H1JJ 1LUWA 2W6AA 4IL6H 1DH3A 3E22A 4TV9A 4I4TB 1EC5A 2P1JA 1IDSA 3JC22 2HHHO 3CXHE 1AI6A 1AP6A 2ZXWB 2KSJA 2YXRB 3ZBHA 3DTUB 1DEBA 4OVNF 1Q86Q 4DV6B 1QLNA 3M0DC 4TQDA 5CA0B 5KAFZ 5KKZC 4KL1A 5AVUB 1IC2A 1WP8A 4JBZA 3K5NA 5BMVB 3SYOA 3T2MA 3JARB 5A9GA 3L71E 4NYKA 1V54C 2EINC 3B09A 1I7FA 4JI5B 2K37A 3PTZA 3HUSC 3O65A 1BDDA 1BGYD 2RMKB 4D6TE 1OCZC 2IJHA 3R4YA 1L0LK 2QJKC 1LJ2A 1URFA 3RYIA 4EB6B 4NXNO 1J2JB 2EZPA 3CMAP 3Q1MA 2E76B 2ZNIA 2Q7EA 1DK1A 3TJTA 1SQQD 4LH6A 4DV5O 4NXMO 2W27A 3RK2D 3L73G 1BE3H 2FYNB 1T6AA 1J95A 1M56D 5LL6Y 3SWFA 2DQ0A 4KJMA 1YIJV 5TISE 2WTYA 3H25A 1BSHA 3H1KD 2NLJC 3CCUV 5GTIH 3T97A 1P84F 1SQVE 4FFBB 2N9BA 4L73A 1N2DC 3T1HO 1ZN5A 4O9BA 4DRXA 1VF7A 4ZKUA 1FZCA 3X2QB 2HPCB 2Q69A 3BAAA 3IJ4A 3C8VA 2QKSA 5APXA 3AG3C 3AG4C 2RMZA 3OEHG 1VQLV 4FLVA 4EIJA 1S9KD 1MFZA 5B66Z 1M9NA 2D2CC 1FPOA 4YY3B 5AW6B 1XHZA 1EDIA 1PPJD 1YZBA 4IIJA 2AZ0A 3ABLB 4I50A 4PJ0H 5TJHA 4H0LB 1EZVI 1Y6XA 3VP9A 2XZRA 3H1JH 2ZM6O 1NH2B 3KYQA 4PA7A 5BVZA 4P30A 2LFRA 4CBCA 1S2EA 2XKMA 1USDA 1GD2E 4CC5A 3E1RA 4Z1MG 2QJPB 3CCMP 1B3QA 1K4DC 2CH7A 1U7MA 3NFQA 1SZTA 1QEXA 1SQPE 1LTTC 1YEWA 1H8HG 3L74G 5AVVB 3O9OA 4IYHA 4U3JA 3W7WA 4H37A 5KHHA 1L0LH 4BWNA 4JI0O 1KYOD 4OGQC 1NGMB 3G80A 2Q7GA 4D7TA 4JYAB 4LP8A 1M5IA 2WWWA 4IHJA 2OYHC 1SESA 4DR6B 2WPSA 2M0BA 2IX7C 4NPEA 4LGDE 2R5DA 5KAIH 2X0LA 1HUCA 2UXBB 3N2GA 1GM7A 1FE6A 1PNLA 2IU0A 1NTKG 3H1LJ 1SQBD 1FD9A 1JFFA 4LNUA 2YXYA 4GX0A 3T1YO 3AECC 1I94O 2DN9A 5J2UB 4ASUG 3Q4HA 1AJPA 3G9RA 4CH4A 5DJTB 4I7ZB 2MKVA 5EZYB 1PL4A 1HR0B 5TISZ 1EBOA 5FPOA 1M56C 3ZHTA 1G1IA 1NR1A 4JTCB 1PL5A 3CXHD 3HKBB 2JDIH 3HE5B 1KMIZ 4QPJA 1KQFB 1FJGB 3KQGA 2AEJA 3CLQA 3JATB 3HD7B 5B5EE 1UIIA 2N04A 3I55V 1P84I 1K04A 3V4WA 1YJNV 1GK6A 3DC6A 4X20A 3EHBB 4BIUA 1YJWV 3FFQA 3RBZA 3H1ID 5CB4B 5C93A 3CD6V 4QE7A 2JS5A 4U7NA 2CTWA 3KCYA 4UB6H 3AE2C 3V6IA 4RAIA 1PGPA 1PZQA 4LF8O 3Q5PA 2YO3A 3QO5A 4CS4A 2K9PA 1QLED 3L70D 4JI2O 4GX5A 2OIEA 3E22B 1XDCA 5AW2B 2PYLA 4TV9B 4X1YB 4LF7O 4MVUA 4FVMA 4MW3A 1X0TA 1CPYA 1N33O 5LYJA 1D7MA 1ZTEA 1JJOA 3E7KA 3B5NA 4DXWA 3CCSP 1N8RW 1GM8A 1K8AW 3AEIA 1KN7A 1W2BO 1NI8A 2EIKB 3CSXA 2HG5D 3NMDA 1Q81Q 1N73C 1I0HA 2KSDA 2KUBA 1VQKP 4NTXA 4DR1O 2O3JA 5FPRA 3FYIB 4P9PA 3V2PA 3FAVA 2O57A 2WVRA 2Y0DA 3FX0A 1GK4A 1NTMK 1FC2C 5IE9A 2QA4V 3RYIB 3QWOC 1GZLA 2QWQB 4P2ZA 1K5SA 4R6ZA 4U3FE 4X64B 3AE1C 2EILB 4YXWG 1EDKA 1J5EO 3KG2A 1W5CE 4IOIH 5KLVE 2A06H 1QVGU 1FJKA 1DEEG 5CBOA 2X6AA 3U10A 3ZRWA 4KHXA 1N7LA 1FXKC 1OVUA 3ABUA 1HNWB 3QVNA 4LWSA 3VN0A 3T97B 4X1IA 4B3SO 3U1AA 2WPVB 1NJIQ 1S77D 1NTZK 5B5EZ 1URQC 3ETEA 3SPCA 4LFBO 2GTAA 3II6A 4ASWA 2BOBC 2BTQA 1Y47A 4DRXB 4ZIBA 1FZCB 2QWRB 1SQPD 4LLHA 2ARHA 4GLXA 4GOFA 1R3KC 1YTZI 3CWBE 1VQNP 1HWYA 3ZX6A 1K9MW 5BR8B 3BRVB 2B89A 1XMQB 1QVGO 5AVQB 3TCUA 1RE4A 2PZSA 3OE7G 4MVQA 2ZVOB 2F93B 1Q90D 1K73W 2P6JA 3JYCA 4L76A 2PY5A 1PKXA 4OX9B 2P7TC 2ZJSE 4XE5B 2CTRA 2FYUK 3L71J 1QLEC 4IIJB 3RL0B 3MD0A 4I50B 3T1CA 4AQYO 4QGPA 4H13B 1PV3A 1GN4A 1ZLLA 4PD4D 3RK3E 1IVSA 3OT7A 5KAFH 2IZ1A 2BCCH 4D6TJ 2DE0X 2YDEA 3OAAG 1L0NG 1Q3EA 2Y0PA 1GN3A 3SJBC 4XDLA 2P4KA 1QL2A 5AW3B 2CH7B 1PP9G 1P7GA 1NYHA 4F6RA 2Q9IA 4JF3A 5GTHH 2K88A 1NU1D 1YQ3C 2POHA 1NT2B 3H1HH 1NTMH 4U3JB 4IFFA 4NTWA 3CXCU 5JCOC 4DUYB 1SQXE 4DJGA 1MMMA 3A8TA 3CCVP 4MVZA 3SPHA 2Y0EA 1QX8A 1K4CC 3PN1A 2FFDA 3CRMA 4IHJB 2JWAA 1VQPV 4LF5O 2XASA 2XAQA 1PNKA 1GL2A 2KI7B 1X22A 3RT3C 2ILMA 1SQVJ 4HJGH 3N2GB 4AYCA 3TNUB 3OEEG 4JI4O 3VMAA 3SYQA 1JFFB 2ZE8A 4LNUB 4DR4O 1EFRG 1N86A 1J1DB 4KXRA 3Q4HB 5KTBA 3CCQP 2RNBA 2IBZI 2QWOB 4DR7O 2W6BA 1S5JA 1WPBA 1SC5B 4RJTA 1NTZH 5JQGA 2WSSH 3O6QA 3CC4P 3PLNA 4PA6A 4OPAA 1OJHA 2QEXV 3L72H 4WFFA 4MTGA 2ZR3A 4BAYA 1PM9A 3TGUE 5H6RA 3BCCE 2RCVA 4JI6O 3Q2YA 1XNQO 2C0WA 2Y0CA 3CX5E 4CH6A 1VQ8V 2IBZG 1YHQP 1F23A 4H0LD 3OTOO 3JAWA 1FZBA 1S1CX 3UT5A 5KX5A 1NH2D 1IBLB 1IURA 1CI6A 3B77A 1AVMA 2ZXWC 5KA5A 5KUKA 5LBQA 3UKMA 2QSIA 2VS0A 2HHHB 2FYUH 3B71A 2HFEC 1N7SC 2Q73A 4I5SA 3WUVA 1SQPJ 2EZOA 4RQFA 3LIEA 3TK1A 4TOIA 1YBKA 3M9BA 2GDSA 4ZKIA 4HBNA 4U3FD 4IFDK 1KB9F 4WFBV 1KKCA 1FZGA 2RN9A 3CL3D 1HGVA 3BASA 3CCLV 2ETNA 5LA6A 2P7JA 1KILA 3JD1A 3ZMZA 3Q3DA 5B3SB 1N32O 1PIXA 2P06A 2QR4A 5LYJB 3B5NB 4RESB 4WCEV 3LSSA 3FXDA 4F4LA 4X1KA 1KTMA 1QNMA 3OR6C 5DEDA 1MOFA 1K33A 5CMUA 4NXNB 3K5MA 2M8RA 4ZOLA 2OGUA 1B06A 5LP6A 3FB7C 5JJJB 4ASVA 1XUQA 2BSKA 3JSNA 3L75E 3L9DA 4NR1A 4MTFA 4QIWF 1E5WA 2EBOA 3FAVB 2ODMA 2N1TA 3ZEDA 4DV5B 3TF5A 5L3EA 3ZCCA 4R4MA 4NXMB 4WBAA 3CP1A 2HYNA 5C39A 5JVDB 1SRYA 4LCUC 2SPZA 3IFMA 3M8AA 1F4MA 3ZIAG 1OZ0A 2JKVA 1NTKK 3A0BH 1JMKC 3L73H 3U1CA 1LNQA 2WLKA 3N4XA 3T1HB 2YMKA 2GUZB 2Q68A 3ZRWB 2QJYB 3WG7C 4J41A 3DC5A 4WFEA 3CCRP 1VQ6V 3AEBC 3OW2O 3GHGC 4TUYA 4A5UB 3ABKB 4WFAV 3GG2A 2P90A 1R1BA 1H2GA 4CC6A 1BCCE 4LWSB 4X1IB 2Q7HA 3HTKA 4OH8B 3SPJA 1KYOF 3H32A 2FKWB 2BTQB 2L6LA 3F5TA 2DYSB 3P32A 4J9ZB 3STLC 4DR3O 1SP4A 4H0LC 4K35A 4FPPA 1JX9A 1NAYA 1QL1A 1SF9A 1NKNA 3PP5A 4JZGA 3GWOA 5B1NA 1DF4A 4BR6A 2R9RB 4I9WA 4WF9V 2FL4A 1G1XB 3MHHC 5CCGA 2ZM6B 2OYIA 4X62O 3H1LG 1M57B 1NO4A 2XAJA 2ADQB 2V7QJ 2UWJE 1FJPA 3CXHF 3TDKA 1JM0A 1VP7A 5CCGD 1HDJA 1VQ5P 2BTOA 5B1AC 3G4SP 5AVTB 1XNRO 4Z1MH 1BGYE 1KB9I 4PV1C 5E1AC 3D36A 3ASOC 1S5LX 1NH4A 1RSOA 4F6RB 1YJ9V 4U3FJ 2QVAA 3L74H 2YI8A 5AW1B 2LXCB 1SQQE 2Y48A 2ZDIA 2P67A 2LP7A 2I1JA 3H6PA 5KLVJ 1B04A 3SWYA 1YQ4C 2KB1A 3BHPA 3D6YA 2DWEC 4E4EA 3T1YB 1I94B 3OM3B 2P4VA 1R8EA 2E5LO 3RGUA 2QG4A 3MUDC 1KQLA 2WT7A 1NTKH 5AW0B 5CJ4A 3H1KE 2F23A 5IYBO 2OYQA 5L3BA 3VMXA 3ZDMA 5EYPA 4ZHQA 1AR4A 2HJFC 3N2KB 1T3UA 2RJZA 2M5AA 3CWBJ 5BU8B 3A5TA 1Q6IA 4IL6X 4Y99C 4EDFA 2ITCC 2LGWA 3VQWA 4PDLA 1KP3A 1Q7YW 5JQGB 3O6QB 2UUBO 3D3IA 1EXJA 1L0LD 2WLLA 2VQEO 1Z56A 3JCZA 3R2PA 5CCHA 1S9KE 1LT9C 3ZN1A 1HNZO 1G1JA 4YXDC 1OCCB 3CMEV 3K79A 3B8EB 5HFMA 3G6EV 3RVZA 4CH3A 3RL0D 2OCHA 1PPJE 4AI8A 1ZOYC 4H13D 4X89A 3JAWB 4LF8B 3UT5B 5KX5B 3G67A 1CI6B 1FYJA 3TSIA 3AG2B 4JI2B 4G2KA 4E2LA 1RH5B 1UJWB 4LF7B 1P84H 2IU3A 5CHXA 2XAHA 2XU6A 4DV7O 1WRGA 2B88A 4JI8O 1H0TA 4UCVA 1E79G 2WLMA 1GM9A 1PGQA 2ZYDA 4JF7A 2KP8A 1FZAA 4LR3A 1IXBA 3CCJV 2YIAA 1SQXJ 4C46A 3MP7B 3S4RA 1K05A 3P8CD 3AK3A 1PV0A 1KILB 1KYOE 2Q0OC 4DR1B 1L0NK 2R9AA 1MZEA 5KHJA 1OCOB 1N4CA 4WFGA 1EDLA 3WUUA 3JASB 2ATKC 4X1KB 1VF5C 2B87A 2WAMA 1BCCD 2AXTH 3A0HH 3VBBA 3HRNA 3LSQA 4O4HA 3W7UA 1NVOA 1R73A 5LP6B 1D2DA 1SQBE 4XBFA 4N6JA 2JRIA 1U97A 4DW1A 2OTLV 1SFCA 1J5EB 1BL8A 1CZQA 2N1TB 5K1XA 1LWUC 4FK5C 4C7UA 1O9GA 3KPEA 3K9AA 4PDVA 3TGUJ 4YXWH 1NBMG 3BCCJ 1L4AA 1QHTA 4QNHB 3L71G 1ZRTD 1OW8A 2FTKA 1HBWA 4B3SB 1WNSA 4FMTA 4LFBB 1DLBA 2ZCEA 2KNCA 1KQGB 4H44C 1QU7A 3MTUE 4A7PA 2CDYA 2KLVA 4D6TG 1S72V 1F4NA 4O2AA 3JAMN 3J80N 1E1QG 4TUYB 3H1IE 1EM1A 4J7JA 3BVHA 1IK9A 3I5CA 3JD3A 2FBWC 3GWKC 3A2AA 3AG1B 4QE9A 5FNVA 3ZRSA 3HPLC 5AW7B 3H32B 2HODA 2H3OA 4JYYA 5IJ0A 4B3RO 2A45I 1Y8AA 2JJ2G 1Q5OA 3RGBA 5E79H 3L70E 2PTMA 4ZI7A 2ZT9B 1FFTB 3B2EE 3AE7C 4MSWC 4RUFA 3QH9A 1XQ8A 3B5ND 2A06D 1YIJP 4AQYB 3GVMA 3CCUP 3PJSK 1SQVG 4FFKA 3BRTB 4L8JA 1Y4MA 2A45G 2OYIB 3WU2E 2WLNA 4JPZB 1R3JC 1U57A 3LIDA 1FDMA 1KV4A 3L75J 1R3IC 2Y0IA 1L0NH 2GM4A 3K57A 2PI5A 2O01H 4TQFA 3V4QA 1VQLP 3LDCA 4KT0J 3FXEA 1AB3A 3BEHA 1T3JA 2Y4TA 1PP9H 2OT5A 2X6BA 1IXMA 3ABMB 1RSOB 4LF5B 3IFXA 1XI1A 5IT9N 4K8ZA 1Y9BA 4R8CA 3WUTA 2VRZA 1LTJC 4BW9A 4IFMA 3UM7A 2MK3A 4JI4B 1R5SA 2HEPA 2OYOA 1H8AA 4DR4B 1BZKA 2IYOA 1BCCJ 5EFWB 4FM2A 1QQCA 3ASNC 1PNMA 1AQ5A 2WT7B 1ZMEC 3M0DA 1G8MA 4DR7B 1SQPG 2BCCD 1UIXA 1LTAC 3AK2A 3AEEC 1T2KD 5EYPB 4ZHQB 2ITAA 3WMM0 1EQ7A 1JCHA 2QE7G 2M5AB 4QJFB 4JI6B 1XNQB 3RBXA 1AJQA 3A2FA 3H1HD 1RE3C 1OVVA 1NTMD 5IWAO 1HNXO 3OTOB 1M1KQ 3E83A 2OCCC 2WLLB 4PDRA 2GV9A 4UCTA 1ZW0A 2FYZA 1M57D 3OJAB 2C9NY 1KECA 4UXNA 2IBZH 2E5YA 1OCRC 2O1JA 4DV1B 3KCXA 5APYA 1ZX3A 2E74B 5J9PC 1OXZA 2PAJA 1E1RG 1WLEA 1S4XA 1VQ4V 4JI1O 5B3SC 1X79B 1BSMA 4PD4E 1QGKB 3CCEV 3VOUA 1BGYJ 1N36O 1TUEB 3M7MX 3WU2Z 2IPPA 3RK2C 2CGOA 1NQTA 4LC1A 3UO2A 1H0TB 1N32B 1AROP 1NTZD 1R5LA 1SQQJ 2FXPA 3I55P 1TUBA 1NU1E 1YJNP 3L72D 2Y69C 4AHCA 4HYTB 2F66C 3OMNB 1YJWP 3CD6P 3CRAA 1VQOV 1OHHG 1M1JC 3MGNA 1GK9A 3BRCA 3I56V 3CRRA 2PI4A 2PF4E 2KB7P 1IX9A 3H1KJ 3U0ZA 1M4UA 2B87B 3S1KA 2J58A 4Z2WA 1FS0E 1L2PA 1GU4A 4WY4D 4JAAA 1RHZB 2YIUB 3D3QA 4O4HB 4DK1A 2FYUD 2KQXA 1Q81W 1JA8A 1SFCB 4RWUA 3ZHQA 1YYCA 4B3TO 1LTBC 2X6CA 2WZ7A 4UFZA 3JCUH 4DV2O 4WB4A 1RP3B 4H33A 2GUVA 2WSEJ 1A02J 1VQMV 1VL2A 1P49A 1L4AB 3HKEA 5IY5B 1EN6A 2V7QG 2BASA 2R5BA 4TLFA 1T2KC 2FMLA 4LF9O 3KKYA 1OZHA 5C8YA 1H2LA 2CK3G 2KG7A 2KNCB 5B1BC 2IFMA 2OYHA 4O2AB 4DR3B 2QA4P 4UV9A 2H8PD 4EOTA 2KIKA 1I08A 1Y74A 1RF1C 1Z5WA 3ZHRA 1VARA 4U3FG 2C0XA 3CX5F 5FNVB 3KXDA 2HODB 5CMZA 2B9BA 1NWQA 5IJ0B 1S5LE 3DSQA 2W8ZA 3ITKA 5KLVG 3ML0A 1NJIW 3W7SA 2AHZA 4X62B 1NOHA 2O1KA 4DR5O 4NPFX 3F5WC 1KILD 3ZMSA 1KQSU 2YICA 1XBLA 5H9CA 4TV8A 2BEZF 2KS1A 4W7ZA 1SS3A 2EJRA 3L73D 4R4LA 1VPCA 3E8HA 3H1LH 3F7YC 2QDOA 5APWA 1W0JG 4Q20A 1XNRB 4B7EA 4UB8H 1SKVA 3BABA 4BRYA 2R32A 1J1EB 1CSBA 1SQBJ 5KLIC 1EXIA 1NKDA 3CWBG 3CRQA 1BMFG 1OMIA 3VOPA 1ZUQA 2N1TD 1H2NA 3K03A 4W4LA 1T5EA 1P7BA 1GTWA 2XUMA 1MV8A 5EK0A 5H2FH 2XTAA 4IL6E 2GBOA 4MTXA 1SERA 1M90Q 2PYJA 3RYHA 1PD3A 2E5LB 2AXCA 2Q6AA 1GO3F 4J10A 2LFSA 4CS3A 1YTFB 2ZYAA 4WY4C 1KB9H 1AR1B 1IFNA 2MJZA 2E42A 3M9QA 4ZMDA 2RH0A 4GZRB 4LFAO 3H1IJ 2WPRA 4LBEC 4B3MO 1RM1B 3RW0A 4HNAA 4Y28J 3SGIA 2NZ2A 2DYRC 1N73A 1OCCC 2V4DA 4O4LA 2UUBB 3NTNA 2CGNA 4YHHO 2VQEB 4FM0A 2E76D 1AP5A 2EINB 3BY6A 2ADPA 1SQXG 5L3GA 3HKDA 2JS3A 5LHHA 1HNZB 1EZVD 4U7OA 1LUVA 2ZT9D 1GMGA 2HG5C 2YO2A 3L74D 3EFFK 3OMIB 2P2UA 1OCZB 3CJHA 4L75A 2VWJA 1VQPP 2HVJC 1USEA 5LXTA 2QJKB 3G3ZA 2R70A 4PA4A 3ZMUA 5BY1A 1FU1A 2LXBA 4YJ2A 1S5LZ 2Q5ZA 4FIPC 2NRGA 4JYCA 1A32A 3VMZA 3S3WA 3D6ZA 1H88A 1K5QA 1G2CA 1V55C 3T4DA 1AVOA 4DV7B 5APUA 1NTKD 3CX5I 4JI8B 1Z5VA 1W0KG 5GTIE 3P8MC 2N74A 4DUZO 1FXKA 1VQ7V 1YITV 3OAKA 3UCSC 4O2BA 5APTA 2GA1A 3ICXA 1DX7A 2QEXP 4N21A 4GUNA 3TGUG 2UXDO 3L70J 3BCCG 1URQA 1E79H 1VF6C 1SQVK 3OMAB 3QG5A 2EIJC 4I6MC 2N9YB 4KUMA 1VQ8P 4Z1VA 1TUBB 2CAZC 1AJNA 2ZE6A 2IH3C 3CRCA 2BEQD 3AG4B 3AG3B 2PGGA 4IL6Z 4WFHA 3CC2V 1XTCC 1ZP0C 4X20B 5B66H 2D2CB 4PJ0E 1WA8A 4NPDA 3MHSC 3LDDA 2ZIMA 1CP9A 1MUUA 3D71A 2L35A 2N05A 3ETGA 1P84D 5K1PA 3CXHH 4CPGA 1JNMA 1D5NA 3P30A 1SLQA 3USSA 1F51A 3CCLP 2UXNA 1DGSA 3AE5C 1FBMA 5LMUO 2E75B 2PFXA 4W7YA 3JSLA 1CXZB 1O9HA 3HE4A 3AG1C 5CCHD 2WSFJ 2QTOA 1R6KA 1L0LE 4GIFA 1YSCA 3L71H 1TAEA 3HKEB 3FWLA 3BFRA 2E76C 4X88A 3L75G 2LW1A 2E74D 1XHXA 5JCOA 5C8YB 5KAIE 1AR5A 3IC9A 4NTYA 4D6TH 2G8YA 2ZINA 2KG7B 4J7KA 4OGQB 3CPWU 1KFMA 4C7NA 5D5PA 3K5LA 4B3RB 1JY2O 2W0FC 2DMXA 2HJDA 3G71V 3KDPB 4GDOA 2OYHB 4JAUA 2XNXA 1A02F 5DN6G 2QRXA 3UQ8A 3FX7A 4ICGA 1Y74B 2FYNC 1VMGA 3SWKA 4AILC 2IW5A 1OW7A 3CI9A 1YCIA 2K1AA 4DR2O 5LGTA 1HR0O 1MG1A 1FAFA 2HLDG 1HW7A 2JK5C 1NU1J 5H6QA 2PGDA 5JWPA 1GDTA 1MFTA 4DO2A 3WU2H 1XOUA 3HD7D 5TISH 1VQ6P 1FXHA 3KZIE 4PI2A 1HVVA 2WLJA 2UU9O 3P8CE 4TV8B 3APQA 3X2QC 2KS1B 5KJ7A 1SQVH 1BCCG 1RPOA 2A45H 4RO0A 3R65A 2F4VO 1HH0A 1GKFA 3HKCA 5LOVA 3ABTA 1FKAO 1OWAA 2G3AA 3QTCA 2XHBA 4IYIA 3V2NA 4BRYB 1JPXA 3CE2A 4UB6E 3K9SA 1ZSPA 1WT6A 1BQZA 2DJVA 1AJYA 2W90A 3ABLC 4PJ0Z 2CE4A 3W67A 2NPSA 1RF0C 1N7SA 1L4AD 3ZMTA 3K3WA 1QVFU 3JD2A 2XT9A 2LO1A 4HZ3A 3RYHB 1BSNA 1ZAUA 2QJPC 1TGOA 1K7DA 5CBGA 1BE3D 2UXCO 1ZRTE 4DV0O 1JCCA 1PGJA 2DWDC 1FZFA 3E2EA 1ROPA 1Y76A 2GHYA 3ZN0A 1BGYG 3THOA 3SR2C 4QPKA 1SQPH 4HNAB 3A7OA 1YXBA 1L0ND 3AE6C 4PI0A 2QM8A 1YJ9P 2Z0AA 5LMNO 2H89C 2NR5A 1N73B 1SQQG 5IWAB 1HNXB 2LW7A 4O4LB 2QE7H 1FFXA 2IJIA 1PP9D 3PRJA 4JI0B 2QM7A 2C9LY 4J11A 1WN7A 1ZV8A 3HKDB 2Z5UA 2UUAO 2PUSA 3SJAC 1KD1Q 4B86A 3CJHB 1EN4A 5EC1C 5LXTB 2YEVA 1XREA 3LW5J 2YXLA 4I7ZC 2A06E 4JI3O 3EWKA 2QWNB 5AW4B 4JI1B 3H1KG 3EQ2A 4YJ2B 4G27B 3WB0A 1IFJA 2FFDB 1N36B 1G2CB 4UVBA 5LHGA 2ZXEB 2A3QA 1GL2B 1LT1A 2OTKE 3FB8C 3KZIZ 4LH7A 3SFDC 5KLVK 1G6UA 3H1JD 2AEFA 3HD7C 5JH7A 1VQ9V 2QJ1A 3GHGA 2V1DA 4DT0A 4PDMA 2ZD9A 4DOJA 2W6IG 2K1EA 4JV5O 4MTOA 2YKOA 1TA8A 3STZC 2OTJV 2JEUA 1K3EA 3LUTB 4K8XA 1URQB 2YKPA 5B5EH 1KUQA 3AE3C 3CMEP 1YI2V 1YTFD 4JI7O 3G6EP 1I5XA 1PPJG 4UB6Z 4GKKO 1H2KA 1N34O 1DD3A 4JASA 2I8DA 3M0AA 1PFIA 1FOSE 2IBZD 1AVYA 4R7CA 2ZYGA 3AEFC 1B6QA 2XAGA 3C90A 4X65O 2FB5A 4XDKA 1KYOI 2JIZG 3SYAA 4B3TB 2CTQA 1L4AC 5AVSB 5IY5C 1WA8B 1MABG 1MNGA 4DV2B 5KAFE 3K04A 2BCCE 2WPDG 3K08A 4K0KO 2AEMA 4MN4C 3AG7A 5M1BA 5JJEB 3CCJP 1HF9A 3DXRA 4X9QA 3M06A 2EIKC 5AVYB 1N33B 4I2LC 5FL7G 3M9HA 3P3NA 1OIPA 2KSEA 2HVKC 1JY3O 5GTHE 4LF9B 3FWNA 1S76D 3F89A 3FYEB 3ZJZA 3H1HE 3TYYA 3OUSA 4N23A 3ZRVA 1NTME 3HE4B 3UO3A 1K92A 2V7QH 5LA6B 3ZRXA 3CXHI 1IFMA 3TETA 2CK3H 2KLUA 1SQBG 1KBHA 2B1IA 1KC8Q 3DGEA 2AZ2A 2OTLP 2EJ7A 1I5YA 2EILC 1SQXK 4UVAA 4C7NB 1THZA 1UFIA 4DW0A 1XMOO 3EXAA 4ZOLB 4PHZA 3K58A 1Q86W 3MUDA 2BSKB 3HR0A 4U3FH 2R3SA 4DR5B 4QMAA 3A0RA 1MSDA 4FLUA 3FB5C 1M93A 5KLVH 4ZNCA 1Y67A 2F43G 1Q82Q 5K5GB 4JTAB 2RN0A 1R3LC 1NTZE 1COWG 5H5NA 4WVZA 3Q5RA 3Q5SA 4YIOA 2LQTA 3L72E 4UCSA 4PD4F 5CN0A 4P9OA 4JGSA 1S72P 3CC7V 1EDJA 3H1IG 5IYDO 1FZCC 2RQ6A 1BT8A 1W2EA 2A0LA 1M8OB 2D2CD 1VEWA 3P3PA 3K59A 2XAFA 1LTIC 2JGDA 4O4IA 4PELA 1LT9A 1ZL8A 3HKCB 5LOVB 1CW5A 3M91A 2ITDC 3CWBH 5L3DA 3V2QA 5KA6A 1MKMA 4X1YA 1SZXA 2K9JA 3L70G 1FXVA 4IGGA 1LTSC 2L91A 3HTKB 3OR7C 2FYUE 3OA7A 3K0GA 3S9OA 4GKJO 2LJ2A 2E75D 1DTOA 1AA0A 1RM1C 4FLZA 3RL0C 4N78E 3RYCA 1IJDB 2ZFCA 3RYFA 4H13C 4X66O 3L35A 2NPSB 2QKCA 3LNMB 1GN6A 4UV8A 1N7SB 4D7SA 1L0LJ 1NAFA 1JR9A 4DV4O 4LFAB 1ZLZA 4HKZH 4B3MB 3E86A 3CS5A 4GYCB 2QGNA 2CTPA 2O01N 4EFEA 1QBZA 4J42A 3H1LD 3KHUA 3OGIB 3AE4C 4OGQD 5GTHZ 1JY2P 2NNUA 1QR9A 1MA1A 1KORA 4YHHB 2Q3IA 1Y76B 4FJCC 2YI9A 3EVKA 3GW6A 1XL4A 1RY3A 3MHVA 4N3YB 3U59A 3VYIA 1DIPA 1IZ3A 1XL6A 3BA8A 1FDIA 4WBNA 1LGHB 1XEQA 2P58A 4W80A 3TXQA 3CMAV 3AEAC 1SQXH 1FFXB 3M99B 3ZMVA 4GCZA 1VIBA 3D70A 4I55A 3BA9A 4DV3O 1S0VA 3F7VC 4MW8A 3AE9C 1J1DC 1KILE 1LWUA 3C9IA 4LF4O 1KB9D 3GF7A 3VP8A 2JEEA 2UUCO 2YEVB 3A0BE 1ORQC 4DUZB 3L73E 3SJCC 4KFMA 4DZOA 2Q67A 5IYCO 5APVA 1AILA 1M1KW 1IBKO 3I5DA 4FLYA 2UXDB 1MSWD 5LHIA 4EEQA 1CEZA 2R44A 3K0DA 3WG7B 5J2TA 5CBNA 3FKSG 1ENVA 5JH7B 2ZKOA 3GHGB 5AVWB 1LP1A 4RKUJ 4HB1A 3TGUH 2Q3EA 1Q2NA 2YIBA 3BCCH 4PD4I 4JPRA 2M3BA 2Y4UA 2Z4EA 5AG2A 1JOCA 3CX5H 3HUSA 3GF3A 1X9VA 3LNNA 3VQXA 1NZ6A 3OD4A 2XOKG 3MIWA 5KMGA 4KHPO 2EIMB 1FZEA 3W68A 1SS1A 1VQ4P 2QM4A 1NR7A 2E75C 3CCEP 1YVWA 3QO8A 4NVPA 3G6BA 3BVOA 4I0XA 3JSVC 2OIGA 5LMUB 4YIPA 2H94A 2HR3A 5B1OA 1EZVG 1HGZA 1F7YA 3B5NC 4CZZA 4YJ3A 4I1LA 1NU1G 2KXPB 1Y66A 3CCMV 2WMMA 2VWKA 2M6YA 4XA4A 1G4YB 3DXRB 1UPGA 2M3EA 2A79B 1VQOP 4ABMA 4ZKPA 5B1AB 1EZVE 3AK1A 3L74E 3I56P 1JY3N 4PV1B 3LDEA 2UXXA 3ASOB 3TNUA 4TWKA 1OFCX 1FS0G 3L75H 1OV9A 1IBMO 3GMAA 1GL2D 1SQQK 1LTJA 4UVCA 4RO2A 4L74A 4DR2B 3C3SA 2Q0AA 4I9QA 3JALA 4PA3A 2XDJA 4GOEA 1NTKE 2IYPA 5EIBD 1H2SB 3A0BZ 2I1KA 4UCOA 1HJ0A 1NVPB 5AW9B 1BHAA 4C7RA 1VQMP 2QJYC 3KZIH 1URQD 1GW3A 2UU9B 3RWRD 4TT3G 4N78D 3ABKC 4BWAA 2D3OW 3NR7A 1JO5A 2OARA 1JJ2U 3AE8C 2F4VB 3L71D 1W2BU 3C1LA 2Q1KA 1WJZA 4Y99B 4EKWA 1BCCH 4J7ZA 1RE3A 2DYSC 2W6JG 2H7HA 3RK3B 4K3AA 4D6TD 4IT5A 2WLIA 2XNDG 1QCEA 2GTSA 3IF4A 1U96A 3E8GA 2JGDB 4O4IB 5D5QA 2ZIOA 4FM1A 1LT9B 1BS3A 1ZL8B 2E43A 2BCCJ 2W83C 2WPQA 1RE4C 1V9PA 3HB3B 4TSFG 2K9JB 4B08A 1P84E 1JY3P 1M57C 3ZS8C 1GU5A 3E89A 5L8RJ 2VQFO 3WB1A 4F6EA 1JMMA 3H9VA 2H43A 3BPZA 2UXCB 4LFCO 4DV0B 1BHBA 3RYCB 3GLMA 3H1HJ 3RYFB 1NTMJ 2CUGA 1NHLA 4JAVA 2LR2A 4ZI7B 3IAYA 3F5HA 1MZ9A 3D8CA 5IDJA 2Z5HA 1LTGC 1SQVD 2Q9LA 2YKQA 3CCSV 3ETDA 3FD9A 1M90W 5LMNB 5L3FA 1BGYH 3OUFA 1AQTA 4NKGB 1M1JA 5A2QN 1VQKV 4LF6O 2AXTE 2OWOA 3RFRA 1JCDA 3A0HE 2YSUB 5BZBA 3EFGA 2EULA 1YDXA 1N8RQ 1K8AQ 5JVDA 2UUAB 3SJQC 2R9IA 3E8FA 1SQQH 2IM9A 1VF5B 1H38A 1AI5A 2FFDC 2ZE5A 3E8BA 2Q8VA 4WBNB 4XFJA 4JI3B 1NTZJ 1GL2C 3K06A 2GUZA 4W4KA 4JTDB 2ZVNB 1S5HC 1SQBK 4I55B 2V4HA 3L72J 1KQSO 2K3RA 1H89A 5EIBC 2ZNJA 4UCRA 5KJ7D 1R6TA 1LWUB 4RUEA 2KOGA 3H1KH 2YNYA 4DV6O 2QKAA 4PA9A 2DW3A 1WMKA 4JV5B 3TXSA 1YTZT 5CJ0A 3OFNG 3JAKA 3OTFA 4J9YB 1S3JA 2LGQA 4MS2A 4JI5O 3A3YB 3IC7A 3APOA 4H44B 2FYUJ 3N27A 5KKZB 3VQVA 4JI7B 2B9ZA 5J2TB 1ZWIC 3B40A 2WSEH 1LP1B 4GKKB 1N34B 1V54B 1IFIA 4U7JA 1RF1A 4HYOA 2NPSD 2HFED 1X59A 1QR8A 2JEXA 1VQNV 5CA1A 1N7SD 1Q6HA 2MW2B 3HUSB 1BE3G 5E79E 3AG2C 1FDOA 1PPJH 4X65B 2H8PC 3MZWB 2B5UA 3IAOA 4WWIA 4YTPC 5CA3A 2QWPB 1KKDA 1N0JA 1U7JA
chains in the Genus database with same CATH topology
4I7ZB 2MKVA 3R4YA 2QJKC 2QJPC 2BEQD 2BEZF 1ZRTE 3Q1MA 2E76B 4H44D 1PL5A 1OW8A 4R4LA 1YQ4C 1KMIZ 3Q3DA 2WSCJ 1KQFB 1PIXA 1ZP0C 3D6YA 2D2CB 1TU3F 3ABVC 1KQGB 4H44C 1Q90D 3AE6C 4TT3H 1R8EA 2E74B 1K04A 3IN6A 5KLIC 3D71A 1EXIA 4RKUJ 1KTMA 2H89C 5L8RJ 1OMIA 1RQVA 2QIWA 2FBWC 3H25A 3GLMA 3RK3E 1PV3A 4H13B 3GF3A 3AE5C 3Q5RA 3Q5SA 2E75B 2H88C 3AEGC 3AE2C 1JB0J 1RQUA 2FXPA 4IL6X 2WSFJ 4R4MA 3LW5J 3Q5PA 4I7ZC 1NYHA 3GF7A 2ZT9B 3EWKA 2E75C 3FGAD 1YQ3C 3AE7C 1EXJA 3AEDC 2D2CD 3C8VA 2E76C 2P10A 2O01J 2JP3A 3RL0g 2E74D 2G8YA 4YXDC 4OGQB 1DD4A 3SFDC 2YMKA 2D2CC 1MKMA 1VF5B 4Y28J 2IDBA 1ZOYC 2J5UA 2NZ2A 4GDOA 1U57A 4H13D 3SFEC 2E74C 3AEBC 3S9OA 2FYNC 4XFJA 1OW7A 2E75D 2E76D 1IK7A 4H0LB 4H13C 2WQYC 4KT0J 3AE3C 4PV1B 2ZT9D 1OW6A 1GMJA 1DD3A 2WSEJ 4H0LC 1VL2A 3AE4C 3AEFC 3GMAA 3O6QA 2ZT9C 1WMKA 1Y9BA 4OGQD 1K05A 2JO1A 1KORA 3D6ZA 1VF5D 3AE1C 3Q2YA 4H44B 4OGQC 2G3AA 1NGMB 1HJ0A 1DIPA 1VF5C 2OQQA 2QJYC 1FDIA 2V7QJ 4H0LD 1ZMEC 4U7JA 5M1BA 4PV1D 1S1CX 1HF9A 1UIXA 3AEAC 5KKZC 2YIUC 1AJYA 3AEEC 3D70A 1FDOA 3T97B 2QSIA 2WPVB 2K9YA 4Z1MH 3AE8C 3IAOA 4YTPC 3B71A 4PV1C 3AE9C 3AECC 1KILE 1S5LX 3G9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I7Z B;  2QJK C;  2QJP C;  2FYN C;  2E75 B;  1ZRT E;  4H44 B;  2E76 B;  4Y28 J;  1JB0 J;  4IL6 X;  4H0L B;  2WSF J;  3LW5 J;  4KT0 J;  2QJY C;  2WSC J;  4PV1 B;  2ZT9 B;  2D2C B;  5KKZ C;  2YIU C;  1Q90 D;  3C8V A;  2O01 J;  2E74 B;  2WSE J;  5KLI C;  2QSI A;  4RKU J;  2WPV B;  2K9Y A;  5L8R J;  4OGQ B;  2QIW A;  1S5L X;  1VF5 B;  4H13 B; 
#chains in the Genus database with same CATH topology
 1YIT P;  5KMG B;  3L4F A;  1VQ7 P;  2KKW A;  2A9H A;  1BE3 E;  1K9M Q;  1WPX A;  4K0K B;  3QO7 A;  3C3T A;  3NXS A;  2J59 M;  5IYZ A;  2Q4P A;  3JD4 A;  5KUM A;  2CPS A;  2YMY A;  1SA0 A;  3SSU A;  3CB2 A;  5JJN B;  2WSC J;  1KIL C;  4I0X B;  2JWD A;  3SYP A;  1L0N E;  1K73 Q;  2X7R B;  2IJK A;  3ABV C;  2HKO A;  4FZ1 A;  4YJ3 B;  1OCO C;  3SPI A;  1DF5 A;  4CS2 A;  1PP9 E;  2AXT Z;  1KYO H;  3A0H Z;  1JQ0 A;  1WAZ A;  2QIW A;  2DQ3 A;  1KZU B;  5LP6 C;  4MT8 A;  2HLO A;  3CC2 P;  1ZXG A;  2YC0 A;  3B4S A;  3CCV V;  3L73 J;  3AEG C;  1HTL C;  4YY3 O;  2WLH A;  5KHI A;  1XMO B;  2N1T C;  1WB7 A;  3H1J G;  2ZE7 A;  1SQB H;  2FXM A;  3N2K A;  4WY4 A;  1OX3 A;  1Z2G A;  4G28 B;  1LTJ B;  1R6N A;  3AED C;  3SDL A;  4NB5 A;  2JP3 A;  3JAL B;  2JJ1 G;  3H1J E;  2ZAE B;  5KJ7 C;  3ZHV A;  4M3L A;  1JOY A;  2HP8 A;  3ASN B;  3CCQ V;  2IDB A;  2G38 A;  4MVS A;  1SQF A;  4UUJ C;  1L0L G;  5IJ9 A;  4EYY Q;  2Y9Z A;  1W59 A;  5KHK A;  3VTP C;  4DYL A;  3W7X A;  3PH0 A;  3CC4 V;  4JZ2 A;  1VDF A;  1HWT C;  3S3X A;  1KFN A;  2Q7C A;  1GTO A;  4XDJ A;  1M7L A;  2WQY C;  1L1F A;  4GKG A;  3H1I H;  1GRJ A;  1WP7 A;  1SQP K;  4R50 A;  4JYA O;  3G71 P;  2IBZ E;  1YHQ V;  4DR6 O;  4DV1 O;  5E79 Z;  2PP6 A;  2OCC B;  2NPS C;  2WLI B;  2UXB O;  4GKJ B;  2ZT9 C;  1K97 A;  2Q5U A;  3SYC A;  1AFO A;  1PL0 A;  1OCR B;  5LGN A;  5FLX N;  3L70 H;  4X66 B;  4EI2 A;  1TVK A;  3R66 A;  2JDI G;  5CCG C;  1FOS F;  1Q43 A;  4DV4 B;  5EBL C;  2OYI C;  4AQR D;  2YID A;  5AW8 B;  4O4J A;  5KLV D;  2KZI A;  4DCK A;  1GAX A;  2KZJ A;  3E1I A;  2A7W A;  3L74 J;  4PV1 D;  5GTI Z;  4GT1 A;  2IH1 C;  5EBW C;  2IJJ A;  1JTH A;  3JAS A;  5AVR B;  3RK2 B;  4MVO A;  2JGU A;  1FJG O;  1VF6 A;  2E3C A;  5EBM C;  2R72 A;  2K9Y A;  1M56 B;  2Y9Y A;  2YUA A;  2E5T A;  2Q6Q A;  4GOD A;  3OW2 U;  3D36 C;  2Y69 B;  1RFY A;  5ITZ A;  2WSC H;  2Z3Y A;  1H2M A;  1NU1 K;  3CPW O;  3ABM C;  3IGA C;  2WIT A;  4DK0 A;  1NTK J;  5GON A;  3BAT A;  2EX3 A;  2ZDI C;  3CWB D;  1M1J B;  3CYO A;  3RN4 A;  3V2R A;  1NVP D;  3PHL A;  4I4T A;  1XTG B;  2YXQ B;  4DV3 B;  1SFC D;  5APQ A;  3UIA A;  4AUW A;  4J80 A;  1TU3 F;  1GW4 A;  1XIL A;  2M7W A;  4LF4 B;  3K5O A;  3IN6 A;  2UUC B;  3K5B A;  4BIO A;  2DOS A;  2GUS A;  3JCU E;  5CA0 A;  5DM6 V;  3U11 A;  2RKL A;  2P5O A;  2YS8 A;  5BMV A;  1IBK B;  3JAR A;  4HAM A;  5BXZ A;  3IR9 A;  1T8Z A;  3RK3 D;  1JEK A;  2H88 C;  1IO4 A;  1JB0 J;  1RQU A;  3N7N A;  1EN5 A;  5F2V O;  5KHG A;  1KD1 W;  2WA4 A;  3CCR V;  3W7T A;  2VRS A;  1KU9 A;  2XV5 A;  2WA3 A;  4EB6 A;  1RPR A;  3FGA D;  1FAV A;  1BDC A;  3JAK B;  2KK7 A;  2P10 A;  5CCH C;  3VQY A;  2EIM C;  1P4R A;  2FKX A;  3JD0 A;  3ZHU A;  5EC2 C;  4FLX A;  4FLT A;  4YPC A;  2F95 B;  1PGO A;  5B1B B;  1DD4 A;  5KAI Z;  1SQX D;  3CEI A;  2FXO A;  1Q8I A;  2J5U A;  2WSF H;  3SFE C;  2E74 C;  2A06 G;  4KHP B;  1RF1 B;  4CH5 A;  1MZF A;  1Q6U A;  1QVF O;  2YXH A;  5CA1 B;  2LKM A;  1H8E G;  2L5G B;  4X64 O;  5CBH A;  5CBF A;  1IK7 A;  3B8M A;  4FFB A;  3GB7 C;  1OW6 A;  1BQ0 A;  4PD4 H;  3ZHS A;  3H1L E;  1VQ9 P;  3H01 A;  1EZJ A;  3ETQ A;  4BW5 A;  4UB8 E;  2JR8 A;  2HPC A;  2B1G A;  1HNW O;  5IYZ B;  4Q6G A;  4OXS A;  2ZXX A;  2JO1 A;  5DJU B;  2OTJ P;  1VF5 D;  1EZV H;  1SA0 B;  4RQE A;  1FXK B;  5AVZ B;  1VQ5 V;  1NU1 H;  3E35 A;  3G4S V;  1YI2 P;  2F1M A;  1GN2 A;  4O2B B;  3J81 N;  3TGU D;  2R3C A;  3BCC D;  5HFL A;  5KLI B;  2AW9 A;  3QNE A;  3CX5 D;  5H2F E;  2OQQ A;  2CPB A;  3CHX A;  1IFP A;  5L3C A;  1IBM B;  2AHY A;  5BR8 O;  2YIU C;  1YF2 A;  2W0X A;  1XMQ O;  1SVF A;  1SET A;  1HJB A;  3O8Z A;  4GX2 A;  1RF0 A;  1SFC C;  2C2A A;  1KB9 E;  2QTS A;  2BE3 A;  1ZR4 A;  4ZBM A;  2NN4 A;  3B8N A;  2GSM B;  3JCU Z;  2PRR A;  2BCC G;  1X8Y A;  4OX9 O;  1US6 A;  2KYV A;  4EFB A;  4WY4 B;  4L87 A;  2JJL A;  4H44 D;  5APS A;  4GX1 A;  2FY8 A;  3SPG A;  1HP8 A;  2QSA A;  2ZQM A;  4UCU A;  3MAQ A;  1JMB A;  1WB8 A;  3RK3 C;  4HH2 A;  1QLE B;  1KC8 W;  3L36 A;  2YIB D;  2BOC C;  3H1H G;  2P22 C;  1NTM G;  2Z5I A;  4TT3 H;  2DYR B;  5IJ9 B;  5GW7 A;  4X8A A;  3WB2 A;  1OVR A;  1RQV A;  5LGU A;  4FZ0 A;  1K34 A;  4JYB A;  1NKZ B;  4MVR A;  3T4Z A;  4DUY O;  1AI7 A;  3OGC C;  4BXL A;  1AV1 A;  1Q82 W;  1BE3 J;  2W6J H;  3L75 D;  1X4T A;  3FB6 C;  2ZR2 A;  5J2U A;  5BU5 A;  1Q7Y Q;  2XND H;  4OWF A;  3J7A U;  5EZY A;  3RVY A;  5AW5 B;  3P7K A;  1LR1 A;  2VQF B;  5AVX B;  2IFN A;  3VMY A;  1S5L H;  1L0N J;  3MDS A;  1JUN A;  4LFC B;  2O01 J;  3HKB A;  1NS1 A;  1JVM A;  3RL0 g;  1KP2 A;  1JY2 N;  1NTZ G;  3HE5 A;  1ZR2 A;  1V55 B;  2WSS G;  1TVK B;  1N0N A;  4OPH A;  3LSU A;  3L72 G;  1PP9 J;  3JAT A;  5DEC A;  3HD7 A;  1GH6 A;  4O4J B;  4UB8 Z;  4FLW A;  3CC7 P;  3L37 A;  3LW5 H;  4BIZ A;  1J1E C;  1SQG A;  1L8D A;  1JTH B;  2JVD A;  1IFD A;  5CB4 A;  1D5A A;  1AI4 A;  3WFV A;  4LF6 B;  2IZ0 A;  2AGA A;  3QF7 A;  1IZN B;  2EIJ B;  2DW4 A;  5H2F Z;  4KP4 A;  2RDC A;  3V5B A;  4B7K A;  5ITZ B;  4MVM A;  1GMJ A;  4JQ0 D;  2FYU G;  5B66 E;  1IBL O;  5GON B;  3H1J J;  1LUW A;  2W6A A;  4IL6 H;  1DH3 A;  3E22 A;  4TV9 A;  4I4T B;  1EC5 A;  2P1J A;  1IDS A;  3JC2 2;  2HHH O;  3CXH E;  1AI6 A;  1AP6 A;  2ZXW B;  2KSJ A;  2YXR B;  3ZBH A;  3DTU B;  1DEB A;  4OVN F;  1Q86 Q;  4DV6 B;  1QLN A;  3M0D C;  4TQD A;  5CA0 B;  5KAF Z;  5KKZ C;  4KL1 A;  5AVU B;  1IC2 A;  1WP8 A;  4JBZ A;  3K5N A;  5BMV B;  3SYO A;  3T2M A;  3JAR B;  5A9G A;  3L71 E;  4NYK A;  1V54 C;  2EIN C;  3B09 A;  1I7F A;  4JI5 B;  2K37 A;  3PTZ A;  3HUS C;  3O65 A;  1BDD A;  1BGY D;  2RMK B;  4D6T E;  1OCZ C;  2IJH A;  3R4Y A;  1L0L K;  2QJK C;  1LJ2 A;  1URF A;  3RYI A;  4EB6 B;  4NXN O;  1J2J B;  2EZP A;  3CMA P;  3Q1M A;  2E76 B;  2ZNI A;  2Q7E A;  1DK1 A;  3TJT A;  1SQQ D;  4LH6 A;  4DV5 O;  4NXM O;  2W27 A;  3RK2 D;  3L73 G;  1BE3 H;  2FYN B;  1T6A A;  1J95 A;  1M56 D;  5LL6 Y;  3SWF A;  2DQ0 A;  4KJM A;  1YIJ V;  5TIS E;  2WTY A;  3H25 A;  1BSH A;  3H1K D;  2NLJ C;  3CCU V;  5GTI H;  3T97 A;  1P84 F;  1SQV E;  4FFB B;  2N9B A;  4L73 A;  1N2D C;  3T1H O;  1ZN5 A;  4O9B A;  4DRX A;  1VF7 A;  4ZKU A;  1FZC A;  3X2Q B;  2HPC B;  2Q69 A;  3BAA A;  3IJ4 A;  3C8V A;  2QKS A;  5APX A;  3AG3 C;  3AG4 C;  2RMZ A;  3OEH G;  1VQL V;  4FLV A;  4EIJ A;  1S9K D;  1MFZ A;  5B66 Z;  1M9N A;  2D2C C;  1FPO A;  4YY3 B;  5AW6 B;  1XHZ A;  1EDI A;  1PPJ D;  1YZB A;  4IIJ A;  2AZ0 A;  3ABL B;  4I50 A;  4PJ0 H;  5TJH A;  4H0L B;  1EZV I;  1Y6X A;  3VP9 A;  2XZR A;  3H1J H;  2ZM6 O;  1NH2 B;  3KYQ A;  4PA7 A;  5BVZ A;  4P30 A;  2LFR A;  4CBC A;  1S2E A;  2XKM A;  1USD A;  1GD2 E;  4CC5 A;  3E1R A;  4Z1M G;  2QJP B;  3CCM P;  1B3Q A;  1K4D C;  2CH7 A;  1U7M A;  3NFQ A;  1SZT A;  1QEX A;  1SQP E;  1LTT C;  1YEW A;  1H8H G;  3L74 G;  5AVV B;  3O9O A;  4IYH A;  4U3J A;  3W7W A;  4H37 A;  5KHH A;  1L0L H;  4BWN A;  4JI0 O;  1KYO D;  4OGQ C;  1NGM B;  3G80 A;  2Q7G A;  4D7T A;  4JYA B;  4LP8 A;  1M5I A;  2WWW A;  4IHJ A;  2OYH C;  1SES A;  4DR6 B;  2WPS A;  2M0B A;  2IX7 C;  4NPE A;  4LGD E;  2R5D A;  5KAI H;  2X0L A;  1HUC A;  2UXB B;  3N2G A;  1GM7 A;  1FE6 A;  1PNL A;  2IU0 A;  1NTK G;  3H1L J;  1SQB D;  1FD9 A;  1JFF A;  4LNU A;  2YXY A;  4GX0 A;  3T1Y O;  3AEC C;  1I94 O;  2DN9 A;  5J2U B;  4ASU G;  3Q4H A;  1AJP A;  3G9R A;  4CH4 A;  5DJT B;  4I7Z B;  2MKV A;  5EZY B;  1PL4 A;  1HR0 B;  5TIS Z;  1EBO A;  5FPO A;  1M56 C;  3ZHT A;  1G1I A;  1NR1 A;  4JTC B;  1PL5 A;  3CXH D;  3HKB B;  2JDI H;  3HE5 B;  1KMI Z;  4QPJ A;  1KQF B;  1FJG B;  3KQG A;  2AEJ A;  3CLQ A;  3JAT B;  3HD7 B;  5B5E E;  1UII A;  2N04 A;  3I55 V;  1P84 I;  1K04 A;  3V4W A;  1YJN V;  1GK6 A;  3DC6 A;  4X20 A;  3EHB B;  4BIU A;  1YJW V;  3FFQ A;  3RBZ A;  3H1I D;  5CB4 B;  5C93 A;  3CD6 V;  4QE7 A;  2JS5 A;  4U7N A;  2CTW A;  3KCY A;  4UB6 H;  3AE2 C;  3V6I A;  4RAI A;  1PGP A;  1PZQ A;  4LF8 O;  3Q5P A;  2YO3 A;  3QO5 A;  4CS4 A;  2K9P A;  1QLE D;  3L70 D;  4JI2 O;  4GX5 A;  2OIE A;  3E22 B;  1XDC A;  5AW2 B;  2PYL A;  4TV9 B;  4X1Y B;  4LF7 O;  4MVU A;  4FVM A;  4MW3 A;  1X0T A;  1CPY A;  1N33 O;  5LYJ A;  1D7M A;  1ZTE A;  1JJO A;  3E7K A;  3B5N A;  4DXW A;  3CCS P;  1N8R W;  1GM8 A;  1K8A W;  3AEI A;  1KN7 A;  1W2B O;  1NI8 A;  2EIK B;  3CSX A;  2HG5 D;  3NMD A;  1Q81 Q;  1N73 C;  1I0H A;  2KSD A;  2KUB A;  1VQK P;  4NTX A;  4DR1 O;  2O3J A;  5FPR A;  3FYI B;  4P9P A;  3V2P A;  3FAV A;  2O57 A;  2WVR A;  2Y0D A;  3FX0 A;  1GK4 A;  1NTM K;  1FC2 C;  5IE9 A;  2QA4 V;  3RYI B;  3QWO C;  1GZL A;  2QWQ B;  4P2Z A;  1K5S A;  4R6Z A;  4U3F E;  4X64 B;  3AE1 C;  2EIL B;  4YXW G;  1EDK A;  1J5E O;  3KG2 A;  1W5C E;  4IOI H;  5KLV E;  2A06 H;  1QVG U;  1FJK A;  1DEE G;  5CBO A;  2X6A A;  3U10 A;  3ZRW A;  4KHX A;  1N7L A;  1FXK C;  1OVU A;  3ABU A;  1HNW B;  3QVN A;  4LWS A;  3VN0 A;  3T97 B;  4X1I A;  4B3S O;  3U1A A;  2WPV B;  1NJI Q;  1S77 D;  1NTZ K;  5B5E Z;  1URQ C;  3ETE A;  3SPC A;  4LFB O;  2GTA A;  3II6 A;  4ASW A;  2BOB C;  2BTQ A;  1Y47 A;  4DRX B;  4ZIB A;  1FZC B;  2QWR B;  1SQP D;  4LLH A;  2ARH A;  4GLX A;  4GOF A;  1R3K C;  1YTZ I;  3CWB E;  1VQN P;  1HWY A;  3ZX6 A;  1K9M W;  5BR8 B;  3BRV B;  2B89 A;  1XMQ B;  1QVG O;  5AVQ B;  3TCU A;  1RE4 A;  2PZS A;  3OE7 G;  4MVQ A;  2ZVO B;  2F93 B;  1Q90 D;  1K73 W;  2P6J A;  3JYC A;  4L76 A;  2PY5 A;  1PKX A;  4OX9 B;  2P7T C;  2ZJS E;  4XE5 B;  2CTR A;  2FYU K;  3L71 J;  1QLE C;  4IIJ B;  3RL0 B;  3MD0 A;  4I50 B;  3T1C A;  4AQY O;  4QGP A;  4H13 B;  1PV3 A;  1GN4 A;  1ZLL A;  4PD4 D;  3RK3 E;  1IVS A;  3OT7 A;  5KAF H;  2IZ1 A;  2BCC H;  4D6T J;  2DE0 X;  2YDE A;  3OAA G;  1L0N G;  1Q3E A;  2Y0P A;  1GN3 A;  3SJB C;  4XDL A;  2P4K A;  1QL2 A;  5AW3 B;  2CH7 B;  1PP9 G;  1P7G A;  1NYH A;  4F6R A;  2Q9I A;  4JF3 A;  5GTH H;  2K88 A;  1NU1 D;  1YQ3 C;  2POH A;  1NT2 B;  3H1H H;  1NTM H;  4U3J B;  4IFF A;  4NTW A;  3CXC U;  5JCO C;  4DUY B;  1SQX E;  4DJG A;  1MMM A;  3A8T A;  3CCV P;  4MVZ A;  3SPH A;  2Y0E A;  1QX8 A;  1K4C C;  3PN1 A;  2FFD A;  3CRM A;  4IHJ B;  2JWA A;  1VQP V;  4LF5 O;  2XAS A;  2XAQ A;  1PNK A;  1GL2 A;  2KI7 B;  1X22 A;  3RT3 C;  2ILM A;  1SQV J;  4HJG H;  3N2G B;  4AYC A;  3TNU B;  3OEE G;  4JI4 O;  3VMA A;  3SYQ A;  1JFF B;  2ZE8 A;  4LNU B;  4DR4 O;  1EFR G;  1N86 A;  1J1D B;  4KXR A;  3Q4H B;  5KTB A;  3CCQ P;  2RNB A;  2IBZ I;  2QWO B;  4DR7 O;  2W6B A;  1S5J A;  1WPB A;  1SC5 B;  4RJT A;  1NTZ H;  5JQG A;  2WSS H;  3O6Q A;  3CC4 P;  3PLN A;  4PA6 A;  4OPA A;  1OJH A;  2QEX V;  3L72 H;  4WFF A;  4MTG A;  2ZR3 A;  4BAY A;  1PM9 A;  3TGU E;  5H6R A;  3BCC E;  2RCV A;  4JI6 O;  3Q2Y A;  1XNQ O;  2C0W A;  2Y0C A;  3CX5 E;  4CH6 A;  1VQ8 V;  2IBZ G;  1YHQ P;  1F23 A;  4H0L D;  3OTO O;  3JAW A;  1FZB A;  1S1C X;  3UT5 A;  5KX5 A;  1NH2 D;  1IBL B;  1IUR A;  1CI6 A;  3B77 A;  1AVM A;  2ZXW C;  5KA5 A;  5KUK A;  5LBQ A;  3UKM A;  2QSI A;  2VS0 A;  2HHH B;  2FYU H;  3B71 A;  2HFE C;  1N7S C;  2Q73 A;  4I5S A;  3WUV A;  1SQP J;  2EZO A;  4RQF A;  3LIE A;  3TK1 A;  4TOI A;  1YBK A;  3M9B A;  2GDS A;  4ZKI A;  4HBN A;  4U3F D;  4IFD K;  1KB9 F;  4WFB V;  1KKC A;  1FZG A;  2RN9 A;  3CL3 D;  1HGV A;  3BAS A;  3CCL V;  2ETN A;  5LA6 A;  2P7J A;  1KIL A;  3JD1 A;  3ZMZ A;  3Q3D A;  5B3S B;  1N32 O;  1PIX A;  2P06 A;  2QR4 A;  5LYJ B;  3B5N B;  4RES B;  4WCE V;  3LSS A;  3FXD A;  4F4L A;  4X1K A;  1KTM A;  1QNM A;  3OR6 C;  5DED A;  1MOF A;  1K33 A;  5CMU A;  4NXN B;  3K5M A;  2M8R A;  4ZOL A;  2OGU A;  1B06 A;  5LP6 A;  3FB7 C;  5JJJ B;  4ASV A;  1XUQ A;  2BSK A;  3JSN A;  3L75 E;  3L9D A;  4NR1 A;  4MTF A;  4QIW F;  1E5W A;  2EBO A;  3FAV B;  2ODM A;  2N1T A;  3ZED A;  4DV5 B;  3TF5 A;  5L3E A;  3ZCC A;  4R4M A;  4NXM B;  4WBA A;  3CP1 A;  2HYN A;  5C39 A;  5JVD B;  1SRY A;  4LCU C;  2SPZ A;  3IFM A;  3M8A A;  1F4M A;  3ZIA G;  1OZ0 A;  2JKV A;  1NTK K;  3A0B H;  1JMK C;  3L73 H;  3U1C A;  1LNQ A;  2WLK A;  3N4X A;  3T1H B;  2YMK A;  2GUZ B;  2Q68 A;  3ZRW B;  2QJY B;  3WG7 C;  4J41 A;  3DC5 A;  4WFE A;  3CCR P;  1VQ6 V;  3AEB C;  3OW2 O;  3GHG C;  4TUY A;  4A5U B;  3ABK B;  4WFA V;  3GG2 A;  2P90 A;  1R1B A;  1H2G A;  4CC6 A;  1BCC E;  4LWS B;  4X1I B;  2Q7H A;  3HTK A;  4OH8 B;  3SPJ A;  1KYO F;  3H32 A;  2FKW B;  2BTQ B;  2L6L A;  3F5T A;  2DYS B;  3P32 A;  4J9Z B;  3STL C;  4DR3 O;  1SP4 A;  4H0L C;  4K35 A;  4FPP A;  1JX9 A;  1NAY A;  1QL1 A;  1SF9 A;  1NKN A;  3PP5 A;  4JZG A;  3GWO A;  5B1N A;  1DF4 A;  4BR6 A;  2R9R B;  4I9W A;  4WF9 V;  2FL4 A;  1G1X B;  3MHH C;  5CCG A;  2ZM6 B;  2OYI A;  4X62 O;  3H1L G;  1M57 B;  1NO4 A;  2XAJ A;  2ADQ B;  2V7Q J;  2UWJ E;  1FJP A;  3CXH F;  3TDK A;  1JM0 A;  1VP7 A;  5CCG D;  1HDJ A;  1VQ5 P;  2BTO A;  5B1A C;  3G4S P;  5AVT B;  1XNR O;  4Z1M H;  1BGY E;  1KB9 I;  4PV1 C;  5E1A C;  3D36 A;  3ASO C;  1S5L X;  1NH4 A;  1RSO A;  4F6R B;  1YJ9 V;  4U3F J;  2QVA A;  3L74 H;  2YI8 A;  5AW1 B;  2LXC B;  1SQQ E;  2Y48 A;  2ZDI A;  2P67 A;  2LP7 A;  2I1J A;  3H6P A;  5KLV J;  1B04 A;  3SWY A;  1YQ4 C;  2KB1 A;  3BHP A;  3D6Y A;  2DWE C;  4E4E A;  3T1Y B;  1I94 B;  3OM3 B;  2P4V A;  1R8E A;  2E5L O;  3RGU A;  2QG4 A;  3MUD C;  1KQL A;  2WT7 A;  1NTK H;  5AW0 B;  5CJ4 A;  3H1K E;  2F23 A;  5IYB O;  2OYQ A;  5L3B A;  3VMX A;  3ZDM A;  5EYP A;  4ZHQ A;  1AR4 A;  2HJF C;  3N2K B;  1T3U A;  2RJZ A;  2M5A A;  3CWB J;  5BU8 B;  3A5T A;  1Q6I A;  4IL6 X;  4Y99 C;  4EDF A;  2ITC C;  2LGW A;  3VQW A;  4PDL A;  1KP3 A;  1Q7Y W;  5JQG B;  3O6Q B;  2UUB O;  3D3I A;  1EXJ A;  1L0L D;  2WLL A;  2VQE O;  1Z56 A;  3JCZ A;  3R2P A;  5CCH A;  1S9K E;  1LT9 C;  3ZN1 A;  1HNZ O;  1G1J A;  4YXD C;  1OCC B;  3CME V;  3K79 A;  3B8E B;  5HFM A;  3G6E V;  3RVZ A;  4CH3 A;  3RL0 D;  2OCH A;  1PPJ E;  4AI8 A;  1ZOY C;  4H13 D;  4X89 A;  3JAW B;  4LF8 B;  3UT5 B;  5KX5 B;  3G67 A;  1CI6 B;  1FYJ A;  3TSI A;  3AG2 B;  4JI2 B;  4G2K A;  4E2L A;  1RH5 B;  1UJW B;  4LF7 B;  1P84 H;  2IU3 A;  5CHX A;  2XAH A;  2XU6 A;  4DV7 O;  1WRG A;  2B88 A;  4JI8 O;  1H0T A;  4UCV A;  1E79 G;  2WLM A;  1GM9 A;  1PGQ A;  2ZYD A;  4JF7 A;  2KP8 A;  1FZA A;  4LR3 A;  1IXB A;  3CCJ V;  2YIA A;  1SQX J;  4C46 A;  3MP7 B;  3S4R A;  1K05 A;  3P8C D;  3AK3 A;  1PV0 A;  1KIL B;  1KYO E;  2Q0O C;  4DR1 B;  1L0N K;  2R9A A;  1MZE A;  5KHJ A;  1OCO B;  1N4C A;  4WFG A;  1EDL A;  3WUU A;  3JAS B;  2ATK C;  4X1K B;  1VF5 C;  2B87 A;  2WAM A;  1BCC D;  2AXT H;  3A0H H;  3VBB A;  3HRN A;  3LSQ A;  4O4H A;  3W7U A;  1NVO A;  1R73 A;  5LP6 B;  1D2D A;  1SQB E;  4XBF A;  4N6J A;  2JRI A;  1U97 A;  4DW1 A;  2OTL V;  1SFC A;  1J5E B;  1BL8 A;  1CZQ A;  2N1T B;  5K1X A;  1LWU C;  4FK5 C;  4C7U A;  1O9G A;  3KPE A;  3K9A A;  4PDV A;  3TGU J;  4YXW H;  1NBM G;  3BCC J;  1L4A A;  1QHT A;  4QNH B;  3L71 G;  1ZRT D;  1OW8 A;  2FTK A;  1HBW A;  4B3S B;  1WNS A;  4FMT A;  4LFB B;  1DLB A;  2ZCE A;  2KNC A;  1KQG B;  4H44 C;  1QU7 A;  3MTU E;  4A7P A;  2CDY A;  2KLV A;  4D6T G;  1S72 V;  1F4N A;  4O2A A;  3JAM N;  3J80 N;  1E1Q G;  4TUY B;  3H1I E;  1EM1 A;  4J7J A;  3BVH A;  1IK9 A;  3I5C A;  3JD3 A;  2FBW C;  3GWK C;  3A2A A;  3AG1 B;  4QE9 A;  5FNV A;  3ZRS A;  3HPL C;  5AW7 B;  3H32 B;  2HOD A;  2H3O A;  4JYY A;  5IJ0 A;  4B3R O;  2A45 I;  1Y8A A;  2JJ2 G;  1Q5O A;  3RGB A;  5E79 H;  3L70 E;  2PTM A;  4ZI7 A;  2ZT9 B;  1FFT B;  3B2E E;  3AE7 C;  4MSW C;  4RUF A;  3QH9 A;  1XQ8 A;  3B5N D;  2A06 D;  1YIJ P;  4AQY B;  3GVM A;  3CCU P;  3PJS K;  1SQV G;  4FFK A;  3BRT B;  4L8J A;  1Y4M A;  2A45 G;  2OYI B;  3WU2 E;  2WLN A;  4JPZ B;  1R3J C;  1U57 A;  3LID A;  1FDM A;  1KV4 A;  3L75 J;  1R3I C;  2Y0I A;  1L0N H;  2GM4 A;  3K57 A;  2PI5 A;  2O01 H;  4TQF A;  3V4Q A;  1VQL P;  3LDC A;  4KT0 J;  3FXE A;  1AB3 A;  3BEH A;  1T3J A;  2Y4T A;  1PP9 H;  2OT5 A;  2X6B A;  1IXM A;  3ABM B;  1RSO B;  4LF5 B;  3IFX A;  1XI1 A;  5IT9 N;  4K8Z A;  1Y9B A;  4R8C A;  3WUT A;  2VRZ A;  1LTJ C;  4BW9 A;  4IFM A;  3UM7 A;  2MK3 A;  4JI4 B;  1R5S A;  2HEP A;  2OYO A;  1H8A A;  4DR4 B;  1BZK A;  2IYO A;  1BCC J;  5EFW B;  4FM2 A;  1QQC A;  3ASN C;  1PNM A;  1AQ5 A;  2WT7 B;  1ZME C;  3M0D A;  1G8M A;  4DR7 B;  1SQP G;  2BCC D;  1UIX A;  1LTA C;  3AK2 A;  3AEE C;  1T2K D;  5EYP B;  4ZHQ B;  2ITA A;  3WMM 0;  1EQ7 A;  1JCH A;  2QE7 G;  2M5A B;  4QJF B;  4JI6 B;  1XNQ B;  3RBX A;  1AJQ A;  3A2F A;  3H1H D;  1RE3 C;  1OVV A;  1NTM D;  5IWA O;  1HNX O;  3OTO B;  1M1K Q;  3E83 A;  2OCC C;  2WLL B;  4PDR A;  2GV9 A;  4UCT A;  1ZW0 A;  2FYZ A;  1M57 D;  3OJA B;  2C9N Y;  1KEC A;  4UXN A;  2IBZ H;  2E5Y A;  1OCR C;  2O1J A;  4DV1 B;  3KCX A;  5APY A;  1ZX3 A;  2E74 B;  5J9P C;  1OXZ A;  2PAJ A;  1E1R G;  1WLE A;  1S4X A;  1VQ4 V;  4JI1 O;  5B3S C;  1X79 B;  1BSM A;  4PD4 E;  1QGK B;  3CCE V;  3VOU A;  1BGY J;  1N36 O;  1TUE B;  3M7M X;  3WU2 Z;  2IPP A;  3RK2 C;  2CGO A;  1NQT A;  4LC1 A;  3UO2 A;  1H0T B;  1N32 B;  1ARO P;  1NTZ D;  1R5L A;  1SQQ J;  2FXP A;  3I55 P;  1TUB A;  1NU1 E;  1YJN P;  3L72 D;  2Y69 C;  4AHC A;  4HYT B;  2F66 C;  3OMN B;  1YJW P;  3CD6 P;  3CRA A;  1VQO V;  1OHH G;  1M1J C;  3MGN A;  1GK9 A;  3BRC A;  3I56 V;  3CRR A;  2PI4 A;  2PF4 E;  2KB7 P;  1IX9 A;  3H1K J;  3U0Z A;  1M4U A;  2B87 B;  3S1K A;  2J58 A;  4Z2W A;  1FS0 E;  1L2P A;  1GU4 A;  4WY4 D;  4JAA A;  1RHZ B;  2YIU B;  3D3Q A;  4O4H B;  4DK1 A;  2FYU D;  2KQX A;  1Q81 W;  1JA8 A;  1SFC B;  4RWU A;  3ZHQ A;  1YYC A;  4B3T O;  1LTB C;  2X6C A;  2WZ7 A;  4UFZ A;  3JCU H;  4DV2 O;  4WB4 A;  1RP3 B;  4H33 A;  2GUV A;  2WSE J;  1A02 J;  1VQM V;  1VL2 A;  1P49 A;  1L4A B;  3HKE A;  5IY5 B;  1EN6 A;  2V7Q G;  2BAS A;  2R5B A;  4TLF A;  1T2K C;  2FML A;  4LF9 O;  3KKY A;  1OZH A;  5C8Y A;  1H2L A;  2CK3 G;  2KG7 A;  2KNC B;  5B1B C;  2IFM A;  2OYH A;  4O2A B;  4DR3 B;  2QA4 P;  4UV9 A;  2H8P D;  4EOT A;  2KIK A;  1I08 A;  1Y74 A;  1RF1 C;  1Z5W A;  3ZHR A;  1VAR A;  4U3F G;  2C0X A;  3CX5 F;  5FNV B;  3KXD A;  2HOD B;  5CMZ A;  2B9B A;  1NWQ A;  5IJ0 B;  1S5L E;  3DSQ A;  2W8Z A;  3ITK A;  5KLV G;  3ML0 A;  1NJI W;  3W7S A;  2AHZ A;  4X62 B;  1NOH A;  2O1K A;  4DR5 O;  4NPF X;  3F5W C;  1KIL D;  3ZMS A;  1KQS U;  2YIC A;  1XBL A;  5H9C A;  4TV8 A;  2BEZ F;  2KS1 A;  4W7Z A;  1SS3 A;  2EJR A;  3L73 D;  4R4L A;  1VPC A;  3E8H A;  3H1L H;  3F7Y C;  2QDO A;  5APW A;  1W0J G;  4Q20 A;  1XNR B;  4B7E A;  4UB8 H;  1SKV A;  3BAB A;  4BRY A;  2R32 A;  1J1E B;  1CSB A;  1SQB J;  5KLI C;  1EXI A;  1NKD A;  3CWB G;  3CRQ A;  1BMF G;  1OMI A;  3VOP A;  1ZUQ A;  2N1T D;  1H2N A;  3K03 A;  4W4L A;  1T5E A;  1P7B A;  1GTW A;  2XUM A;  1MV8 A;  5EK0 A;  5H2F H;  2XTA A;  4IL6 E;  2GBO A;  4MTX A;  1SER A;  1M90 Q;  2PYJ A;  3RYH A;  1PD3 A;  2E5L B;  2AXC A;  2Q6A A;  1GO3 F;  4J10 A;  2LFS A;  4CS3 A;  1YTF B;  2ZYA A;  4WY4 C;  1KB9 H;  1AR1 B;  1IFN A;  2MJZ A;  2E42 A;  3M9Q A;  4ZMD A;  2RH0 A;  4GZR B;  4LFA O;  3H1I J;  2WPR A;  4LBE C;  4B3M O;  1RM1 B;  3RW0 A;  4HNA A;  4Y28 J;  3SGI A;  2NZ2 A;  2DYR C;  1N73 A;  1OCC C;  2V4D A;  4O4L A;  2UUB B;  3NTN A;  2CGN A;  4YHH O;  2VQE B;  4FM0 A;  2E76 D;  1AP5 A;  2EIN B;  3BY6 A;  2ADP A;  1SQX G;  5L3G A;  3HKD A;  2JS3 A;  5LHH A;  1HNZ B;  1EZV D;  4U7O A;  1LUV A;  2ZT9 D;  1GMG A;  2HG5 C;  2YO2 A;  3L74 D;  3EFF K;  3OMI B;  2P2U A;  1OCZ B;  3CJH A;  4L75 A;  2VWJ A;  1VQP P;  2HVJ C;  1USE A;  5LXT A;  2QJK B;  3G3Z A;  2R70 A;  4PA4 A;  3ZMU A;  5BY1 A;  1FU1 A;  2LXB A;  4YJ2 A;  1S5L Z;  2Q5Z A;  4FIP C;  2NRG A;  4JYC A;  1A32 A;  3VMZ A;  3S3W A;  3D6Z A;  1H88 A;  1K5Q A;  1G2C A;  1V55 C;  3T4D A;  1AVO A;  4DV7 B;  5APU A;  1NTK D;  3CX5 I;  4JI8 B;  1Z5V A;  1W0K G;  5GTI E;  3P8M C;  2N74 A;  4DUZ O;  1FXK A;  1VQ7 V;  1YIT V;  3OAK A;  3UCS C;  4O2B A;  5APT A;  2GA1 A;  3ICX A;  1DX7 A;  2QEX P;  4N21 A;  4GUN A;  3TGU G;  2UXD O;  3L70 J;  3BCC G;  1URQ A;  1E79 H;  1VF6 C;  1SQV K;  3OMA B;  3QG5 A;  2EIJ C;  4I6M C;  2N9Y B;  4KUM A;  1VQ8 P;  4Z1V A;  1TUB B;  2CAZ C;  1AJN A;  2ZE6 A;  2IH3 C;  3CRC A;  2BEQ D;  3AG4 B;  3AG3 B;  2PGG A;  4IL6 Z;  4WFH A;  3CC2 V;  1XTC C;  1ZP0 C;  4X20 B;  5B66 H;  2D2C B;  4PJ0 E;  1WA8 A;  4NPD A;  3MHS C;  3LDD A;  2ZIM A;  1CP9 A;  1MUU A;  3D71 A;  2L35 A;  2N05 A;  3ETG A;  1P84 D;  5K1P A;  3CXH H;  4CPG A;  1JNM A;  1D5N A;  3P30 A;  1SLQ A;  3USS A;  1F51 A;  3CCL P;  2UXN A;  1DGS A;  3AE5 C;  1FBM A;  5LMU O;  2E75 B;  2PFX A;  4W7Y A;  3JSL A;  1CXZ B;  1O9H A;  3HE4 A;  3AG1 C;  5CCH D;  2WSF J;  2QTO A;  1R6K A;  1L0L E;  4GIF A;  1YSC A;  3L71 H;  1TAE A;  3HKE B;  3FWL A;  3BFR A;  2E76 C;  4X88 A;  3L75 G;  2LW1 A;  2E74 D;  1XHX A;  5JCO A;  5C8Y B;  5KAI E;  1AR5 A;  3IC9 A;  4NTY A;  4D6T H;  2G8Y A;  2ZIN A;  2KG7 B;  4J7K A;  4OGQ B;  3CPW U;  1KFM A;  4C7N A;  5D5P A;  3K5L A;  4B3R B;  1JY2 O;  2W0F C;  2DMX A;  2HJD A;  3G71 V;  3KDP B;  4GDO A;  2OYH B;  4JAU A;  2XNX A;  1A02 F;  5DN6 G;  2QRX A;  3UQ8 A;  3FX7 A;  4ICG A;  1Y74 B;  2FYN C;  1VMG A;  3SWK A;  4AIL C;  2IW5 A;  1OW7 A;  3CI9 A;  1YCI A;  2K1A A;  4DR2 O;  5LGT A;  1HR0 O;  1MG1 A;  1FAF A;  2HLD G;  1HW7 A;  2JK5 C;  1NU1 J;  5H6Q A;  2PGD A;  5JWP A;  1GDT A;  1MFT A;  4DO2 A;  3WU2 H;  1XOU A;  3HD7 D;  5TIS H;  1VQ6 P;  1FXH A;  3KZI E;  4PI2 A;  1HVV A;  2WLJ A;  2UU9 O;  3P8C E;  4TV8 B;  3APQ A;  3X2Q C;  2KS1 B;  5KJ7 A;  1SQV H;  1BCC G;  1RPO A;  2A45 H;  4RO0 A;  3R65 A;  2F4V O;  1HH0 A;  1GKF A;  3HKC A;  5LOV A;  3ABT A;  1FKA O;  1OWA A;  2G3A A;  3QTC A;  2XHB A;  4IYI A;  3V2N A;  4BRY B;  1JPX A;  3CE2 A;  4UB6 E;  3K9S A;  1ZSP A;  1WT6 A;  1BQZ A;  2DJV A;  1AJY A;  2W90 A;  3ABL C;  4PJ0 Z;  2CE4 A;  3W67 A;  2NPS A;  1RF0 C;  1N7S A;  1L4A D;  3ZMT A;  3K3W A;  1QVF U;  3JD2 A;  2XT9 A;  2LO1 A;  4HZ3 A;  3RYH B;  1BSN A;  1ZAU A;  2QJP C;  1TGO A;  1K7D A;  5CBG A;  1BE3 D;  2UXC O;  1ZRT E;  4DV0 O;  1JCC A;  1PGJ A;  2DWD C;  1FZF A;  3E2E A;  1ROP A;  1Y76 A;  2GHY A;  3ZN0 A;  1BGY G;  3THO A;  3SR2 C;  4QPK A;  1SQP H;  4HNA B;  3A7O A;  1YXB A;  1L0N D;  3AE6 C;  4PI0 A;  2QM8 A;  1YJ9 P;  2Z0A A;  5LMN O;  2H89 C;  2NR5 A;  1N73 B;  1SQQ G;  5IWA B;  1HNX B;  2LW7 A;  4O4L B;  2QE7 H;  1FFX A;  2IJI A;  1PP9 D;  3PRJ A;  4JI0 B;  2QM7 A;  2C9L Y;  4J11 A;  1WN7 A;  1ZV8 A;  3HKD B;  2Z5U A;  2UUA O;  2PUS A;  3SJA C;  1KD1 Q;  4B86 A;  3CJH B;  1EN4 A;  5EC1 C;  5LXT B;  2YEV A;  1XRE A;  3LW5 J;  2YXL A;  4I7Z C;  2A06 E;  4JI3 O;  3EWK A;  2QWN B;  5AW4 B;  4JI1 B;  3H1K G;  3EQ2 A;  4YJ2 B;  4G27 B;  3WB0 A;  1IFJ A;  2FFD B;  1N36 B;  1G2C B;  4UVB A;  5LHG A;  2ZXE B;  2A3Q A;  1GL2 B;  1LT1 A;  2OTK E;  3FB8 C;  3KZI Z;  4LH7 A;  3SFD C;  5KLV K;  1G6U A;  3H1J D;  2AEF A;  3HD7 C;  5JH7 A;  1VQ9 V;  2QJ1 A;  3GHG A;  2V1D A;  4DT0 A;  4PDM A;  2ZD9 A;  4DOJ A;  2W6I G;  2K1E A;  4JV5 O;  4MTO A;  2YKO A;  1TA8 A;  3STZ C;  2OTJ V;  2JEU A;  1K3E A;  3LUT B;  4K8X A;  1URQ B;  2YKP A;  5B5E H;  1KUQ A;  3AE3 C;  3CME P;  1YI2 V;  1YTF D;  4JI7 O;  3G6E P;  1I5X A;  1PPJ G;  4UB6 Z;  4GKK O;  1H2K A;  1N34 O;  1DD3 A;  4JAS A;  2I8D A;  3M0A A;  1PFI A;  1FOS E;  2IBZ D;  1AVY A;  4R7C A;  2ZYG A;  3AEF C;  1B6Q A;  2XAG A;  3C90 A;  4X65 O;  2FB5 A;  4XDK A;  1KYO I;  2JIZ G;  3SYA A;  4B3T B;  2CTQ A;  1L4A C;  5AVS B;  5IY5 C;  1WA8 B;  1MAB G;  1MNG A;  4DV2 B;  5KAF E;  3K04 A;  2BCC E;  2WPD G;  3K08 A;  4K0K O;  2AEM A;  4MN4 C;  3AG7 A;  5M1B A;  5JJE B;  3CCJ P;  1HF9 A;  3DXR A;  4X9Q A;  3M06 A;  2EIK C;  5AVY B;  1N33 B;  4I2L C;  5FL7 G;  3M9H A;  3P3N A;  1OIP A;  2KSE A;  2HVK C;  1JY3 O;  5GTH E;  4LF9 B;  3FWN A;  1S76 D;  3F89 A;  3FYE B;  3ZJZ A;  3H1H E;  3TYY A;  3OUS A;  4N23 A;  3ZRV A;  1NTM E;  3HE4 B;  3UO3 A;  1K92 A;  2V7Q H;  5LA6 B;  3ZRX A;  3CXH I;  1IFM A;  3TET A;  2CK3 H;  2KLU A;  1SQB G;  1KBH A;  2B1I A;  1KC8 Q;  3DGE A;  2AZ2 A;  2OTL P;  2EJ7 A;  1I5Y A;  2EIL C;  1SQX K;  4UVA A;  4C7N B;  1THZ A;  1UFI A;  4DW0 A;  1XMO O;  3EXA A;  4ZOL B;  4PHZ A;  3K58 A;  1Q86 W;  3MUD A;  2BSK B;  3HR0 A;  4U3F H;  2R3S A;  4DR5 B;  4QMA A;  3A0R A;  1MSD A;  4FLU A;  3FB5 C;  1M93 A;  5KLV H;  4ZNC A;  1Y67 A;  2F43 G;  1Q82 Q;  5K5G B;  4JTA B;  2RN0 A;  1R3L C;  1NTZ E;  1COW G;  5H5N A;  4WVZ A;  3Q5R A;  3Q5S A;  4YIO A;  2LQT A;  3L72 E;  4UCS A;  4PD4 F;  5CN0 A;  4P9O A;  4JGS A;  1S72 P;  3CC7 V;  1EDJ A;  3H1I G;  5IYD O;  1FZC C;  2RQ6 A;  1BT8 A;  1W2E A;  2A0L A;  1M8O B;  2D2C D;  1VEW A;  3P3P A;  3K59 A;  2XAF A;  1LTI C;  2JGD A;  4O4I A;  4PEL A;  1LT9 A;  1ZL8 A;  3HKC B;  5LOV B;  1CW5 A;  3M91 A;  2ITD C;  3CWB H;  5L3D A;  3V2Q A;  5KA6 A;  1MKM A;  4X1Y A;  1SZX A;  2K9J A;  3L70 G;  1FXV A;  4IGG A;  1LTS C;  2L91 A;  3HTK B;  3OR7 C;  2FYU E;  3OA7 A;  3K0G A;  3S9O A;  4GKJ O;  2LJ2 A;  2E75 D;  1DTO A;  1AA0 A;  1RM1 C;  4FLZ A;  3RL0 C;  4N78 E;  3RYC A;  1IJD B;  2ZFC A;  3RYF A;  4H13 C;  4X66 O;  3L35 A;  2NPS B;  2QKC A;  3LNM B;  1GN6 A;  4UV8 A;  1N7S B;  4D7S A;  1L0L J;  1NAF A;  1JR9 A;  4DV4 O;  4LFA B;  1ZLZ A;  4HKZ H;  4B3M B;  3E86 A;  3CS5 A;  4GYC B;  2QGN A;  2CTP A;  2O01 N;  4EFE A;  1QBZ A;  4J42 A;  3H1L D;  3KHU A;  3OGI B;  3AE4 C;  4OGQ D;  5GTH Z;  1JY2 P;  2NNU A;  1QR9 A;  1MA1 A;  1KOR A;  4YHH B;  2Q3I A;  1Y76 B;  4FJC C;  2YI9 A;  3EVK A;  3GW6 A;  1XL4 A;  1RY3 A;  3MHV A;  4N3Y B;  3U59 A;  3VYI A;  1DIP A;  1IZ3 A;  1XL6 A;  3BA8 A;  1FDI A;  4WBN A;  1LGH B;  1XEQ A;  2P58 A;  4W80 A;  3TXQ A;  3CMA V;  3AEA C;  1SQX H;  1FFX B;  3M99 B;  3ZMV A;  4GCZ A;  1VIB A;  3D70 A;  4I55 A;  3BA9 A;  4DV3 O;  1S0V A;  3F7V C;  4MW8 A;  3AE9 C;  1J1D C;  1KIL E;  1LWU A;  3C9I A;  4LF4 O;  1KB9 D;  3GF7 A;  3VP8 A;  2JEE A;  2UUC O;  2YEV B;  3A0B E;  1ORQ C;  4DUZ B;  3L73 E;  3SJC C;  4KFM A;  4DZO A;  2Q67 A;  5IYC O;  5APV A;  1AIL A;  1M1K W;  1IBK O;  3I5D A;  4FLY A;  2UXD B;  1MSW D;  5LHI A;  4EEQ A;  1CEZ A;  2R44 A;  3K0D A;  3WG7 B;  5J2T A;  5CBN A;  3FKS G;  1ENV A;  5JH7 B;  2ZKO A;  3GHG B;  5AVW B;  1LP1 A;  4RKU J;  4HB1 A;  3TGU H;  2Q3E A;  1Q2N A;  2YIB A;  3BCC H;  4PD4 I;  4JPR A;  2M3B A;  2Y4U A;  2Z4E A;  5AG2 A;  1JOC A;  3CX5 H;  3HUS A;  3GF3 A;  1X9V A;  3LNN A;  3VQX A;  1NZ6 A;  3OD4 A;  2XOK G;  3MIW A;  5KMG A;  4KHP O;  2EIM B;  1FZE A;  3W68 A;  1SS1 A;  1VQ4 P;  2QM4 A;  1NR7 A;  2E75 C;  3CCE P;  1YVW A;  3QO8 A;  4NVP A;  3G6B A;  3BVO A;  4I0X A;  3JSV C;  2OIG A;  5LMU B;  4YIP A;  2H94 A;  2HR3 A;  5B1O A;  1EZV G;  1HGZ A;  1F7Y A;  3B5N C;  4CZZ A;  4YJ3 A;  4I1L A;  1NU1 G;  2KXP B;  1Y66 A;  3CCM V;  2WMM A;  2VWK A;  2M6Y A;  4XA4 A;  1G4Y B;  3DXR B;  1UPG A;  2M3E A;  2A79 B;  1VQO P;  4ABM A;  4ZKP A;  5B1A B;  1EZV E;  3AK1 A;  3L74 E;  3I56 P;  1JY3 N;  4PV1 B;  3LDE A;  2UXX A;  3ASO B;  3TNU A;  4TWK A;  1OFC X;  1FS0 G;  3L75 H;  1OV9 A;  1IBM O;  3GMA A;  1GL2 D;  1SQQ K;  1LTJ A;  4UVC A;  4RO2 A;  4L74 A;  4DR2 B;  3C3S A;  2Q0A A;  4I9Q A;  3JAL A;  4PA3 A;  2XDJ A;  4GOE A;  1NTK E;  2IYP A;  5EIB D;  1H2S B;  3A0B Z;  2I1K A;  4UCO A;  1HJ0 A;  1NVP B;  5AW9 B;  1BHA A;  4C7R A;  1VQM P;  2QJY C;  3KZI H;  1URQ D;  1GW3 A;  2UU9 B;  3RWR D;  4TT3 G;  4N78 D;  3ABK C;  4BWA A;  2D3O W;  3NR7 A;  1JO5 A;  2OAR A;  1JJ2 U;  3AE8 C;  2F4V B;  3L71 D;  1W2B U;  3C1L A;  2Q1K A;  1WJZ A;  4Y99 B;  4EKW A;  1BCC H;  4J7Z A;  1RE3 A;  2DYS C;  2W6J G;  2H7H A;  3RK3 B;  4K3A A;  4D6T D;  4IT5 A;  2WLI A;  2XND G;  1QCE A;  2GTS A;  3IF4 A;  1U96 A;  3E8G A;  2JGD B;  4O4I B;  5D5Q A;  2ZIO A;  4FM1 A;  1LT9 B;  1BS3 A;  1ZL8 B;  2E43 A;  2BCC J;  2W83 C;  2WPQ A;  1RE4 C;  1V9P A;  3HB3 B;  4TSF G;  2K9J B;  4B08 A;  1P84 E;  1JY3 P;  1M57 C;  3ZS8 C;  1GU5 A;  3E89 A;  5L8R J;  2VQF O;  3WB1 A;  4F6E A;  1JMM A;  3H9V A;  2H43 A;  3BPZ A;  2UXC B;  4LFC O;  4DV0 B;  1BHB A;  3RYC B;  3GLM A;  3H1H J;  3RYF B;  1NTM J;  2CUG A;  1NHL A;  4JAV A;  2LR2 A;  4ZI7 B;  3IAY A;  3F5H A;  1MZ9 A;  3D8C A;  5IDJ A;  2Z5H A;  1LTG C;  1SQV D;  2Q9L A;  2YKQ A;  3CCS V;  3ETD A;  3FD9 A;  1M90 W;  5LMN B;  5L3F A;  1BGY H;  3OUF A;  1AQT A;  4NKG B;  1M1J A;  5A2Q N;  1VQK V;  4LF6 O;  2AXT E;  2OWO A;  3RFR A;  1JCD A;  3A0H E;  2YSU B;  5BZB A;  3EFG A;  2EUL A;  1YDX A;  1N8R Q;  1K8A Q;  5JVD A;  2UUA B;  3SJQ C;  2R9I A;  3E8F A;  1SQQ H;  2IM9 A;  1VF5 B;  1H38 A;  1AI5 A;  2FFD C;  2ZE5 A;  3E8B A;  2Q8V A;  4WBN B;  4XFJ A;  4JI3 B;  1NTZ J;  1GL2 C;  3K06 A;  2GUZ A;  4W4K A;  4JTD B;  2ZVN B;  1S5H C;  1SQB K;  4I55 B;  2V4H A;  3L72 J;  1KQS O;  2K3R A;  1H89 A;  5EIB C;  2ZNJ A;  4UCR A;  5KJ7 D;  1R6T A;  1LWU B;  4RUE A;  2KOG A;  3H1K H;  2YNY A;  4DV6 O;  2QKA A;  4PA9 A;  2DW3 A;  1WMK A;  4JV5 B;  3TXS A;  1YTZ T;  5CJ0 A;  3OFN G;  3JAK A;  3OTF A;  4J9Y B;  1S3J A;  2LGQ A;  4MS2 A;  4JI5 O;  3A3Y B;  3IC7 A;  3APO A;  4H44 B;  2FYU J;  3N27 A;  5KKZ B;  3VQV A;  4JI7 B;  2B9Z A;  5J2T B;  1ZWI C;  3B40 A;  2WSE H;  1LP1 B;  4GKK B;  1N34 B;  1V54 B;  1IFI A;  4U7J A;  1RF1 A;  4HYO A;  2NPS D;  2HFE D;  1X59 A;  1QR8 A;  2JEX A;  1VQN V;  5CA1 A;  1N7S D;  1Q6H A;  2MW2 B;  3HUS B;  1BE3 G;  5E79 E;  3AG2 C;  1FDO A;  1PPJ H;  4X65 B;  2H8P C;  3MZW B;  2B5U A;  3IAO A;  4WWI A;  4YTP C;  5CA3 A;  2QWP B;  1KKD A;  1N0J A;  1U7J A; 
#chains in the Genus database with same CATH homology
 4I7Z B;  2MKV A;  3R4Y A;  2QJK C;  2QJP C;  2BEQ D;  2BEZ F;  1ZRT E;  3Q1M A;  2E76 B;  4H44 D;  1PL5 A;  1OW8 A;  4R4L A;  1YQ4 C;  1KMI Z;  3Q3D A;  2WSC J;  1KQF B;  1PIX A;  1ZP0 C;  3D6Y A;  2D2C B;  1TU3 F;  3ABV C;  1KQG B;  4H44 C;  1Q90 D;  3AE6 C;  4TT3 H;  1R8E A;  2E74 B;  1K04 A;  3IN6 A;  5KLI C;  3D71 A;  1EXI A;  4RKU J;  1KTM A;  2H89 C;  5L8R J;  1OMI A;  1RQV A;  2QIW A;  2FBW C;  3H25 A;  3GLM A;  3RK3 E;  1PV3 A;  4H13 B;  3GF3 A;  3AE5 C;  3Q5R A;  3Q5S A;  2E75 B;  2H88 C;  3AEG C;  3AE2 C;  1JB0 J;  1RQU A;  2FXP A;  4IL6 X;  2WSF J;  4R4M A;  3LW5 J;  3Q5P A;  4I7Z C;  1NYH A;  3GF7 A;  2ZT9 B;  3EWK A;  2E75 C;  3FGA D;  1YQ3 C;  3AE7 C;  1EXJ A;  3AED C;  2D2C D;  3C8V A;  2E76 C;  2P10 A;  2O01 J;  2JP3 A;  3RL0 g;  2E74 D;  2G8Y A;  4YXD C;  4OGQ B;  1DD4 A;  3SFD C;  2YMK A;  2D2C C;  1MKM A;  1VF5 B;  4Y28 J;  2IDB A;  1ZOY C;  2J5U A;  2NZ2 A;  4GDO A;  1U57 A;  4H13 D;  3SFE C;  2E74 C;  3AEB C;  3S9O A;  2FYN C;  4XFJ A;  1OW7 A;  2E75 D;  2E76 D;  1IK7 A;  4H0L B;  4H13 C;  2WQY C;  4KT0 J;  3AE3 C;  4PV1 B;  2ZT9 D;  1OW6 A;  1GMJ A;  1DD3 A;  2WSE J;  4H0L C;  1VL2 A;  3AE4 C;  3AEF C;  3GMA A;  3O6Q A;  2ZT9 C;  1WMK A;  1Y9B A;  4OGQ D;  1K05 A;  2JO1 A;  1KOR A;  3D6Z A;  1VF5 D;  3AE1 C;  3Q2Y A;  4H44 B;  4OGQ C;  2G3A A;  1NGM B;  1HJ0 A;  1DIP A;  1VF5 C;  2OQQ A;  2QJY C;  1FDI A;  2V7Q J;  4H0L D;  1ZME C;  4U7J A;  5M1B A;  4PV1 D;  1S1C X;  1HF9 A;  1UIX A;  3AEA C;  5KKZ C;  2YIU C;  1AJY A;  3AEE C;  3D70 A;  1FDO A;  3T97 B;  2QSI A;  2WPV B;  2K9Y A;  4Z1M H;  3AE8 C;  3IAO A;  4YTP C;  3B71 A;  4PV1 C;  3AE9 C;  3AEC C;  1KIL E;  1S5L X;  3G9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...