2E74B

Crystal structure of the cytochrome b6f complex from m.laminosus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 40
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2e74B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e74B01
2YIUC 2QJPC 2QJYC 2WPVB 5L8RJ 2D2CB 1ZRTE 2QIWA 2WSEJ 4Y28J 4OGQB 2E75B 3C8VA 4H13B 2FYNC 2K9YA 4H0LB 4H44B 4I7ZB 1VF5B 5KKZC 2E74B 4PV1B 2QSIA 2QJKC 1JB0J 3LW5J 5KLIC 1Q90D 1S5LX 2O01J 4KT0J 2ZT9B 4IL6X 2E76B 2WSFJ 2WSCJ 4RKUJ
chains in the Genus database with same CATH superfamily
3AK3A 2QJ1A 2ZNIA 4FLUA 1VQNV 4RJTA 1XDCA 1VIBA 4GLXA 2A45H 1ROPA 1RM1B 4C46A 3UKMA 1HJ0A 1B6QA 2D2CC 2KZIA 4ZOLA 2A45I 1KMIZ 1VARA 2W90A 1NGMB 3MGNA 2WWWA 1R3KC 3CCUV 2ZINA 4JTAB 4PV1B 2Q0AA 2CUGA 2LKMA 3KCXA 5EYPA 4EEQA 3WB1A 4RQFA 4WY4A 2LW7A 1PKXA 3G71V 3ABLC 3VN0A 4I9QA 1RH5B 2PGDA 4CBCA 2OQQA 1FXHA 1FU1A 1FDIA 4YTPC 3VOPA 2X0LA 1PPJD 2FXOA 4I55B 3V2NA 5BR8O 4UCVA 2E43A 3LDCA 2WLIB 2GM4A 3IAYA 3HRNA 3M99B 2J59M 5GTHZ 2YEVA 2FXMA 3HKCA 1U97A 2ARHA 1GW3A 2NPSA 2F4VO 2YO2A 5B66E 1XTCC 1PGJA 3B8NA 2E75C 1VEWA 4DV7B 2IBZG 1AROP 2RQ6A 2FYUJ 3OM3B 1N7SD 4UXNA 2Q3IA 1YQ3C 1KC8Q 3A0BZ 1N4CA 2IH3C 3CCQV 2QJYC 1FZAA 2Q3EA 2C0WA 1VQ9P 2YO3A 1PL5A 1FZFA 4KHPO 1SQPK 4O4LB 1NJIW 5H5NA 2JEEA 1VF6C 1J1EC 2WSEJ 4EDFA 1CEZA 4R6ZA 1VQ7V 5JCOC 1EZVG 1Y74A 2EZPA 1L8DA 2DW4A 4HB1A 5APWA 1DX7A 5C93A 2OYHC 1VQNP 1EZVI 3D71A 1HGVA 3W7SA 1QLNA 2P10A 1N0JA 4FJCC 1OCOC 5FNVB 4DV0O 2AEMA 3A0BE 4NYKA 5IYZA 1NU1E 1L0NJ 2ILMA 4MTOA 1I5XA 1JOCA 3J7AU 4NB5A 1XNRB 2PYJA 3B8MA 4JI7O 3L73D 2V4DA 4GX2A 1PD3A 3TF5A 1N73A 4HBNA 2WPRA 4QJFB 3HE5A 2FYNC 2FYUH 2Q4PA 2WSCH 3ABTA 1NO4A 3SR2C 3W7TA 1P84H 4H44D 5CJ4A 1NAFA 3H01A 1CI6B 2POHA 3KKYA 3HUSC 1H89A 1SQXH 2W0FC 1JB0J 1N7LA 2KUBA 4D6TD 1FDMA 4DR2O 5JVDA 4OGQD 4WFBV 3E1RA 4DR1B 4TWKA 1KKCA 2ZKOA 3H1HE 1AJPA 1SRYA 4DR5O 3A0HZ 1BCCD 2R5BA 1JO5A 2ZE8A 1WPBA 4UFZA 2YSUB 4YY3O 3Q5RA 4JYAO 3F5TA 3P8CD 4Z2WA 4YXWH 1LJ2A 3VMXA 1HNWB 2QWQB 4DYLA 2PGGA 2B1GA 5KUKA 1NTZH 4P9PA 1FDOA 4DUYO 3CCQP 5EBWC 1LT9C 2M5AA 2Q6QA 3OGIB 2AGAA 1U57A 2JDIH 2AXTE 2P2UA 1US6A 1VQ7P 3G4SP 1T2KD 5JQGA 1K9MQ 2J58A 3WG7C 3SPCA 1KQLA 3OUFA 3SYAA 3ABKB 5KHIA 3CD6V 3FD9A 4FLVA 4QE9A 2W6JG 3R66A 1V54B 1S5JA 3D70A 4RO0A 1XOUA 2IJKA 4I0XB 3RYCA 1R8EA 2AHYA 1KD1Q 1YEWA 3L36A 1B06A 3M9BA 2E42A 3HKDA 1S5LE 1GN2A 1NTMG 4ICGA 3ABKC 4B3RB 4ASWA 3MIWA 3K08A 1TUEB 1HNZB 3CCLP 3E8BA 4N21A 5AW6B 2X6AA 2NLJC 5L8RJ 3JAWB 2W0XA 1L0LJ 3ASOB 4LGDE 3ZMSA 4Z1MG 3FB5C 1Y4MA 4Y28J 3BVOA 3RN4A 5LOVA 4J42A 4JPRA 2WVRA 2ZFCA 1KFNA 4EFEA 3J81N 3A0RA 1BQ0A 1P84D 3S1KA 2BE3A 3TXSA 3BCCD 3OT7A 4JPZB 4MVMA 5BMVB 5CBOA 2RCVA 1VQOV 2L6LA 1K7DA 3K04A 1PGOA 2WSCJ 3T97B 1H38A 1VQ4V 1KILA 3KZIH 1EDKA 4NXNB 5GW7A 1PGQA 3VQVA 3EQ2A 1XMQO 1UFIA 5CCHC 1N7SA 1QX8A 2ZNJA 4E4EA 5KHJA 1FJKA 1AI6A 4JI3O 2Q0OC 1RF1C 3G4SV 2N9BA 1OMIA 1U7JA 4BIOA 1Q82W 5AW9B 1QCEA 4IHJA 3RYIA 3P8MC 4I5SA 3OEEG 3LDDA 3KXDA 2JWAA 2E5YA 3NXSA 5AVYB 2A3QA 1EC5A 1G8MA 1M1JA 3UO3A 1IVSA 2QJPC 2BTQA 1JMBA 4M3LA 1VQPP 3UT5A 5IY5C 4NPDA 4AI8A 2RH0A 2PY5A 1SQVK 3L74G 1DIPA 2CE4A 2P6JA 2A9HA 3T1HB 5KJ7C 4ZBMA 1MZEA 1K3EA 2EIMC 4DV6B 2HJFC 4I9WA 1ZWIC 5K5GB 1NYHA 4DV5O 3BAAA 2G8YA 1YI2V 1I94O 1OWAA 3I5DA 3Q4HA 1K5SA 1S5LZ 1T8ZA 3QO5A 3JAWA 1G6UA 4RUFA 1S0VA 2BASA 5B1OA 4B3SB 1AI4A 1FD9A 2PUSA 1XNQB 3RW0A 1K92A 1YTZT 2SPZA 5AW5B 3CXHD 3AG4C 4JI4O 1CZQA 1VF7A 2DW3A 2ZM6B 3L75D 3WUUA 5K1PA 5KHGA 3CX5D 1KBHA 4GCZA 1VQ4P 4PI2A 1OV9A 1DF4A 3BVHA 3AG3B 2XTAA 4LNUA 1URQC 2LGWA 5APSA 3KPEA 1YDXA 3ZHRA 3FKSG 5DECA 4JI8B 2IJJA 4ZMDA 4IGGA 3NMDA 2VQFO 4NXNO 3W68A 3V4WA 3L74H 1H2LA 5DEDA 4GX0A 1FXVA 4J9ZB 1USDA 4KXRA 5KA6A 1AQTA 3RL0g 1YXBA 3JARB 2HKOA 2K1AA 3CXHI 2W6AA 3TSIA 1IJDB 4F4LA 1S1CX 2XNDH 3CWBE 2Q9LA 4EKWA 2HVJC 3HKEA 3DSQA 3FYEB 3H1ID 1H2SB 1FZGA 4PD4F 3OW2U 3TNUB 1RF1A 4PA6A 5B5EZ 2N1TD 5EC1C 1ZN5A 4I1LA 3AG7A 1D5NA 1OX3A 2DQ3A 2XT9A 2KSDA 1KUQA 3AK1A 4TLFA 1HDJA 1XHZA 1N36B 4K35A 1DEBA 2K9PA 1Y47A 1KYOF 1RQVA 2K3RA 5BXZA 5KUMA 2IX7C 2H3OA 2MJZA 2W8ZA 5L3FA 2JEXA 4JI1B 2KYVA 1GM8A 2CK3H 4O4HB 3GHGA 5H6QA 1HTLC 5CMUA 3CMAV 2HYNA 1L4AA 1BE3J 4O4IB 1SQXJ 4MTFA 4X9QA 2CGNA 1LGHB 4CPGA 1AR1B 3M9HA 1NTZJ 3DGEA 4D7SA 5FL7G 1MOFA 5DJUB 4B3MO 1RE4C 2YKOA 2L35A 1OFCX 1MMMA 3LNMB 5FPRA 1MFTA 3CCJV 1EBOA 1HNXB 2JGUA 3IR9A 4ZI7A 4RO2A 2O01N 3RGBA 3CS5A 3WB0A 1EQ7A 1GN4A 4RUEA 3JAKA 1ZW0A 1NWQA 1DD3A 3MZWB 1M8OB 4QPJA 4CH4A 2EBOA 1H8AA 4FM2A 1FJPA 4O4JB 3W7UA 2QKAA 3IF4A 2FFDB 2AW9A 1S3JA 1IC2A 2W6JH 3NFQA 3L72J 1AVOA 3SSUA 2NPSC 2XNXA 3FAVA 3DXRB 1ZMEC 1GM7A 2M6YA 1J2JB 2B9BA 5CCGC 3ZHTA 2P7JA 2QSIA 3SFEC 4PA9A 4W7ZA 1G4YB 4K8XA 4JI0O 3SYCA 2PYLA 3JASA 3P8CE 5KAFE 3JSLA 1Z5VA 2JDIG 4JV5O 1P84E 1SS1A 4KP4A 3DXRA 4GT1A 3AE2C 3QH9A 4DR3B 3ZN1A 2W83C 4PD4D 2EINB 1FOSE 5CCGD 5H2FZ 1OW8A 1V54C 3TGUE 1GL2A 3OAKA 1N8RW 4U3JA 2D3OW 4YXWG 2ZXXA 2OCCB 1MV8A 5LXTA 3VP8A 2QKCA 2Q1KA 2OTKE 1X9VA 4GZRB 2KKWA 1FXKA 4X1KB 4IFFA 4DV2O 1J1DC 1L0LH 1KB9D 3ZJZA 2BCCG 2IPPA 1V9PA 2N1TB 2H43A 4DR6B 2QEXV 1HR0B 1K73Q 1Y76A 2DN9A 4ZOLB 4DR3O 2CH7A 5IWAO 3V2PA 2H8PD 1LTBC 2YXLA 3HE5B 1GO3F 2DMXA 1FC2C 2CTRA 1RSOB 4FZ0A 3JSNA 2ZYDA 4TT3H 2R3CA 4UCUA 1DEEG 3HKEB 1AI7A 3L73J 4R7CA 4LC1A 4CZZA 1H0TB 2QWOB 1R73A 3CP1A 4B3MB 4PJ0Z 4B7KA 4OX9B 4HKZH 3ABVC 1NH2B 4R4MA 1HWTC 3PN1A 1YJWV 3K5NA 4JI5O 1PIXA 4X66B 2IU3A 3BRCA 1VQKV 3CCEP 1G1JA 2QR4A 3CC7V 1R3LC 1W59A 4O4LA 4UVAA 4XDJA 1JY2P 1S4XA 3E22A 2IZ1A 1WAZA 3ABLB 2Z5UA 3I5CA 1J5EO 5KLVG 4J10A 3MTUE 2WPQA 4XE5B 4BWNA 1K97A 1KORA 2HODB 3D36A 3SWFA 5EC2C 5CA1A 4NPEA 4D6TG 5IYBO 1M57C 2JO1A 1D5AA 1SQBK 5C39A 4NTWA 1M1JC 3G9RA 4Q6GA 3ZX6A 2ZVNB 1HBWA 1YHQV 5KLIB 4BR6A 1MKMA 1GRJA 1IBLO 3JAMN 2FYUD 4LF5O 4LR3A 3D3QA 4DR7B 1SQVD 3CL3D 5KAIZ 3L37A 2IYOA 1HNWO 2OYIB 4TUYB 3GW6A 1YI2P 4P30A 1JOYA 1JY2N 4WFAV 3IC7A 2F93B 1V55B 2QA4V 4RESB 1VMGA 2YIAA 3M0DA 5CCHD 2ZIMA 3L72G 1N8RQ 3CSXA 1KILC 2KB1A 3VQXA 3H1KG 3IC9A 1URFA 1VP7A 1AI5A 1T3UA 2RKLA 3AEGC 1NU1D 4EIJA 5KAFH 1W2BO 4PDVA 4CH6A 3KG2A 4PELA 5E79H 3B4SA 3H1JG 3R65A 2HHHO 1K73W 2HFEC 1YCIA 1Q7YW 4JI4B 4IIJB 2KSJA 1PM9A 2C2AA 3H1KD 1R6KA 1URQA 1F51A 4N3YB 3SFDC 3CC7P 1M56B 5CA1B 4LF9B 1S9KE 4WF9V 3AECC 1NVPD 2B88A 4MN4C 3O8ZA 4EI2A 3AK2A 4YJ2A 1SQVG 1KQFB 4I4TB 3O9OA 4JI1O 2AEJA 5KX5A 4GODA 5E1AC 3TNUA 4ZNCA 1VQ6P 1E1RG 4JI2O 3A0HE 3T1HO 2JK5C 1PPJH 1QU7A 1WPXA 2DOSA 2I8DA 4H0LD 1JPXA 5LGUA 1ENVA 2JS3A 5J2TB 4YHHO 4JI7B 1JJ2U 1QLED 1FZCB 1GDTA 2XUMA 3ABMC 2IBZI 4FFBA 3S3WA 4OWFA 3B5NC 1S72P 2Q67A 4P2ZA 1H0TA 1Q5OA 1WP8A 3K03A 2UUCO 1LTTC 1KTMA 1MNGA 3RK2B 2WMMA 4DV7O 3HE4A 1NS1A 5TISZ 1IO4A 2Y9YA 2ZCEA 4MSWC 2P4KA 5APYA 5LMUO 3P3NA 3N27A 2ZYGA 2QGNA 1QVGO 2JEUA 2MK3A 1FKAO 1BGYD 2CH7B 2ZR2A 4JI3B 2GDSA 4D6TH 4EB6A 2C0XA 1Y76B 4LNUB 2OTLP 3S4RA 1GMJA 1KYOE 5TISH 5A2QN 4PD4I 3VMAA 1Q43A 1RM1C 3AG1B 4U7OA 3AEAC 3OTOO 3L71J 3K58A 1JMMA 4P9OA 3CRRA 1IXMA 4MS2A 1M57D 4JZ2A 1N7SC 1BDCA 1MFZA 4KUMA 3NTNA 3GLMA 2JKVA 1L2PA 5L3DA 4JAUA 3O65A 2ZM6O 5IT9N 1LTIC 3ASNC 1ZOYC 3L72E 4A7PA 3Q1MA 3UIAA 1LNQA 2VRSA 4X1YB 2OYQA 3T1CA 3QO8A 1RE3C 2LXBA 3ZIAG 2YEVB 2RJZA 1EFRG 4LFCO 4L87A 2EIKC 3R4YA 5AW0B 2FB5A 4ASUG 1SQGA 2A45G 3B77A 1P4RA 4NR1A 3E8GA 2HEPA 1TUBA 2QTSA 4H44B 3W7XA 5LMNO 1PPJE 4K3AA 5KAFZ 4QGPA 4MT8A 3SYPA 5EZYA 3I55V 2P90A 3CI9A 5BVZA 1CI6A 2H94A 4WBAA 1SQPE 1FZEA 4YIOA 4DT0A 4LF8O 4OVNF 1O9GA 1Z2GA 2OTLV 1XILA 1NTKK 3CXCU 2WPDG 2KQXA 5APQA 1IZNB 4UCOA 2R32A 1EN5A 4O4IA 3PHLA 2CDYA 1L0NG 4QMAA 1SQPJ 3N7NA 3RYHB 2CTQA 3M0DC 2ODMA 4XBFA 3A3YB 3B5NA 3BFRA 1IURA 1TVKB 1NR7A 4DV3B 3AG4B 3GHGB 3L4FA 3L70E 3RK3B 1EDIA 1HH0A 3CD6P 1WB7A 3TYYA 4X1KA 1BSHA 4IL6H 2E74C 2R9AA 2UUAO 1LT1A 3ZEDA 4WY4C 4DV1O 5D5PA 2OARA 4D6TJ 4TOIA 2Q68A 2AHZA 2P67A 1J95A 3K5OA 1VPCA 2A7WA 3FX0A 1Q8IA 2QE7H 2VWJA 4LFCB 3A2AA 4FM1A 2GHYA 4AILC 3Q2YA 4HZ3A 1WT6A 2KK7A 5FNVA 4DO2A 1T5EA 2QM4A 4W4KA 1VF5B 4X1IA 4DOJA 5L3GA 1M4UA 2ZD9A 1H2KA 1NAYA 4LWSB 3BCCG 1GL2D 4OX9O 1G1XB 1VQ8V 2UU9O 4O2AB 3ZRWA 1IX9A 4I0XA 5B1NA 5LGTA 1GM9A 4DR1O 1YJ9P 3CXHH 3L73H 3H1LE 1PZQA 3D6ZA 1ZRTD 1N2DC 1Q6IA 4GX1A 1PV0A 4FIPC 5LL6Y 3H1KJ 2OIEA 1SQQK 1ZV8A 1NTMJ 5A9GA 2VRZA 1B3QA 2GA1A 4BIZA 4DCKA 1LTJA 1GK9A 3ZRVA 3K5MA 4FVMA 2NPSB 3TJTA 5FLXN 1KB9E 2N9YB 2YIBA 4YHHB 2GSMB 2BSKB 1GTOA 1L0LD 2FL4A 4UB8E 3RBZA 1PL4A 1A02J 2LFSA 3TGUD 2L91A 4JI2B 3H1JD 3AG2B 3JCZA 1OZHA 2AZ2A 2OYOA 3LSQA 1ZUQA 2NRGA 1GU5A 1B04A 1KB9F 3FXEA 1KECA 1SFCA 5JVDB 4JI5B 3L70D 4C7NA 1L0LG 4UB8Z 1W2BU 4WFFA 4RQEA 3M91A 3VYIA 1BE3G 1KILE 1PP9J 2BCCD 3C9IA 3C3TA 1CXZB 1TVKA 1USEA 3D36C 1KV4A 3L73E 1JMKC 4G2KA 1RP3B 1DTOA 1Q7YQ 5ITZB 1PP9D 4N78D 2XU6A 4X8AA 1FJGO 4UCRA 1Q86W 2R44A 2UXCO 3RK3D 3TGUH 3K0DA 5APXA 2YI8A 4TV8A 4LH7A 2BTQB 1IXBA 1M1JB 2QIWA 4EYYQ 4OGQB 4JTCB 1OHHG 3I56V 2Q7EA 1YJ9V 1OW7A 2GUVA 4J80A 4DR6O 2YMYA 1IFPA 2HFED 1EZVH 2FMLA 1BGYJ 1IK7A 2XDJA 1K4CC 1TUBB 1N36O 3WG7B 4B86A 1N32O 3G80A 2WT7A 3AE3C 3TK1A 1N73C 2BEZF 1VF5C 4UVCA 2IFMA 4U3FD 4JZGA 3RK3E 4JTDB 3A2FA 1H2MA 1NQTA 3VP9A 3ETDA 3PRJA 3QO7A 3AG3C 4JF3A 1S72V 2IM9A 3OGCC 5APUA 3O6QA 1FZCC 4XDLA 3FB8C 3F7YC 2IZ0A 2EJ7A 1GW4A 2Z5IA 4JI0B 4X1YA 1A02F 4OPAA 3JATB 3MHHC 5HFMA 1NTZE 3HD7B 1SZXA 4LCUC 5CCGA 3KCYA 2G38A 2EIMB 2YXQB 1WP7A 3ZMZA 2B9ZA 3CX5H 3W67A 2I1JA 1THZA 2Y48A 2IDBA 1VF6A 1XMQB 3R2PA 5LMUB 4I55A 1BGYH 1RE3A 2O3JA 1P49A 1HWYA 3LW5H 1CSBA 2X6BA 2O01H 3OA7A 4GIFA 4IL6E 5KMGB 4TT3G 3SYOA 3AG1C 2WPSA 3Q3DA 1KYOD 3H1JE 4BXLA 1NTME 3FGAD 4ZKUA 4WB4A 2M3BA 2E74D 1QL2A 4X65O 3U1CA 2XOKG 2ZYAA 2KS1B 3B40A 2DQ0A 4IFMA 2ZT9D 5IY5B 1LUWA 4X62O 2YXRB 4LLHA 1GKFA 1N33B 3ZRXA 2OYIA 5KLVD 2VS0A 1N34B 5E79E 1PNLA 3EHBB 2XZRA 1XUQA 1OCOB 5JCOA 3AE6C 3B71A 1YSCA 5JJJB 1FFXA 1G1IA 2H88C 1SQPD 1R3IC 3OJAB 4W80A 5BU5A 3HE4B 3GMAA 5JQGB 1PPJG 3G67A 1M9NA 4GKJB 2YNYA 3H6PA 1KN7A 1BHBA 1TGOA 4DRXA 3J80N 1V55C 5J9PC 3H1LD 3JATA 4DUZO 4LF9O 1E5WA 4K0KO 2EIJB 2O01J 2FBWC 4LF6O 3TGUJ 1SFCC 3L72H 2OYIC 1XHXA 2KXPB 1S5HC 4X20A 1EXJA 1ZLLA 1HUCA 4GKKO 2QVAA 2GUZB 3VBBA 1PGPA 3T4ZA 1KD1W 3LIEA 4JI6O 2HJDA 4QE7A 1QLEB 1PL0A 3WU2Z 1FPOA 3GF7A 2EZOA 1JEKA 5IWAB 1H2NA 3P30A 1SQBE 2ITCC 3BEHA 3C3SA 3JALA 4DV5B 4TSFG 3H25A 1K9MW 2K1EA 4TV9A 2ADPA 3VQWA 4FPPA 4J7ZA 4FLYA 3FWLA 1SFCB 4C7NB 4RWUA 5GTHE 1ZTEA 1NVPB 3L9DA 3CE2A 3HUSB 1SQBJ 3RVYA 4U7JA 4PV1D 1RE4A 4MW8A 1FFXB 2FYNB 2KOGA 1SS3A 1ZAUA 1BGYE 2BOBC 2HLDG 3CPWU 3IN6A 1W2EA 1K8AQ 3CC2V 5ITZA 4NXMO 1JQ0A 2F43G 1EM1A 1YIJV 3F89A 1NTZG 3IFXA 3L71E 2KS1A 5K1XA 1ZL8A 4NTXA 2GUSA 4PA4A 4F6EA 1VQPV 2YMKA 2IH1C 3AE9C 1N0NA 3H1LH 3L71D 2UXXA 3FB7C 4I50A 4WFHA 1KQSU 4BRYA 4LP8A 4TUYA 3CEIA 3JCUZ 2UU9B 1OIPA 5LP6B 5LA6A 3V2RA 1F4NA 3G6EV 2AZ0A 3HD7D 2YI9A 2M3EA 2UUBB 4MVZA 3H1IG 5AVTB 4XDKA 2HG5C 3SJQC 1JUNA 2M0BA 2BSKA 3UQ8A 3WU2E 4R4LA 2Q7CA 4OPHA 3FX7A 3S3XA 2UUAB 5KJ7A 1FJGB 3EXAA 3HD7C 5B5EH 4OH8B 2KLUA 3FAVB 2UXBB 3CRMA 2EIJC 4H37A 3X2QC 2IBZH 4CS4A 4DR4B 3JD0A 1SQQG 4F6RA 1Q82Q 3WU2H 4HJGH 4PDMA 1OCZC 1WA8A 3JD3A 2W27A 1S77D 1SERA 2P22C 1GMGA 1LUVA 5LHIA 5B1AC 1SQFA 1K05A 4WY4B 2QM7A 3U0ZA 1AB3A 3F5HA 2YKQA 3JCUH 4MVSA 4NPFX 2LGQA 3U10A 3TXQA 2KLVA 1K8AW 1QVGU 4UB6E 3BA9A 5GTHH 1SQVE 3FFQA 3NR7A 3U11A 4TQDA 2K88A 4YY3B 1BGYG 2R9RB 2EJRA 5L3BA 4TV8B 1RSOA 5L3CA 3KHUA 3BPZA 4G28B 1R3JC 5CB4A 1H8EG 3B5ND 1L0LK 1L1FA 5GTIE 5BY1A 4BW5A 1K33A 2YIUB 3V4QA 2HHHB 2Y4TA 5IJ9B 2E3CA 1NU1K 4O4HA 5EZYB 2IJIA 4GOFA 2WLMA 3SPGA 2PAJA 2BCCE 2ADQB 1QVFU 5J2UB 1F7YA 1O9HA 2LP7A 1NTZD 3G6EP 2K9JB 1QL1A 3PTZA 4U3JB 3I56P 4GDOA 1WA8B 5TJHA 5KX5B 3E2EA 1KYOI 1NU1G 1Q3EA 1WB8A 1NTMK 1SQXE 2WLLB 2J5UA 2XV5A 4H13C 2EX3A 2A79B 3F5WC 1DGSA 1PP9H 2ZXWC 4YIPA 3BCCE 5IYDO 1JVMA 4J9YB 1QNMA 1JY3N 4I7ZB 3H1LJ 3KQGA 2PRRA 1KB9I 3CCSP 4Z1VA 3ZRSA 3JASB 2E5LO 4Q20A 3LW5J 2V7QG 1BSMA 4I6MC 3HKCB 4JASA 5H6RA 1NT2B 2P06A 3MDSA 4ZKIA 3BCCJ 4IOIH 3E89A 2Z0AA 3II6A 4MW3A 1YJNV 1ZXGA 1JFFB 4FLXA 2MW2B 1H2GA 1FYJA 4NKGB 4JI6B 2NPSD 4DR4O 1SZTA 3JD1A 3H1JH 4LF4O 3L71G 3BRVB 2FKWB 1TA8A 4BRYB 4H0LB 2QJKB 3RL0C 4LF7B 3CWBH 3M9QA 1KP2A 3CHXA 4UCTA 5EBMC 3AE8C 3CX5I 5AVWB 1BE3H 4O2AA 1NZ6A 3C90A 1M7LA 1LWUA 4LWSA 4W4LA 1SKVA 2XNDG 1W0JG 3N2KB 1TU3F 1JY3P 3IJ4A 2LXCB 3TCUA 5GONB 2BTOA 4GKJO 4JAAA 4BWAA 1GK6A 4C7RA 3L73G 2EIKB 3SDLA 1M56D 2R9IA 2KNCB 5CBNA 2FKXA 1S76D 2ZVOB 3TDKA 1NVOA 1XTGB 3VQYA 3BCCH 2OYHA 2E76D 1ORQC 2FYUE 4DW0A 2ZDIC 4IYIA 4W7YA 4ZHQB 2WTYA 1FZCA 2CPBA 4TV9B 3HKBB 2Z4EA 1L0LE 1NTMH 3P3PA 3B5NB 1M90Q 1H8HG 2AXTH 4U3FJ 2IJHA 4WFGA 4X88A 1UIXA 5EBLC 2OTJV 2EILC 3E22B 4YJ2B 1L0NE 2P7TC 4CC6A 4NTYA 2WT7B 3IFMA 4XFJA 5KLVH 1D7MA 1SQBH 1Y67A 2Z5HA 3B2EE 2IYPA 3H32A 1IFMA 2ZE5A 3CRAA 3HB3B 1KC8W 4WY4D 1QQCA 1RQUA 3ABUA 4HNAB 1IBLB 5EK0A 1KZUB 4DV4B 1NH4A 1D2DA 2DYSC 4MTXA 3CJHB 1SP4A 4BAYA 1IBKO 1R6NA 1EZJA 3FXDA 3AE7C 3L70J 1VQLV 3WFVA 2Q6AA 3H1HJ 2UXDB 1G2CB 1URQD 3A5TA 1PNMA 3G71P 1AJNA 5L3EA 2VQEB 1VQKP 3CCEV 3RK2D 3CCRV 1FE6A 1BL8A 1T6AA 3HKBA 1YTZI 3X2QB 1NTKD 2HPCB 1KP3A 3PH0A 1GN6A 1JCHA 1XI1A 3OD4A 1OVUA 1SQBD 4YPCA 2A06D 2FTKA 2V4HA 4JYCA 4IIJA 4DW1A 5B66Z 3L74D 3H1JJ 4FM0A 3WUTA 5LXTB 1I08A 2ITDC 4JV5B 4DK1A 2UXDO 1JCCA 4X64O 3JYCA 2RMKB 3T1YO 2I1KA 3H1IE 2XAHA 3I55P 2WLHA 3WUVA 1AJQA 4KJMA 1CW5A 5H2FE 1NTZK 4FLTA 4IL6Z 5AVZB 4LF6B 4NVPA 5AW2B 4MVUA 4X65B 3RBXA 2Y4UA 1UJWB 3AE4C 1GU4A 4J11A 3CRCA 3RYCB 2HODA 3AEBC 1MG1A 1NOHA 4ZKPA 2H7HA 2PP6A 4UCSA 5DN6G 3AEEC 1FOSF 1G2CA 1I7FA 3K59A 4MTGA 2QA4P 3E86A 4H44C 2XASA 1WJZA 1M5IA 1NKNA 1HJBA 5B3SC 2DYRB 1YYCA 3USSA 1YVWA 3STZC 3JSVC 2QWRB 1Y9BA 4XA4A 2XHBA 3GHGC 3RK3C 4IHJB 4RAIA 1BDDA 5J2TA 1Q90D 1QVFO 3DTUB 5CBFA 3CXHE 2ZT9B 2AEFA 1P84I 1JTHB 1LT9B 2P4VA 4GX5A 3L75G 1IFJA 3A0BH 1IFIA 1DLBA 2ZJSE 1FS0G 1BCCH 1KU9A 1WN7A 3CMEP 1IZ3A 3Q5SA 3KYQA 3L75E 5IJ0B 3ML0A 2H89C 3SPIA 3PP5A 3T97A 1N86A 2JR8A 2Q69A 1AVYA 5AW7B 3K79A 3ZHVA 2YXHA 4TQFA 3SYQA 1OCRB 2Y0DA 4Z1MH 2WSFH 3ZDMA 2A06G 2DYSB 1QBZA 1L0NH 2QJKC 4H0LC 3RL0B 5CCHA 4CH5A 4Y99B 4I2LC 3L75H 2ITAA 1HF9A 5CA3A 2YIDA 1LTSC 2OYHB 3K9SA 1VQMP 4X66O 3E8FA 2UUBO 2LO1A 1PFIA 3K0GA 5KHHA 3CC4P 3OW2O 1J1DB 5F2VO 2E76C 2P1JA 1FBMA 4J7KA 1BZKA 3CB2A 2JJ1G 2W6IG 3DC5A 3MUDC 2WAMA 2C9LY 1CP9A 1AA0A 2LR2A 5LBQA 3SJAC 3HKDB 3RK2C 4DUZB 3CWBD 3FWNA 2M8RA 1KYOH 2V7QH 4KT0J 5TISE 1LTJB 4JI8O 4D7TA 1Y74B 1LWUC 2Y0CA 2WSFJ 2P58A 1E1QG 5JJEB 2LJ2A 2LQTA 2OGUA 1JFFA 2F95B 1LR1A 3ETEA 4PD4H 3GWOA 1EDLA 4PA7A 1K34A 4EFBA 3HTKB 4DV2B 1NU1H 3T4DA 1GD2E 1K4DC 2F66C 3JAKB 5B1BC 2XAJA 3CCLV 1YTFD 4UVBA 5C8YB 4ZI7B 1Q81W 2WA4A 3ZCCA 3CMEV 2M5AB 1BQZA 1ZLZA 3MD0A 1IBMO 2ZR3A 2YICA 3H1IJ 1MZ9A 4X1IB 3OR6C 1JCDA 1L0NK 1SQXD 1ZR4A 2RN9A 4IYHA 2BEQD 1TAEA 4OXSA 3K3WA 4JYYA 4DK0A 1X79B 2WLIA 4PV1C 1M93A 1Q6HA 3Q5PA 4UV8A 5LP6A 3BHPA 3E35A 2DWEC 3Q4HB 5EIBC 2Q73A 4UV9A 1PP9G 2FYUG 1VQOP 5BU8B 5APVA 1GAXA 2K9JA 1SQQJ 2M7WA 4LBEC 4H33A 3ZHUA 5AVVB 3CC4V 5EYPB 1BT8A 4PA3A 4A5UB 5LHHA 3C1LA 2JVDA 2KI7B 1OVVA 1Q6UA 1UPGA 2QG4A 1E79G 4EB6B 1XL4A 1T3JA 1L4AD 4UB6Z 4R8CA 1N73B 1W5CE 1WNSA 1IBMB 3CWBJ 3OMNB 3UT5B 5LHGA 2B1IA 5B3SB 5IJ0A 1XL6A 3L75J 3C8VA 4HAMA 1MZFA 2ZIOA 3HUSA 1EXIA 5KLVE 3WB2A 2ZE7A 4UB8H 5JH7B 1JY2O 4B3SO 5KA5A 1XMOB 2WZ7A 3MP7B 2N1TA 4LFAO 2CAZC 2NN4A 1YZBA 1KILD 1XQ8A 1JA8A 2HR3A 3E8HA 3WMM0 1SQVH 3ZS8C 2E5TA 2KZJA 1NBMG 1LTAC 4HYTB 3D6YA 1VQ5V 1SQPG 1R6TA 3RYFA 5B5EE 1HR0O 4JAVA 5BR8B 5HFLA 4PD4E 2XKMA 5CHXA 1S5LH 3H1IH 4F6RB 1HNXO 2O1KA 2QRXA 1MSWD 1JY3O 3KDPB 1QR8A 4IFDK 2UUCB 4YJ3B 1JX9A 1MABG 2V7QJ 3N2GA 3MAQA 1KQGB 5FPOA 3N4XA 2PF4E 5AW8B 3LNNA 3FYIB 4J7JA 1SA0A 2Z3YA 2Q7HA 3BASA 5C8YA 1XREA 1URQB 5LOVB 2GBOA 5EFWB 1I94B 1S9KD 4U7NA 3APOA 5GTIZ 1AP5A 1SESA 1RF0C 3CCRP 3E7KA 1F23A 1Q81Q 2ZDIA 1VQ8P 5AVUB 3OTFA 3CRQA 3L71H 1SLQA 4LF7O 3H9VA 1M57B 5H2FH 3M8AA 2HLOA 4GOEA 3N2KA 5DM6V 1DK1A 2Q5UA 3SGIA 1BHAA 2GV9A 4CC5A 2HPCA 1DH3A 3FB6C 4PDRA 1IBKB 2UWJE 1R1BA 2RDCA 5CBHA 1SFCD 2N1TC 1GL2C 2KIKA 2A0LA 5AW3B 3S9OA 2JP3A 4ASVA 4DZOA 2YXYA 2JJLA 1ZSPA 3CLQA 1P7BA 1FS0E 5D5QA 2Y0IA 1J1EB 2E75D 2IFNA 4R50A 2Q7GA 5LP6C 2R72A 2B87B 1L4AB 2GTAA 1PP9E 5B1AB 4L74A 1XNQO 2QJPB 2WSSG 1VL2A 3M7MX 2QKSA 5BZBA 2R3SA 5AG2A 2DWDC 5CA0A 1XNRO 4PDLA 4DR5B 5CJ0A 4DV3O 1CPYA 3EWKA 3CPWO 3CC2P 1AILA 2QTOA 3VTPC 1T2KC 4J41A 1HVVA 3U1AA 1L4AC 2B5UA 1OZ0A 1RF1B 2PFXA 3LDEA 2C9NY 2XAQA 3OEHG 1K04A 3CMAP 1DF5A 4JYBA 2F1MA 3CJHA 2GTSA 2GUZA 3QTCA 5IYCO 4U3FG 2Y9ZA 2XAFA 2FFDC 4AQRD 3V5BA 3THOA 4HNAA 4LF4B 5B66H 3DC6A 2WLJA 3RYIB 2KB7P 1Z5WA 4AQYB 3UCSC 2O1JA 3RVZA 1WMKA 1BE3E 3JARA 1JM0A 2OCCC 1R5SA 5JH7A 4AHCA 4DJGA 2XAGA 4D6TE 5AVSB 1HGZA 1SQPH 3STLC 2Y0EA 3B8EB 1SETA 4B3TO 3SWKA 2EINC 4DUYB 5CN0A 1NH2D 5AVQB 1NTKJ 1YITP 4PJ0E 4FZ1A 1ZRTE 3D8CA 2IBZD 2E75B 5GONA 1R5LA 1IK9A 3QWOC 1KFMA 1VQMV 3LUTB 1Q86Q 2OCHA 2HG5D 2QM8A 3ITKA 2Y0PA 4ZHQA 3QF7A 2JWDA 1QR9A 4FK5C 1OCZB 1XMOO 2JS5A 3UM7A 3QNEA 2Q5ZA 4KL1A 2YKPA 2WQYC 4DV4O 3APQA 4JF7A 1MSDA 3A0HH 1E79H 3QVNA 1GL2B 3EVKA 1EDJA 3MUDA 2JGDA 2ZXEB 3OFNG 2QSAA 3BY6A 5APTA 2F23A 4NXMB 3SPHA 2CTWA 3U59A 1AV1A 1HW7A 1Z56A 5KKZC 2AXTZ 2BCCH 2YDEA 2PTMA 2PI5A 2VQFB 4YXDC 3L72D 2RNBA 3VMYA 2OIGA 3L70H 1FZBA 3H1LG 1WRGA 1SF9A 2CTPA 3ZHQA 3H1HH 2N05A 3G3ZA 3O6QB 3RWRD 4YJ3A 2VWKA 4DV0B 2YS8A 1U7MA 5KAIE 1AJYA 5IDJA 3M06A 4GKGA 1OW6A 5KLVK 4LFBO 4DR7O 5B1BB 2WLLA 3GF3A 4LF5B 1EZVE 4DV1B 2UXCB 1KKDA 2RMZA 1JR9A 4I50B 2P5OA 2PI4A 2WSSH 3B09A 3ZRWB 1SQBG 1BE3D 3CX5F 4AQYO 1GZLA 1Y6XA 5IJ9A 2WITA 1AQ5A 1YITV 1SC5B 1L0ND 1SQXK 1HNZO 1VDFA 3EFGA 2B89A 3CXHF 3L70G 2X7RB 4B3RO 5LMNB 3ABMB 3AG2C 3ZMUA 1YBKA 3SWYA 1AVMA 1JJOA 1UIIA 3CCSV 1NKZB 2H8PC 5CBGA 1J5EB 3OR7C 3ZN0A 4B3TB 3V2QA 1YJWP 4LF8B 3M0AA 1RPOA 3CX5E 2WLKA 3LSSA 3JC22 1SQVJ 5LGNA 1W0KG 4FLWA 4KHPB 1YTFB 2ZQMA 1YJNP 1S5LX 2ATKC 2A06E 1RPRA 1N34O 1RFYA 1FXKB 2UXNA 1NTKH 4DXWA 3RYHA 2EULA 2AXCA 2BCCJ 3E83A 3CCUP 1OXZA 5JJNB 1GTWA 3K57A 1YQ4C 2KNCA 2E5LB 3PLNA 3L35A 1K5QA 1OVRA 3ZHSA 5LYJA 2YC0A 3D3IA 3UO2A 4L8JA 1IDSA 2YUAA 5IYZB 1IFNA 5AVXB 1BMFG 1NTKE 4QNHB 3OE7G 2CK3G 3L74E 1OCCB 3AEIA 4QIWF 3TETA 1VQ5P 4KHXA 3EFFK 2WLNA 4QPKA 1LWUB 4G27B 1NTKG 3H1KE 3MHSC 1LP1A 1GH6A 1LTGC 1AFOA 4X89A 1N33O 4ABMA 4DR2B 3AE1C 1YIJP 3HTKA 3ETGA 5KJ7D 2FYUK 2FFDA 3K9AA 5LA6B 1QEXA 4O4JA 1Y66A 1Y8AA 3AEDC 2IW5A 2QE7G 4N78E 5H9CA 4CS2A 1QGKB 3RGUA 3BATA 4C7UA 3ZBHA 5E79Z 4AYCA 4O2BB 2L5GB 1I0HA 2A06H 3T2MA 3OTOB 1VQ9V 1MUUA 3RL0D 4FLZA 1NHLA 2KG7B 2IU0A 1JNMA 5KLIC 4MVQA 1NTMD 2OTJP 3P7KA 4UUJC 5IE9A 2RN0A 4L73A 2N74A 4Y99C 5CMZA 1MA1A 4FMTA 3ZMTA 1IFDA 1SQQE 4IL6X 4JQ0D 2UXBO 5KTBA 3CCJP 1SVFA 1OCRC 1BCCG 3KZIE 2QWPB 4FFKA 1EN4A 2D2CB 2WA3A 3SJCC 1X0TA 3KZIZ 1RF0A 1FXKC 3GWKC 1QHTA 1BCCE 3TGUG 1PV3A 5KAIH 1QLEC 2NR5A 3A8TA 2FY8A 1U96A 1AP6A 4O9BA 2DE0X 3BA8A 1VF5D 3GVMA 4JYAB 5KKZB 1NI8A 4E2LA 1XBLA 2BOCC 1A32A 1VQ6V 1GK4A 1VQLP 1OJHA 1NR1A 2G3AA 2JIZG 2KSEA 3IAOA 1GN3A 1NU1J 2FXPA 2WSEH 4GKKB 3OMIB 2E76B 2Q9IA 4RKUJ 5CB4B 2F4VB 4K0KB 2QDOA 1ZX3A 2ZXWB 4WCEV 2OWOA 4X64B 3LSUA 1M90W 3SJBC 2NZ2A 4B08A 1SQXG 3AEFC 1JTHA 1LT9A 1NKDA 4U3FE 2ZE6A 3W7WA 3IGAC 3OAAG 4FFBB 4EOTA 2E74B 3ASNB 5DJTB 2LW1A 1DD4A 1KB9H 2DYRC 1KQSO 3K5BA 3H32B 3VMZA 3H1HG 2Q8VA 2V1DA 4MVOA 1SQQH 4X62B 5JWPA 1N7SB 3SPJA 3BRTB 4PJ0H 3QG5A 2YIUC 5AW4B 1OCCC 1FAFA 4BIUA 3BABA 2PZSA 3VOUA 4B7EA 1X59A 2N04A 4WFEA 2KP8A 2ZT9C 2HVKC 2D2CD 2QEXP 5EIBD 2W6BA 3CCVV 5AW1B 4H13D 5BMVA 2Y69C 3K5LA 2JRIA 1X8YA 3K06A 2QWNB 4N23A 3L74J 3AE5C 1ZR2A 4DRXB 5KHKA 1X4TA 5KMGA 2B87A 2NNUA 3CYOA 4CS3A 1H88A 1X22A 4WWIA 2JGDB 1BSNA 3JCUE 4ZIBA 3CCMP 1WLEA 1FFTB 1SQQD 3GG2A 1XEQA 4BW9A 2K9YA 3H1HD 4GYCB 3GB7C 1M1KQ 3A7OA 3HD7A 3P32A 2KG7A 1ZL8B 2IBZE 4LFAB 3MHVA 4O2BA 2X6CA 1N32B 3HPLC 1BS3A 2R5DA 5GTIH 5M1BA 3F7VC 1HP8A 3OUSA 1RY3A 4LH6A 1RHZB 1PNKA 3T1YB 4AUWA 2R70A 3PJSK 1YF2A 3ICXA 2CGOA 1YHQP 4U3FH 1M56C 3HR0A 4JBZA 3ETQA 3OMAB 4K8ZA 1BCCJ 2QJYB 2O57A 1LP1B 1Q2NA 4L75A 1P84F 4PI0A 2YIBD 2LFRA 1SA0B 3JD2A 4JGSA 1NJIQ 1S2EA 4CH3A 4WBNA 3ASOC 3CCVP 4PHZA 1EZVD 1ZP0C 3E1IA 3JALB 3N2GB 4HH2A 5KLVJ 1AR4A 4N6JA 4WVZA 2K37A 4MVRA 5LYJB 2VQEO 4I7ZC 5AVRB 3V6IA 3JD4A 3ZMVA 2WPVB 4I4TA 3LIDA 4L76A 1KILB 3RT3C 2ZAEB 3RYFB 1LTJC 2HP8A 4H13B 2CPSA 1F4MA 1P7GA 4X20B 2FYZA 4WBNB 1COWG 2ETNA 5J2UA 2MKVA 2OT5A 1EN6A 3H1KH 5CA0B 2Y69B 4DV6O 3CWBG 4OGQC 1FAVA 2DJVA 4LFBB 3G6BA 3RFRA 3CCMV 2JJ2G 2EILB 1AR5A 4KFMA 4IT5A 1I5YA 1M1KW 4UB6H 4GUNA 4HYOA
chains in the Genus database with same CATH topology
4PV1D 2YIUC 2QJPC 1YQ4C 2E76C 1VF5C 3AE7C 3RK3E 4H13C 2J5UA 2ZT9C 2D2CD 1ZRTE 3Q5RA 3IN6A 2E75B 3Q2YA 1DIPA 4H13D 1HJ0A 2D2CC 2V7QJ 3O6QA 1KMIZ 1NGMB 4I7ZB 1KQGB 1VF5B 1KORA 1GMJA 1FDOA 4PV1B 3LW5J 3AEAC 3AE5C 2YMKA 3AE9C 4KT0J 1NYHA 2JO1A 2G8YA 1U57A 3G9RA 2WQYC 1DD3A 1MKMA 2WSFJ 2OQQA 2IDBA 3AE1C 1FDIA 4YTPC 3D6ZA 3AEDC 3GLMA 2K9YA 4H0LB 3Q3DA 3D70A 1ZOYC 1ZMEC 3AE8C 5KKZC 3Q1MA 1R8EA 2QSIA 2E74D 3SFEC 3AE4C 5KLIC 4YXDC 4R4LA 2E75C 3AEBC 2ZT9D 1TU3F 3AE2C 4IL6X 2BEQD 5M1BA 1AJYA 3S9OA 2JP3A 1OW6A 1YQ3C 3AEEC 3AEGC 3R4YA 4PV1C 1OW8A 3AE6C 2QJYC 3B71A 3GF3A 5L8RJ 3Q5PA 2H88C 4H44C 1PL5A 2D2CB 3GMAA 2WSEJ 2E75D 4Y28J 1PV3A 4H44B 2E76D 1Y9BA 3RL0g 1K05A 1VF5D 1VL2A 3SFDC 1KILE 1Q90D 2O01J 2G3AA 2FBWC 1S1CX 3IAOA 3D71A 2ZT9B 3EWKA 2FXPA 1ZP0C 3AECC 1EXJA 2P10A 4U7JA 2E76B 2WSCJ 4I7ZC 3T97B 4RKUJ 1UIXA 3Q5SA 2WPVB 1KQFB 2H89C 4TT3H 1K04A 3GF7A 2QIWA 4OGQB 3C8VA 2NZ2A 4H13B 2FYNC 1EXIA 4XFJA 4H0LD 3AEFC 4H44D 4Z1MH 3FGAD 3H25A 1OW7A 1RQVA 2MKVA 2E74B 1OMIA 2QJKC 4H0LC 1JB0J 1DD4A 3ABVC 1IK7A 1RQUA 4OGQC 1S5LX 1HF9A 4R4MA 1WMKA 1PIXA 4OGQD 2E74C 3D6YA 1KTMA 3AE3C 2BEZF 4GDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YIU C;  2QJP C;  2QJY C;  2WPV B;  5L8R J;  2D2C B;  1ZRT E;  2QIW A;  2WSE J;  4Y28 J;  4OGQ B;  2E75 B;  3C8V A;  4H13 B;  2FYN C;  2K9Y A;  4H0L B;  4H44 B;  4I7Z B;  1VF5 B;  5KKZ C;  2E74 B;  4PV1 B;  2QSI A;  2QJK C;  1JB0 J;  3LW5 J;  5KLI C;  1Q90 D;  1S5L X;  2O01 J;  4KT0 J;  2ZT9 B;  4IL6 X;  2E76 B;  2WSF J;  2WSC J;  4RKU J; 
#chains in the Genus database with same CATH topology
 3AK3 A;  2QJ1 A;  2ZNI A;  4FLU A;  1VQN V;  4RJT A;  1XDC A;  1VIB A;  4GLX A;  2A45 H;  1ROP A;  1RM1 B;  4C46 A;  3UKM A;  1HJ0 A;  1B6Q A;  2D2C C;  2KZI A;  4ZOL A;  2A45 I;  1KMI Z;  1VAR A;  2W90 A;  1NGM B;  3MGN A;  2WWW A;  1R3K C;  3CCU V;  2ZIN A;  4JTA B;  4PV1 B;  2Q0A A;  2CUG A;  2LKM A;  3KCX A;  5EYP A;  4EEQ A;  3WB1 A;  4RQF A;  4WY4 A;  2LW7 A;  1PKX A;  3G71 V;  3ABL C;  3VN0 A;  4I9Q A;  1RH5 B;  2PGD A;  4CBC A;  2OQQ A;  1FXH A;  1FU1 A;  1FDI A;  4YTP C;  3VOP A;  2X0L A;  1PPJ D;  2FXO A;  4I55 B;  3V2N A;  5BR8 O;  4UCV A;  2E43 A;  3LDC A;  2WLI B;  2GM4 A;  3IAY A;  3HRN A;  3M99 B;  2J59 M;  5GTH Z;  2YEV A;  2FXM A;  3HKC A;  1U97 A;  2ARH A;  1GW3 A;  2NPS A;  2F4V O;  2YO2 A;  5B66 E;  1XTC C;  1PGJ A;  3B8N A;  2E75 C;  1VEW A;  4DV7 B;  2IBZ G;  1ARO P;  2RQ6 A;  2FYU J;  3OM3 B;  1N7S D;  4UXN A;  2Q3I A;  1YQ3 C;  1KC8 Q;  3A0B Z;  1N4C A;  2IH3 C;  3CCQ V;  2QJY C;  1FZA A;  2Q3E A;  2C0W A;  1VQ9 P;  2YO3 A;  1PL5 A;  1FZF A;  4KHP O;  1SQP K;  4O4L B;  1NJI W;  5H5N A;  2JEE A;  1VF6 C;  1J1E C;  2WSE J;  4EDF A;  1CEZ A;  4R6Z A;  1VQ7 V;  5JCO C;  1EZV G;  1Y74 A;  2EZP A;  1L8D A;  2DW4 A;  4HB1 A;  5APW A;  1DX7 A;  5C93 A;  2OYH C;  1VQN P;  1EZV I;  3D71 A;  1HGV A;  3W7S A;  1QLN A;  2P10 A;  1N0J A;  4FJC C;  1OCO C;  5FNV B;  4DV0 O;  2AEM A;  3A0B E;  4NYK A;  5IYZ A;  1NU1 E;  1L0N J;  2ILM A;  4MTO A;  1I5X A;  1JOC A;  3J7A U;  4NB5 A;  1XNR B;  2PYJ A;  3B8M A;  4JI7 O;  3L73 D;  2V4D A;  4GX2 A;  1PD3 A;  3TF5 A;  1N73 A;  4HBN A;  2WPR A;  4QJF B;  3HE5 A;  2FYN C;  2FYU H;  2Q4P A;  2WSC H;  3ABT A;  1NO4 A;  3SR2 C;  3W7T A;  1P84 H;  4H44 D;  5CJ4 A;  1NAF A;  3H01 A;  1CI6 B;  2POH A;  3KKY A;  3HUS C;  1H89 A;  1SQX H;  2W0F C;  1JB0 J;  1N7L A;  2KUB A;  4D6T D;  1FDM A;  4DR2 O;  5JVD A;  4OGQ D;  4WFB V;  3E1R A;  4DR1 B;  4TWK A;  1KKC A;  2ZKO A;  3H1H E;  1AJP A;  1SRY A;  4DR5 O;  3A0H Z;  1BCC D;  2R5B A;  1JO5 A;  2ZE8 A;  1WPB A;  4UFZ A;  2YSU B;  4YY3 O;  3Q5R A;  4JYA O;  3F5T A;  3P8C D;  4Z2W A;  4YXW H;  1LJ2 A;  3VMX A;  1HNW B;  2QWQ B;  4DYL A;  2PGG A;  2B1G A;  5KUK A;  1NTZ H;  4P9P A;  1FDO A;  4DUY O;  3CCQ P;  5EBW C;  1LT9 C;  2M5A A;  2Q6Q A;  3OGI B;  2AGA A;  1U57 A;  2JDI H;  2AXT E;  2P2U A;  1US6 A;  1VQ7 P;  3G4S P;  1T2K D;  5JQG A;  1K9M Q;  2J58 A;  3WG7 C;  3SPC A;  1KQL A;  3OUF A;  3SYA A;  3ABK B;  5KHI A;  3CD6 V;  3FD9 A;  4FLV A;  4QE9 A;  2W6J G;  3R66 A;  1V54 B;  1S5J A;  3D70 A;  4RO0 A;  1XOU A;  2IJK A;  4I0X B;  3RYC A;  1R8E A;  2AHY A;  1KD1 Q;  1YEW A;  3L36 A;  1B06 A;  3M9B A;  2E42 A;  3HKD A;  1S5L E;  1GN2 A;  1NTM G;  4ICG A;  3ABK C;  4B3R B;  4ASW A;  3MIW A;  3K08 A;  1TUE B;  1HNZ B;  3CCL P;  3E8B A;  4N21 A;  5AW6 B;  2X6A A;  2NLJ C;  5L8R J;  3JAW B;  2W0X A;  1L0L J;  3ASO B;  4LGD E;  3ZMS A;  4Z1M G;  3FB5 C;  1Y4M A;  4Y28 J;  3BVO A;  3RN4 A;  5LOV A;  4J42 A;  4JPR A;  2WVR A;  2ZFC A;  1KFN A;  4EFE A;  3J81 N;  3A0R A;  1BQ0 A;  1P84 D;  3S1K A;  2BE3 A;  3TXS A;  3BCC D;  3OT7 A;  4JPZ B;  4MVM A;  5BMV B;  5CBO A;  2RCV A;  1VQO V;  2L6L A;  1K7D A;  3K04 A;  1PGO A;  2WSC J;  3T97 B;  1H38 A;  1VQ4 V;  1KIL A;  3KZI H;  1EDK A;  4NXN B;  5GW7 A;  1PGQ A;  3VQV A;  3EQ2 A;  1XMQ O;  1UFI A;  5CCH C;  1N7S A;  1QX8 A;  2ZNJ A;  4E4E A;  5KHJ A;  1FJK A;  1AI6 A;  4JI3 O;  2Q0O C;  1RF1 C;  3G4S V;  2N9B A;  1OMI A;  1U7J A;  4BIO A;  1Q82 W;  5AW9 B;  1QCE A;  4IHJ A;  3RYI A;  3P8M C;  4I5S A;  3OEE G;  3LDD A;  3KXD A;  2JWA A;  2E5Y A;  3NXS A;  5AVY B;  2A3Q A;  1EC5 A;  1G8M A;  1M1J A;  3UO3 A;  1IVS A;  2QJP C;  2BTQ A;  1JMB A;  4M3L A;  1VQP P;  3UT5 A;  5IY5 C;  4NPD A;  4AI8 A;  2RH0 A;  2PY5 A;  1SQV K;  3L74 G;  1DIP A;  2CE4 A;  2P6J A;  2A9H A;  3T1H B;  5KJ7 C;  4ZBM A;  1MZE A;  1K3E A;  2EIM C;  4DV6 B;  2HJF C;  4I9W A;  1ZWI C;  5K5G B;  1NYH A;  4DV5 O;  3BAA A;  2G8Y A;  1YI2 V;  1I94 O;  1OWA A;  3I5D A;  3Q4H A;  1K5S A;  1S5L Z;  1T8Z A;  3QO5 A;  3JAW A;  1G6U A;  4RUF A;  1S0V A;  2BAS A;  5B1O A;  4B3S B;  1AI4 A;  1FD9 A;  2PUS A;  1XNQ B;  3RW0 A;  1K92 A;  1YTZ T;  2SPZ A;  5AW5 B;  3CXH D;  3AG4 C;  4JI4 O;  1CZQ A;  1VF7 A;  2DW3 A;  2ZM6 B;  3L75 D;  3WUU A;  5K1P A;  5KHG A;  3CX5 D;  1KBH A;  4GCZ A;  1VQ4 P;  4PI2 A;  1OV9 A;  1DF4 A;  3BVH A;  3AG3 B;  2XTA A;  4LNU A;  1URQ C;  2LGW A;  5APS A;  3KPE A;  1YDX A;  3ZHR A;  3FKS G;  5DEC A;  4JI8 B;  2IJJ A;  4ZMD A;  4IGG A;  3NMD A;  2VQF O;  4NXN O;  3W68 A;  3V4W A;  3L74 H;  1H2L A;  5DED A;  4GX0 A;  1FXV A;  4J9Z B;  1USD A;  4KXR A;  5KA6 A;  1AQT A;  3RL0 g;  1YXB A;  3JAR B;  2HKO A;  2K1A A;  3CXH I;  2W6A A;  3TSI A;  1IJD B;  4F4L A;  1S1C X;  2XND H;  3CWB E;  2Q9L A;  4EKW A;  2HVJ C;  3HKE A;  3DSQ A;  3FYE B;  3H1I D;  1H2S B;  1FZG A;  4PD4 F;  3OW2 U;  3TNU B;  1RF1 A;  4PA6 A;  5B5E Z;  2N1T D;  5EC1 C;  1ZN5 A;  4I1L A;  3AG7 A;  1D5N A;  1OX3 A;  2DQ3 A;  2XT9 A;  2KSD A;  1KUQ A;  3AK1 A;  4TLF A;  1HDJ A;  1XHZ A;  1N36 B;  4K35 A;  1DEB A;  2K9P A;  1Y47 A;  1KYO F;  1RQV A;  2K3R A;  5BXZ A;  5KUM A;  2IX7 C;  2H3O A;  2MJZ A;  2W8Z A;  5L3F A;  2JEX A;  4JI1 B;  2KYV A;  1GM8 A;  2CK3 H;  4O4H B;  3GHG A;  5H6Q A;  1HTL C;  5CMU A;  3CMA V;  2HYN A;  1L4A A;  1BE3 J;  4O4I B;  1SQX J;  4MTF A;  4X9Q A;  2CGN A;  1LGH B;  4CPG A;  1AR1 B;  3M9H A;  1NTZ J;  3DGE A;  4D7S A;  5FL7 G;  1MOF A;  5DJU B;  4B3M O;  1RE4 C;  2YKO A;  2L35 A;  1OFC X;  1MMM A;  3LNM B;  5FPR A;  1MFT A;  3CCJ V;  1EBO A;  1HNX B;  2JGU A;  3IR9 A;  4ZI7 A;  4RO2 A;  2O01 N;  3RGB A;  3CS5 A;  3WB0 A;  1EQ7 A;  1GN4 A;  4RUE A;  3JAK A;  1ZW0 A;  1NWQ A;  1DD3 A;  3MZW B;  1M8O B;  4QPJ A;  4CH4 A;  2EBO A;  1H8A A;  4FM2 A;  1FJP A;  4O4J B;  3W7U A;  2QKA A;  3IF4 A;  2FFD B;  2AW9 A;  1S3J A;  1IC2 A;  2W6J H;  3NFQ A;  3L72 J;  1AVO A;  3SSU A;  2NPS C;  2XNX A;  3FAV A;  3DXR B;  1ZME C;  1GM7 A;  2M6Y A;  1J2J B;  2B9B A;  5CCG C;  3ZHT A;  2P7J A;  2QSI A;  3SFE C;  4PA9 A;  4W7Z A;  1G4Y B;  4K8X A;  4JI0 O;  3SYC A;  2PYL A;  3JAS A;  3P8C E;  5KAF E;  3JSL A;  1Z5V A;  2JDI G;  4JV5 O;  1P84 E;  1SS1 A;  4KP4 A;  3DXR A;  4GT1 A;  3AE2 C;  3QH9 A;  4DR3 B;  3ZN1 A;  2W83 C;  4PD4 D;  2EIN B;  1FOS E;  5CCG D;  5H2F Z;  1OW8 A;  1V54 C;  3TGU E;  1GL2 A;  3OAK A;  1N8R W;  4U3J A;  2D3O W;  4YXW G;  2ZXX A;  2OCC B;  1MV8 A;  5LXT A;  3VP8 A;  2QKC A;  2Q1K A;  2OTK E;  1X9V A;  4GZR B;  2KKW A;  1FXK A;  4X1K B;  4IFF A;  4DV2 O;  1J1D C;  1L0L H;  1KB9 D;  3ZJZ A;  2BCC G;  2IPP A;  1V9P A;  2N1T B;  2H43 A;  4DR6 B;  2QEX V;  1HR0 B;  1K73 Q;  1Y76 A;  2DN9 A;  4ZOL B;  4DR3 O;  2CH7 A;  5IWA O;  3V2P A;  2H8P D;  1LTB C;  2YXL A;  3HE5 B;  1GO3 F;  2DMX A;  1FC2 C;  2CTR A;  1RSO B;  4FZ0 A;  3JSN A;  2ZYD A;  4TT3 H;  2R3C A;  4UCU A;  1DEE G;  3HKE B;  1AI7 A;  3L73 J;  4R7C A;  4LC1 A;  4CZZ A;  1H0T B;  2QWO B;  1R73 A;  3CP1 A;  4B3M B;  4PJ0 Z;  4B7K A;  4OX9 B;  4HKZ H;  3ABV C;  1NH2 B;  4R4M A;  1HWT C;  3PN1 A;  1YJW V;  3K5N A;  4JI5 O;  1PIX A;  4X66 B;  2IU3 A;  3BRC A;  1VQK V;  3CCE P;  1G1J A;  2QR4 A;  3CC7 V;  1R3L C;  1W59 A;  4O4L A;  4UVA A;  4XDJ A;  1JY2 P;  1S4X A;  3E22 A;  2IZ1 A;  1WAZ A;  3ABL B;  2Z5U A;  3I5C A;  1J5E O;  5KLV G;  4J10 A;  3MTU E;  2WPQ A;  4XE5 B;  4BWN A;  1K97 A;  1KOR A;  2HOD B;  3D36 A;  3SWF A;  5EC2 C;  5CA1 A;  4NPE A;  4D6T G;  5IYB O;  1M57 C;  2JO1 A;  1D5A A;  1SQB K;  5C39 A;  4NTW A;  1M1J C;  3G9R A;  4Q6G A;  3ZX6 A;  2ZVN B;  1HBW A;  1YHQ V;  5KLI B;  4BR6 A;  1MKM A;  1GRJ A;  1IBL O;  3JAM N;  2FYU D;  4LF5 O;  4LR3 A;  3D3Q A;  4DR7 B;  1SQV D;  3CL3 D;  5KAI Z;  3L37 A;  2IYO A;  1HNW O;  2OYI B;  4TUY B;  3GW6 A;  1YI2 P;  4P30 A;  1JOY A;  1JY2 N;  4WFA V;  3IC7 A;  2F93 B;  1V55 B;  2QA4 V;  4RES B;  1VMG A;  2YIA A;  3M0D A;  5CCH D;  2ZIM A;  3L72 G;  1N8R Q;  3CSX A;  1KIL C;  2KB1 A;  3VQX A;  3H1K G;  3IC9 A;  1URF A;  1VP7 A;  1AI5 A;  1T3U A;  2RKL A;  3AEG C;  1NU1 D;  4EIJ A;  5KAF H;  1W2B O;  4PDV A;  4CH6 A;  3KG2 A;  4PEL A;  5E79 H;  3B4S A;  3H1J G;  3R65 A;  2HHH O;  1K73 W;  2HFE C;  1YCI A;  1Q7Y W;  4JI4 B;  4IIJ B;  2KSJ A;  1PM9 A;  2C2A A;  3H1K D;  1R6K A;  1URQ A;  1F51 A;  4N3Y B;  3SFD C;  3CC7 P;  1M56 B;  5CA1 B;  4LF9 B;  1S9K E;  4WF9 V;  3AEC C;  1NVP D;  2B88 A;  4MN4 C;  3O8Z A;  4EI2 A;  3AK2 A;  4YJ2 A;  1SQV G;  1KQF B;  4I4T B;  3O9O A;  4JI1 O;  2AEJ A;  5KX5 A;  4GOD A;  5E1A C;  3TNU A;  4ZNC A;  1VQ6 P;  1E1R G;  4JI2 O;  3A0H E;  3T1H O;  2JK5 C;  1PPJ H;  1QU7 A;  1WPX A;  2DOS A;  2I8D A;  4H0L D;  1JPX A;  5LGU A;  1ENV A;  2JS3 A;  5J2T B;  4YHH O;  4JI7 B;  1JJ2 U;  1QLE D;  1FZC B;  1GDT A;  2XUM A;  3ABM C;  2IBZ I;  4FFB A;  3S3W A;  4OWF A;  3B5N C;  1S72 P;  2Q67 A;  4P2Z A;  1H0T A;  1Q5O A;  1WP8 A;  3K03 A;  2UUC O;  1LTT C;  1KTM A;  1MNG A;  3RK2 B;  2WMM A;  4DV7 O;  3HE4 A;  1NS1 A;  5TIS Z;  1IO4 A;  2Y9Y A;  2ZCE A;  4MSW C;  2P4K A;  5APY A;  5LMU O;  3P3N A;  3N27 A;  2ZYG A;  2QGN A;  1QVG O;  2JEU A;  2MK3 A;  1FKA O;  1BGY D;  2CH7 B;  2ZR2 A;  4JI3 B;  2GDS A;  4D6T H;  4EB6 A;  2C0X A;  1Y76 B;  4LNU B;  2OTL P;  3S4R A;  1GMJ A;  1KYO E;  5TIS H;  5A2Q N;  4PD4 I;  3VMA A;  1Q43 A;  1RM1 C;  3AG1 B;  4U7O A;  3AEA C;  3OTO O;  3L71 J;  3K58 A;  1JMM A;  4P9O A;  3CRR A;  1IXM A;  4MS2 A;  1M57 D;  4JZ2 A;  1N7S C;  1BDC A;  1MFZ A;  4KUM A;  3NTN A;  3GLM A;  2JKV A;  1L2P A;  5L3D A;  4JAU A;  3O65 A;  2ZM6 O;  5IT9 N;  1LTI C;  3ASN C;  1ZOY C;  3L72 E;  4A7P A;  3Q1M A;  3UIA A;  1LNQ A;  2VRS A;  4X1Y B;  2OYQ A;  3T1C A;  3QO8 A;  1RE3 C;  2LXB A;  3ZIA G;  2YEV B;  2RJZ A;  1EFR G;  4LFC O;  4L87 A;  2EIK C;  3R4Y A;  5AW0 B;  2FB5 A;  4ASU G;  1SQG A;  2A45 G;  3B77 A;  1P4R A;  4NR1 A;  3E8G A;  2HEP A;  1TUB A;  2QTS A;  4H44 B;  3W7X A;  5LMN O;  1PPJ E;  4K3A A;  5KAF Z;  4QGP A;  4MT8 A;  3SYP A;  5EZY A;  3I55 V;  2P90 A;  3CI9 A;  5BVZ A;  1CI6 A;  2H94 A;  4WBA A;  1SQP E;  1FZE A;  4YIO A;  4DT0 A;  4LF8 O;  4OVN F;  1O9G A;  1Z2G A;  2OTL V;  1XIL A;  1NTK K;  3CXC U;  2WPD G;  2KQX A;  5APQ A;  1IZN B;  4UCO A;  2R32 A;  1EN5 A;  4O4I A;  3PHL A;  2CDY A;  1L0N G;  4QMA A;  1SQP J;  3N7N A;  3RYH B;  2CTQ A;  3M0D C;  2ODM A;  4XBF A;  3A3Y B;  3B5N A;  3BFR A;  1IUR A;  1TVK B;  1NR7 A;  4DV3 B;  3AG4 B;  3GHG B;  3L4F A;  3L70 E;  3RK3 B;  1EDI A;  1HH0 A;  3CD6 P;  1WB7 A;  3TYY A;  4X1K A;  1BSH A;  4IL6 H;  2E74 C;  2R9A A;  2UUA O;  1LT1 A;  3ZED A;  4WY4 C;  4DV1 O;  5D5P A;  2OAR A;  4D6T J;  4TOI A;  2Q68 A;  2AHZ A;  2P67 A;  1J95 A;  3K5O A;  1VPC A;  2A7W A;  3FX0 A;  1Q8I A;  2QE7 H;  2VWJ A;  4LFC B;  3A2A A;  4FM1 A;  2GHY A;  4AIL C;  3Q2Y A;  4HZ3 A;  1WT6 A;  2KK7 A;  5FNV A;  4DO2 A;  1T5E A;  2QM4 A;  4W4K A;  1VF5 B;  4X1I A;  4DOJ A;  5L3G A;  1M4U A;  2ZD9 A;  1H2K A;  1NAY A;  4LWS B;  3BCC G;  1GL2 D;  4OX9 O;  1G1X B;  1VQ8 V;  2UU9 O;  4O2A B;  3ZRW A;  1IX9 A;  4I0X A;  5B1N A;  5LGT A;  1GM9 A;  4DR1 O;  1YJ9 P;  3CXH H;  3L73 H;  3H1L E;  1PZQ A;  3D6Z A;  1ZRT D;  1N2D C;  1Q6I A;  4GX1 A;  1PV0 A;  4FIP C;  5LL6 Y;  3H1K J;  2OIE A;  1SQQ K;  1ZV8 A;  1NTM J;  5A9G A;  2VRZ A;  1B3Q A;  2GA1 A;  4BIZ A;  4DCK A;  1LTJ A;  1GK9 A;  3ZRV A;  3K5M A;  4FVM A;  2NPS B;  3TJT A;  5FLX N;  1KB9 E;  2N9Y B;  2YIB A;  4YHH B;  2GSM B;  2BSK B;  1GTO A;  1L0L D;  2FL4 A;  4UB8 E;  3RBZ A;  1PL4 A;  1A02 J;  2LFS A;  3TGU D;  2L91 A;  4JI2 B;  3H1J D;  3AG2 B;  3JCZ A;  1OZH A;  2AZ2 A;  2OYO A;  3LSQ A;  1ZUQ A;  2NRG A;  1GU5 A;  1B04 A;  1KB9 F;  3FXE A;  1KEC A;  1SFC A;  5JVD B;  4JI5 B;  3L70 D;  4C7N A;  1L0L G;  4UB8 Z;  1W2B U;  4WFF A;  4RQE A;  3M91 A;  3VYI A;  1BE3 G;  1KIL E;  1PP9 J;  2BCC D;  3C9I A;  3C3T A;  1CXZ B;  1TVK A;  1USE A;  3D36 C;  1KV4 A;  3L73 E;  1JMK C;  4G2K A;  1RP3 B;  1DTO A;  1Q7Y Q;  5ITZ B;  1PP9 D;  4N78 D;  2XU6 A;  4X8A A;  1FJG O;  4UCR A;  1Q86 W;  2R44 A;  2UXC O;  3RK3 D;  3TGU H;  3K0D A;  5APX A;  2YI8 A;  4TV8 A;  4LH7 A;  2BTQ B;  1IXB A;  1M1J B;  2QIW A;  4EYY Q;  4OGQ B;  4JTC B;  1OHH G;  3I56 V;  2Q7E A;  1YJ9 V;  1OW7 A;  2GUV A;  4J80 A;  4DR6 O;  2YMY A;  1IFP A;  2HFE D;  1EZV H;  2FML A;  1BGY J;  1IK7 A;  2XDJ A;  1K4C C;  1TUB B;  1N36 O;  3WG7 B;  4B86 A;  1N32 O;  3G80 A;  2WT7 A;  3AE3 C;  3TK1 A;  1N73 C;  2BEZ F;  1VF5 C;  4UVC A;  2IFM A;  4U3F D;  4JZG A;  3RK3 E;  4JTD B;  3A2F A;  1H2M A;  1NQT A;  3VP9 A;  3ETD A;  3PRJ A;  3QO7 A;  3AG3 C;  4JF3 A;  1S72 V;  2IM9 A;  3OGC C;  5APU A;  3O6Q A;  1FZC C;  4XDL A;  3FB8 C;  3F7Y C;  2IZ0 A;  2EJ7 A;  1GW4 A;  2Z5I A;  4JI0 B;  4X1Y A;  1A02 F;  4OPA A;  3JAT B;  3MHH C;  5HFM A;  1NTZ E;  3HD7 B;  1SZX A;  4LCU C;  5CCG A;  3KCY A;  2G38 A;  2EIM B;  2YXQ B;  1WP7 A;  3ZMZ A;  2B9Z A;  3CX5 H;  3W67 A;  2I1J A;  1THZ A;  2Y48 A;  2IDB A;  1VF6 A;  1XMQ B;  3R2P A;  5LMU B;  4I55 A;  1BGY H;  1RE3 A;  2O3J A;  1P49 A;  1HWY A;  3LW5 H;  1CSB A;  2X6B A;  2O01 H;  3OA7 A;  4GIF A;  4IL6 E;  5KMG B;  4TT3 G;  3SYO A;  3AG1 C;  2WPS A;  3Q3D A;  1KYO D;  3H1J E;  4BXL A;  1NTM E;  3FGA D;  4ZKU A;  4WB4 A;  2M3B A;  2E74 D;  1QL2 A;  4X65 O;  3U1C A;  2XOK G;  2ZYA A;  2KS1 B;  3B40 A;  2DQ0 A;  4IFM A;  2ZT9 D;  5IY5 B;  1LUW A;  4X62 O;  2YXR B;  4LLH A;  1GKF A;  1N33 B;  3ZRX A;  2OYI A;  5KLV D;  2VS0 A;  1N34 B;  5E79 E;  1PNL A;  3EHB B;  2XZR A;  1XUQ A;  1OCO B;  5JCO A;  3AE6 C;  3B71 A;  1YSC A;  5JJJ B;  1FFX A;  1G1I A;  2H88 C;  1SQP D;  1R3I C;  3OJA B;  4W80 A;  5BU5 A;  3HE4 B;  3GMA A;  5JQG B;  1PPJ G;  3G67 A;  1M9N A;  4GKJ B;  2YNY A;  3H6P A;  1KN7 A;  1BHB A;  1TGO A;  4DRX A;  3J80 N;  1V55 C;  5J9P C;  3H1L D;  3JAT A;  4DUZ O;  4LF9 O;  1E5W A;  4K0K O;  2EIJ B;  2O01 J;  2FBW C;  4LF6 O;  3TGU J;  1SFC C;  3L72 H;  2OYI C;  1XHX A;  2KXP B;  1S5H C;  4X20 A;  1EXJ A;  1ZLL A;  1HUC A;  4GKK O;  2QVA A;  2GUZ B;  3VBB A;  1PGP A;  3T4Z A;  1KD1 W;  3LIE A;  4JI6 O;  2HJD A;  4QE7 A;  1QLE B;  1PL0 A;  3WU2 Z;  1FPO A;  3GF7 A;  2EZO A;  1JEK A;  5IWA B;  1H2N A;  3P30 A;  1SQB E;  2ITC C;  3BEH A;  3C3S A;  3JAL A;  4DV5 B;  4TSF G;  3H25 A;  1K9M W;  2K1E A;  4TV9 A;  2ADP A;  3VQW A;  4FPP A;  4J7Z A;  4FLY A;  3FWL A;  1SFC B;  4C7N B;  4RWU A;  5GTH E;  1ZTE A;  1NVP B;  3L9D A;  3CE2 A;  3HUS B;  1SQB J;  3RVY A;  4U7J A;  4PV1 D;  1RE4 A;  4MW8 A;  1FFX B;  2FYN B;  2KOG A;  1SS3 A;  1ZAU A;  1BGY E;  2BOB C;  2HLD G;  3CPW U;  3IN6 A;  1W2E A;  1K8A Q;  3CC2 V;  5ITZ A;  4NXM O;  1JQ0 A;  2F43 G;  1EM1 A;  1YIJ V;  3F89 A;  1NTZ G;  3IFX A;  3L71 E;  2KS1 A;  5K1X A;  1ZL8 A;  4NTX A;  2GUS A;  4PA4 A;  4F6E A;  1VQP V;  2YMK A;  2IH1 C;  3AE9 C;  1N0N A;  3H1L H;  3L71 D;  2UXX A;  3FB7 C;  4I50 A;  4WFH A;  1KQS U;  4BRY A;  4LP8 A;  4TUY A;  3CEI A;  3JCU Z;  2UU9 B;  1OIP A;  5LP6 B;  5LA6 A;  3V2R A;  1F4N A;  3G6E V;  2AZ0 A;  3HD7 D;  2YI9 A;  2M3E A;  2UUB B;  4MVZ A;  3H1I G;  5AVT B;  4XDK A;  2HG5 C;  3SJQ C;  1JUN A;  2M0B A;  2BSK A;  3UQ8 A;  3WU2 E;  4R4L A;  2Q7C A;  4OPH A;  3FX7 A;  3S3X A;  2UUA B;  5KJ7 A;  1FJG B;  3EXA A;  3HD7 C;  5B5E H;  4OH8 B;  2KLU A;  3FAV B;  2UXB B;  3CRM A;  2EIJ C;  4H37 A;  3X2Q C;  2IBZ H;  4CS4 A;  4DR4 B;  3JD0 A;  1SQQ G;  4F6R A;  1Q82 Q;  3WU2 H;  4HJG H;  4PDM A;  1OCZ C;  1WA8 A;  3JD3 A;  2W27 A;  1S77 D;  1SER A;  2P22 C;  1GMG A;  1LUV A;  5LHI A;  5B1A C;  1SQF A;  1K05 A;  4WY4 B;  2QM7 A;  3U0Z A;  1AB3 A;  3F5H A;  2YKQ A;  3JCU H;  4MVS A;  4NPF X;  2LGQ A;  3U10 A;  3TXQ A;  2KLV A;  1K8A W;  1QVG U;  4UB6 E;  3BA9 A;  5GTH H;  1SQV E;  3FFQ A;  3NR7 A;  3U11 A;  4TQD A;  2K88 A;  4YY3 B;  1BGY G;  2R9R B;  2EJR A;  5L3B A;  4TV8 B;  1RSO A;  5L3C A;  3KHU A;  3BPZ A;  4G28 B;  1R3J C;  5CB4 A;  1H8E G;  3B5N D;  1L0L K;  1L1F A;  5GTI E;  5BY1 A;  4BW5 A;  1K33 A;  2YIU B;  3V4Q A;  2HHH B;  2Y4T A;  5IJ9 B;  2E3C A;  1NU1 K;  4O4H A;  5EZY B;  2IJI A;  4GOF A;  2WLM A;  3SPG A;  2PAJ A;  2BCC E;  2ADQ B;  1QVF U;  5J2U B;  1F7Y A;  1O9H A;  2LP7 A;  1NTZ D;  3G6E P;  2K9J B;  1QL1 A;  3PTZ A;  4U3J B;  3I56 P;  4GDO A;  1WA8 B;  5TJH A;  5KX5 B;  3E2E A;  1KYO I;  1NU1 G;  1Q3E A;  1WB8 A;  1NTM K;  1SQX E;  2WLL B;  2J5U A;  2XV5 A;  4H13 C;  2EX3 A;  2A79 B;  3F5W C;  1DGS A;  1PP9 H;  2ZXW C;  4YIP A;  3BCC E;  5IYD O;  1JVM A;  4J9Y B;  1QNM A;  1JY3 N;  4I7Z B;  3H1L J;  3KQG A;  2PRR A;  1KB9 I;  3CCS P;  4Z1V A;  3ZRS A;  3JAS B;  2E5L O;  4Q20 A;  3LW5 J;  2V7Q G;  1BSM A;  4I6M C;  3HKC B;  4JAS A;  5H6R A;  1NT2 B;  2P06 A;  3MDS A;  4ZKI A;  3BCC J;  4IOI H;  3E89 A;  2Z0A A;  3II6 A;  4MW3 A;  1YJN V;  1ZXG A;  1JFF B;  4FLX A;  2MW2 B;  1H2G A;  1FYJ A;  4NKG B;  4JI6 B;  2NPS D;  4DR4 O;  1SZT A;  3JD1 A;  3H1J H;  4LF4 O;  3L71 G;  3BRV B;  2FKW B;  1TA8 A;  4BRY B;  4H0L B;  2QJK B;  3RL0 C;  4LF7 B;  3CWB H;  3M9Q A;  1KP2 A;  3CHX A;  4UCT A;  5EBM C;  3AE8 C;  3CX5 I;  5AVW B;  1BE3 H;  4O2A A;  1NZ6 A;  3C90 A;  1M7L A;  1LWU A;  4LWS A;  4W4L A;  1SKV A;  2XND G;  1W0J G;  3N2K B;  1TU3 F;  1JY3 P;  3IJ4 A;  2LXC B;  3TCU A;  5GON B;  2BTO A;  4GKJ O;  4JAA A;  4BWA A;  1GK6 A;  4C7R A;  3L73 G;  2EIK B;  3SDL A;  1M56 D;  2R9I A;  2KNC B;  5CBN A;  2FKX A;  1S76 D;  2ZVO B;  3TDK A;  1NVO A;  1XTG B;  3VQY A;  3BCC H;  2OYH A;  2E76 D;  1ORQ C;  2FYU E;  4DW0 A;  2ZDI C;  4IYI A;  4W7Y A;  4ZHQ B;  2WTY A;  1FZC A;  2CPB A;  4TV9 B;  3HKB B;  2Z4E A;  1L0L E;  1NTM H;  3P3P A;  3B5N B;  1M90 Q;  1H8H G;  2AXT H;  4U3F J;  2IJH A;  4WFG A;  4X88 A;  1UIX A;  5EBL C;  2OTJ V;  2EIL C;  3E22 B;  4YJ2 B;  1L0N E;  2P7T C;  4CC6 A;  4NTY A;  2WT7 B;  3IFM A;  4XFJ A;  5KLV H;  1D7M A;  1SQB H;  1Y67 A;  2Z5H A;  3B2E E;  2IYP A;  3H32 A;  1IFM A;  2ZE5 A;  3CRA A;  3HB3 B;  1KC8 W;  4WY4 D;  1QQC A;  1RQU A;  3ABU A;  4HNA B;  1IBL B;  5EK0 A;  1KZU B;  4DV4 B;  1NH4 A;  1D2D A;  2DYS C;  4MTX A;  3CJH B;  1SP4 A;  4BAY A;  1IBK O;  1R6N A;  1EZJ A;  3FXD A;  3AE7 C;  3L70 J;  1VQL V;  3WFV A;  2Q6A A;  3H1H J;  2UXD B;  1G2C B;  1URQ D;  3A5T A;  1PNM A;  3G71 P;  1AJN A;  5L3E A;  2VQE B;  1VQK P;  3CCE V;  3RK2 D;  3CCR V;  1FE6 A;  1BL8 A;  1T6A A;  3HKB A;  1YTZ I;  3X2Q B;  1NTK D;  2HPC B;  1KP3 A;  3PH0 A;  1GN6 A;  1JCH A;  1XI1 A;  3OD4 A;  1OVU A;  1SQB D;  4YPC A;  2A06 D;  2FTK A;  2V4H A;  4JYC A;  4IIJ A;  4DW1 A;  5B66 Z;  3L74 D;  3H1J J;  4FM0 A;  3WUT A;  5LXT B;  1I08 A;  2ITD C;  4JV5 B;  4DK1 A;  2UXD O;  1JCC A;  4X64 O;  3JYC A;  2RMK B;  3T1Y O;  2I1K A;  3H1I E;  2XAH A;  3I55 P;  2WLH A;  3WUV A;  1AJQ A;  4KJM A;  1CW5 A;  5H2F E;  1NTZ K;  4FLT A;  4IL6 Z;  5AVZ B;  4LF6 B;  4NVP A;  5AW2 B;  4MVU A;  4X65 B;  3RBX A;  2Y4U A;  1UJW B;  3AE4 C;  1GU4 A;  4J11 A;  3CRC A;  3RYC B;  2HOD A;  3AEB C;  1MG1 A;  1NOH A;  4ZKP A;  2H7H A;  2PP6 A;  4UCS A;  5DN6 G;  3AEE C;  1FOS F;  1G2C A;  1I7F A;  3K59 A;  4MTG A;  2QA4 P;  3E86 A;  4H44 C;  2XAS A;  1WJZ A;  1M5I A;  1NKN A;  1HJB A;  5B3S C;  2DYR B;  1YYC A;  3USS A;  1YVW A;  3STZ C;  3JSV C;  2QWR B;  1Y9B A;  4XA4 A;  2XHB A;  3GHG C;  3RK3 C;  4IHJ B;  4RAI A;  1BDD A;  5J2T A;  1Q90 D;  1QVF O;  3DTU B;  5CBF A;  3CXH E;  2ZT9 B;  2AEF A;  1P84 I;  1JTH B;  1LT9 B;  2P4V A;  4GX5 A;  3L75 G;  1IFJ A;  3A0B H;  1IFI A;  1DLB A;  2ZJS E;  1FS0 G;  1BCC H;  1KU9 A;  1WN7 A;  3CME P;  1IZ3 A;  3Q5S A;  3KYQ A;  3L75 E;  5IJ0 B;  3ML0 A;  2H89 C;  3SPI A;  3PP5 A;  3T97 A;  1N86 A;  2JR8 A;  2Q69 A;  1AVY A;  5AW7 B;  3K79 A;  3ZHV A;  2YXH A;  4TQF A;  3SYQ A;  1OCR B;  2Y0D A;  4Z1M H;  2WSF H;  3ZDM A;  2A06 G;  2DYS B;  1QBZ A;  1L0N H;  2QJK C;  4H0L C;  3RL0 B;  5CCH A;  4CH5 A;  4Y99 B;  4I2L C;  3L75 H;  2ITA A;  1HF9 A;  5CA3 A;  2YID A;  1LTS C;  2OYH B;  3K9S A;  1VQM P;  4X66 O;  3E8F A;  2UUB O;  2LO1 A;  1PFI A;  3K0G A;  5KHH A;  3CC4 P;  3OW2 O;  1J1D B;  5F2V O;  2E76 C;  2P1J A;  1FBM A;  4J7K A;  1BZK A;  3CB2 A;  2JJ1 G;  2W6I G;  3DC5 A;  3MUD C;  2WAM A;  2C9L Y;  1CP9 A;  1AA0 A;  2LR2 A;  5LBQ A;  3SJA C;  3HKD B;  3RK2 C;  4DUZ B;  3CWB D;  3FWN A;  2M8R A;  1KYO H;  2V7Q H;  4KT0 J;  5TIS E;  1LTJ B;  4JI8 O;  4D7T A;  1Y74 B;  1LWU C;  2Y0C A;  2WSF J;  2P58 A;  1E1Q G;  5JJE B;  2LJ2 A;  2LQT A;  2OGU A;  1JFF A;  2F95 B;  1LR1 A;  3ETE A;  4PD4 H;  3GWO A;  1EDL A;  4PA7 A;  1K34 A;  4EFB A;  3HTK B;  4DV2 B;  1NU1 H;  3T4D A;  1GD2 E;  1K4D C;  2F66 C;  3JAK B;  5B1B C;  2XAJ A;  3CCL V;  1YTF D;  4UVB A;  5C8Y B;  4ZI7 B;  1Q81 W;  2WA4 A;  3ZCC A;  3CME V;  2M5A B;  1BQZ A;  1ZLZ A;  3MD0 A;  1IBM O;  2ZR3 A;  2YIC A;  3H1I J;  1MZ9 A;  4X1I B;  3OR6 C;  1JCD A;  1L0N K;  1SQX D;  1ZR4 A;  2RN9 A;  4IYH A;  2BEQ D;  1TAE A;  4OXS A;  3K3W A;  4JYY A;  4DK0 A;  1X79 B;  2WLI A;  4PV1 C;  1M93 A;  1Q6H A;  3Q5P A;  4UV8 A;  5LP6 A;  3BHP A;  3E35 A;  2DWE C;  3Q4H B;  5EIB C;  2Q73 A;  4UV9 A;  1PP9 G;  2FYU G;  1VQO P;  5BU8 B;  5APV A;  1GAX A;  2K9J A;  1SQQ J;  2M7W A;  4LBE C;  4H33 A;  3ZHU A;  5AVV B;  3CC4 V;  5EYP B;  1BT8 A;  4PA3 A;  4A5U B;  5LHH A;  3C1L A;  2JVD A;  2KI7 B;  1OVV A;  1Q6U A;  1UPG A;  2QG4 A;  1E79 G;  4EB6 B;  1XL4 A;  1T3J A;  1L4A D;  4UB6 Z;  4R8C A;  1N73 B;  1W5C E;  1WNS A;  1IBM B;  3CWB J;  3OMN B;  3UT5 B;  5LHG A;  2B1I A;  5B3S B;  5IJ0 A;  1XL6 A;  3L75 J;  3C8V A;  4HAM A;  1MZF A;  2ZIO A;  3HUS A;  1EXI A;  5KLV E;  3WB2 A;  2ZE7 A;  4UB8 H;  5JH7 B;  1JY2 O;  4B3S O;  5KA5 A;  1XMO B;  2WZ7 A;  3MP7 B;  2N1T A;  4LFA O;  2CAZ C;  2NN4 A;  1YZB A;  1KIL D;  1XQ8 A;  1JA8 A;  2HR3 A;  3E8H A;  3WMM 0;  1SQV H;  3ZS8 C;  2E5T A;  2KZJ A;  1NBM G;  1LTA C;  4HYT B;  3D6Y A;  1VQ5 V;  1SQP G;  1R6T A;  3RYF A;  5B5E E;  1HR0 O;  4JAV A;  5BR8 B;  5HFL A;  4PD4 E;  2XKM A;  5CHX A;  1S5L H;  3H1I H;  4F6R B;  1HNX O;  2O1K A;  2QRX A;  1MSW D;  1JY3 O;  3KDP B;  1QR8 A;  4IFD K;  2UUC B;  4YJ3 B;  1JX9 A;  1MAB G;  2V7Q J;  3N2G A;  3MAQ A;  1KQG B;  5FPO A;  3N4X A;  2PF4 E;  5AW8 B;  3LNN A;  3FYI B;  4J7J A;  1SA0 A;  2Z3Y A;  2Q7H A;  3BAS A;  5C8Y A;  1XRE A;  1URQ B;  5LOV B;  2GBO A;  5EFW B;  1I94 B;  1S9K D;  4U7N A;  3APO A;  5GTI Z;  1AP5 A;  1SES A;  1RF0 C;  3CCR P;  3E7K A;  1F23 A;  1Q81 Q;  2ZDI A;  1VQ8 P;  5AVU B;  3OTF A;  3CRQ A;  3L71 H;  1SLQ A;  4LF7 O;  3H9V A;  1M57 B;  5H2F H;  3M8A A;  2HLO A;  4GOE A;  3N2K A;  5DM6 V;  1DK1 A;  2Q5U A;  3SGI A;  1BHA A;  2GV9 A;  4CC5 A;  2HPC A;  1DH3 A;  3FB6 C;  4PDR A;  1IBK B;  2UWJ E;  1R1B A;  2RDC A;  5CBH A;  1SFC D;  2N1T C;  1GL2 C;  2KIK A;  2A0L A;  5AW3 B;  3S9O A;  2JP3 A;  4ASV A;  4DZO A;  2YXY A;  2JJL A;  1ZSP A;  3CLQ A;  1P7B A;  1FS0 E;  5D5Q A;  2Y0I A;  1J1E B;  2E75 D;  2IFN A;  4R50 A;  2Q7G A;  5LP6 C;  2R72 A;  2B87 B;  1L4A B;  2GTA A;  1PP9 E;  5B1A B;  4L74 A;  1XNQ O;  2QJP B;  2WSS G;  1VL2 A;  3M7M X;  2QKS A;  5BZB A;  2R3S A;  5AG2 A;  2DWD C;  5CA0 A;  1XNR O;  4PDL A;  4DR5 B;  5CJ0 A;  4DV3 O;  1CPY A;  3EWK A;  3CPW O;  3CC2 P;  1AIL A;  2QTO A;  3VTP C;  1T2K C;  4J41 A;  1HVV A;  3U1A A;  1L4A C;  2B5U A;  1OZ0 A;  1RF1 B;  2PFX A;  3LDE A;  2C9N Y;  2XAQ A;  3OEH G;  1K04 A;  3CMA P;  1DF5 A;  4JYB A;  2F1M A;  3CJH A;  2GTS A;  2GUZ A;  3QTC A;  5IYC O;  4U3F G;  2Y9Z A;  2XAF A;  2FFD C;  4AQR D;  3V5B A;  3THO A;  4HNA A;  4LF4 B;  5B66 H;  3DC6 A;  2WLJ A;  3RYI B;  2KB7 P;  1Z5W A;  4AQY B;  3UCS C;  2O1J A;  3RVZ A;  1WMK A;  1BE3 E;  3JAR A;  1JM0 A;  2OCC C;  1R5S A;  5JH7 A;  4AHC A;  4DJG A;  2XAG A;  4D6T E;  5AVS B;  1HGZ A;  1SQP H;  3STL C;  2Y0E A;  3B8E B;  1SET A;  4B3T O;  3SWK A;  2EIN C;  4DUY B;  5CN0 A;  1NH2 D;  5AVQ B;  1NTK J;  1YIT P;  4PJ0 E;  4FZ1 A;  1ZRT E;  3D8C A;  2IBZ D;  2E75 B;  5GON A;  1R5L A;  1IK9 A;  3QWO C;  1KFM A;  1VQM V;  3LUT B;  1Q86 Q;  2OCH A;  2HG5 D;  2QM8 A;  3ITK A;  2Y0P A;  4ZHQ A;  3QF7 A;  2JWD A;  1QR9 A;  4FK5 C;  1OCZ B;  1XMO O;  2JS5 A;  3UM7 A;  3QNE A;  2Q5Z A;  4KL1 A;  2YKP A;  2WQY C;  4DV4 O;  3APQ A;  4JF7 A;  1MSD A;  3A0H H;  1E79 H;  3QVN A;  1GL2 B;  3EVK A;  1EDJ A;  3MUD A;  2JGD A;  2ZXE B;  3OFN G;  2QSA A;  3BY6 A;  5APT A;  2F23 A;  4NXM B;  3SPH A;  2CTW A;  3U59 A;  1AV1 A;  1HW7 A;  1Z56 A;  5KKZ C;  2AXT Z;  2BCC H;  2YDE A;  2PTM A;  2PI5 A;  2VQF B;  4YXD C;  3L72 D;  2RNB A;  3VMY A;  2OIG A;  3L70 H;  1FZB A;  3H1L G;  1WRG A;  1SF9 A;  2CTP A;  3ZHQ A;  3H1H H;  2N05 A;  3G3Z A;  3O6Q B;  3RWR D;  4YJ3 A;  2VWK A;  4DV0 B;  2YS8 A;  1U7M A;  5KAI E;  1AJY A;  5IDJ A;  3M06 A;  4GKG A;  1OW6 A;  5KLV K;  4LFB O;  4DR7 O;  5B1B B;  2WLL A;  3GF3 A;  4LF5 B;  1EZV E;  4DV1 B;  2UXC B;  1KKD A;  2RMZ A;  1JR9 A;  4I50 B;  2P5O A;  2PI4 A;  2WSS H;  3B09 A;  3ZRW B;  1SQB G;  1BE3 D;  3CX5 F;  4AQY O;  1GZL A;  1Y6X A;  5IJ9 A;  2WIT A;  1AQ5 A;  1YIT V;  1SC5 B;  1L0N D;  1SQX K;  1HNZ O;  1VDF A;  3EFG A;  2B89 A;  3CXH F;  3L70 G;  2X7R B;  4B3R O;  5LMN B;  3ABM B;  3AG2 C;  3ZMU A;  1YBK A;  3SWY A;  1AVM A;  1JJO A;  1UII A;  3CCS V;  1NKZ B;  2H8P C;  5CBG A;  1J5E B;  3OR7 C;  3ZN0 A;  4B3T B;  3V2Q A;  1YJW P;  4LF8 B;  3M0A A;  1RPO A;  3CX5 E;  2WLK A;  3LSS A;  3JC2 2;  1SQV J;  5LGN A;  1W0K G;  4FLW A;  4KHP B;  1YTF B;  2ZQM A;  1YJN P;  1S5L X;  2ATK C;  2A06 E;  1RPR A;  1N34 O;  1RFY A;  1FXK B;  2UXN A;  1NTK H;  4DXW A;  3RYH A;  2EUL A;  2AXC A;  2BCC J;  3E83 A;  3CCU P;  1OXZ A;  5JJN B;  1GTW A;  3K57 A;  1YQ4 C;  2KNC A;  2E5L B;  3PLN A;  3L35 A;  1K5Q A;  1OVR A;  3ZHS A;  5LYJ A;  2YC0 A;  3D3I A;  3UO2 A;  4L8J A;  1IDS A;  2YUA A;  5IYZ B;  1IFN A;  5AVX B;  1BMF G;  1NTK E;  4QNH B;  3OE7 G;  2CK3 G;  3L74 E;  1OCC B;  3AEI A;  4QIW F;  3TET A;  1VQ5 P;  4KHX A;  3EFF K;  2WLN A;  4QPK A;  1LWU B;  4G27 B;  1NTK G;  3H1K E;  3MHS C;  1LP1 A;  1GH6 A;  1LTG C;  1AFO A;  4X89 A;  1N33 O;  4ABM A;  4DR2 B;  3AE1 C;  1YIJ P;  3HTK A;  3ETG A;  5KJ7 D;  2FYU K;  2FFD A;  3K9A A;  5LA6 B;  1QEX A;  4O4J A;  1Y66 A;  1Y8A A;  3AED C;  2IW5 A;  2QE7 G;  4N78 E;  5H9C A;  4CS2 A;  1QGK B;  3RGU A;  3BAT A;  4C7U A;  3ZBH A;  5E79 Z;  4AYC A;  4O2B B;  2L5G B;  1I0H A;  2A06 H;  3T2M A;  3OTO B;  1VQ9 V;  1MUU A;  3RL0 D;  4FLZ A;  1NHL A;  2KG7 B;  2IU0 A;  1JNM A;  5KLI C;  4MVQ A;  1NTM D;  2OTJ P;  3P7K A;  4UUJ C;  5IE9 A;  2RN0 A;  4L73 A;  2N74 A;  4Y99 C;  5CMZ A;  1MA1 A;  4FMT A;  3ZMT A;  1IFD A;  1SQQ E;  4IL6 X;  4JQ0 D;  2UXB O;  5KTB A;  3CCJ P;  1SVF A;  1OCR C;  1BCC G;  3KZI E;  2QWP B;  4FFK A;  1EN4 A;  2D2C B;  2WA3 A;  3SJC C;  1X0T A;  3KZI Z;  1RF0 A;  1FXK C;  3GWK C;  1QHT A;  1BCC E;  3TGU G;  1PV3 A;  5KAI H;  1QLE C;  2NR5 A;  3A8T A;  2FY8 A;  1U96 A;  1AP6 A;  4O9B A;  2DE0 X;  3BA8 A;  1VF5 D;  3GVM A;  4JYA B;  5KKZ B;  1NI8 A;  4E2L A;  1XBL A;  2BOC C;  1A32 A;  1VQ6 V;  1GK4 A;  1VQL P;  1OJH A;  1NR1 A;  2G3A A;  2JIZ G;  2KSE A;  3IAO A;  1GN3 A;  1NU1 J;  2FXP A;  2WSE H;  4GKK B;  3OMI B;  2E76 B;  2Q9I A;  4RKU J;  5CB4 B;  2F4V B;  4K0K B;  2QDO A;  1ZX3 A;  2ZXW B;  4WCE V;  2OWO A;  4X64 B;  3LSU A;  1M90 W;  3SJB C;  2NZ2 A;  4B08 A;  1SQX G;  3AEF C;  1JTH A;  1LT9 A;  1NKD A;  4U3F E;  2ZE6 A;  3W7W A;  3IGA C;  3OAA G;  4FFB B;  4EOT A;  2E74 B;  3ASN B;  5DJT B;  2LW1 A;  1DD4 A;  1KB9 H;  2DYR C;  1KQS O;  3K5B A;  3H32 B;  3VMZ A;  3H1H G;  2Q8V A;  2V1D A;  4MVO A;  1SQQ H;  4X62 B;  5JWP A;  1N7S B;  3SPJ A;  3BRT B;  4PJ0 H;  3QG5 A;  2YIU C;  5AW4 B;  1OCC C;  1FAF A;  4BIU A;  3BAB A;  2PZS A;  3VOU A;  4B7E A;  1X59 A;  2N04 A;  4WFE A;  2KP8 A;  2ZT9 C;  2HVK C;  2D2C D;  2QEX P;  5EIB D;  2W6B A;  3CCV V;  5AW1 B;  4H13 D;  5BMV A;  2Y69 C;  3K5L A;  2JRI A;  1X8Y A;  3K06 A;  2QWN B;  4N23 A;  3L74 J;  3AE5 C;  1ZR2 A;  4DRX B;  5KHK A;  1X4T A;  5KMG A;  2B87 A;  2NNU A;  3CYO A;  4CS3 A;  1H88 A;  1X22 A;  4WWI A;  2JGD B;  1BSN A;  3JCU E;  4ZIB A;  3CCM P;  1WLE A;  1FFT B;  1SQQ D;  3GG2 A;  1XEQ A;  4BW9 A;  2K9Y A;  3H1H D;  4GYC B;  3GB7 C;  1M1K Q;  3A7O A;  3HD7 A;  3P32 A;  2KG7 A;  1ZL8 B;  2IBZ E;  4LFA B;  3MHV A;  4O2B A;  2X6C A;  1N32 B;  3HPL C;  1BS3 A;  2R5D A;  5GTI H;  5M1B A;  3F7V C;  1HP8 A;  3OUS A;  1RY3 A;  4LH6 A;  1RHZ B;  1PNK A;  3T1Y B;  4AUW A;  2R70 A;  3PJS K;  1YF2 A;  3ICX A;  2CGO A;  1YHQ P;  4U3F H;  1M56 C;  3HR0 A;  4JBZ A;  3ETQ A;  3OMA B;  4K8Z A;  1BCC J;  2QJY B;  2O57 A;  1LP1 B;  1Q2N A;  4L75 A;  1P84 F;  4PI0 A;  2YIB D;  2LFR A;  1SA0 B;  3JD2 A;  4JGS A;  1NJI Q;  1S2E A;  4CH3 A;  4WBN A;  3ASO C;  3CCV P;  4PHZ A;  1EZV D;  1ZP0 C;  3E1I A;  3JAL B;  3N2G B;  4HH2 A;  5KLV J;  1AR4 A;  4N6J A;  4WVZ A;  2K37 A;  4MVR A;  5LYJ B;  2VQE O;  4I7Z C;  5AVR B;  3V6I A;  3JD4 A;  3ZMV A;  2WPV B;  4I4T A;  3LID A;  4L76 A;  1KIL B;  3RT3 C;  2ZAE B;  3RYF B;  1LTJ C;  2HP8 A;  4H13 B;  2CPS A;  1F4M A;  1P7G A;  4X20 B;  2FYZ A;  4WBN B;  1COW G;  2ETN A;  5J2U A;  2MKV A;  2OT5 A;  1EN6 A;  3H1K H;  5CA0 B;  2Y69 B;  4DV6 O;  3CWB G;  4OGQ C;  1FAV A;  2DJV A;  4LFB B;  3G6B A;  3RFR A;  3CCM V;  2JJ2 G;  2EIL B;  1AR5 A;  4KFM A;  4IT5 A;  1I5Y A;  1M1K W;  4UB6 H;  4GUN A;  4HYO A; 
#chains in the Genus database with same CATH homology
 4PV1 D;  2YIU C;  2QJP C;  1YQ4 C;  2E76 C;  1VF5 C;  3AE7 C;  3RK3 E;  4H13 C;  2J5U A;  2ZT9 C;  2D2C D;  1ZRT E;  3Q5R A;  3IN6 A;  2E75 B;  3Q2Y A;  1DIP A;  4H13 D;  1HJ0 A;  2D2C C;  2V7Q J;  3O6Q A;  1KMI Z;  1NGM B;  4I7Z B;  1KQG B;  1VF5 B;  1KOR A;  1GMJ A;  1FDO A;  4PV1 B;  3LW5 J;  3AEA C;  3AE5 C;  2YMK A;  3AE9 C;  4KT0 J;  1NYH A;  2JO1 A;  2G8Y A;  1U57 A;  3G9R A;  2WQY C;  1DD3 A;  1MKM A;  2WSF J;  2OQQ A;  2IDB A;  3AE1 C;  1FDI A;  4YTP C;  3D6Z A;  3AED C;  3GLM A;  2K9Y A;  4H0L B;  3Q3D A;  3D70 A;  1ZOY C;  1ZME C;  3AE8 C;  5KKZ C;  3Q1M A;  1R8E A;  2QSI A;  2E74 D;  3SFE C;  3AE4 C;  5KLI C;  4YXD C;  4R4L A;  2E75 C;  3AEB C;  2ZT9 D;  1TU3 F;  3AE2 C;  4IL6 X;  2BEQ D;  5M1B A;  1AJY A;  3S9O A;  2JP3 A;  1OW6 A;  1YQ3 C;  3AEE C;  3AEG C;  3R4Y A;  4PV1 C;  1OW8 A;  3AE6 C;  2QJY C;  3B71 A;  3GF3 A;  5L8R J;  3Q5P A;  2H88 C;  4H44 C;  1PL5 A;  2D2C B;  3GMA A;  2WSE J;  2E75 D;  4Y28 J;  1PV3 A;  4H44 B;  2E76 D;  1Y9B A;  3RL0 g;  1K05 A;  1VF5 D;  1VL2 A;  3SFD C;  1KIL E;  1Q90 D;  2O01 J;  2G3A A;  2FBW C;  1S1C X;  3IAO A;  3D71 A;  2ZT9 B;  3EWK A;  2FXP A;  1ZP0 C;  3AEC C;  1EXJ A;  2P10 A;  4U7J A;  2E76 B;  2WSC J;  4I7Z C;  3T97 B;  4RKU J;  1UIX A;  3Q5S A;  2WPV B;  1KQF B;  2H89 C;  4TT3 H;  1K04 A;  3GF7 A;  2QIW A;  4OGQ B;  3C8V A;  2NZ2 A;  4H13 B;  2FYN C;  1EXI A;  4XFJ A;  4H0L D;  3AEF C;  4H44 D;  4Z1M H;  3FGA D;  3H25 A;  1OW7 A;  1RQV A;  2MKV A;  2E74 B;  1OMI A;  2QJK C;  4H0L C;  1JB0 J;  1DD4 A;  3ABV C;  1IK7 A;  1RQU A;  4OGQ C;  1S5L X;  1HF9 A;  4R4M A;  1WMK A;  1PIX A;  4OGQ D;  2E74 C;  3D6Y A;  1KTM A;  3AE3 C;  2BEZ F;  4GDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...