2E74B

Crystal structure of the cytochrome b6f complex from m.laminosus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 40
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2e74B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e74B01
2E75B 2D2CB 2YIUC 3LW5J 2K9YA 2O01J 1S5LX 4I7ZB 2ZT9B 1VF5B 1ZRTE 2WPVB 2WSCJ 5L8RJ 2FYNC 2QJYC 4IL6X 4H13B 4OGQB 5KLIC 4KT0J 2QSIA 2E74B 2QJPC 4Y28J 4H44B 4H0LB 2E76B 3C8VA 1JB0J 1Q90D 2QJKC 2QIWA 2WSFJ 4PV1B 4RKUJ 2WSEJ 5KKZC
chains in the Genus database with same CATH superfamily
3ZHRA 2KKWA 1YDXA 3QVNA 5CCGC 3T1CA 2W6BA 2RN9A 4HYOA 4I7ZB 3RBXA 5CJ4A 3CPWO 3N2KA 2BCCH 4MTXA 4DV4O 4IL6E 5LMUB 5AVRB 1ZLZA 4RO2A 1JM0A 1FPOA 5B1AC 3FXEA 5J2UA 2UU9B 2KLUA 3A0HE 1LTIC 3AECC 3JCUZ 1WB8A 3A0BZ 4FLTA 1GMJA 3RGBA 3ASOB 2UXDB 3RK3B 2X0LA 1L0NE 1BCCH 3G6BA 1FZCC 3Q5SA 4DV6O 1JEKA 4ZI7B 1QVFO 3FX0A 4LF5O 1SQGA 4LFCB 2OQQA 2CGNA 1KKDA 4PJ0H 4NB5A 4WY4B 4X65B 3E83A 3G4SV 3A0RA 2P7TC 3AK2A 4JAAA 3TNUB 2Q68A 1PZQA 5LGNA 1YJ9P 4FPPA 1B04A 4TV8B 1NAYA 2ZT9D 3K58A 4FLWA 2CH7A 3H1ID 3L73D 5LBQA 1IFMA 3UO3A 1LT9A 2O1JA 3LSSA 1NU1J 4JAVA 2M7WA 2FY8A 1N8RQ 2IDBA 4PI2A 5JJEB 2AXTH 2Q5UA 3RL0g 4DR7O 2XZRA 1LTTC 2GDSA 1K73W 4ZNCA 1M4UA 1ZUQA 1OW7A 4LF8B 2GSMB 5L8RJ 5JQGA 5C39A 1SF9A 2FYUD 1K9MQ 3TF5A 4KHXA 1NT2B 3STZC 4YHHB 1LP1A 1LTGC 1MUUA 1YQ4C 2XU6A 3CMEP 4GYCB 2HPCB 4L75A 1M5IA 4R50A 1EXJA 1LR1A 2Y69C 1AR1B 1VQLV 2WPQA 1SQQG 3B5NB 4GX1A 5IJ9A 4U7JA 4EI2A 4K0KO 3CJHA 5M1BA 3MIWA 2ZQMA 1PGJA 3V2RA 1TVKB 2KP8A 1XHXA 4KP4A 2P90A 5KHIA 3CB2A 1GTWA 2LXBA 2K1AA 1MFTA 1QVGU 1VL2A 1CI6A 1QNMA 3STLC 3BCCG 1US6A 1D7MA 1NTZK 4ICGA 2I1JA 4K3AA 5IYZA 3L74J 4KHPB 4JI6O 3TCUA 1N8RW 4DR4O 5APXA 1H88A 2B88A 4O4IB 2F4VB 1Q8IA 2E74C 2XASA 2SPZA 2F4VO 1L0NK 5AW8B 1NGMB 3H1HE 3SPCA 4DV2O 1GL2A 2RN0A 2WPVB 1GD2E 5DJUB 3MAQA 2BSKB 3K59A 3F5WC 4W4KA 3M0DA 1K7DA 4LF9B 1M90W 1Q86W 3O9OA 4WFHA 5CHXA 2PZSA 1OHHG 1SQPJ 3CCQP 1JCDA 1LTSC 3C3SA 3VBBA 2A9HA 2WSEJ 3BASA 1AQTA 4NTWA 2UUAB 1YIJV 3BVHA 2FYUK 4PI0A 1BSMA 4MVQA 1Y8AA 3HUSA 4EKWA 5KUMA 3ZDMA 2H89C 1YITV 3JC22 1P4RA 5B66E 1JUNA 3HE5B 1W0KG 4JGSA 4YXWG 2QSAA 4J42A 4DW1A 4TQFA 1KILB 4Z1VA 2HHHO 1LTJA 3OR7C 1NU1K 2QJPC 2JR8A 4D6TH 4DV1O 3TGUH 1HW7A 2QM4A 1EFRG 3QO7A 1JPXA 3B8MA 4X62B 1N7SA 1ZRTD 2ITAA 3P3PA 3RK2B 3L74H 3OMIB 2R70A 1NKNA 4PA3A 1Q82Q 4QE9A 2KS1A 2IBZH 2K3RA 4BWNA 2QJYC 5JWPA 2JWDA 1KYOF 3CCLV 4NR1A 3GMAA 1CXZB 4JYAB 5KAIH 1Y74A 1VF7A 2YS8A 3HD7B 2YI8A 3SFEC 1FFXB 2BASA 3H1JE 4YJ2A 3AEBC 3ZIAG 2HVJC 1EM1A 2KNCB 3CCRP 3HRNA 3CX5E 1H8EG 2LFRA 4H13D 4KUMA 5CA0A 2Z3YA 2R5BA 1L8DA 4J7KA 5KMGB 1H0TB 3ZMUA 1FZBA 2XUMA 3ABMC 1OWAA 3SJBC 3SYCA 1SQFA 4DV5B 4MW8A 4FLVA 3E2EA 1J1DB 4LFAO 3KZIE 2B87A 4U3FE 3BRCA 1R3LC 1OIPA 1NTMK 3AEGC 3TNUA 2YIBA 1MOFA 4JI0O 3H1JH 3HKCA 1NTME 2FFDB 3CXHE 3FAVA 3DXRA 1SQPD 2IZ0A 1DIPA 3BVOA 3CX5F 4NPFX 3L75D 3EFFK 1JVMA 5TISZ 3ZX6A 2N05A 3FB7C 4NTXA 3HKCB 1KB9E 3AG2B 1HNXB 1XHZA 4O4JB 4JYAO 3LW5J 1MZEA 1KMIZ 3HKBB 2BSKA 3OEHG 4EFBA 3H1IE 4IYHA 2DYRB 2ZVNB 4GDOA 3WB2A 1NTZG 2VQFO 5GW7A 3E86A 2E5TA 3I56V 2OCCC 3CI9A 4FLUA 2QM8A 2WSFH 3M91A 3OAKA 1KV4A 3CC7P 2YXHA 4JTAB 1MZ9A 5FNVB 4DRXA 5KJ7D 3CRCA 1VQKV 4I5SA 3VMZA 4TUYA 5CA0B 1O9GA 3AE6C 4I50A 3H1KE 2XTAA 4LCUC 1FZGA 4H0LB 3R65A 3V5BA 1EZVH 4TUYB 1XMOB 1MFZA 1J2JB 5JCOC 2UXBO 5IWAB 1T6AA 4J80A 4J9YB 5JVDB 3SYOA 1KQGB 3JAKB 1OZ0A 2HODA 2WQYC 1B06A 5ITZA 1HJ0A 3NR7A 2ZT9B 2WSSG 5KHGA 5APQA 4BW5A 1UJWB 1I5XA 2HODB 3KYQA 2JGDB 1BT8A 1Z56A 4FFBA 2OYIA 2ZINA 1SQVD 1J5EO 3VN0A 2P06A 2AZ0A 1AJYA 4X1IA 1MNGA 3LUTB 3K03A 2Q1KA 1VQ6P 2DQ0A 4UCTA 1W5CE 1EZVD 2R3CA 5AVWB 2EZPA 3RL0D 1YTZI 2LR2A 5KLVG 1KUQA 2XAQA 4EB6A 2BTOA 2DN9A 5LOVB 5IT9N 5EYPB 1VQ7V 4J9ZB 5KUKA 2QWOB 1DF4A 4JI8O 1OX3A 1VPCA 1Z5WA 1ZV8A 1H2NA 3E89A 4HYTB 1Q81Q 3MP7B 3LNNA 1JY2P 3H01A 4DV0B 1KQSU 1I94O 1VIBA 1KQLA 3OW2O 4ASUG 4UVAA 1DD3A 1IXMA 4I4TB 1IZNB 3H1JG 2UUCO 1DD4A 3V6IA 4I55B 1YTFB 1JB0J 3CCQV 3H1LD 1FYJA 2FXPA 2C0XA 5H2FZ 3VP8A 1RF0A 1SQBK 3II6A 2DOSA 5KJ7C 2DW4A 1OJHA 2WITA 4DXWA 3HKDB 4E2LA 1N0JA 2LGWA 4UV9A 5IYBO 1FU1A 2FKWB 3AE4C 3AE2C 3CCSP 4M3LA 5K1XA 1NOHA 1KC8Q 1HVVA 1P84H 1H89A 4DR3O 2AXTZ 4JI2B 4YTPC 3S1KA 5CCHC 3ZHTA 3L35A 1ZL8B 4LC1A 4JI2O 3A3YB 3QTCA 1FXVA 1FS0G 4X1IB 3M8AA 4LP8A 3S9OA 4I9WA 2ADQB 2E42A 4GKKB 1OW6A 4LF4B 3O8ZA 4AQYO 4RKUJ 4B3RO 3Q5RA 2DYSB 1QR9A 2YIBD 3AK3A 2B9BA 1L4AB 4DUZB 2BCCD 1K04A 2XNDG 4DUZO 1YJNV 3N2GA 1ZRTE 3DGEA 2XOKG 1KORA 1IFJA 1XEQA 4C7NA 4FIPC 4NXMO 1L0LK 2FKXA 2KUBA 2POHA 4U3JB 1X9VA 5IJ9B 2YICA 3IFXA 3APOA 5E1AC 1SQXJ 3D3QA 4I7ZC 4I55A 5BR8O 3H1KG 1USEA 3H1HJ 1HR0B 4F6RA 4WB4A 1M9NA 3B5NC 2BCCE 4EFEA 3V2NA 1NJIW 2OTLV 5BVZA 1K9MW 4U3FG 4O4HA 1YYCA 2B87B 2R3SA 3CXHF 3OR6C 3L74E 2EJRA 4JQ0D 1K8AW 1Q43A 4YIOA 1NH2D 2Z5UA 3JSLA 1SQXG 2N1TB 3OEEG 3RK2D 3WU2H 3CCMV 4LF4O 3TGUE 3I55V 3K5MA 5GTHZ 4O2AA 5DJTB 2AXCA 2BEQD 1BQZA 3RYHB 2QWPB 1M90Q 1KB9H 1Q86Q 2WT7B 1BS3A 2HP8A 3GVMA 4X1YB 1N33O 1EDLA 1IURA 1PPJE 1EDIA 3IGAC 1JFFA 2XHBA 4X66O 2PTMA 4J7ZA 5B3SB 3LW5H 2YUAA 2Z5HA 1OVRA 3OFNG 3DSQA 4YIPA 5AVUB 2WWWA 2O01J 1F4NA 2CUGA 3G9RA 2WPRA 3MZWB 3ITKA 5B5EH 3E8HA 3H1IG 1QL2A 1EN4A 1H8HG 1M57C 4PA9A 4FMTA 1N73A 2H3OA 1JJ2U 3M99B 3Q5PA 3P8CD 1R8EA 2XAGA 1GRJA 2YIUB 5CBGA 1R5SA 1P49A 3BA9A 2Y0CA 2EILC 4P9PA 1PPJH 1NVOA 5CN0A 2ZKOA 1JTHA 3EQ2A 4UVCA 4P2ZA 1NI8A 4LF9O 5J2UB 1RM1B 1H2LA 3SJCC 1EDKA 2P10A 2ZE8A 4K0KB 2VRSA 1VF5B 1GL2D 2E76D 5CMZA 4PD4D 2GV9A 1JY2O 3BCCE 5A2QN 2OYQA 3KZIH 1QR8A 3L72D 1KILC 1FZCA 2ZJSE 4RJTA 3ABMB 2Q9LA 1PNLA 4TOIA 1N32O 3UCSC 4W4LA 4A5UB 2G3AA 3CWBH 3CWBJ 1E79G 4CH5A 2GTSA 1S77D 1FE6A 5EBMC 2AHYA 1SQPE 2V4DA 1F7YA 2DMXA 2E5LO 2Q5ZA 1KECA 1KILD 3SWFA 4B3RB 1K73Q 2LQTA 5HFMA 4ZIBA 5LOVA 4Y99B 5E79H 4EB6B 2P1JA 4I1LA 3I5CA 3CMAP 2Y0PA 5APYA 4FLZA 2GM4A 4OVNF 2G8YA 4DR4B 4Z1MH 4HBNA 2FTKA 2DYRC 3H1IJ 1NTKG 1G6UA 5LYJA 2LJ2A 4DJGA 4RO0A 2IW5A 1BSHA 4MVMA 3Q1MA 1FXHA 4AI8A 3VQXA 3FXDA 1FKAO 3GG2A 4UV8A 1GAXA 3JAKA 1N36B 2C0WA 5KHJA 5KAIZ 1BSNA 1NVPD 2KZIA 3IN6A 3VOUA 1NTMG 1LWUC 5BU8B 2D2CD 3L75J 2WLLB 3L73J 2ZT9C 2B1GA 3L72E 1LTJC 2QG4A 5KLVH 3O6QA 1PPJG 4EOTA 1OXZA 4DRXB 2M6YA 4FJCC 3F5HA 3HPLC 3RYCA 1XUQA 1B3QA 1SFCC 4OWFA 1URFA 3FYEB 3WUUA 1FXKC 3N2KB 4I6MC 4DV5O 4DR7B 4RESB 5CBOA 2P2UA 2L5GB 2LW7A 1USDA 2QJ1A 3OTOB 1N34B 1U7JA 1JMMA 3U1CA 1RE3C 2PP6A 1IFDA 2QJKB 1TA8A 3LSQA 1SFCA 2ZIOA 4WFFA 3CCVP 2BOCC 3CS5A 4PHZA 2FYUG 3KQGA 1AILA 3JD4A 2I8DA 2A3QA 2C9NY 1J1EB 4UB8E 3A5TA 1VQOV 2KYVA 3EHBB 3AEAC 1U7MA 2HFEC 4IHJB 2PGGA 1XMOO 5AVXB 3EXAA 1DLBA 2Z4EA 4JI6B 2UXCO 4NPDA 4JAUA 1J95A 4DR2O 3BCCH 1GO3F 4LR3A 3L72H 4LBEC 3VQYA 4R4MA 5APUA 1AJPA 1X79B 2YXRB 4OGQB 1SQVJ 4K35A 3K5NA 3V2QA 1OCZC 1DTOA 2OARA 1V54B 4R7CA 2ZR3A 2AEJA 2ODMA 4JI7O 3CX5I 4I9QA 3FB8C 1Q90D 4UCSA 2HHHB 4UB6E 1JMKC 2ZCEA 3F7VC 1CI6B 3H1KH 3PLNA 4QNHB 4PDMA 2WA3A 1IVSA 2EIMB 2CPBA 3USSA 5IWAO 3H9VA 1DEEG 3L73E 4HNAB 3SWKA 2N9BA 3GHGC 5AVTB 4OPHA 4XE5B 3AE7C 1LGHB 4RQEA 3KXDA 3VQVA 3RVZA 1AI6A 5AW1B 1TUBA 3RL0B 3BAAA 5E79Z 3QO5A 5JJJB 3SPGA 4HNAA 2EILB 3H1KD 3G67A 1NH2B 1XDCA 2LFSA 1UFIA 3P8CE 5EZYB 3K9SA 4F4LA 2QE7G 2GTAA 2UUCB 4P9OA 4JI5B 2IFMA 1VEWA 3SYQA 2YKOA 3SWYA 3ZMTA 4H0LC 2OTKE 3RYFB 2GUZB 2FYZA 3LIDA 4PJ0E 2HLDG 1H2KA 1M8OB 4AILC 2HJDA 3U10A 3B5ND 2WPDG 5K1PA 4JZ2A 4BRYA 3A2FA 1RY3A 1SQPG 2Q0AA 5EBWC 2OT5A 3JCUH 2JEUA 1KKCA 4TV8A 3VMXA 1SKVA 1IBMB 3D6ZA 3ETQA 3ZRWB 5GONA 5KLVE 1WA8A 3ZJZA 1L4AC 3ZRXA 5AW5B 4WFAV 2OTLP 2LP7A 1G2CB 3U0ZA 1FOSE 4RUFA 3CL3D 4D7TA 1KQSO 3M9BA 3DC6A 3VP9A 1Y9BA 1W2BU 5LP6A 4X1KB 1HTLC 1S5LZ 2I1KA 3UM7A 4RAIA 4IIJB 2V7QG 4YPCA 3T4ZA 4WY4D 3HKEB 2BTQB 5FLXN 1ROPA 1S3JA 4QE7A 2DQ3A 2OYHB 2QWQB 3K04A 1IJDB 3AEIA 1DX7A 3L75H 4WFGA 2YIUC 1SFCD 1GN2A 1WP7A 3MHHC 1QLEB 1D2DA 1NU1H 2AHZA 2JIZG 5H2FE 1ZL8A 4KFMA 4MW3A 4B3TB 1S4XA 1AQ5A 3R66A 4JF3A 4B7KA 1JOYA 3JYCA 3NTNA 4PD4I 5BXZA 4IFDK 1RFYA 3H1KJ 2E3CA 2HG5C 3FKSG 3OMNB 4MSWC 3JATB 3BRVB 3N7NA 5B66Z 5TJHA 1G1XB 4DO2A 3E1RA 1LP1B 1XMQB 1M1JA 4JYCA 3WB1A 1HGVA 3ASNC 1JJOA 3VMYA 2QGNA 3CCSV 2WT7A 1MZFA 1BCCD 3IFMA 3F89A 5GTIE 1Q2NA 1SQQD 4W80A 2PY5A 1RQUA 1NU1G 3JALA 5DECA 1PGPA 3B77A 2CK3G 1FJGO 2E75D 1LT9C 3KKYA 2IYPA 4B3SO 2Q9IA 3FYIB 3JD2A 2Q67A 1HUCA 1FAVA 5FL7G 2W6IG 3MUDC 4DV2B 1LWUA 1UPGA 2YMKA 5LHHA 4JI3O 5LHGA 4JTDB 4D7SA 3A7OA 2UXBB 4X64O 3IAOA 2CTWA 2DJVA 4ABMA 4J7JA 2Y48A 3S3XA 2AEMA 1VQ6V 1GN3A 4FFBB 4UCRA 4DV3B 3V2PA 3D6YA 1FZCB 1IX9A 1AVMA 1NZ6A 4GIFA 4LLHA 1T3JA 2JS3A 3Q3DA 2HEPA 1ZAUA 1H2SB 1ZN5A 1BGYG 2NPSC 1W59A 3JD1A 2A06D 4DR1O 3WUTA 1Q81W 5IE9A 3S4RA 2MK3A 1FBMA 3U1AA 1BE3E 5LXTA 3JARA 3RWRD 1IBKB 1OCOB 1P84F 2O3JA 1AP6A 2OTJP 3J81N 2RQ6A 3AEFC 1T8ZA 1WPBA 1JA8A 2RDCA 3TDKA 3CPWU 3CSXA 3LDCA 2E75C 2D3OW 4JI4O 2KOGA 1M1JB 1NKDA 1FXKB 1Q3EA 3WG7C 1HNZO 1TVKA 4NXNO 3JATA 3AE1C 3HKDA 1IFNA 2N1TD 1TAEA 4NXNB 3Q2YA 4OGQD 5KLVJ 3T4DA 2K37A 1FFTB 5L3DA 2B1IA 4YJ3B 2Q7CA 3K57A 4K8XA 2KG7B 4JV5O 1WJZA 1N7SB 1RHZB 1Y67A 3ZHSA 1NTZE 2ARHA 1NTKJ 4BIOA 1BCCJ 1Q7YQ 2YXYA 1TGOA 3N27A 1X8YA 2FFDA 4EEQA 2Y0IA 2PYLA 5CA1A 3JCUE 4H13C 4CPGA 4O9BA 1J1EC 1VF6C 2ZE6A 1KILA 1NAFA 5CCHD 2WMMA 4GX5A 3HD7C 5AW3B 2RH0A 3H1LE 3C8VA 3ASOC 3AE9C 2ZNJA 1QQCA 2N9YB 3GF3A 2QIWA 1H0TA 5CB4A 5CA1B 2BCCJ 4UCVA 4RQFA 2YI9A 3L70H 2JVDA 4D6TE 5KA5A 1Q6HA 3H1IH 1F23A 1NQTA 4PELA 1H2MA 2IBZI 1MMMA 5AG2A 4X62O 5KAIE 2QKSA 1WNSA 4WY4C 4O4LA 1JR9A 1IBLO 1J1DC 4YXDC 3LSUA 1SA0B 1K5SA 4IL6H 1S76D 1RPOA 3ETGA 1NTMJ 4C46A 4CC5A 2FYUJ 4ZBMA 2OIGA 1HNWO 2ZXEB 1HNXO 2UU9O 2FYUH 1CSBA 2YMYA 3E22B 3L71H 5IDJA 2E76B 1GL2B 1WMKA 1EN5A 3CYOA 2JJLA 3G71V 3CCLP 1G1JA 1SQVE 2KB7P 1CW5A 3RL0C 3MDSA 2MKVA 3QO8A 4PA7A 3AG2C 3OUFA 1SQXH 3W7XA 5APWA 1RSOA 4JYBA 2Q4PA 2NZ2A 1KP3A 4Q6GA 2X6AA 3H32A 1L0NJ 2M0BA 2VQEO 3SJAC 5F2VO 4TQDA 1XOUA 1OFCX 4AHCA 1NTZJ 1RSOB 3OTFA 4HKZH 4U3FH 2PAJA 3PP5A 5CMUA 2WLLA 5BMVB 3J7AU 1F51A 1GN4A 3P32A 2V7QH 5GTIH 2EINB 1VARA 5LL6Y 2WLIB 3OAAG 1YVWA 4DR5O 2Z0AA 1KP2A 1OVUA 1SQVK 2FYNC 5B1OA 4WBNA 1GU5A 2XV5A 1YCIA 2W6JG 4I0XB 1MSWD 1AI7A 3G80A 1RQVA 3WMM0 1ZTEA 1SFCB 2ZIMA 1QLED 1AI5A 3ZN0A 3HKEA 4UB6Z 1EZVI 3GW6A 1PP9G 2V4HA 2QJYB 3JSNA 1K4DC 1QEXA 1BQ0A 3ZHUA 3E35A 5DM6V 3OUSA 3BY6A 5EC1C 1OVVA 1VQOP 2ZNIA 3MHSC 3FWLA 4EDFA 1S5LX 4FVMA 2IM9A 2RMKB 2Y69B 3JAMN 1NYHA 4LF6O 1JNMA 5EIBC 3AE8C 2ZFCA 2ETNA 4RUEA 4QIWF 1QBZA 4RWUA 1VQ4V 1MV8A 4IFMA 1FJKA 4ZMDA 3I55P 1YJWV 2W27A 1I0HA 5IY5C 3KZIZ 1HBWA 1SC5B 1XL6A 4UB8H 1R6KA 1TUEB 1R1BA 2FL4A 2H8PD 4FK5C 1KB9I 1K97A 3QF7A 2EIKC 3EWKA 2KG7A 3GB7C 3RN4A 3UT5A 1XNQO 4DV1B 2UXCB 3FWNA 1KB9D 4OH8B 1AFOA 4MS2A 2IX7C 3KCXA 4QPJA 2Y4UA 2Y0DA 2YO2A 1HJBA 1L0LE 3AG7A 4LWSA 1GH6A 3CD6V 1VQLP 1GZLA 1OV9A 3O6QB 2Z5IA 4LWSB 1CZQA 4JI7B 1GW4A 3AK1A 4LFBB 5B5EZ 4TV9B 2E5LB 1YJNP 3H1HD 3HB3B 1A02F 3RK2C 3NXSA 2OYHC 1P84D 1QL1A 1LT9B 4FM1A 1IK7A 5GTIZ 3JAWB 1KQFB 1YXBA 3BEHA 1QLEC 5KAFZ 2V7QJ 1XNRB 1P84I 1URQD 2N04A 2R72A 2EIJC 3ZBHA 2A45H 3WB0A 1WA8B 2IU0A 1KYOH 3R4YA 1BHAA 5KLIB 2A0LA 5GTHH 1ZR4A 1YJ9V 1K4CC 3M9HA 4B3MO 4GODA 4FLYA 1U57A 2K88A 3UKMA 3HE4B 1KZUB 1NU1D 2KB1A 4O2BB 3G4SP 1AA0A 4O4IA 3B2EE 3M0AA 3JALB 5J9PC 4R8CA 1OZHA 3CX5D 4F6EA 1ZX3A 4ZHQB 2QJPB 1Z2GA 4O2BA 3W7TA 1MABG 3MD0A 1SQQJ 2K9JA 3TYYA 4H44C 1W2BO 1GTOA 1JX9A 1WAZA 2ATKC 4WCEV 3HD7A 1O9HA 5APVA 1H38A 4B08A 2A06H 4DCKA 5B1NA 4X8AA 4DR6B 1EZJA 4JI1B 3UO2A 1ZXGA 3DTUB 2O01N 2F93B 2B5UA 3O65A 1SQVH 2CTQA 3L9DA 1GK4A 1VQ5P 1NTMH 3PRJA 4ZOLB 1EXIA 5LHIA 4PV1C 2FBWC 1M1KQ 1RE4C 1Y4MA 2E75B 1GKFA 4DUYB 2AXTE 4MVZA 2IU3A 3JASB 1SQBJ 1XQ8A 5B1BB 3ABUA 3K3WA 1YITP 5L3EA 3WG7B 3JCZA 4PD4E 5CJ0A 2OCCB 4GX2A 1AVYA 4CC6A 2UWJE 3V4QA 4HB1A 4DV7O 4IOIH 5JVDA 3IC7A 2XDJA 4OX9B 4CH3A 2QTSA 3C90A 1F4MA 1ZLLA 1NTMD 1KTMA 3CXHH 5JQGB 3IR9A 4PD4F 2NRGA 2NPSA 2WSEH 2Y9YA 4Z1MG 5L3CA 1W2EA 3RK3E 4DV3O 1DEBA 3HUSB 3AG3C 1SQPH 2B89A 3H1LH 3UT5B 3RYIB 2YIAA 1Y6XA 1NTKH 2IBZE 1WLEA 4B3MB 1Q82W 1WT6A 1E1RG 3KG2A 4GKJO 1HF9A 1M56B 4DR3B 1XBLA 1PV3A 5AW4B 1WRGA 1HNWB 3E7KA 1PP9H 4I0XA 1B6QA 1M93A 2QA4P 2W6AA 2IFNA 3A0HH 3RGUA 3H1LJ 5AW2B 1JCCA 2WLNA 3CEIA 2WLIA 4AQYB 1G4YB 3SGIA 1NR7A 2CTPA 3OW2U 2ZXXA 3U11A 1GM7A 4K8ZA 3B09A 1MA1A 4WFBV 2IJKA 1NTKD 4NPEA 1FD9A 1IFPA 5AW9B 1N86A 3WU2E 2HVKC 1XILA 2L6LA 3K5BA 4O4HB 3CD6P 1S5LE 4HAMA 4CS2A 2Q7GA 3CRRA 3H32B 5K5GB 2Q73A 2JEXA 5LA6A 1LT1A 2UUAO 1N7SD 3OJAB 3CMEV 4UCOA 1R6NA 5AVZB 2DWDC 4YJ2B 1PGOA 3BCCJ 1TU3F 1OCRC 4HZ3A 5BMVA 1X0TA 4LH6A 1AR5A 1LUVA 5KX5B 1S2EA 3NFQA 2E43A 2LXCB 3CCRV 4IT5A 2XAJA 1L0ND 1VP7A 1VQPP 3SPIA 1H2GA 2AEFA 4HH2A 1W0JG 2Q7HA 3JD0A 2YKPA 2D2CC 2Q3EA 5KAFH 2ZYAA 2UUBB 3CWBE 2IH3C 1OCOC 3L70D 3U59A 1PFIA 1GL2C 2E76C 3IAYA 3CRQA 1BE3D 2JWAA 3A8TA 5KHHA 1M57B 2DYSC 1LTJB 2C9LY 4WFEA 1KC8W 1PD3A 1N73B 2N1TA 2ZVOB 2QKCA 5FNVA 2CH7B 4BAYA 2GA1A 2JJ2G 2XKMA 2ZE7A 4D6TJ 1RF1C 3KDPB 5LGUA 3HR0A 3M7MX 4C7UA 4CS3A 4G28B 4WBAA 1BL8A 2XNXA 2EIJB 4BIUA 1AJNA 1HNZB 2IYOA 3G3ZA 5LP6B 4JI4B 1RE4A 4TSFG 3VMAA 1DK1A 2HJFC 1GDTA 1SQQH 5H6QA 5CBNA 4O4LB 1VF5D 5C8YA 1T2KC 5BR8B 5IYCO 2E5YA 5L3GA 1EDJA 2RCVA 1IBKO 1ZR2A 2QTOA 5B5EE 2H43A 2LO1A 1XREA 5B1AB 1EC5A 1IZ3A 3T1HO 2E74D 5BU5A 3CCUP 4MN4C 5JH7B 2KZJA 4N23A 3QWOC 5APTA 4MVRA 1PP9J 1URQC 1HGZA 1S5JA 4LFCO 2HR3A 3RYCB 2IPPA 1AI4A 4N6JA 1IBLB 1NTKK 3C1LA 1YEWA 4DV6B 2WAMA 1SQBH 3JSVC 4AYCA 3ZCCA 3L75E 1N7LA 4Y99C 2Q6AA 1K05A 4I50B 3BATA 3S3WA 5APSA 4JPZB 2NN4A 1SERA 1L2PA 2QM7A 3LIEA 3G71P 5KHKA 2UUBO 1OCCB 5EZYA 3CCEV 4X66B 2F66C 4MVUA 1VQNV 3FD9A 1M7LA 1YTZT 4ZKPA 1Z5VA 4FZ1A 1LTAC 3OT7A 5ITZB 4O4JA 2W90A 4MT8A 3WFVA 2FXOA 3P8MC 5CCHA 1K3EA 3M0DC 1KU9A 5J2TB 1DGSA 4ZOLA 3N4XA 4QPKA 1U96A 2IZ1A 2QRXA 4BWAA 4JPRA 4I4TA 3CC7V 2UXXA 4X89A 1IXBA 4J11A 3L74D 3I56P 5LXTB 4MTOA 3ZMSA 1RM1C 2GHYA 4KXRA 1BHBA 5LGTA 1PM9A 1G1IA 2OYHA 1COWG 2X6CA 1SRYA 4YXWH 5D5QA 4DOJA 2K9JB 2DW3A 1FZFA 4L73A 3D36C 3BA8A 4IL6X 4DT0A 3L73H 3D36A 1P7BA 2W0XA 1KN7A 1VQMP 3HE4A 1UIIA 2CK3H 4L76A 2OWOA 2ADPA 1LJ2A 1E1QG 2WZ7A 2PYJA 2O01H 4GT1A 4C7NB 2CAZC 2QA4V 1UIXA 4LFBO 4CZZA 3ABKB 1Q6UA 1FXKA 4U3FD 1SS1A 1CEZA 1PV0A 4MVOA 3JAWA 3TXQA 4LF6B 2ZXWC 1SQPK 4H37A 4IL6Z 1X22A 1HWYA 3VQWA 5KMGA 2WSSH 3CWBD 1SLQA 4OPAA 3HTKB 1SQQE 1VF5C 3PHLA 2Y0EA 4NXMB 2LW1A 3IC9A 1GN6A 3AG4B 3QH9A 3E8GA 3A0BE 5J2TA 3APQA 1FC2C 3FX7A 3L71D 3V4WA 1NTZH 1E5WA 4LFAB 2RNBA 1L0LG 3PN1A 3ABLB 5AW7B 5L3BA 1BDDA 1GK9A 1D5AA 4JBZA 4BW9A 3JASA 4LF7O 2R9AA 4MVSA 1BMFG 1WB7A 2FFDC 3TGUD 2HFED 5C8YB 3D71A 1KD1W 1EBOA 1Y76A 2XAFA 1XTGB 3GHGB 4Z2WA 1FS0E 3W7WA 2J59M 2K1EA 3RT3C 3QG5A 2M5AB 1K33A 4PDLA 3SFDC 4PV1B 4JI5O 3GF7A 1JY3N 3LNMB 1SQQK 1QVGO 2EULA 2BTQA 2EX3A 5KA6A 3C9IA 4B3SB 3T1YO 2DE0X 5LYJB 1FDOA 4HJGH 1G8MA 3ML0A 3FFQA 1YHQV 2VWKA 2X6BA 4UB6H 2ITCC 4L8JA 2R32A 1D5NA 3B8EB 4DR2B 4XDJA 1I94B 1N2DC 1M1KW 1DH3A 2Q7EA 3RYFA 4CH6A 2YKQA 1OMIA 2YNYA 4GX0A 2OGUA 4PJ0Z 3Q4HA 1QGKB 2OYIB 1BGYD 1T2KD 1SP4A 1X59A 5C93A 1QLNA 1Y74B 2JGDA 2QDOA 3ZRSA 3FGAD 2YC0A 3HD7D 5KLVD 2ITDC 1JQ0A 3ZRWA 1MSDA 4F6RB 1KBHA 4WY4A 5CCGD 3L74G 5EBLC 2H88C 1SQBG 2CDYA 3RK3D 5FPRA 4B3TO 3CCMP 1OCRB 1OCZB 3IJ4A 4U3JA 2DWEC 2WSCH 3TGUG 2R9IA 3MUDA 1K34A 2W6JH 3W7SA 1EN6A 2CGOA 1VQMV 1LTBC 2GUZA 1KB9F 3GWKC 1U97A 4DW0A 1VF6A 4GCZA 3L71J 4I2LC 3CC2P 5KKZC 3OE7G 1JY3P 2EIMC 1H8AA 1VDFA 3K08A 4DR5B 1URQA 1HWTC 4DUYO 4ZKUA 4DK0A 1AROP 3AE3C 2Q3IA 2K9PA 5DEDA 2OYOA 3HTKA 1VQ9V 2YXQB 3CLQA 3UIAA 3RFRA 1XNQB 1YI2V 3L70J 3T2MA 4DYLA 1FJGB 2A06G 4LH7A 1G2CA 2A7WA 2GBOA 5EK0A 2NPSD 3A0BH 4TWKA 1FAFA 2VWJA 2OIEA 2WTYA 1GK6A 2G38A 5KJ7A 3CC4V 1YJWP 3WU2Z 3T97A 1K5QA 2KLVA 1LUWA 1S9KD 1N32B 3QNEA 4ZI7A 3AG3B 4GKJB 2HLOA 2QWRB 3EFGA 4MTFA 4X88A 2QR4A 3RYIA 4UUJC 2ZAEB 2MJZA 5AVSB 4CBCA 3E8FA 1BE3J 4C7RA 3ZRVA 1ZWIC 4QGPA 1URQB 4IHJA 3L4FA 4DR1B 1FZAA 2N1TC 3SPHA 4LF5B 1Y66A 5E79E 3E1IA 2N74A 4E4EA 2VQFB 1RP3B 2EBOA 4H44D 1ZP0C 3CCUV 2NNUA 5JJNB 1BE3G 1M57D 3L73G 1NO4A 3K79A 5LP6C 3KHUA 3L71E 1FDMA 1HR0O 1OCCC 1AP5A 1PNMA 2P4KA 4TLFA 2KXPB 4X20B 5B3SC 2YSUB 2A06E 3H1JJ 3SSUA 4TV9A 5CA3A 4XDKA 4JI8B 1M56D 3A0HZ 1VQ7P 5H5NA 2ZDIC 1JMBA 5IYZB 1NTKE 1BCCE 2RKLA 2V1DA 4DZOA 4DR6O 3ZEDA 2O1KA 4X65O 2KQXA 1KD1Q 4W7YA 1N34O 2VQEB 1I08A 1PP9D 1BZKA 2XT9A 4IGGA 2R5DA 1YTFD 2IJIA 1SESA 5AVVB 1JY3O 2ZYGA 3JARB 1KILE 2BE3A 3ZMZA 4EYYQ 1FDIA 4B7EA 3P7KA 4KT0J 2UXDO 2Q6QA 4XFJA 1SQXK 4ZKIA 5IJ0B 4DV0O 1Y47A 1BGYE 1SQXD 3E22A 2H7HA 3OD4A 3T97B 2HPCA 1SZTA 4IYIA 2KSEA 3MTUE 3CCVV 2KSJA 4L87A 1VQPV 2R44A 4J41A 1M1JC 2IH1C 2BOBC 2VRZA 2JK5C 4FM2A 3ABVC 3LDDA 3RYHA 3G6EV 2YDEA 2QE7H 5FPOA 1V9PA 2WLJA 5A9GA 2X7RB 4PD4H 3FAVB 1VQKP 1QX8A 1VQ8V 1L4AD 3H6PA 5AVYB 2F95B 4OX9O 2JEEA 3VTPC 1BCCG 3K9AA 3K0DA 5HFLA 1WN7A 2OYIC 2M3EA 3NMDA 1DF5A 3OGIB 4NVPA 5AVQB 3AEDC 4FFKA 3DC5A 1ZW0A 2BCCG 2JP3A 1P7GA 1CPYA 5BY1A 1IDSA 2HG5D 4JF7A 1N33B 3IF4A 4X64B 1L0LD 4G2KA 5KLVK 3L37A 1P84E 3CC2V 1I5YA 4JI3B 3CJHB 5B66H 1LNQA 1PKXA 4AUWA 2PUSA 2EJ7A 4PDVA 2ZM6O 3I5DA 4QJFB 4N78D 5H6RA 3TK1A 3ABLC 1JCHA 1RE3A 3N2GB 3K06A 5KX5A 4FZ0A 4FLXA 2JO1A 1S9KE 5KKZB 2AGAA 4FM0A 2EIKB 3T1HB 5AW6B 2Q69A 3L72G 2PI5A 1CP9A 1Q7YW 3BRTB 5H9CA 1JTHB 2NR5A 1VMGA 2H94A 3L72J 2OTJV 4O2AB 3AE5C 5LA6B 5EC2C 4GUNA 2ZXWB 1R6TA 3L71G 2YEVB 5CB4B 2HKOA 2WVRA 1YBKA 3CXHI 2ZYDA 3ICXA 2A79B 5JH7A 2H8PC 4IIJA 3AG4C 1MG1A 2EZOA 1XNRO 2PGDA 1YHQP 2ILMA 1PL4A 1PL5A 3TSIA 1GMGA 5D5PA 2M5AA 1SQXE 1XTCC 1R73A 2ZDIA 1SQBD 1V55C 1RF1A 2JS5A 2W83C 1IK9A 1RH5B 2RMZA 3R2PA 4H13B 3H25A 2WA4A 4BR6A 4YY3B 4UXNA 3TJTA 1FOSF 5BZBA 2EINC 3FB6C 3TGUJ 2AW9A 2IJHA 1ENVA 4XBFA 1LWUB 4UB8Z 3PJSK 4LNUB 4Y28J 2M8RA 2FB5A 3K0GA 1ORQC 1VQ5V 2GUVA 1MKMA 1L0NG 1SETA 1S5HC 2WSFJ 1YIJP 2Y4TA 3F7YC 1K92A 2YEVA 2XNDH 3VYIA 4LF8O 4JV5B 3H1HG 2JRIA 2JKVA 5TISH 2LKMA 2XAHA 3CCJP 1JO5A 1L0LJ 1KYOI 3L36A 4NKGB 3CHXA 1K8AQ 4YJ3A 4PA4A 2QSIA 5JCOA 1PPJD 3ABKC 4TT3H 2P7JA 3ZN1A 1N7SC 2E74B 4JASA 3K5OA 1I7FA 2P22C 4UVBA 2J58A 2KS1B 4ASVA 1NTZD 2QJKC 3W67A 1JFFB 1L4AA 4PA6A 4G27B 4N21A 4KJMA 4YY3O 3D70A 4EIJA 1SA0A 2F1MA 3B4SA 5B1BC 3RBZA 3TXSA 3AG1C 1A02J 3B8NA 4U3FJ 2ZE5A 4ZHQA 1ZMEC 2ZR2A 4H33A 1BGYH 3ABTA 3CRAA 4OGQC 1AVOA 2FMLA 4N78E 2HYNA 2JJ1G 3MGNA 1L0NH 2P67A 2L91A 3B40A 3F5TA 2JGUA 3ZHQA 5LMNO 2IBZD 3HUSC 4D6TG 3SYAA 1VQ9P 3BCCD 1GU4A 1BDCA 4WBNB 2JDIG 3D8CA 1HP8A 2KNCA 3X2QC 1BE3H 1WP8A 1IC2A 2C2AA 2P4VA 1Y76B 4KL1A 2GUSA 3GHGA 2FYNB 3SJQC 4WWIA 2YXLA 3E8BA 3OM3B 4LF7B 4GKGA 1THZA 1A32A 4U7NA 4KHPO 3W68A 1N36O 1OW8A 1VQ8P 1T3UA 1QU7A 2Q0OC 2QWNB 1IBMO 3M06A 5EYPA 3G6EP 2F43G 4W7ZA 3LDEA 3J80N 1VQ4P 3BABA 1VQNP 2K9YA 1SQBE 3CCEP 3BHPA 1KYOE 3CE2A 3P3NA 3A2AA 4LGDE 1YF2A 5LMNB 1QVFU 2IJJA 3ZMVA 4NTYA 4PDRA 3BPZA 3L70E 4GZRB 4JI0B 4YHHO 2RJZA 4GOEA 2P5OA 2LGQA 1FZEA 3OTOO 1NWQA 3L70G 1FJPA 4X1KA 3FB5C 3CCJV 5AW0B 3T1YB 3RK3C 4X20A 3SPJA 1TUBB 3OGCC 2PI4A 4U7OA 3CP1A 3BFRA 1RPRA 3OA7A 3GLMA 2WLKA 4X1YA 5GTHE 3EVKA 4J10A 1N0NA 3B71A 1SZXA 1V54C 2JDIH 1HDJA 3WUVA 1ZSPA 1NHLA 3DXRB 2F23A 4CS4A 1AV1A 4XA4A 3P30A 4X9QA 2M3BA 1L1FA 1AJQA 3MHVA 1IO4A 5L3FA 3SR2C 2FXMA 2AZ2A 2OCHA 3GWOA 3HKBA 1QHTA 4XDLA 1NVPB 2KI7B 2O57A 3PH0A 5IY5B 1N4CA 3ETEA 3UQ8A 2Y9ZA 2WLHA 3K5LA 3ETDA 1ZOYC 1R3IC 1V55B 1RF1B 1FFXA 1AR4A 1SVFA 2MW2B 2UXNA 4ASWA 5KLIC 1GW3A 1RF0C 4WF9V 4DK1A 1NR1A 1EQ7A 1M56C 4TT3G 3H1LG 2CTRA 5EFWB 1R3KC 5IJ0A 4DV4B 1WPXA 1YQ3C 1GM9A 2IBZG 1XL4A 4D6TD 3ZS8C 4R4LA 3CC4P 3H1HH 5CBHA 2L35A 2B9ZA 5DN6G 3C3TA 3PTZA 3D3IA 2VS0A 1PGQA 5CCGA 5KTBA 4A7PA 2A45I 2NPSB 1JOCA 1E79H 3CWBG 1PNKA 2QEXV 1YI2P 1YSCA 1IFIA 2PRRA 2CPSA 3KCYA 1KYOD 5KAFE 4MTGA 1BGYJ 3ZHVA 4LNUA 4GLXA 1SS3A 4N3YB 4AQRD 5EIBD 1NH4A 3CX5H 3CXHD 5LMUO 1S72P 1SQVG 1NJIQ 1JY2N 2R9RB 1S72V 3B5NA 2QKAA 2KSDA 4JTCB 2P58A 4BIZA 2PF4E 4UCUA 3W7UA 1Q5OA 3CXCU 2WSCJ 4H0LD 4NYKA 3SYPA 3AG1B 2YO3A 4BXLA 2NLJC 1Q6IA 1KFMA 5H2FH 1PL0A 1J5EB 2QEXP 1R3JC 2BEZF 4L74A 3SDLA 4CH4A 1S0VA 3HE5A 4GOFA 4H44B 3Q4HB 4DV7B 2W8ZA 4R6ZA 4B86A 2P6JA 2ZD9A 3H1JD 1L0LH 1KFNA 3RW0A 2ZM6B 2CE4A 1X4TA 3VOPA 2W0FC 1S1CX 2WPSA 3RVYA 1GM8A 2WLMA 4P30A 2PFXA 5TISE 2D2CB 3JD3A 1QCEA 5IYDO 3THOA 2KIKA 1NBMG 3X2QB 3CRMA 1XMQO 3CMAV 4JZGA 1AB3A 1EZVE 5CBFA 3TETA 1T5EA 4WVZA 1YZBA 4UFZA 4PV1D 1NU1E 4JI1O 1N73C 3ASNB 2J5UA 1NS1A 1EZVG 4Q20A 1PIXA 4JYYA 1R5LA 5GONB 1XI1A 3AEEC 2YIDA 3OMAB 2A45G 1S5LH 1NKZB 3M9QA 1PP9E 4IFFA 3KPEA 3L75G 2Q8VA 2QVAA 4OXSA 4QMAA 2KK7A 1HH0A 4BRYB 2FYUE 4GKKO
chains in the Genus database with same CATH topology
2JP3A 2E74C 3D70A 3LW5J 1KMIZ 1K04A 2E74D 1NGMB 1HF9A 4GDOA 4I7ZB 1ZOYC 2WPVB 1ZRTE 3AE7C 1PV3A 4YXDC 1KORA 1ZMEC 1RQUA 5KLIC 4OGQC 2E75D 2G8YA 4Z1MH 3AECC 3AE6C 4I7ZC 3D71A 4H0LB 2E76B 1K05A 1WMKA 1GMJA 2JO1A 3SFDC 4PV1B 1YQ3C 2YMKA 2WSEJ 3Q1MA 3GF7A 4R4LA 1IK7A 2MKVA 3Q5SA 1KQFB 3IAOA 1KQGB 2WQYC 2H89C 1HJ0A 4H0LC 4H44D 2OQQA 2ZT9B 1ZP0C 2V7QJ 1FDOA 2NZ2A 3AE5C 3D6YA 3R4YA 1OW8A 3IN6A 2D2CD 2BEQD 2QJPC 3Q3DA 2ZT9C 2ZT9D 1OMIA 1U57A 1AJYA 3D6ZA 3O6QA 1PL5A 1TU3F 3FGAD 2IDBA 2K9YA 3RL0g 2O01J 1OW7A 2WSCJ 3G9RA 4H0LD 4H44C 5L8RJ 2FYNC 2QJYC 2H88C 3GMAA 1KILE 4IL6X 4H13B 3AEFC 3H25A 1FDIA 1Y9BA 4KT0J 1RQVA 3Q5PA 2E75C 4XFJA 1R8EA 2BEZF 2D2CC 3SFEC 1DD3A 1YQ4C 4Y28J 4H44B 1DD4A 3AEBC 2E76C 1EXJA 1JB0J 3AE1C 3T97B 2FXPA 1MKMA 4H13D 3Q2YA 2WSFJ 4OGQD 1EXIA 4PV1C 5KKZC 2FBWC 1S1CX 4U7JA 2E75B 3GLMA 5M1BA 2D2CB 2YIUC 1UIXA 2P10A 3AEAC 3AE2C 3B71A 3AE4C 1S5LX 3AE3C 1VF5B 2E76D 3ABVC 1NYHA 4R4MA 3AE8C 3AEGC 4PV1D 4OGQB 1VL2A 4H13C 4YTPC 2J5UA 2QSIA 1PIXA 4TT3H 1KTMA 2G3AA 2E74B 3AEEC 1VF5C 1DIPA 1VF5D 3C8VA 3RK3E 3S9OA 3AE9C 1Q90D 1OW6A 2QJKC 3GF3A 2QIWA 3EWKA 4RKUJ 3Q5RA 3AEDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E75 B;  2D2C B;  2YIU C;  3LW5 J;  2K9Y A;  2O01 J;  1S5L X;  4I7Z B;  2ZT9 B;  1VF5 B;  1ZRT E;  2WPV B;  2WSC J;  5L8R J;  2FYN C;  2QJY C;  4IL6 X;  4H13 B;  4OGQ B;  5KLI C;  4KT0 J;  2QSI A;  2E74 B;  2QJP C;  4Y28 J;  4H44 B;  4H0L B;  2E76 B;  3C8V A;  1JB0 J;  1Q90 D;  2QJK C;  2QIW A;  2WSF J;  4PV1 B;  4RKU J;  2WSE J;  5KKZ C; 
#chains in the Genus database with same CATH topology
 3ZHR A;  2KKW A;  1YDX A;  3QVN A;  5CCG C;  3T1C A;  2W6B A;  2RN9 A;  4HYO A;  4I7Z B;  3RBX A;  5CJ4 A;  3CPW O;  3N2K A;  2BCC H;  4MTX A;  4DV4 O;  4IL6 E;  5LMU B;  5AVR B;  1ZLZ A;  4RO2 A;  1JM0 A;  1FPO A;  5B1A C;  3FXE A;  5J2U A;  2UU9 B;  2KLU A;  3A0H E;  1LTI C;  3AEC C;  3JCU Z;  1WB8 A;  3A0B Z;  4FLT A;  1GMJ A;  3RGB A;  3ASO B;  2UXD B;  3RK3 B;  2X0L A;  1L0N E;  1BCC H;  3G6B A;  1FZC C;  3Q5S A;  4DV6 O;  1JEK A;  4ZI7 B;  1QVF O;  3FX0 A;  4LF5 O;  1SQG A;  4LFC B;  2OQQ A;  2CGN A;  1KKD A;  4PJ0 H;  4NB5 A;  4WY4 B;  4X65 B;  3E83 A;  3G4S V;  3A0R A;  2P7T C;  3AK2 A;  4JAA A;  3TNU B;  2Q68 A;  1PZQ A;  5LGN A;  1YJ9 P;  4FPP A;  1B04 A;  4TV8 B;  1NAY A;  2ZT9 D;  3K58 A;  4FLW A;  2CH7 A;  3H1I D;  3L73 D;  5LBQ A;  1IFM A;  3UO3 A;  1LT9 A;  2O1J A;  3LSS A;  1NU1 J;  4JAV A;  2M7W A;  2FY8 A;  1N8R Q;  2IDB A;  4PI2 A;  5JJE B;  2AXT H;  2Q5U A;  3RL0 g;  4DR7 O;  2XZR A;  1LTT C;  2GDS A;  1K73 W;  4ZNC A;  1M4U A;  1ZUQ A;  1OW7 A;  4LF8 B;  2GSM B;  5L8R J;  5JQG A;  5C39 A;  1SF9 A;  2FYU D;  1K9M Q;  3TF5 A;  4KHX A;  1NT2 B;  3STZ C;  4YHH B;  1LP1 A;  1LTG C;  1MUU A;  1YQ4 C;  2XU6 A;  3CME P;  4GYC B;  2HPC B;  4L75 A;  1M5I A;  4R50 A;  1EXJ A;  1LR1 A;  2Y69 C;  1AR1 B;  1VQL V;  2WPQ A;  1SQQ G;  3B5N B;  4GX1 A;  5IJ9 A;  4U7J A;  4EI2 A;  4K0K O;  3CJH A;  5M1B A;  3MIW A;  2ZQM A;  1PGJ A;  3V2R A;  1TVK B;  2KP8 A;  1XHX A;  4KP4 A;  2P90 A;  5KHI A;  3CB2 A;  1GTW A;  2LXB A;  2K1A A;  1MFT A;  1QVG U;  1VL2 A;  1CI6 A;  1QNM A;  3STL C;  3BCC G;  1US6 A;  1D7M A;  1NTZ K;  4ICG A;  2I1J A;  4K3A A;  5IYZ A;  3L74 J;  4KHP B;  4JI6 O;  3TCU A;  1N8R W;  4DR4 O;  5APX A;  1H88 A;  2B88 A;  4O4I B;  2F4V B;  1Q8I A;  2E74 C;  2XAS A;  2SPZ A;  2F4V O;  1L0N K;  5AW8 B;  1NGM B;  3H1H E;  3SPC A;  4DV2 O;  1GL2 A;  2RN0 A;  2WPV B;  1GD2 E;  5DJU B;  3MAQ A;  2BSK B;  3K59 A;  3F5W C;  4W4K A;  3M0D A;  1K7D A;  4LF9 B;  1M90 W;  1Q86 W;  3O9O A;  4WFH A;  5CHX A;  2PZS A;  1OHH G;  1SQP J;  3CCQ P;  1JCD A;  1LTS C;  3C3S A;  3VBB A;  2A9H A;  2WSE J;  3BAS A;  1AQT A;  4NTW A;  2UUA B;  1YIJ V;  3BVH A;  2FYU K;  4PI0 A;  1BSM A;  4MVQ A;  1Y8A A;  3HUS A;  4EKW A;  5KUM A;  3ZDM A;  2H89 C;  1YIT V;  3JC2 2;  1P4R A;  5B66 E;  1JUN A;  3HE5 B;  1W0K G;  4JGS A;  4YXW G;  2QSA A;  4J42 A;  4DW1 A;  4TQF A;  1KIL B;  4Z1V A;  2HHH O;  1LTJ A;  3OR7 C;  1NU1 K;  2QJP C;  2JR8 A;  4D6T H;  4DV1 O;  3TGU H;  1HW7 A;  2QM4 A;  1EFR G;  3QO7 A;  1JPX A;  3B8M A;  4X62 B;  1N7S A;  1ZRT D;  2ITA A;  3P3P A;  3RK2 B;  3L74 H;  3OMI B;  2R70 A;  1NKN A;  4PA3 A;  1Q82 Q;  4QE9 A;  2KS1 A;  2IBZ H;  2K3R A;  4BWN A;  2QJY C;  5JWP A;  2JWD A;  1KYO F;  3CCL V;  4NR1 A;  3GMA A;  1CXZ B;  4JYA B;  5KAI H;  1Y74 A;  1VF7 A;  2YS8 A;  3HD7 B;  2YI8 A;  3SFE C;  1FFX B;  2BAS A;  3H1J E;  4YJ2 A;  3AEB C;  3ZIA G;  2HVJ C;  1EM1 A;  2KNC B;  3CCR P;  3HRN A;  3CX5 E;  1H8E G;  2LFR A;  4H13 D;  4KUM A;  5CA0 A;  2Z3Y A;  2R5B A;  1L8D A;  4J7K A;  5KMG B;  1H0T B;  3ZMU A;  1FZB A;  2XUM A;  3ABM C;  1OWA A;  3SJB C;  3SYC A;  1SQF A;  4DV5 B;  4MW8 A;  4FLV A;  3E2E A;  1J1D B;  4LFA O;  3KZI E;  2B87 A;  4U3F E;  3BRC A;  1R3L C;  1OIP A;  1NTM K;  3AEG C;  3TNU A;  2YIB A;  1MOF A;  4JI0 O;  3H1J H;  3HKC A;  1NTM E;  2FFD B;  3CXH E;  3FAV A;  3DXR A;  1SQP D;  2IZ0 A;  1DIP A;  3BVO A;  3CX5 F;  4NPF X;  3L75 D;  3EFF K;  1JVM A;  5TIS Z;  3ZX6 A;  2N05 A;  3FB7 C;  4NTX A;  3HKC B;  1KB9 E;  3AG2 B;  1HNX B;  1XHZ A;  4O4J B;  4JYA O;  3LW5 J;  1MZE A;  1KMI Z;  3HKB B;  2BSK A;  3OEH G;  4EFB A;  3H1I E;  4IYH A;  2DYR B;  2ZVN B;  4GDO A;  3WB2 A;  1NTZ G;  2VQF O;  5GW7 A;  3E86 A;  2E5T A;  3I56 V;  2OCC C;  3CI9 A;  4FLU A;  2QM8 A;  2WSF H;  3M91 A;  3OAK A;  1KV4 A;  3CC7 P;  2YXH A;  4JTA B;  1MZ9 A;  5FNV B;  4DRX A;  5KJ7 D;  3CRC A;  1VQK V;  4I5S A;  3VMZ A;  4TUY A;  5CA0 B;  1O9G A;  3AE6 C;  4I50 A;  3H1K E;  2XTA A;  4LCU C;  1FZG A;  4H0L B;  3R65 A;  3V5B A;  1EZV H;  4TUY B;  1XMO B;  1MFZ A;  1J2J B;  5JCO C;  2UXB O;  5IWA B;  1T6A A;  4J80 A;  4J9Y B;  5JVD B;  3SYO A;  1KQG B;  3JAK B;  1OZ0 A;  2HOD A;  2WQY C;  1B06 A;  5ITZ A;  1HJ0 A;  3NR7 A;  2ZT9 B;  2WSS G;  5KHG A;  5APQ A;  4BW5 A;  1UJW B;  1I5X A;  2HOD B;  3KYQ A;  2JGD B;  1BT8 A;  1Z56 A;  4FFB A;  2OYI A;  2ZIN A;  1SQV D;  1J5E O;  3VN0 A;  2P06 A;  2AZ0 A;  1AJY A;  4X1I A;  1MNG A;  3LUT B;  3K03 A;  2Q1K A;  1VQ6 P;  2DQ0 A;  4UCT A;  1W5C E;  1EZV D;  2R3C A;  5AVW B;  2EZP A;  3RL0 D;  1YTZ I;  2LR2 A;  5KLV G;  1KUQ A;  2XAQ A;  4EB6 A;  2BTO A;  2DN9 A;  5LOV B;  5IT9 N;  5EYP B;  1VQ7 V;  4J9Z B;  5KUK A;  2QWO B;  1DF4 A;  4JI8 O;  1OX3 A;  1VPC A;  1Z5W A;  1ZV8 A;  1H2N A;  3E89 A;  4HYT B;  1Q81 Q;  3MP7 B;  3LNN A;  1JY2 P;  3H01 A;  4DV0 B;  1KQS U;  1I94 O;  1VIB A;  1KQL A;  3OW2 O;  4ASU G;  4UVA A;  1DD3 A;  1IXM A;  4I4T B;  1IZN B;  3H1J G;  2UUC O;  1DD4 A;  3V6I A;  4I55 B;  1YTF B;  1JB0 J;  3CCQ V;  3H1L D;  1FYJ A;  2FXP A;  2C0X A;  5H2F Z;  3VP8 A;  1RF0 A;  1SQB K;  3II6 A;  2DOS A;  5KJ7 C;  2DW4 A;  1OJH A;  2WIT A;  4DXW A;  3HKD B;  4E2L A;  1N0J A;  2LGW A;  4UV9 A;  5IYB O;  1FU1 A;  2FKW B;  3AE4 C;  3AE2 C;  3CCS P;  4M3L A;  5K1X A;  1NOH A;  1KC8 Q;  1HVV A;  1P84 H;  1H89 A;  4DR3 O;  2AXT Z;  4JI2 B;  4YTP C;  3S1K A;  5CCH C;  3ZHT A;  3L35 A;  1ZL8 B;  4LC1 A;  4JI2 O;  3A3Y B;  3QTC A;  1FXV A;  1FS0 G;  4X1I B;  3M8A A;  4LP8 A;  3S9O A;  4I9W A;  2ADQ B;  2E42 A;  4GKK B;  1OW6 A;  4LF4 B;  3O8Z A;  4AQY O;  4RKU J;  4B3R O;  3Q5R A;  2DYS B;  1QR9 A;  2YIB D;  3AK3 A;  2B9B A;  1L4A B;  4DUZ B;  2BCC D;  1K04 A;  2XND G;  4DUZ O;  1YJN V;  3N2G A;  1ZRT E;  3DGE A;  2XOK G;  1KOR A;  1IFJ A;  1XEQ A;  4C7N A;  4FIP C;  4NXM O;  1L0L K;  2FKX A;  2KUB A;  2POH A;  4U3J B;  1X9V A;  5IJ9 B;  2YIC A;  3IFX A;  3APO A;  5E1A C;  1SQX J;  3D3Q A;  4I7Z C;  4I55 A;  5BR8 O;  3H1K G;  1USE A;  3H1H J;  1HR0 B;  4F6R A;  4WB4 A;  1M9N A;  3B5N C;  2BCC E;  4EFE A;  3V2N A;  1NJI W;  2OTL V;  5BVZ A;  1K9M W;  4U3F G;  4O4H A;  1YYC A;  2B87 B;  2R3S A;  3CXH F;  3OR6 C;  3L74 E;  2EJR A;  4JQ0 D;  1K8A W;  1Q43 A;  4YIO A;  1NH2 D;  2Z5U A;  3JSL A;  1SQX G;  2N1T B;  3OEE G;  3RK2 D;  3WU2 H;  3CCM V;  4LF4 O;  3TGU E;  3I55 V;  3K5M A;  5GTH Z;  4O2A A;  5DJT B;  2AXC A;  2BEQ D;  1BQZ A;  3RYH B;  2QWP B;  1M90 Q;  1KB9 H;  1Q86 Q;  2WT7 B;  1BS3 A;  2HP8 A;  3GVM A;  4X1Y B;  1N33 O;  1EDL A;  1IUR A;  1PPJ E;  1EDI A;  3IGA C;  1JFF A;  2XHB A;  4X66 O;  2PTM A;  4J7Z A;  5B3S B;  3LW5 H;  2YUA A;  2Z5H A;  1OVR A;  3OFN G;  3DSQ A;  4YIP A;  5AVU B;  2WWW A;  2O01 J;  1F4N A;  2CUG A;  3G9R A;  2WPR A;  3MZW B;  3ITK A;  5B5E H;  3E8H A;  3H1I G;  1QL2 A;  1EN4 A;  1H8H G;  1M57 C;  4PA9 A;  4FMT A;  1N73 A;  2H3O A;  1JJ2 U;  3M99 B;  3Q5P A;  3P8C D;  1R8E A;  2XAG A;  1GRJ A;  2YIU B;  5CBG A;  1R5S A;  1P49 A;  3BA9 A;  2Y0C A;  2EIL C;  4P9P A;  1PPJ H;  1NVO A;  5CN0 A;  2ZKO A;  1JTH A;  3EQ2 A;  4UVC A;  4P2Z A;  1NI8 A;  4LF9 O;  5J2U B;  1RM1 B;  1H2L A;  3SJC C;  1EDK A;  2P10 A;  2ZE8 A;  4K0K B;  2VRS A;  1VF5 B;  1GL2 D;  2E76 D;  5CMZ A;  4PD4 D;  2GV9 A;  1JY2 O;  3BCC E;  5A2Q N;  2OYQ A;  3KZI H;  1QR8 A;  3L72 D;  1KIL C;  1FZC A;  2ZJS E;  4RJT A;  3ABM B;  2Q9L A;  1PNL A;  4TOI A;  1N32 O;  3UCS C;  4W4L A;  4A5U B;  2G3A A;  3CWB H;  3CWB J;  1E79 G;  4CH5 A;  2GTS A;  1S77 D;  1FE6 A;  5EBM C;  2AHY A;  1SQP E;  2V4D A;  1F7Y A;  2DMX A;  2E5L O;  2Q5Z A;  1KEC A;  1KIL D;  3SWF A;  4B3R B;  1K73 Q;  2LQT A;  5HFM A;  4ZIB A;  5LOV A;  4Y99 B;  5E79 H;  4EB6 B;  2P1J A;  4I1L A;  3I5C A;  3CMA P;  2Y0P A;  5APY A;  4FLZ A;  2GM4 A;  4OVN F;  2G8Y A;  4DR4 B;  4Z1M H;  4HBN A;  2FTK A;  2DYR C;  3H1I J;  1NTK G;  1G6U A;  5LYJ A;  2LJ2 A;  4DJG A;  4RO0 A;  2IW5 A;  1BSH A;  4MVM A;  3Q1M A;  1FXH A;  4AI8 A;  3VQX A;  3FXD A;  1FKA O;  3GG2 A;  4UV8 A;  1GAX A;  3JAK A;  1N36 B;  2C0W A;  5KHJ A;  5KAI Z;  1BSN A;  1NVP D;  2KZI A;  3IN6 A;  3VOU A;  1NTM G;  1LWU C;  5BU8 B;  2D2C D;  3L75 J;  2WLL B;  3L73 J;  2ZT9 C;  2B1G A;  3L72 E;  1LTJ C;  2QG4 A;  5KLV H;  3O6Q A;  1PPJ G;  4EOT A;  1OXZ A;  4DRX B;  2M6Y A;  4FJC C;  3F5H A;  3HPL C;  3RYC A;  1XUQ A;  1B3Q A;  1SFC C;  4OWF A;  1URF A;  3FYE B;  3WUU A;  1FXK C;  3N2K B;  4I6M C;  4DV5 O;  4DR7 B;  4RES B;  5CBO A;  2P2U A;  2L5G B;  2LW7 A;  1USD A;  2QJ1 A;  3OTO B;  1N34 B;  1U7J A;  1JMM A;  3U1C A;  1RE3 C;  2PP6 A;  1IFD A;  2QJK B;  1TA8 A;  3LSQ A;  1SFC A;  2ZIO A;  4WFF A;  3CCV P;  2BOC C;  3CS5 A;  4PHZ A;  2FYU G;  3KQG A;  1AIL A;  3JD4 A;  2I8D A;  2A3Q A;  2C9N Y;  1J1E B;  4UB8 E;  3A5T A;  1VQO V;  2KYV A;  3EHB B;  3AEA C;  1U7M A;  2HFE C;  4IHJ B;  2PGG A;  1XMO O;  5AVX B;  3EXA A;  1DLB A;  2Z4E A;  4JI6 B;  2UXC O;  4NPD A;  4JAU A;  1J95 A;  4DR2 O;  3BCC H;  1GO3 F;  4LR3 A;  3L72 H;  4LBE C;  3VQY A;  4R4M A;  5APU A;  1AJP A;  1X79 B;  2YXR B;  4OGQ B;  1SQV J;  4K35 A;  3K5N A;  3V2Q A;  1OCZ C;  1DTO A;  2OAR A;  1V54 B;  4R7C A;  2ZR3 A;  2AEJ A;  2ODM A;  4JI7 O;  3CX5 I;  4I9Q A;  3FB8 C;  1Q90 D;  4UCS A;  2HHH B;  4UB6 E;  1JMK C;  2ZCE A;  3F7V C;  1CI6 B;  3H1K H;  3PLN A;  4QNH B;  4PDM A;  2WA3 A;  1IVS A;  2EIM B;  2CPB A;  3USS A;  5IWA O;  3H9V A;  1DEE G;  3L73 E;  4HNA B;  3SWK A;  2N9B A;  3GHG C;  5AVT B;  4OPH A;  4XE5 B;  3AE7 C;  1LGH B;  4RQE A;  3KXD A;  3VQV A;  3RVZ A;  1AI6 A;  5AW1 B;  1TUB A;  3RL0 B;  3BAA A;  5E79 Z;  3QO5 A;  5JJJ B;  3SPG A;  4HNA A;  2EIL B;  3H1K D;  3G67 A;  1NH2 B;  1XDC A;  2LFS A;  1UFI A;  3P8C E;  5EZY B;  3K9S A;  4F4L A;  2QE7 G;  2GTA A;  2UUC B;  4P9O A;  4JI5 B;  2IFM A;  1VEW A;  3SYQ A;  2YKO A;  3SWY A;  3ZMT A;  4H0L C;  2OTK E;  3RYF B;  2GUZ B;  2FYZ A;  3LID A;  4PJ0 E;  2HLD G;  1H2K A;  1M8O B;  4AIL C;  2HJD A;  3U10 A;  3B5N D;  2WPD G;  5K1P A;  4JZ2 A;  4BRY A;  3A2F A;  1RY3 A;  1SQP G;  2Q0A A;  5EBW C;  2OT5 A;  3JCU H;  2JEU A;  1KKC A;  4TV8 A;  3VMX A;  1SKV A;  1IBM B;  3D6Z A;  3ETQ A;  3ZRW B;  5GON A;  5KLV E;  1WA8 A;  3ZJZ A;  1L4A C;  3ZRX A;  5AW5 B;  4WFA V;  2OTL P;  2LP7 A;  1G2C B;  3U0Z A;  1FOS E;  4RUF A;  3CL3 D;  4D7T A;  1KQS O;  3M9B A;  3DC6 A;  3VP9 A;  1Y9B A;  1W2B U;  5LP6 A;  4X1K B;  1HTL C;  1S5L Z;  2I1K A;  3UM7 A;  4RAI A;  4IIJ B;  2V7Q G;  4YPC A;  3T4Z A;  4WY4 D;  3HKE B;  2BTQ B;  5FLX N;  1ROP A;  1S3J A;  4QE7 A;  2DQ3 A;  2OYH B;  2QWQ B;  3K04 A;  1IJD B;  3AEI A;  1DX7 A;  3L75 H;  4WFG A;  2YIU C;  1SFC D;  1GN2 A;  1WP7 A;  3MHH C;  1QLE B;  1D2D A;  1NU1 H;  2AHZ A;  2JIZ G;  5H2F E;  1ZL8 A;  4KFM A;  4MW3 A;  4B3T B;  1S4X A;  1AQ5 A;  3R66 A;  4JF3 A;  4B7K A;  1JOY A;  3JYC A;  3NTN A;  4PD4 I;  5BXZ A;  4IFD K;  1RFY A;  3H1K J;  2E3C A;  2HG5 C;  3FKS G;  3OMN B;  4MSW C;  3JAT B;  3BRV B;  3N7N A;  5B66 Z;  5TJH A;  1G1X B;  4DO2 A;  3E1R A;  1LP1 B;  1XMQ B;  1M1J A;  4JYC A;  3WB1 A;  1HGV A;  3ASN C;  1JJO A;  3VMY A;  2QGN A;  3CCS V;  2WT7 A;  1MZF A;  1BCC D;  3IFM A;  3F89 A;  5GTI E;  1Q2N A;  1SQQ D;  4W80 A;  2PY5 A;  1RQU A;  1NU1 G;  3JAL A;  5DEC A;  1PGP A;  3B77 A;  2CK3 G;  1FJG O;  2E75 D;  1LT9 C;  3KKY A;  2IYP A;  4B3S O;  2Q9I A;  3FYI B;  3JD2 A;  2Q67 A;  1HUC A;  1FAV A;  5FL7 G;  2W6I G;  3MUD C;  4DV2 B;  1LWU A;  1UPG A;  2YMK A;  5LHH A;  4JI3 O;  5LHG A;  4JTD B;  4D7S A;  3A7O A;  2UXB B;  4X64 O;  3IAO A;  2CTW A;  2DJV A;  4ABM A;  4J7J A;  2Y48 A;  3S3X A;  2AEM A;  1VQ6 V;  1GN3 A;  4FFB B;  4UCR A;  4DV3 B;  3V2P A;  3D6Y A;  1FZC B;  1IX9 A;  1AVM A;  1NZ6 A;  4GIF A;  4LLH A;  1T3J A;  2JS3 A;  3Q3D A;  2HEP A;  1ZAU A;  1H2S B;  1ZN5 A;  1BGY G;  2NPS C;  1W59 A;  3JD1 A;  2A06 D;  4DR1 O;  3WUT A;  1Q81 W;  5IE9 A;  3S4R A;  2MK3 A;  1FBM A;  3U1A A;  1BE3 E;  5LXT A;  3JAR A;  3RWR D;  1IBK B;  1OCO B;  1P84 F;  2O3J A;  1AP6 A;  2OTJ P;  3J81 N;  2RQ6 A;  3AEF C;  1T8Z A;  1WPB A;  1JA8 A;  2RDC A;  3TDK A;  3CPW U;  3CSX A;  3LDC A;  2E75 C;  2D3O W;  4JI4 O;  2KOG A;  1M1J B;  1NKD A;  1FXK B;  1Q3E A;  3WG7 C;  1HNZ O;  1TVK A;  4NXN O;  3JAT A;  3AE1 C;  3HKD A;  1IFN A;  2N1T D;  1TAE A;  4NXN B;  3Q2Y A;  4OGQ D;  5KLV J;  3T4D A;  2K37 A;  1FFT B;  5L3D A;  2B1I A;  4YJ3 B;  2Q7C A;  3K57 A;  4K8X A;  2KG7 B;  4JV5 O;  1WJZ A;  1N7S B;  1RHZ B;  1Y67 A;  3ZHS A;  1NTZ E;  2ARH A;  1NTK J;  4BIO A;  1BCC J;  1Q7Y Q;  2YXY A;  1TGO A;  3N27 A;  1X8Y A;  2FFD A;  4EEQ A;  2Y0I A;  2PYL A;  5CA1 A;  3JCU E;  4H13 C;  4CPG A;  4O9B A;  1J1E C;  1VF6 C;  2ZE6 A;  1KIL A;  1NAF A;  5CCH D;  2WMM A;  4GX5 A;  3HD7 C;  5AW3 B;  2RH0 A;  3H1L E;  3C8V A;  3ASO C;  3AE9 C;  2ZNJ A;  1QQC A;  2N9Y B;  3GF3 A;  2QIW A;  1H0T A;  5CB4 A;  5CA1 B;  2BCC J;  4UCV A;  4RQF A;  2YI9 A;  3L70 H;  2JVD A;  4D6T E;  5KA5 A;  1Q6H A;  3H1I H;  1F23 A;  1NQT A;  4PEL A;  1H2M A;  2IBZ I;  1MMM A;  5AG2 A;  4X62 O;  5KAI E;  2QKS A;  1WNS A;  4WY4 C;  4O4L A;  1JR9 A;  1IBL O;  1J1D C;  4YXD C;  3LSU A;  1SA0 B;  1K5S A;  4IL6 H;  1S76 D;  1RPO A;  3ETG A;  1NTM J;  4C46 A;  4CC5 A;  2FYU J;  4ZBM A;  2OIG A;  1HNW O;  2ZXE B;  1HNX O;  2UU9 O;  2FYU H;  1CSB A;  2YMY A;  3E22 B;  3L71 H;  5IDJ A;  2E76 B;  1GL2 B;  1WMK A;  1EN5 A;  3CYO A;  2JJL A;  3G71 V;  3CCL P;  1G1J A;  1SQV E;  2KB7 P;  1CW5 A;  3RL0 C;  3MDS A;  2MKV A;  3QO8 A;  4PA7 A;  3AG2 C;  3OUF A;  1SQX H;  3W7X A;  5APW A;  1RSO A;  4JYB A;  2Q4P A;  2NZ2 A;  1KP3 A;  4Q6G A;  2X6A A;  3H32 A;  1L0N J;  2M0B A;  2VQE O;  3SJA C;  5F2V O;  4TQD A;  1XOU A;  1OFC X;  4AHC A;  1NTZ J;  1RSO B;  3OTF A;  4HKZ H;  4U3F H;  2PAJ A;  3PP5 A;  5CMU A;  2WLL A;  5BMV B;  3J7A U;  1F51 A;  1GN4 A;  3P32 A;  2V7Q H;  5GTI H;  2EIN B;  1VAR A;  5LL6 Y;  2WLI B;  3OAA G;  1YVW A;  4DR5 O;  2Z0A A;  1KP2 A;  1OVU A;  1SQV K;  2FYN C;  5B1O A;  4WBN A;  1GU5 A;  2XV5 A;  1YCI A;  2W6J G;  4I0X B;  1MSW D;  1AI7 A;  3G80 A;  1RQV A;  3WMM 0;  1ZTE A;  1SFC B;  2ZIM A;  1QLE D;  1AI5 A;  3ZN0 A;  3HKE A;  4UB6 Z;  1EZV I;  3GW6 A;  1PP9 G;  2V4H A;  2QJY B;  3JSN A;  1K4D C;  1QEX A;  1BQ0 A;  3ZHU A;  3E35 A;  5DM6 V;  3OUS A;  3BY6 A;  5EC1 C;  1OVV A;  1VQO P;  2ZNI A;  3MHS C;  3FWL A;  4EDF A;  1S5L X;  4FVM A;  2IM9 A;  2RMK B;  2Y69 B;  3JAM N;  1NYH A;  4LF6 O;  1JNM A;  5EIB C;  3AE8 C;  2ZFC A;  2ETN A;  4RUE A;  4QIW F;  1QBZ A;  4RWU A;  1VQ4 V;  1MV8 A;  4IFM A;  1FJK A;  4ZMD A;  3I55 P;  1YJW V;  2W27 A;  1I0H A;  5IY5 C;  3KZI Z;  1HBW A;  1SC5 B;  1XL6 A;  4UB8 H;  1R6K A;  1TUE B;  1R1B A;  2FL4 A;  2H8P D;  4FK5 C;  1KB9 I;  1K97 A;  3QF7 A;  2EIK C;  3EWK A;  2KG7 A;  3GB7 C;  3RN4 A;  3UT5 A;  1XNQ O;  4DV1 B;  2UXC B;  3FWN A;  1KB9 D;  4OH8 B;  1AFO A;  4MS2 A;  2IX7 C;  3KCX A;  4QPJ A;  2Y4U A;  2Y0D A;  2YO2 A;  1HJB A;  1L0L E;  3AG7 A;  4LWS A;  1GH6 A;  3CD6 V;  1VQL P;  1GZL A;  1OV9 A;  3O6Q B;  2Z5I A;  4LWS B;  1CZQ A;  4JI7 B;  1GW4 A;  3AK1 A;  4LFB B;  5B5E Z;  4TV9 B;  2E5L B;  1YJN P;  3H1H D;  3HB3 B;  1A02 F;  3RK2 C;  3NXS A;  2OYH C;  1P84 D;  1QL1 A;  1LT9 B;  4FM1 A;  1IK7 A;  5GTI Z;  3JAW B;  1KQF B;  1YXB A;  3BEH A;  1QLE C;  5KAF Z;  2V7Q J;  1XNR B;  1P84 I;  1URQ D;  2N04 A;  2R72 A;  2EIJ C;  3ZBH A;  2A45 H;  3WB0 A;  1WA8 B;  2IU0 A;  1KYO H;  3R4Y A;  1BHA A;  5KLI B;  2A0L A;  5GTH H;  1ZR4 A;  1YJ9 V;  1K4C C;  3M9H A;  4B3M O;  4GOD A;  4FLY A;  1U57 A;  2K88 A;  3UKM A;  3HE4 B;  1KZU B;  1NU1 D;  2KB1 A;  4O2B B;  3G4S P;  1AA0 A;  4O4I A;  3B2E E;  3M0A A;  3JAL B;  5J9P C;  4R8C A;  1OZH A;  3CX5 D;  4F6E A;  1ZX3 A;  4ZHQ B;  2QJP B;  1Z2G A;  4O2B A;  3W7T A;  1MAB G;  3MD0 A;  1SQQ J;  2K9J A;  3TYY A;  4H44 C;  1W2B O;  1GTO A;  1JX9 A;  1WAZ A;  2ATK C;  4WCE V;  3HD7 A;  1O9H A;  5APV A;  1H38 A;  4B08 A;  2A06 H;  4DCK A;  5B1N A;  4X8A A;  4DR6 B;  1EZJ A;  4JI1 B;  3UO2 A;  1ZXG A;  3DTU B;  2O01 N;  2F93 B;  2B5U A;  3O65 A;  1SQV H;  2CTQ A;  3L9D A;  1GK4 A;  1VQ5 P;  1NTM H;  3PRJ A;  4ZOL B;  1EXI A;  5LHI A;  4PV1 C;  2FBW C;  1M1K Q;  1RE4 C;  1Y4M A;  2E75 B;  1GKF A;  4DUY B;  2AXT E;  4MVZ A;  2IU3 A;  3JAS B;  1SQB J;  1XQ8 A;  5B1B B;  3ABU A;  3K3W A;  1YIT P;  5L3E A;  3WG7 B;  3JCZ A;  4PD4 E;  5CJ0 A;  2OCC B;  4GX2 A;  1AVY A;  4CC6 A;  2UWJ E;  3V4Q A;  4HB1 A;  4DV7 O;  4IOI H;  5JVD A;  3IC7 A;  2XDJ A;  4OX9 B;  4CH3 A;  2QTS A;  3C90 A;  1F4M A;  1ZLL A;  1NTM D;  1KTM A;  3CXH H;  5JQG B;  3IR9 A;  4PD4 F;  2NRG A;  2NPS A;  2WSE H;  2Y9Y A;  4Z1M G;  5L3C A;  1W2E A;  3RK3 E;  4DV3 O;  1DEB A;  3HUS B;  3AG3 C;  1SQP H;  2B89 A;  3H1L H;  3UT5 B;  3RYI B;  2YIA A;  1Y6X A;  1NTK H;  2IBZ E;  1WLE A;  4B3M B;  1Q82 W;  1WT6 A;  1E1R G;  3KG2 A;  4GKJ O;  1HF9 A;  1M56 B;  4DR3 B;  1XBL A;  1PV3 A;  5AW4 B;  1WRG A;  1HNW B;  3E7K A;  1PP9 H;  4I0X A;  1B6Q A;  1M93 A;  2QA4 P;  2W6A A;  2IFN A;  3A0H H;  3RGU A;  3H1L J;  5AW2 B;  1JCC A;  2WLN A;  3CEI A;  2WLI A;  4AQY B;  1G4Y B;  3SGI A;  1NR7 A;  2CTP A;  3OW2 U;  2ZXX A;  3U11 A;  1GM7 A;  4K8Z A;  3B09 A;  1MA1 A;  4WFB V;  2IJK A;  1NTK D;  4NPE A;  1FD9 A;  1IFP A;  5AW9 B;  1N86 A;  3WU2 E;  2HVK C;  1XIL A;  2L6L A;  3K5B A;  4O4H B;  3CD6 P;  1S5L E;  4HAM A;  4CS2 A;  2Q7G A;  3CRR A;  3H32 B;  5K5G B;  2Q73 A;  2JEX A;  5LA6 A;  1LT1 A;  2UUA O;  1N7S D;  3OJA B;  3CME V;  4UCO A;  1R6N A;  5AVZ B;  2DWD C;  4YJ2 B;  1PGO A;  3BCC J;  1TU3 F;  1OCR C;  4HZ3 A;  5BMV A;  1X0T A;  4LH6 A;  1AR5 A;  1LUV A;  5KX5 B;  1S2E A;  3NFQ A;  2E43 A;  2LXC B;  3CCR V;  4IT5 A;  2XAJ A;  1L0N D;  1VP7 A;  1VQP P;  3SPI A;  1H2G A;  2AEF A;  4HH2 A;  1W0J G;  2Q7H A;  3JD0 A;  2YKP A;  2D2C C;  2Q3E A;  5KAF H;  2ZYA A;  2UUB B;  3CWB E;  2IH3 C;  1OCO C;  3L70 D;  3U59 A;  1PFI A;  1GL2 C;  2E76 C;  3IAY A;  3CRQ A;  1BE3 D;  2JWA A;  3A8T A;  5KHH A;  1M57 B;  2DYS C;  1LTJ B;  2C9L Y;  4WFE A;  1KC8 W;  1PD3 A;  1N73 B;  2N1T A;  2ZVO B;  2QKC A;  5FNV A;  2CH7 B;  4BAY A;  2GA1 A;  2JJ2 G;  2XKM A;  2ZE7 A;  4D6T J;  1RF1 C;  3KDP B;  5LGU A;  3HR0 A;  3M7M X;  4C7U A;  4CS3 A;  4G28 B;  4WBA A;  1BL8 A;  2XNX A;  2EIJ B;  4BIU A;  1AJN A;  1HNZ B;  2IYO A;  3G3Z A;  5LP6 B;  4JI4 B;  1RE4 A;  4TSF G;  3VMA A;  1DK1 A;  2HJF C;  1GDT A;  1SQQ H;  5H6Q A;  5CBN A;  4O4L B;  1VF5 D;  5C8Y A;  1T2K C;  5BR8 B;  5IYC O;  2E5Y A;  5L3G A;  1EDJ A;  2RCV A;  1IBK O;  1ZR2 A;  2QTO A;  5B5E E;  2H43 A;  2LO1 A;  1XRE A;  5B1A B;  1EC5 A;  1IZ3 A;  3T1H O;  2E74 D;  5BU5 A;  3CCU P;  4MN4 C;  5JH7 B;  2KZJ A;  4N23 A;  3QWO C;  5APT A;  4MVR A;  1PP9 J;  1URQ C;  1HGZ A;  1S5J A;  4LFC O;  2HR3 A;  3RYC B;  2IPP A;  1AI4 A;  4N6J A;  1IBL B;  1NTK K;  3C1L A;  1YEW A;  4DV6 B;  2WAM A;  1SQB H;  3JSV C;  4AYC A;  3ZCC A;  3L75 E;  1N7L A;  4Y99 C;  2Q6A A;  1K05 A;  4I50 B;  3BAT A;  3S3W A;  5APS A;  4JPZ B;  2NN4 A;  1SER A;  1L2P A;  2QM7 A;  3LIE A;  3G71 P;  5KHK A;  2UUB O;  1OCC B;  5EZY A;  3CCE V;  4X66 B;  2F66 C;  4MVU A;  1VQN V;  3FD9 A;  1M7L A;  1YTZ T;  4ZKP A;  1Z5V A;  4FZ1 A;  1LTA C;  3OT7 A;  5ITZ B;  4O4J A;  2W90 A;  4MT8 A;  3WFV A;  2FXO A;  3P8M C;  5CCH A;  1K3E A;  3M0D C;  1KU9 A;  5J2T B;  1DGS A;  4ZOL A;  3N4X A;  4QPK A;  1U96 A;  2IZ1 A;  2QRX A;  4BWA A;  4JPR A;  4I4T A;  3CC7 V;  2UXX A;  4X89 A;  1IXB A;  4J11 A;  3L74 D;  3I56 P;  5LXT B;  4MTO A;  3ZMS A;  1RM1 C;  2GHY A;  4KXR A;  1BHB A;  5LGT A;  1PM9 A;  1G1I A;  2OYH A;  1COW G;  2X6C A;  1SRY A;  4YXW H;  5D5Q A;  4DOJ A;  2K9J B;  2DW3 A;  1FZF A;  4L73 A;  3D36 C;  3BA8 A;  4IL6 X;  4DT0 A;  3L73 H;  3D36 A;  1P7B A;  2W0X A;  1KN7 A;  1VQM P;  3HE4 A;  1UII A;  2CK3 H;  4L76 A;  2OWO A;  2ADP A;  1LJ2 A;  1E1Q G;  2WZ7 A;  2PYJ A;  2O01 H;  4GT1 A;  4C7N B;  2CAZ C;  2QA4 V;  1UIX A;  4LFB O;  4CZZ A;  3ABK B;  1Q6U A;  1FXK A;  4U3F D;  1SS1 A;  1CEZ A;  1PV0 A;  4MVO A;  3JAW A;  3TXQ A;  4LF6 B;  2ZXW C;  1SQP K;  4H37 A;  4IL6 Z;  1X22 A;  1HWY A;  3VQW A;  5KMG A;  2WSS H;  3CWB D;  1SLQ A;  4OPA A;  3HTK B;  1SQQ E;  1VF5 C;  3PHL A;  2Y0E A;  4NXM B;  2LW1 A;  3IC9 A;  1GN6 A;  3AG4 B;  3QH9 A;  3E8G A;  3A0B E;  5J2T A;  3APQ A;  1FC2 C;  3FX7 A;  3L71 D;  3V4W A;  1NTZ H;  1E5W A;  4LFA B;  2RNB A;  1L0L G;  3PN1 A;  3ABL B;  5AW7 B;  5L3B A;  1BDD A;  1GK9 A;  1D5A A;  4JBZ A;  4BW9 A;  3JAS A;  4LF7 O;  2R9A A;  4MVS A;  1BMF G;  1WB7 A;  2FFD C;  3TGU D;  2HFE D;  5C8Y B;  3D71 A;  1KD1 W;  1EBO A;  1Y76 A;  2XAF A;  1XTG B;  3GHG B;  4Z2W A;  1FS0 E;  3W7W A;  2J59 M;  2K1E A;  3RT3 C;  3QG5 A;  2M5A B;  1K33 A;  4PDL A;  3SFD C;  4PV1 B;  4JI5 O;  3GF7 A;  1JY3 N;  3LNM B;  1SQQ K;  1QVG O;  2EUL A;  2BTQ A;  2EX3 A;  5KA6 A;  3C9I A;  4B3S B;  3T1Y O;  2DE0 X;  5LYJ B;  1FDO A;  4HJG H;  1G8M A;  3ML0 A;  3FFQ A;  1YHQ V;  2VWK A;  2X6B A;  4UB6 H;  2ITC C;  4L8J A;  2R32 A;  1D5N A;  3B8E B;  4DR2 B;  4XDJ A;  1I94 B;  1N2D C;  1M1K W;  1DH3 A;  2Q7E A;  3RYF A;  4CH6 A;  2YKQ A;  1OMI A;  2YNY A;  4GX0 A;  2OGU A;  4PJ0 Z;  3Q4H A;  1QGK B;  2OYI B;  1BGY D;  1T2K D;  1SP4 A;  1X59 A;  5C93 A;  1QLN A;  1Y74 B;  2JGD A;  2QDO A;  3ZRS A;  3FGA D;  2YC0 A;  3HD7 D;  5KLV D;  2ITD C;  1JQ0 A;  3ZRW A;  1MSD A;  4F6R B;  1KBH A;  4WY4 A;  5CCG D;  3L74 G;  5EBL C;  2H88 C;  1SQB G;  2CDY A;  3RK3 D;  5FPR A;  4B3T O;  3CCM P;  1OCR B;  1OCZ B;  3IJ4 A;  4U3J A;  2DWE C;  2WSC H;  3TGU G;  2R9I A;  3MUD A;  1K34 A;  2W6J H;  3W7S A;  1EN6 A;  2CGO A;  1VQM V;  1LTB C;  2GUZ A;  1KB9 F;  3GWK C;  1U97 A;  4DW0 A;  1VF6 A;  4GCZ A;  3L71 J;  4I2L C;  3CC2 P;  5KKZ C;  3OE7 G;  1JY3 P;  2EIM C;  1H8A A;  1VDF A;  3K08 A;  4DR5 B;  1URQ A;  1HWT C;  4DUY O;  4ZKU A;  4DK0 A;  1ARO P;  3AE3 C;  2Q3I A;  2K9P A;  5DED A;  2OYO A;  3HTK A;  1VQ9 V;  2YXQ B;  3CLQ A;  3UIA A;  3RFR A;  1XNQ B;  1YI2 V;  3L70 J;  3T2M A;  4DYL A;  1FJG B;  2A06 G;  4LH7 A;  1G2C A;  2A7W A;  2GBO A;  5EK0 A;  2NPS D;  3A0B H;  4TWK A;  1FAF A;  2VWJ A;  2OIE A;  2WTY A;  1GK6 A;  2G38 A;  5KJ7 A;  3CC4 V;  1YJW P;  3WU2 Z;  3T97 A;  1K5Q A;  2KLV A;  1LUW A;  1S9K D;  1N32 B;  3QNE A;  4ZI7 A;  3AG3 B;  4GKJ B;  2HLO A;  2QWR B;  3EFG A;  4MTF A;  4X88 A;  2QR4 A;  3RYI A;  4UUJ C;  2ZAE B;  2MJZ A;  5AVS B;  4CBC A;  3E8F A;  1BE3 J;  4C7R A;  3ZRV A;  1ZWI C;  4QGP A;  1URQ B;  4IHJ A;  3L4F A;  4DR1 B;  1FZA A;  2N1T C;  3SPH A;  4LF5 B;  1Y66 A;  5E79 E;  3E1I A;  2N74 A;  4E4E A;  2VQF B;  1RP3 B;  2EBO A;  4H44 D;  1ZP0 C;  3CCU V;  2NNU A;  5JJN B;  1BE3 G;  1M57 D;  3L73 G;  1NO4 A;  3K79 A;  5LP6 C;  3KHU A;  3L71 E;  1FDM A;  1HR0 O;  1OCC C;  1AP5 A;  1PNM A;  2P4K A;  4TLF A;  2KXP B;  4X20 B;  5B3S C;  2YSU B;  2A06 E;  3H1J J;  3SSU A;  4TV9 A;  5CA3 A;  4XDK A;  4JI8 B;  1M56 D;  3A0H Z;  1VQ7 P;  5H5N A;  2ZDI C;  1JMB A;  5IYZ B;  1NTK E;  1BCC E;  2RKL A;  2V1D A;  4DZO A;  4DR6 O;  3ZED A;  2O1K A;  4X65 O;  2KQX A;  1KD1 Q;  4W7Y A;  1N34 O;  2VQE B;  1I08 A;  1PP9 D;  1BZK A;  2XT9 A;  4IGG A;  2R5D A;  1YTF D;  2IJI A;  1SES A;  5AVV B;  1JY3 O;  2ZYG A;  3JAR B;  1KIL E;  2BE3 A;  3ZMZ A;  4EYY Q;  1FDI A;  4B7E A;  3P7K A;  4KT0 J;  2UXD O;  2Q6Q A;  4XFJ A;  1SQX K;  4ZKI A;  5IJ0 B;  4DV0 O;  1Y47 A;  1BGY E;  1SQX D;  3E22 A;  2H7H A;  3OD4 A;  3T97 B;  2HPC A;  1SZT A;  4IYI A;  2KSE A;  3MTU E;  3CCV V;  2KSJ A;  4L87 A;  1VQP V;  2R44 A;  4J41 A;  1M1J C;  2IH1 C;  2BOB C;  2VRZ A;  2JK5 C;  4FM2 A;  3ABV C;  3LDD A;  3RYH A;  3G6E V;  2YDE A;  2QE7 H;  5FPO A;  1V9P A;  2WLJ A;  5A9G A;  2X7R B;  4PD4 H;  3FAV B;  1VQK P;  1QX8 A;  1VQ8 V;  1L4A D;  3H6P A;  5AVY B;  2F95 B;  4OX9 O;  2JEE A;  3VTP C;  1BCC G;  3K9A A;  3K0D A;  5HFL A;  1WN7 A;  2OYI C;  2M3E A;  3NMD A;  1DF5 A;  3OGI B;  4NVP A;  5AVQ B;  3AED C;  4FFK A;  3DC5 A;  1ZW0 A;  2BCC G;  2JP3 A;  1P7G A;  1CPY A;  5BY1 A;  1IDS A;  2HG5 D;  4JF7 A;  1N33 B;  3IF4 A;  4X64 B;  1L0L D;  4G2K A;  5KLV K;  3L37 A;  1P84 E;  3CC2 V;  1I5Y A;  4JI3 B;  3CJH B;  5B66 H;  1LNQ A;  1PKX A;  4AUW A;  2PUS A;  2EJ7 A;  4PDV A;  2ZM6 O;  3I5D A;  4QJF B;  4N78 D;  5H6R A;  3TK1 A;  3ABL C;  1JCH A;  1RE3 A;  3N2G B;  3K06 A;  5KX5 A;  4FZ0 A;  4FLX A;  2JO1 A;  1S9K E;  5KKZ B;  2AGA A;  4FM0 A;  2EIK B;  3T1H B;  5AW6 B;  2Q69 A;  3L72 G;  2PI5 A;  1CP9 A;  1Q7Y W;  3BRT B;  5H9C A;  1JTH B;  2NR5 A;  1VMG A;  2H94 A;  3L72 J;  2OTJ V;  4O2A B;  3AE5 C;  5LA6 B;  5EC2 C;  4GUN A;  2ZXW B;  1R6T A;  3L71 G;  2YEV B;  5CB4 B;  2HKO A;  2WVR A;  1YBK A;  3CXH I;  2ZYD A;  3ICX A;  2A79 B;  5JH7 A;  2H8P C;  4IIJ A;  3AG4 C;  1MG1 A;  2EZO A;  1XNR O;  2PGD A;  1YHQ P;  2ILM A;  1PL4 A;  1PL5 A;  3TSI A;  1GMG A;  5D5P A;  2M5A A;  1SQX E;  1XTC C;  1R73 A;  2ZDI A;  1SQB D;  1V55 C;  1RF1 A;  2JS5 A;  2W83 C;  1IK9 A;  1RH5 B;  2RMZ A;  3R2P A;  4H13 B;  3H25 A;  2WA4 A;  4BR6 A;  4YY3 B;  4UXN A;  3TJT A;  1FOS F;  5BZB A;  2EIN C;  3FB6 C;  3TGU J;  2AW9 A;  2IJH A;  1ENV A;  4XBF A;  1LWU B;  4UB8 Z;  3PJS K;  4LNU B;  4Y28 J;  2M8R A;  2FB5 A;  3K0G A;  1ORQ C;  1VQ5 V;  2GUV A;  1MKM A;  1L0N G;  1SET A;  1S5H C;  2WSF J;  1YIJ P;  2Y4T A;  3F7Y C;  1K92 A;  2YEV A;  2XND H;  3VYI A;  4LF8 O;  4JV5 B;  3H1H G;  2JRI A;  2JKV A;  5TIS H;  2LKM A;  2XAH A;  3CCJ P;  1JO5 A;  1L0L J;  1KYO I;  3L36 A;  4NKG B;  3CHX A;  1K8A Q;  4YJ3 A;  4PA4 A;  2QSI A;  5JCO A;  1PPJ D;  3ABK C;  4TT3 H;  2P7J A;  3ZN1 A;  1N7S C;  2E74 B;  4JAS A;  3K5O A;  1I7F A;  2P22 C;  4UVB A;  2J58 A;  2KS1 B;  4ASV A;  1NTZ D;  2QJK C;  3W67 A;  1JFF B;  1L4A A;  4PA6 A;  4G27 B;  4N21 A;  4KJM A;  4YY3 O;  3D70 A;  4EIJ A;  1SA0 A;  2F1M A;  3B4S A;  5B1B C;  3RBZ A;  3TXS A;  3AG1 C;  1A02 J;  3B8N A;  4U3F J;  2ZE5 A;  4ZHQ A;  1ZME C;  2ZR2 A;  4H33 A;  1BGY H;  3ABT A;  3CRA A;  4OGQ C;  1AVO A;  2FML A;  4N78 E;  2HYN A;  2JJ1 G;  3MGN A;  1L0N H;  2P67 A;  2L91 A;  3B40 A;  3F5T A;  2JGU A;  3ZHQ A;  5LMN O;  2IBZ D;  3HUS C;  4D6T G;  3SYA A;  1VQ9 P;  3BCC D;  1GU4 A;  1BDC A;  4WBN B;  2JDI G;  3D8C A;  1HP8 A;  2KNC A;  3X2Q C;  1BE3 H;  1WP8 A;  1IC2 A;  2C2A A;  2P4V A;  1Y76 B;  4KL1 A;  2GUS A;  3GHG A;  2FYN B;  3SJQ C;  4WWI A;  2YXL A;  3E8B A;  3OM3 B;  4LF7 B;  4GKG A;  1THZ A;  1A32 A;  4U7N A;  4KHP O;  3W68 A;  1N36 O;  1OW8 A;  1VQ8 P;  1T3U A;  1QU7 A;  2Q0O C;  2QWN B;  1IBM O;  3M06 A;  5EYP A;  3G6E P;  2F43 G;  4W7Z A;  3LDE A;  3J80 N;  1VQ4 P;  3BAB A;  1VQN P;  2K9Y A;  1SQB E;  3CCE P;  3BHP A;  1KYO E;  3CE2 A;  3P3N A;  3A2A A;  4LGD E;  1YF2 A;  5LMN B;  1QVF U;  2IJJ A;  3ZMV A;  4NTY A;  4PDR A;  3BPZ A;  3L70 E;  4GZR B;  4JI0 B;  4YHH O;  2RJZ A;  4GOE A;  2P5O A;  2LGQ A;  1FZE A;  3OTO O;  1NWQ A;  3L70 G;  1FJP A;  4X1K A;  3FB5 C;  3CCJ V;  5AW0 B;  3T1Y B;  3RK3 C;  4X20 A;  3SPJ A;  1TUB B;  3OGC C;  2PI4 A;  4U7O A;  3CP1 A;  3BFR A;  1RPR A;  3OA7 A;  3GLM A;  2WLK A;  4X1Y A;  5GTH E;  3EVK A;  4J10 A;  1N0N A;  3B71 A;  1SZX A;  1V54 C;  2JDI H;  1HDJ A;  3WUV A;  1ZSP A;  1NHL A;  3DXR B;  2F23 A;  4CS4 A;  1AV1 A;  4XA4 A;  3P30 A;  4X9Q A;  2M3B A;  1L1F A;  1AJQ A;  3MHV A;  1IO4 A;  5L3F A;  3SR2 C;  2FXM A;  2AZ2 A;  2OCH A;  3GWO A;  3HKB A;  1QHT A;  4XDL A;  1NVP B;  2KI7 B;  2O57 A;  3PH0 A;  5IY5 B;  1N4C A;  3ETE A;  3UQ8 A;  2Y9Z A;  2WLH A;  3K5L A;  3ETD A;  1ZOY C;  1R3I C;  1V55 B;  1RF1 B;  1FFX A;  1AR4 A;  1SVF A;  2MW2 B;  2UXN A;  4ASW A;  5KLI C;  1GW3 A;  1RF0 C;  4WF9 V;  4DK1 A;  1NR1 A;  1EQ7 A;  1M56 C;  4TT3 G;  3H1L G;  2CTR A;  5EFW B;  1R3K C;  5IJ0 A;  4DV4 B;  1WPX A;  1YQ3 C;  1GM9 A;  2IBZ G;  1XL4 A;  4D6T D;  3ZS8 C;  4R4L A;  3CC4 P;  3H1H H;  5CBH A;  2L35 A;  2B9Z A;  5DN6 G;  3C3T A;  3PTZ A;  3D3I A;  2VS0 A;  1PGQ A;  5CCG A;  5KTB A;  4A7P A;  2A45 I;  2NPS B;  1JOC A;  1E79 H;  3CWB G;  1PNK A;  2QEX V;  1YI2 P;  1YSC A;  1IFI A;  2PRR A;  2CPS A;  3KCY A;  1KYO D;  5KAF E;  4MTG A;  1BGY J;  3ZHV A;  4LNU A;  4GLX A;  1SS3 A;  4N3Y B;  4AQR D;  5EIB D;  1NH4 A;  3CX5 H;  3CXH D;  5LMU O;  1S72 P;  1SQV G;  1NJI Q;  1JY2 N;  2R9R B;  1S72 V;  3B5N A;  2QKA A;  2KSD A;  4JTC B;  2P58 A;  4BIZ A;  2PF4 E;  4UCU A;  3W7U A;  1Q5O A;  3CXC U;  2WSC J;  4H0L D;  4NYK A;  3SYP A;  3AG1 B;  2YO3 A;  4BXL A;  2NLJ C;  1Q6I A;  1KFM A;  5H2F H;  1PL0 A;  1J5E B;  2QEX P;  1R3J C;  2BEZ F;  4L74 A;  3SDL A;  4CH4 A;  1S0V A;  3HE5 A;  4GOF A;  4H44 B;  3Q4H B;  4DV7 B;  2W8Z A;  4R6Z A;  4B86 A;  2P6J A;  2ZD9 A;  3H1J D;  1L0L H;  1KFN A;  3RW0 A;  2ZM6 B;  2CE4 A;  1X4T A;  3VOP A;  2W0F C;  1S1C X;  2WPS A;  3RVY A;  1GM8 A;  2WLM A;  4P30 A;  2PFX A;  5TIS E;  2D2C B;  3JD3 A;  1QCE A;  5IYD O;  3THO A;  2KIK A;  1NBM G;  3X2Q B;  3CRM A;  1XMQ O;  3CMA V;  4JZG A;  1AB3 A;  1EZV E;  5CBF A;  3TET A;  1T5E A;  4WVZ A;  1YZB A;  4UFZ A;  4PV1 D;  1NU1 E;  4JI1 O;  1N73 C;  3ASN B;  2J5U A;  1NS1 A;  1EZV G;  4Q20 A;  1PIX A;  4JYY A;  1R5L A;  5GON B;  1XI1 A;  3AEE C;  2YID A;  3OMA B;  2A45 G;  1S5L H;  1NKZ B;  3M9Q A;  1PP9 E;  4IFF A;  3KPE A;  3L75 G;  2Q8V A;  2QVA A;  4OXS A;  4QMA A;  2KK7 A;  1HH0 A;  4BRY B;  2FYU E;  4GKK O; 
#chains in the Genus database with same CATH homology
 2JP3 A;  2E74 C;  3D70 A;  3LW5 J;  1KMI Z;  1K04 A;  2E74 D;  1NGM B;  1HF9 A;  4GDO A;  4I7Z B;  1ZOY C;  2WPV B;  1ZRT E;  3AE7 C;  1PV3 A;  4YXD C;  1KOR A;  1ZME C;  1RQU A;  5KLI C;  4OGQ C;  2E75 D;  2G8Y A;  4Z1M H;  3AEC C;  3AE6 C;  4I7Z C;  3D71 A;  4H0L B;  2E76 B;  1K05 A;  1WMK A;  1GMJ A;  2JO1 A;  3SFD C;  4PV1 B;  1YQ3 C;  2YMK A;  2WSE J;  3Q1M A;  3GF7 A;  4R4L A;  1IK7 A;  2MKV A;  3Q5S A;  1KQF B;  3IAO A;  1KQG B;  2WQY C;  2H89 C;  1HJ0 A;  4H0L C;  4H44 D;  2OQQ A;  2ZT9 B;  1ZP0 C;  2V7Q J;  1FDO A;  2NZ2 A;  3AE5 C;  3D6Y A;  3R4Y A;  1OW8 A;  3IN6 A;  2D2C D;  2BEQ D;  2QJP C;  3Q3D A;  2ZT9 C;  2ZT9 D;  1OMI A;  1U57 A;  1AJY A;  3D6Z A;  3O6Q A;  1PL5 A;  1TU3 F;  3FGA D;  2IDB A;  2K9Y A;  3RL0 g;  2O01 J;  1OW7 A;  2WSC J;  3G9R A;  4H0L D;  4H44 C;  5L8R J;  2FYN C;  2QJY C;  2H88 C;  3GMA A;  1KIL E;  4IL6 X;  4H13 B;  3AEF C;  3H25 A;  1FDI A;  1Y9B A;  4KT0 J;  1RQV A;  3Q5P A;  2E75 C;  4XFJ A;  1R8E A;  2BEZ F;  2D2C C;  3SFE C;  1DD3 A;  1YQ4 C;  4Y28 J;  4H44 B;  1DD4 A;  3AEB C;  2E76 C;  1EXJ A;  1JB0 J;  3AE1 C;  3T97 B;  2FXP A;  1MKM A;  4H13 D;  3Q2Y A;  2WSF J;  4OGQ D;  1EXI A;  4PV1 C;  5KKZ C;  2FBW C;  1S1C X;  4U7J A;  2E75 B;  3GLM A;  5M1B A;  2D2C B;  2YIU C;  1UIX A;  2P10 A;  3AEA C;  3AE2 C;  3B71 A;  3AE4 C;  1S5L X;  3AE3 C;  1VF5 B;  2E76 D;  3ABV C;  1NYH A;  4R4M A;  3AE8 C;  3AEG C;  4PV1 D;  4OGQ B;  1VL2 A;  4H13 C;  4YTP C;  2J5U A;  2QSI A;  1PIX A;  4TT3 H;  1KTM A;  2G3A A;  2E74 B;  3AEE C;  1VF5 C;  1DIP A;  1VF5 D;  3C8V A;  3RK3 E;  3S9O A;  3AE9 C;  1Q90 D;  1OW6 A;  2QJK C;  3GF3 A;  2QIW A;  3EWK A;  4RKU J;  3Q5R A;  3AED C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...