5AW5B

Kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 2.2 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw5B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw5B02
2Q3IA 5AW4B 3I5CA 1GU4A 1KQLA 5AW0B 3V4WA 2WT7A 3M91A 5AVRB 4RETB 3HE5B 2VRSA 3WGVB 5APXA 1CI6A 2R5BA 3L36A 3V5BA 2WTYA 1H8AA 2C9LY 2P7JA 4KHXA 2E43A 2Z5HA 4I6MC 1S9KE 2QM7A 1GTWA 3NFQA 3B8EB 3NMDA 1HBWA 4JYCA 2YO2A 2WT7B 1GU5A 1H89A 2H7HA 1S9KD 1CI6B 1OWAA 2ZXEB 3VMZA 2R3CA 3VN0A 3KQGA 3M0AA 3M9HA 3P8MC 3M9BA 1A02J 3V4QA 1OXZA 3L35A 3LIEA 5APYA 2Q7CA 1JUNA 5CMZA 1CSBA 2Z5IA 4DZOA 4AYCA 1X8YA 3KDPB 5AVYB 4HYTB 1HWTC 1HUCA 3A3YB 2BASA 5AVVB 3LIDA 2W27A 1SLQA 3M06A 2Q5UA 1MFZA 5APWA 1MUUA 1CZQA 3A5TA 4RESB 3IR9A 1GD2E 1GK6A 2P67A 5AW2B 2YO3A 2QM8A 5AW7B 5AW9B 5AW5B 2P2UA 4I2LC 3NTNA 5APSA 1YYCA 3HE4A 5APQA 3TYYA 1J2JB 2R32A 3O8ZA 2XU6A 3P7KA 4EOTA 4C7NA 1FOSE 4GKGA 3SWFA 1FOSF 4XE5B 2C9NY 3TK1A 1GK4A 2WPRA 2ZFCA 5AW6B 1G2CB 3HE4B 3OAKA 2N9BA 3T97A 1MV8A 1H88A 2E42A 5APVA 4C7NB 1FAVA 3A2AA 1T2KD 4JYBA 3VYIA 1NWQA 5AVWB 2WPQA 2IPPA 1NAFA 5AVUB 2YNYA 4LC1A 1JNMA 5AVQB 2JJLA 3L37A 1A02F 3M0DA 1DH3A 3TNUA 4B86A 2XZRA 1SP4A 5AVSB 5AVTB 5APTA 2W6AA 3WGUB 3VMYA 1GZLA 4AUWA 3TNUB 3NXSA 5AVZB 2KP8A 5AVXB 3UIAA 1HJBA 4GT1A 3A7OA 4C46A 2XV5A 3P32A 5AW3B 4M3LA 4AQRD 2WPSA 1IO4A 5AW8B 3HTKA 3HE5A 2R5DA 3VMXA 3VTPC 5APUA 1T2KC 2WWWA 5AW1B 3MD0A 3MGNA
chains in the Genus database with same CATH superfamily
3A4DA 5C2UB 3QQ4B 3LN4A 4I13B 1E67A 3UL4A 2GJ6B 3ARGD 3NJHA 3U9UA 2NZ2A 1XR9A 3S5LG 1AFVH 5I23A 2M3BA 2IDUA 5K69A 3MUY1 5F6IC 4AMXA 1IM3A 5CGYC 1DFXA 5FM8A 4F7TB 1TJMA 1ZS8B 3CXHJ 3NJXA 4U6TA 2BM3A 1NMCC 2Z1PA 1QG3A 2K3RA 3UTSE 4X4YB 5IIEB 3H9HA 4Q6YA 4W1TA 2CKBH 2WBJC 2CUAA 5DRXA 5KLIB 3LPPA 2KZIA 3HZ3A 3WXVH 3CC7P 3L75J 3MJ7B 3OBAA 2QSIA 2VITA 2YA1A 5LO7A 1J1DB 4LL4A 4WFGE 1MQKL 3AE2C 1UACL 2HVBA 4LNRB 5KJ7E 3G08B 1UM6H 5T33H 4PJDB 3CHOA 4XCCL 4WNJA 4NQCE 4PRHE 3HUJB 3MCLH 1MKFA 1SJEA 3F84A 3QRBA 4UTAA 2E6QA 1S1CX 5DRZA 1OX3A 1MCCA 5F70A 4BQCA 3OKEA 4U0RC 2QE7H 3BCCE 5BW7C 4CSSA 3NFSH 1RJCA 1LTIC 2V2XB 4TULH 3SDCC 3NTNA 4X9GA 2H5UA 1W9XA 4Y89A 5FA4A 4A68A 2ZYSA 5IFHL 5HGBB 3F6LA 3SWFA 3PXHA 4NQDA 1ASQA 3GS4A 2LFEA 3ZPDA 4Z8FH 4HJSA 3B9AA 2UX7A 1L0PA 3BAWA 5C97A 3SOTA 5IVXE 3QR2A 1UB6A 2M26A 2I8DA 5DQDH 5HI4C 5JHAA 1M2VB 1BX2B 5MP6H 3MV8E 1GIGH 2AXWA 1NM4A 4M8VA 3VTMA 3OAZH 4WFFE 1RY7B 4MCYA 1T6AA 2M2DA 2AV7A 2QQNL 1U8PA 2PYED 1SOSA 4R90L 4LPVA 4DN4L 3NDZE 3NZHL 3O6KL 5D7LB 5D1XC 3MNVB 3MNWA 4GIOA 1DN0A 3TEYA 3HE6A 1MWAA 4AC4A 1CGTA 1RZIA 3L3IB 1P7KB 3QFGA 4QT5A 4E41E 4PLJC 1U3HA 4PR5A 4GT1A 4MXQC 5I28A 3MKKA 3A7OA 3US0A 3WLBA 3O6FD 3W2DL 5TK2A 1H0DA 3PFUA 2MOGA 4I1PA 5E99H 2LR2A 2HT3C 1FPTL 4GW4A 1DO6A 2OMTA 3AXLB 5BMFL 5E6YA 2J7LA 5CN3A 1PV3A 5IJVA 1EAOA 3P0YL 2QLVB 4YAQA 2SPZA 4RAVB 2JKRM 2G4GA 4NUGH 4A66A 3TC9A 5C8JB 5IEHB 1UIIA 3MZWB 4FTVD 4KY2A 1OMIA 1FO0B 1ZGLB 3H1LG 3BPNB 3M91A 3DOHA 4E2OA 1T1ZB 4DGVH 1HE8A 4ZW3A 2DQGH 2ED7A 2X4OB 3O2VH 4P3CL 4WENB 2FD6H 4KAQH 1T7ZA 2VXVH 4WHTB 3ZKQD 4KK6C 3JWDC 4GO9A 1Y6KR 4KGLA 4LSUH 2ZXEB 2OMVA 4K3HA 3X1BA 2EQDA 1J9CT 4I1RA 4HJJH 4LARH 1ILUA 3TEZA 2WLKA 2JK5B 5KVFE 3RL0g 5GS2H 3EFFK 1I7TB 1NAYA 4Y16D 3S34L 1WCQA 2J72A 4KVNH 2NQCA 1NC2B 3GHPA 4O2CB 3HBQA 3MV9B 2VDLB 2ZYRA 1CDHA 3MUJA 4PREA 4HXAH 4WCYL 1BD2A 1G6RL 4WY7H 1DQML 2Z7YA 3UPCA 3ZMNA 2F54D 3BMVA 4JM2A 1DANT 1O9ZA 1JPEA 5DJ6A 4UT9H 4WIQA 4IM8A 1KWGA 2CBQA 1E5YA 2V33A 4UANA 2BP8A 2R0KH 3V6ZB 3Q1SL 2O5ZH 2WLHA 4A7PA 4RFOH 1K5NB 1AR1D 1VACA 4PB9L 4ZFGH 1QI5A 3F6IA 7FABL 2EILB 4GDOA 1Q0XH 2A77L 3QUML 2Z92A 3CXHK 3F5WA 4N5EC 3GSNL 2C4XA 5FOBA 4B41A 3SGJC 1JV5A 1YTZI 3D0AA 4DIXA 1IJ9A 4M6AA 3GTNA 4N5UA 2RFXA 2NY5H 3AJ7A 4DQAA 4UDTA 1ZV5A 5DMYA 3APMA 2EO7A 2PYFB 4HD9A 5F21B 1NCBL 2X89D 4DO6A 5FYKL 4PD4I 2ICWI 5G4OA 1IEAA 4L8SA 4UOW0 3O2DL 1JCDA 2ESVD 2HJLB 2OV0A 1R75A 3IXTA 3RPBA 1G7JB 4DOHE 1ITBB 2P5WA 1KLFA 1NFDF 2E7MA 3KEDA 2C3WA 4JFFB 5JIQA 2QKIB 1GL2C 1J86A 2G3ZA 1MLBA 2OXHA 4U1MB 1GW3A 4Z7WE 5GGUA 2JJLA 3CFJA 1LT1A 4OF7A 1E7VA 2QGDA 4AJ0A 2EUZA 5TE7L 3BXNA 4JPKL 4U3SA 2OMWB 5I71C 2W65A 5IMLB 4DP9X 4WI3A 5DQ9A 1KJMA 5HYSA 5KKZB 3OWRA 3FU7B 4H26A 2XWBB 3VRLF 1NAKL 3STLB 1FZKA 2R2BB 3EZ8A 5ICZB 2M3EA 4DCQA 5A7EA 5EEUA 3P32A 2WJ5A 4K8RC 5EZJB 2WNKA 3VU1A 2ADJA 3KGTA 2J20A 2PYEE 3BEWA 4P2OB 1UIXA 3HE5A 5IF0B 3BVHA 2EE6A 4C8XA 4EKXA 3DBXA 1QL1A 4J3OC 4U1NB 1U8IB 1VZHA 1HKLH 2E9IA 4JHWL 3FRPG 2N0MA 4OQTL 1UKQA 3Q9QA 4JGNA 2R15A 5DJ8A 4CPGA 3V5KB 1QATA 4X8JB 3UTPD 2H45A 1TQTA 1HSBB 1ETA1 1G1YA 2ZX5A 3UBHA 3VWKA 1FZCA 1B0GA 3BZEA 1U2HA 1IL1A 3G5XA 3LX9A 4I2XA 1F97A 4QHUB 4JB9H 1LEIA 4R96B 1TPXC 2NT1A 4W70A 3L9BA 3P8CD 1P4BH 4K9JA 5INDB 3U30C 1EUTA 4GXFA 3EDFA 3BN9D 3T3MB 1D5IH 5IFJA 4D7PA 2WZ5A 2XRAL 2BS71 1FCGA 1L9SA 2Q7NA 4RFNB 1UFGA 2AJVH 2N1KA 1C5BH 1QA9A 2BHZA 3MRMA 3MX0A 5C08A 2IDBA 1S7RB 2B3RA 2VDML 2VJ8A 3JWOC 2X7LB 2VR7A 3BGFB 1B0IA 4XH2A 4HWBA 3VJ6B 4EIBA 2IGTA 1D6EB 4LCCB 2WANA 5D2LB 1QSZA 2D2CC 4PMEA 1BZ7B 1NCJA 3CXHH 1CK0H 4AH2B 4Z7QB 4CN6A 3K80A 3TBWA 3BPCA 3US9A 4L9DA 5CP7A 3TYFA 1KCRH 4P46C 2DMGA 2FZ3B 3ZDXB 4JFED 1ZA3A 4TSCH 1H9VA 1JGUL 4IU2A 1CMOA 1NJ9A 4N0FB 1B4JH 1MH5B 4EQ2A 1ZE3H 1OT4A 3IM1A 5HHXL 5JO5A 1JFQL 2XA8L 1LTJC 5I16B 1LXMA 1N86A 4GJTB 5HI3D 2C8NA 2FSDA 5I1AB 4Z3HA 4JM4H 3BVXA 3WNMA 4KU1A 1IK7A 4OV5B 4X99B 4APQB 4M1CC 3RK2C 3PF2A 1OF2A 2CHXA 3LIZL 2NXZC 4FA8A 5AOMA 3BP7B 1XHHA 1SQ2N 2J2ZA 4LPYA 2IPPA 4FNQA 1BQUA 1S7XB 3EDDA 4LESA 3U25A 4BSVA 3BRVB 3QUHA 1MEXH 2O72A 4GW1B 5E2TH 1MY5A 4XZUB 5E5MB 4BFIA 4R4BA 2FR4A 2QHRH 1P7QB 1U92B 3RVUC 2GITB 1CBJA 1NGXA 3L4CA 4XPFL 5D4IA 4AUWA 1TZGH 3ZT7A 1ZN5A 1EHNA 2WSSH 1AS8A 1UVQA 2IH3B 2W90A 5IKCA 2KLRA 3QFJD 1GZHA 2ESVE 1OP5H 1NU1J 2QELA 5B39B 1XF4A 2FT6A 3NGBC 4K7PX 5EU6D 4FQQA 5IJKA 1A3RL 3IJEB 2FEDC 1RIHH 2HG5B 3RIFK 2AV1A 4H40A 2FGWL 2YPLE 2MHAB 3KBPA 4U1JB 3T0VA 4XAKD 3QO1B 1GHFL 4G2AA 2B9BA 5FUZH 1IAOB 3GKWL 5IK3B 3ARFC 4HUUA 4GH7B 1M1SA 5H4YA 1OV8A 1BDYA 1TZHB 2CK2A 5ACZA 2X4PB 4G43B 1MKMA 1MVYA 3CHSA 5DJZB 1GPOL 4NZUL 3EH4B 3QISA 4NZRH 4OUUA 4P3DA 4Y4HB 3V9EA 5CEXA 3V0HA 1BXVA 2R2CA 3HE7A 4Q14A 1L0LJ 5MEPB 1MFMA 4UIMA 4JCWA 1NWOA 1SQVJ 3I02A 4HMDA 4U1SA 3BKJH 4XVSL 2E27L 5EF3A 5K33A 4HF5H 2MCPL 2F1BA 5GSVB 3L4WA 1ZT4A 5GGRA 1PCXA 5CO1A 5E56A 1DLHB 1F18A 1T1XB 1LK3H 2B0SL 3QQXA 4TNVK 5I8EA 1NCCL 3AQZA 3OR7B 3Q5TA 4GRLD 1KELL 2WZ6A 1DQQB 1G9ML 3KPSD 3IDMB 4WY4D 1CQKA 1LO4L 2RMZA 1EDQA 3GSVA 3L3JA 3WN5C 1HUCA 1EDYA 4BK8A 4XXWA 4HULB 4ZMOA 4Z77A 2E8YA 5IOPA 5C0CD 1BZ9B 2EE9A 5I8CB 4K94H 3OMAB 2GSIB 4L73A 4PV1C 3DTXB 1XEDA 4MD0A 4G7YH 4KXAA 4JQIH 4YHZH 4XP6L 1ZJAA 2DYPA 5IQ7H 4FXGC 1C08A 3PTZA 1OP4A 1WJ3A 4G6KL 5FYKE 1KT2A 1N64L 3D07A 3E1IA 1ADQH 1BAFH 5G2NA 1U0QA 4DKTA 1T0MB 1JFHA 4FFYL 3SGEI 1S8DB 3VWJA 2Z0UA 4MJ6B 4TQPA 3ZIYA 1HXMA 3Q5YA 1SHSA 4FKHA 2HA1A 2GCYB 3MJ8B 3F01A 4ABVA 5MHSD 3HE4B 3RI5F 4PGCA 1CDIA 3LH2L 3AGWA 3X13B 3VA6A 1HZLA 4FHKA 2EYSA 4WTQA 1H8NA 1DDHB 4WW1B 5KYNA 2P52A 1PP9J 3TN0D 3TWYA 1QBLH 1FJ1A 5C0RH 1FWXA 4G8GA 5I1DA 3MLWH 2BP0B 4KRPD 3RWEA 2B7DT 1USDA 2DWXA 2ZAHA 3QPQD 5I82A 2DQDH 1A2YB 1P7HL 2QVKA 3GMAA 3KGUA 4QHLB 1DUYA 4LSPL 4U3FJ 3FUIA 3K4ZA 3CFIC 2B14A 2CHDA 4DGUA 3H3PH 3RG1C 1HQ4B 4I0PD 3FCTA 3R1GL 3GMRB 5LLIC 5IBUB 1SXBA 4F9LC 4D94A 2OJEB 5GRWA 1RUML 2DLIA 4HX1B 1HDMB 4S1RH 2O26U 5FO7B 2KBGA 1UXWA 4TLSA 3EO0B 4RGMC 3EFGA 1MI5D 2EDEA 1IO4A 2Z31D 2Z65C 3L9YA 1OVZA 2A45G 1U36A 4K71C 4PJ8B 1XGPA 1MCWW 3TIEB 3SQBA 1CXIA 2BW4A 4BRVA 3ARBA 4G6MH 4MCZA 3X12A 3SDXB 3OXSB 5EF0A 1ZWIB 3QFJE 1KMGA 2QHLA 1MUJB 1H8AA 4R7NA 4H44C 4DZBA 1JZIA 4UBDD 5GJTL 2HP4A 1HVXA 3C5XA 4X5PA 1O6SB 4YLQT 2YC1B 4Z7NF 2NXYD 2PETA 5EDXA 4AYFA 5ESVB 5FM5M 2YSSB 3HW7A 5AG9A 3WJLA 3QI9A 2Z8SA 4UQDA 1NU1K 1J05A 2PW1A 4X7CC 4HLEA 4B9YA 1BFOA 4ZSOA 2B4CC 4GLRH 1CD9B 2XU9A 4LSVH 3LS4H 1XL6A 1OCOB 4X98A 5TE4H 3OHXC 2NSMA 4M56A 2FQGA 3JSSA 3W9EB 3H53A 4XC3L 2K78A 2BWDA 4JR9L 3VGDA 3ZRCC 2VQUA 3FW6A 2IAND 4ODVH 4PRNA 1WFJA 5T1MB 4P4KC 3WTWA 4RJTA 2VM3A 5FUOH 25C8H 1P84H 1L0LK 4M7JL 3UJIL 5A2BA 1DBBL 3ZZSA 1EEUA 4QHKJ 1AP2A 1M7IB 3KPSE 5D7JC 4IRSD 3OAWA 3Q2YA 1L0QA 2B16A 2IPKB 2QADC 1S78C 3PHAA 5ESQA 1L5GB 3SYAA 3T6QC 1BJ1J 5D9SA 1DZ0A 1QBAA 1UCTA 2A6IB 3N85L 5EZPA 3DTUB 1GDTA 5HGAA 4AMKL 4XHJC 4Y4FD 1QHOA 1RUAL 2I07B 5ENWA 2WLMA 2E42A 1JUFB 5B1BB 5TISH 3GK8L 4MTMA 1H0TA 5F89B 1TF4A 1ZHLB 4RAUB 3SYCA 4RKUJ 3O6LH 4F5CE 2Z1KA 1N59A 2VLRD 4DZ8A 3C60C 4H0HB 4OGQB 1U8JA 2VLJE 1RMFH 2WUBH 3O45B 4F80A 4FA6A 5CCHA 3RPIB 3W11D 4E5XA 2WMPA 1A3QA 1NCNA 3MYJA 1XF5B 3VGEA 1U3YA 3VOPA 4KKBD 1AJ7H 3WIHA 5LUMA 3LZNA 4G7VH 4L5FH 4XPHL 3B6SB 4FRWA 1QUNA 1N6QL 4RZCB 1FRGL 2CJ3A 4DP5X 1R5VA 1IFRA 1RLWA 5EO9A 5C9KA 4NKIH 4CADB 1P9MA 2J12B 3K6SA 4OKVA 4ONHB 1MW3A 3ZX1A 2DKUA 3LRMA 5EBMA 1HZHL 3WI9A 4U1GC 1KXTA 3MRCB 1GGCH 4OFVA 1KB5B 4Z7UF 4AYEC 2Y36H 2APTA 5E9DA 2CKBA 4WKZA 1KFGA 2UVFA 2WBJB 3BWSA 2LV4A 1RZKL 4CKVX 1IGYA 3K6OA 2C9RA 3BO8A 1DBML 5F0MB 4PJCF 5B1JC 3LY6A 4NPYA 2R2EB 1GOGA 1OE2A 4RGOL 3HTLX 3LKQA 1OQXA 2BIMA 2YMOA 3BAKA 3EYUL 4M29A 4X6CB 3U36B 3ZGHA 4ATWA 2H6UA 3TYGH 2R1XB 3WYRA 1OAUL 1MI5E 2D4FA 4NNPH 2P24B 1U8QB 5E8NB 1ROCA 3QUKB 4OTXL 4HZ1A 5JHLH 4DJMA 5GZOA 4C56D 5CINL 3RE0A 3LPWA 1XSIA 4G1MA 4E5XG 4N6RA 3F7QA 1A6TB 2FJGB 3NZ8A 3SDCB 3H6PA 4AUUA 1XVSA 1XBDA 1XGYL 2IPTL 3UGUA 3VFOA 3CNKA 4AYSA 2CRYA 2EICA 5DSCB 3GMLA 4X0KB 4YDVB 5DJTB 2ZUQB 5GRUH 4G80B 4C4KO 3UACA 3UO1H 2WPGA 2ZJSH 1F4HA 3V95A 1SJHA 2BP3A 4W4NA 5KYYB 2A9DA 1DZBA 1PZAA 2FYYB 2X1WL 1EHLH 2X0VA 1J0YA 4P2YA 1CDGA 5I74C 1ACXA 4LFHG 4R2GD 3RNKA 3PWJA 4O4YL 4ZW6A 4F2MA 3TT1H 2WXRA 3K2UH 2VDQL 5I6PA 4NBXB 2C7UA 2ETWA 2K7QA 3FO9A 3MLTB 5CR8A 5ES4B 4YUEL 1FOSF 2GUVA 1FNSL 5D1XB 1RUPH 4XE5B 2QQKH 3W56A 2YQGA 1KQFB 4UQAA 1XGRB 2NDFA 2VZUA 2R2HA 2K9FB 1NBCA 4AIZB 2L7QA 1NTME 4YFDB 2XIIA 2ARWA 4HKZH 1VENA 5DURD 1S7TA 4ZW7A 4HAGA 1UYWL 1XAKA 2CUHA 4YC2C 1NBZB 2GJZA 4ZOBA 5T1LD 4UQCA 1E7UA 4IHBA 3B8YA 3B5NA 1RH8A 2Y1VA 3EGDB 4HOZA 1KGJA 4L76A 2XQ0A 4TUOB 4Z3TA 2HX9A 1W2EA 3OKMB 5IVZA 2NPSA 1M1KQ 4WI5A 4MMYA 1DVFB 2X4UB 1E5UI 4G6JH 5L2KA 4EVNB 4IGBD 1JRHH 1KENH 2C9QA 4LDEB 4ZTPL 3RHWK 1OCCB 2ATKA 5GGQH 2VLRE 4IRJB 2QA4P 2WSFJ 2VZVA 3T1FA 1QWUA 3H9SD 4IBTA 3WNIA 2CA3A 2PWGA 3GM8A 4J3SA 4MZ3A 3RZCA 5IWLA 1ET8A 3HR5A 1WZLA 3ARQA 1L0NG 3QIBC 3QWOA 4QJ5B 1R3JA 4H0GA 4WI0A 4AZUA 1AGFB 5JHBA 1Q1PA 3BGMA 4R0LC 2YAEA 3BKYH 4LPUA 3TZVA 5IHZB 4K7PY 3FTGB 3V0EA 2HRHA 2FHBA 1NIEA 3I3BA 2X4SA 1OT1A 5T1KA 1A6VL 1RERA 3KPTA 5EU7C 3UAEA 5A6MA 3Q5RA 1A02N 4O5LH 3NMDA 3CC5B 1FP5A 4RMUA 4XMPL 3MOAH 3B9EA 3NPSB 3VI4A 3CU1A 3CVHB 5C0FB 1A9EA 5D5MA 2VKWA 5K1JA 3U4AA 1BMGA 3LKOB 4LU5L 5JORA 1KN4H 1CXHA 4P9HC 4XNYL 4H25B 1OAJA 1LWHA 3MV11 4P5TC 1U4EA 3VE0B 4PRIB 1VQPP 2V2TA 4KOBA 3NESA 4W9CC 1THCA 1GGUA 2KLTA 1Q82Q 1EJOH 2P7TB 3FOLB 3U1AA 4BEIA 2Q9OA 4JZJC 1TVBA 1RF0A 5LBSL 4H1LA 2WB7A 3N40F 2ZQKA 1W0VB 4P48A 4Y5YA 1E5CA 5FV1L 1B4TA 5DK0A 1JYXA 1EGJA 2VLMD 3CC1A 2B87A 1YY8B 2YKLH 1X6NA 1G0XA 2CM5A 1YUKB 4K5LA 4H0LC 3W57A 1LO0L 3E6HB 2Q7YA 3C2AL 3R4RA 2V7QH 1GL2B 4KVCH 5BVJB 6FABL 4K3JH 3WKYA 5APQA 3PP4L 3BZFA 5HYJB 3FQUA 3JWNH 4TPRL 3B5TA 3UJTH 4B3VA 5D8JL 1RZGA 3HNTL 4LHUB 1BXXA 2AJXH 2YBRB 4DWHA 4NOBA 2BMKB 3L74D 5HHOA 4KDVA 1WZ1L 4JM2F 3O9WC 2CO7A 1MV8A 4I1LA 1TQSA 1K3ZA 2AQRA 4NI3A 1HYSD 4GKSA 4N8PA 3IMSA 1AZZC 1EERB 1JF6A 1KILD 3P0VH 4G8EB 4X6EA 3WFEL 3EYQD 5KLVJ 3RWHA 4AVJA 1OB1B 2OMZB 3ZKMD 3QHTC 2Y06L 2BVQB 3FB8B 4Y2DA 2MJZA 1XTLA 4MNGB 2Q76A 4YXWH 2D0HA 4K7PH 4ERSH 4B86A 3CQQA 4O02B 2EXYC 3E8UH 3EHBB 1ZVSB 2IG2L 2OZ4A 3SE4C 4W81A 3ZE1E 4KPHH 3KWUA 5BVPL 3GNMH 5IB1B 4H1LG 5TPWH 3BCDA 3ZKSD 4AL8C 5KS9A 3CCEP 1RUKL 3CQFA 3A67L 1KGUA 2HKFH 3AG3B 1Z5LB 4J1UB 4P59L 4WW2C 3D08A 1PD1A 3QPXL 3EFFA 4NAMA 3QUZD 1TPXB 2CD0A 2UZXA 3QQ4A 3HRZA 1Q1JL 3U30B 2AXCA 4OBRA 1HEJC 2POHA 4KZCA 1I9IH 1XBRA 3ML8A 3N50A 2D9QB 4O51B 4G5ZH 1OAYL 2X2IA 5HHMB 2OULB 3T6XA 3ZT5A 4F7TA 4QO1B 1INEL 2R5BA 4BZ2H 4X4YA 4L3AA 3B7TA 5BOPA 3H9SE 4JHZA 2G60L 4YSOA 1FN4B 3PNWB 2NNAA 3X3GH 4Q6KA 4C4BA 3MJ7A 4L2LA 2VQ4A 4LF3B 5CD3B 4AQAB 3NCCB 4AG4L 2AFNA 3L5WB 1ZIBA 3OB8A 4J8RA 4NUJB 5C07D 4Y1AB 1FI8C 1WAAA 3G08A 3O11B 4P46B 4NJAL 4PJDA 4ZPVA 5CNHA 3TF5A 3BEVB 3CX2A 1SQPD 2NW2B 1A0QH 3HUJA 3AS2A 1X5FA 1KIUB 1XZ0B 4G8IA 4NIYE 2BERA 4IOFC 4UZUA 4PJGB 1SZNA 4FQJL 3RUGE 1LTJB 1KZQA 4KQ3H 5D1QC 1OANA 4NQXA 5EO1B 4DVRL 1ECZA 3D12B 1KYOI 4L4TB 1JWSB 2F68X 4U1IB 1JMMA 1MUUA 5HGBA 3KYQA 1KBPA 3BUDA 3MFFB 1E3FA 1KV7A 5EORL 2OKMA 4YSAA 2I9TB 3VD9A 3TU6A 1T6VN 1E6OH 2P5EA 4FXLA 3IGAB 1YEDB 4ZYKB 3H4FA 5DHYB 1TQBC 4JBSA 4KH2A 3HMXH 3C5SB 3RAJH 2C34A 3ZHDA 4QRPD 2A45I 3ARTA 3FQYA 4GMTH 5E1AB 5JHDE 1FGVH 2YN5A 1BX2A 3NIGB 4X80L 2VDPB 1A3LL 4JE4B 5CHNB 4ELKB 2K9UA 2CDGB 4MNQB 3SDAD 1QEXA 1T5WA 2HVKB 1QPPA 3SODB 3WSQL 2WWNA 3NJIA 4KK5D 3R0NA 2JIXB 5D7LA 4BDVA 4UNIA 2N0KA 3ESOA 3GF8A 3MNVA 2X1XR 1FFPB 3DIFB 1XR8B 4V11A 4EZJA 4ZMQA 3CSBA 1SJXA 2H1XA 1F42A 1HINH 3MLYL 3L3IA 1P7KA 2BSSB 3U2JA 4QWWD 3VVVA 3L75G 3ARFB 2VT0A 4LSSL 1EJ8A 3SBQA 4MAYC 1YYLH 1LDSA 1MFDH 5F1IB 1M3IA 1WEJH 3IJHB 3K6NA 4FLQA 4JO1H 1F0LA 3AXLA 2BIHA 3MHZA 2DWDB 1KILE 4FTVB 4KXDA 4PB0L 1QD0A 1Q7YQ 4U4BA 3ATEA 5DZJA 3B5HA 4MSWB 4PM1A 5C8JA 3NEEA 5IEHA 2XZQL 4EQ3A 3SYQA 4XOCA 1I31A 3FL7A 1FO0A 1ZGLA 4IDJH 1S7UB 2XTLA 2LAGB 5ECJE 4LMQI 5EOQL 1T1ZA 1EDKA 5CKAA 1A4AA 1K9TA 4ORGB 1MN4A 2X4OA 5AOLA 5FK9B 5C71A 3UBFA 4FNLH 5KLVK 1FYHB 4WHTA 5MI0B 2NCEA 3B5GA 4OIIH 5D1ZC 4XP5L 5CLWA 1DVSA 3EYVB 3NH7L 2VQ1A 3AXIA 3DMMC 4W9GC 1F58H 2JK5A 3EFDL 3D25A 3F7PC 1I7TA 1ZV8A 3TV3L 4JLRB 4R4MA 4PV1B 1NC2A 2CKNA 2F54B 2FB4H 4LDLB 4O2CA 2OMXB 3MV9A 1UWEH 2B1AH 1TLMA 2Q86B 4F7CB 3AY2A 3G71P 4FLRA 4FXGB 4GSUA 5IP4A 1GYUA 2XN9A 3BKML 1CFVH 1PX4A 3H6JA 3Q5PA 2OSLB 5IG7B 1AR1B 2GPZA 3PL6C 5EG6C 2GC4C 3ZE2F 5F3BA 3H6AA 1MJUH 3V6ZA 2F9BT 3LNEA 1K5NA 4JKKA 3ARWA 1RK1B 3BUPA 4N8VB 1S2EA 2CJUL 5FCUH 1F2QA 1X9VA 5E2UH 1IC4H 3HC4L 5C07E 4DP6X 1N8OE 2R29H 4YHYC 2ZXDA 4NGHL 4FG2A 4K5NA 3WHE0 1SQPE 3UIYA 4ELMB 1UA6L 3WKNA 4AYGA 4LKCB 2PYFA 1NIAA 1A6ZB 1HNFA 6CGTA 5FWRA 3G6DL 3HPJB 3PWPD 3VDCA 5C0NC 2HJLA 1CL7I 4W7ZA 1G7JA 3E1ZA 3MBWB 3NMEA 4UV4H 4A2HA 1CLOL 1G9HA 1OAZH 4KUCF 4JFFA 3N1GC 2WP3T 5DGQA 4IHOB 1N7MH 4U1MA 1HS6A 4KKPA 1KPVB 1MXDA 4NJ9H 4WU7A 1OAXH 4OFPA 1SMAA 3GIVA 4U6HB 3VYOA 5IMLA 4RGMB 4QY8B 1WA0X 3I6LD 4LC1A 4FFVC 4K71B 3Q5SA 2Y7LA 3FU7A 2FTAA 3QNXB 2XWBA 5I1GL 3STLA 5ICZA 3ZMRA 2Y5EA 4KFZC 5T3XD 1MCOH 1G7HB 2G5BB 5EZJA 4L0YA 4ZMZA 4UYPA 4AENB 3S88L 2JLPA 3OKDB 4P2OA 2DV6A 1OZUA 3DHPA 3BDYL 2KDGA 5IM7B 5IF0A 4KWUA 4X8XA 3FXDA 4IU3B 1WK0A 4U1NA 2O1AA 3PJLA 1JJUA 1FZEA 3BIBX 2CHZA 3K8MA 4ANXA 4M6NH 1JIBA 1RVFL 3PREA 3V5KA 3QDGE 4X8JA 3WNNA 1LEKB 4M9OA 4K07A 4MJ2A 3VACA 1ZLEA 2FVNA 3P3YA 1HSBA 4IRZL 1TEFA 4OVUA 2Q8AL 5LHDA 2HMID 1PKQE 4FKKA 5KVFH 2YD0A 4QHUA 3QQDA 3V6OC 2HVJB 4BH7B 1T5KA 4ODTL 4R96A 1KWKA 2XBTA 1AD0B 2NY0C 3KLQA 5INDA 3UGXA 1WRGA 1JG9A 1FDLH 4J3VA 3H2QA 5E1QA 3OHXB 3MCKB 2EIDA 1U8HB 3VXSD 1O9WA 5FF6B 1LILA 5DK3A 3O8XC 4EDWL 2LVEA 1H3GA 3BZDA 3RGBA 2GJJA 3A0OA 1S7RA 3BP5B 4YE4H 3TCLB 1ETB1 4P4KB 3VFNB 2YEQA 3S8GB 5E5UB 5CCGD 1E9PB 3BASA 4LLDB 3Q3DA 2LVCA 3U7YL 4OM0H 4L0PB 3RY6A 1D6EA 5CCKL 1VPCA 5AOKA 4XMKL 2YPVH 3Q43A 5I30H 2PR9A 4F8NA 1BZ7A 1W0WA 4JFEB 2E7LC 4FULA 1XCWA 2ADGB 1A6AB 4B9GA 1YJDL 3CGTA 3E9TA 3KPLB 4H4NA 3SKNB 3CLFL 2TSBA 4CKQA 5GS0L 1W72L 1MH5A 3QG7H 4LIQL 4LP8A 4Q52A 3BAXA 2NY4C 4HUMB 1CICA 3C60B 4DESA 5I16A 3OA7A 1FFTB 1JHKL 1GGYA 4UUJB 5A2FA 5I1AA 4ZW5A 3G9VA 1NMAH 1EFXD 1TUPA 5BPPA 4JDEB 4MQXD 4X99A 4OV5A 4APQA 2EVFA 1TYRA 1QLEB 3CLQA 1R8EA 3JXAA 1V7NL 3ZGIA 5L4MA 3BP7A 5I1CL 1XXFC 1XF1A 3MLUH 4FG4A 1S7XA 1J0ZA 5LXGL 2G2PA 1HESA 4KO7A 5D71L 3CWBJ 2GUYA 4XN2A 4PRBB 4GW1A 4GIFA 1RIUH 3HG1D 4BE6A 1K8IB 1B9ZA 5E5MA 1P7QA 4M3KB 1U92A 1WFNA 2GITA 2H0PA 4MBOA 5EU6B 3N44B 3TF7C 2IH3A 3KLHD 1UH3A 2XZRA 5B39A 1AR2A 3M07A 4JKPH 3STBA 4QF1B 3CSPA 4MA3B 1DVYA 1FVCB 3IJEA 1N8RQ 2HG5A 1TJXA 3FONB 4RA3A 4TYUA 1REIA 1QVOB 1J8HD 2MHAA 4AM0Q 4M8QA 2F7QA 3QO1A 5IK3A 1IAOA 3QEUB 1JDAA 1EZVY 3C09C 3NVQA 4OLYL 2NOYA 3ZL2A 4AQRD 5DA4A 3I6LE 4M43H 5BVZA 1D5RA 1TZHA 5KYWA 3GM0A 2X4PA 5KVDL 4G43A 4YHPB 3BW9B 3TJHD 2JB6B 5DJZA 2IAMD 1J10A 3HN5A 4TLKA 1X5HA 4Y4HA 5T3XE 4JDTL 2VC2L 1T2KC 2H4EA 3B7YA 3PIQB 1BMZA 4AE1A 3V79C 1J5IA 3CI9A 5MEPA 1QEWB 3AEDC 1L9OA 2XIDA 4PJEE 5LB1A 1RF1B 1EO8H 1NANI 2B15A 5BO0D 4MB5A 4YXLH 4C58B 4QRSB 3HZVB 1RP8A 1JZEA 1UWXK 2VDKB 4ACPA 1JSYA 1DLHA 1M9WA 3DJRA 3GEFA 4FMKA 3OR7A 2XXFA 2YAMA 4P5KB 1JZ3A 4Q9RL 5HVFB 3Q3GB 4HPHA 2WNWA 1DQQA 3IDMA 1MF2H 1AVAA 3NQKA 3VMAA 2JELH 4S1DC 5C0CB 2KIKA 4J6IA 5F7DB 4GAJH 2LABA 1VEMA 1ZHKA 4L8BB 1YNKL 4U7MA 3OSVA 4N2GA 1OXZA 3NOIA 1LGVA 1TFHA 1BZ9A 5I8CA 1CLZL 3BH9B 2CR0A 4M00A 4BWUA 3DTXA 1UZ6F 3VXSE 1M6OB 5E23A 4BSWB 4XBPB 3MLRL 4CBPA 1M1XA 1NU1G 4PJBB 1UUSA 1BF5A 5DHVH 1KYDA 4NB7A 3O6KH 5DR5L 3RIKA 2KMWA 4E9QA 3PU7A 2W81C 2IYOA 4KQ4L 5LQBL 1S8DA 1FIGH 1VESA 1QRND 4MJ6A 2V2WB 4FQLL 3APFA 3K6DA 1GC1L 2CRMA 2GCYA 3MJ8A 3HE4A 3P2DA 4MB4A 1AO7E 3X13A 2DMBA 2K4AA 3ZQWA 2E7CA 1DDHA 4WW1A 5E1IA 4F2EA 1FPTH 3Q05A 1NPUA 2DDQL 5AW6B 4NO2B 1JXGA 4UOW1 5H94A 5T5FL 5C0BD 4PD4D 1H3UA 3IMWA 5IROD 3DDGA 4IYKA 1SQVG 1A2YA 4QHLA 3DVFA 1NFDE 3AE5C 3UZEC 1BF2A 3LRKA 4UNVA 1RCYA 2CBOA 3AAZA 5AB1A 3LD8C 5FYLL 4R3SB 1HQ4A 3A4EA 4PP2B 3GMRA 2EDJA 5H37A 3DI3B 3GJFH 2B1OA 2BCKB 2OJEA 3KW8A 3DO4A 3D06A 5FUCE 4HX1A 1HDMA 5FO7A 1KY6A 1CT8B 4HCRA 1VCBC 3QCVH 2ATAA 1WFMA 4OZFB 5GS3A 3VRLE 4BRYB 2ZIDA 4PJ8A 4Y99C 1JPSL 2ZX7A 5DFVD 2GUSA 5DJYA 3TL5A 3TIEA 1UURA 1NGPH 5EBWB 4EI6A 3SDXA 4OD1L 5JXEC 3OXSA 1WBZB 3X17A 1ZWIA 5ACLA 2IQ9L 3WFDL 4M5SA 1MUJA 3APCA 5I18L 1A65A 3UJJL 3WLWD 4PFEA 3IMBA 4MQSB 1YQ4C 4P5TB 4OI8A 1YHPA 1RZ7L 2F53D 1J8HE 1O6SA 2YC1A 4MDIB 3RKDD 5ICYB 3LRGA 5ESVA 5CJXA 1CIDA 2YSSA 3GRWH 3PQYD 2LTQB 4OW6A 7FABH 3RL0C 4TUKL 5HHQB 4QHPA 2EDTA 2P58A 1D5BB 1AE6H 1OCRB 1VGKB 2NPLX 3D39B 4MASA 4KHTL 2BY3A 3FB6B 1PP9G 1DANU 1D2OA 1I53A 3FC8A 3QUYD 4OGYH 1WGOA 2MSPA 4GKZB 3MPCA 4U49A 1GAFL 1P4LB 3QRGL 3HS0C 1G9NH 5CJBA 5I0YA 2J6EL 5F8QC 5I5RA 3EYFA 2IANB 5H37G 2J88L 5IBUG 3W9EA 5CFHA 4G70B 3K5RA 4LIQE 4U3FG 3CFKB 1BW8A 4GAGL 4IFDK 4DZOA 2B9AA 5T1MA 2GVYA 2BIOA 3O9WB 1KFAH 5D5MF 5I1HL 1M7IA 1R0AH 3E8VA 2IPKA 2MH4A 5BZZA 3VB9A 2H0FA 2AZUA 2XWJA 1EC5A 1MHPH 2A6IA 4NFBA 4BWTA 3B83A 5EPMA 4FFTA 4PYGA 5IHUH 1NAKH 1NC4D 3WIAA 2I07A 1JUFA 4NHCL 4XBEL 1YECH 4N20A 5F89A 3ABGA 1ZHLA 4N4YB 2C9NY 2A0LC 4H88H 5IB4A 3WU1A 4IBQA 1E8XA 1PZUB 3VMOA 4BELD 3MNMA 3FFCB 4HFUH 3SDDD 3V5HB 3O45A 4TSAH 1SQBJ 1N26A 3MN8A 3FHEA 5JMOC 1NCUA 3C5JA 1ZSHA 2JNZA 1XF5A 3ZYJA 1KXVA 3CHQA 5ISZD 2APBA 1F11B 3GSXB 4WW2B 3RTQB 2WLLB 4F8TA 3FYIB 2WPQA 2JVUA 1G7LA 1NGWB 4RZCA 4I89A 5KJ7C 4M1DL 3II2A 3TGUJ 5DK2B 3MLSH 3ZYIA 4CADA 3C12A 4ONHA 3ZKND 2QL1A 1XCQB 5KVDE 2NY7L 5C0BE 3WS3B 4PD4E 3JUZA 4R4ND 5D96C 1IJNA 1KEGL 1GGBH 3MRCA 2EACA 1FC2C 3B1TA 4BZ2A 3RWFB 2IH9A 1KB5A 3GI9H 4HBCH 1PCSA 5HTSA 1ACYH 2IFGA 3BFWA 1FGNL 1I4FB 2QTEA 4WTXA 5GGTL 2R2EA 1KACB 1NCGA 1URQC 2R5DA 2H1LM 4ZS7L 3U36A 5EEWA 4C7RA 4AJYV 1AHWC 4M6MH 3TBSB 4QRTB 2AZAA 5HDQH 1T8ZA 2VR6A 1ZKAA 2J8UB 4C56B 1JHLH 3ZR5A 2P24A 1ZS2A 3C5ZD 1NPNA 3A6OA 1U8QA 3C6LA 4WI9A 3V10A 3QUKA 4Z7VA 2DL9A 4Q4IA 2XWRA 1QR4A 3ULUL 3T0WA 5KS9F 4CU7A 3N41B 4KVPA 2WUCH 1WFIA 5LCVH 4DP1X 3CFEB 5BW7A 2UY7B 1NSNL 3KYNB 1A6TA 2FJGA 3SDCA 2UZPA 1YEEH 5LKNA 3Q01A 3CFUA 2MKLC 2APVA 2FL5B 2IDTA 5MEND 3GLMA 4WDIA 2XA8H 3N04A 5DSCA 4EI5D 4X0KA 4YDVA 3NDYE 4PJ9C 4G80A 1FFQA 1E5AA 2IGFH 4PJ7F 4L1SA 2F53E 3LW5H 1UGKA 1OTUD 1DLFL 3G3LA 1TQBB 3GDBA 4R2GB 2WVRA 3GFUA 1S46A 2GTZB 3LQAL 4PGDB 1LEGB 1T89C 2FYYA 4GG8B 2O5YH 2X40A 5M7QA 1QO3B 3WY4A 1MRCH 1NCDL 4FF9A 4S10A 2IQAB 4Q8BA 1SDDB 4RBPK 5LXVA 2NDGA 2OYMA 2FHCA 3TCXA 3MLTA 1ZW0A 1N7SD 4MDJB 1GK6A 4XPFH 5M1BA 5D1XA 2A9NL 4N0RA 1WAAF 4QMEA 5HI5D 5IZ7A 3ASOB 4KC3B 3TBYB 4PJDF 3LHPH 3HUJF 2ZYDA 4KITB 3RBGA 5I15L 1TYEB 4AIZA 3FK3A 4NZ8A 3NIDB 1HXYB 2AP2A 3KS0J 4TSBL 5AFAA 4XCFL 2FGWH 3ZTNH 3S6CA 1I3GL 3L4XA 4MAYB 3UTQB 5JXAH 5FYLE 2XNDH 4QXVA 1NBZA 3IBEA 1BLNB 1I1AC 5IHHA 4C7NB 5A2CA 4TUOA 2EUXA 4GAAA 4OAWB 1MQ8A 3HLAB 2ZXXA 4HIJA 4NZUH 3HBGA 1ASPA 1DVFA 1LTGC 2BSDA 2WAQA 1JN6B 2X4UA 4Q6IC 3TWCH 5HYFA 1T2QL 4EVNA 3IEAA 4HPOH 4PLNC 4LGPB 3I9IA 5BQ7B 2Z34A 4UTAL 1HOEA 2YD3A 3MRBB 4IRJA 4U3XA 4KX9A 1NFIB 3FT2B 2H9GB 3L2MA 4WV1C 3U0TB 5D1ZB 3R19A 5ISZE 3SQOH 1OW7A 1JNLH 3MRGA 1E42A 1AGFA 4NQCA 1NCCH 3D0LB 3MRDB 1WT5A 3HZKB 1D5XB 5IHZA 2DI7A 1MAKA 5EOCL 1LO4H 2XTSA 4JPWH 4OZGE 5MEOB 5I6KA 3GBLA 3MDJA 2ZKYA 4NZJA 3PWNB 4HV8B 1L7TL 4OM1L 4PVLA 4KNQA 1SNRA 3CC5A 1Q9LB 5C0FA 3PL6B 4OCXH 1KBGL 4J3UA 3LKOA 4JCLA 2Y9YA 4HIHB 1P4IH 3TVMD 4RRPM 1U3NA 2F74A 1N64H 5KTEL 3PAYA 4H25A 2GY7B 1MXGA 3THML 5IVXA 5FGCB 3VE0A 1S5IL 1XIWC 1QLRA 1IM3D 1WH0A 4B9ZA 4ZNEE 4I88A 1YQ2A 2CPUA 4ZQKA 2P7TA 3FOLA 1JY3P 4G3YL 3SGJA 4YHYB 4ODHL 4Z5RB 5LAPA 3M7FB 3IMTA 3MV7B 4PJHB 1T7XA 1XFPA 2GBAA 2QGBA 1IGIL 1NAMB 1W0VA 4AIXA 4CVXB 4F15C 3KJ4C 3QG6B 3DV4B 4RBPH 1QAWA 5AYUH 2GIXA 3L74J 4V33A 5CMZA 1Z9MA 1SQQG 1YY8A 3TOPA 4KJQD 4Y7OC 2WD0A 2I7SA 2XBDA 3SFEC 1T7WA 4C57C 1GL2A 5MENE 4F2FA 3SJVE 3GHBL 3TO4B 5HYJA 4N3TA 1MRFL 3REWB 5DJAB 3BQUB 5G4MA 4AVIA 3VG9C 1VQ5P 4LHUA 4MJID 2YBRA 2AW2A 4JPVH 3Q44A 5GTHE 3UTTB 2BMKA 2JKNA 5BOJA 1BM7A 3G5ZB 5JW4Q 2QBWA 2NLJA 3Q8FA 1NO4A 1RUMH 3OQ3B 3D6YA 3MMEB 4JHBA 4P06A 3CXDL 4P23C 1DEBA 1C5CL 2QDWA 2VH5L 4NQDD 4G8EA 3H1LD 2NY2D 1OB1A 2OMZA 4YSUA 1U8OA 3FT3B 1SVBA 3FB8A 1L4AD 4JMXA 5GGVL 4MNGA 3IFNL 2AGJL 4ATTA 4EXPX 4XPAL 4L3EE 4O02A 4PWEA 2A9CA 2EO1A 3VXNB 3S2AA 2OX5B 1I7UB 1ZVSA 1JY3N 4KTGA 1NGMB 4UZSA 3V4PB 1QWNA 4JGUA 3QUZB 2CNYA 2BDNL 3IRCA 4U1KA 1PG7W 3CJJA 4H8WL 3QUXC 4J1UA 2PPCA 3TV8A 4NS0A 1KB3A 3RIFF 4NZDA 3WGUB 3HE6D 4NKQB 2NY0B 2BIPA 1CGYA 3NXSA 2PCYA 3INUH 1RIVH 1HJBA 3INOA 4JHAL 3T0DA 4M3LA 3LH8A 1SUHA 2V4LA 4O51A 3O8XB 2HAZA 1MIEH 3PJSB 1S5LE 1JDCA 4Z7UE 3L1FA 1R6VA 4QO1A 1WUZA 1SQPJ 1KC5H 1GKEA 2QSCH 3SE6A 4G9FB 5JIIA 4WI6A 4MCMA 5C0DB 1FN4A 1MJ8H 4PSRA 1DSWA 4PJCE 3RGVC 3S5YA 3CH1B 1U57A 1PAZA 1T22B 2HRGA 1PNDA 4UIKL 3WXWH 1SQXG 1VAHA 5HVHC 4LF3A 5CD3A 1WITA 4G11A 3Q2VA 1EEYB 4AQAA 2ZWZA 3L5WA 2VN4A 4GNKB 4NUJA 4Y1AA 4P46A 1KQGB 4J3OG 4PGJA 1BPLB 3BEVA 4PPTA 5DUML 2NW2A 2MKWA 5SWZE 1KIUA 1XZ0A 3N85H 5C0GB 3WY2A 1DQDL 2XZAH 5LDSA 3J07A 2BSRB 2WPVB 4PJGA 2NY4B 3MFGB 3NACH 1MDAA 4LL1A 5EO1A 2DTML 4Z7WA 2Q10A 1I3UA 4L4TA 1JWSA 1NCAH 3P40A 4U1IA 5A2LH 1EMTH 1EIBA 2DLEA 4LSTH 5CSBA 4CGTA 3ZY7A 4BFGA 1M1JC 1J1OH 2I9TA 1YPZA 3T08A 4BK4A 4QRPB 2FYZA 4JDVB 3T3MF 3IGAA 3MACH 4YDKL 1HWTC 1YEDA 4J4PD 4KX7A 4ZYKA 5T3ZD 3VM5A 1BD2D 3BLKA 5DHYA 4UILL 1JZ7A 2G5UA 3VSVA 3C5SA 3WNJA 2B39A 4RESB 1YJ9P 1BFVH 3S3DB 1P5UC 4Z3JA 3WAJA 4YSRA 2PYEA 4ELKA 1HZKA 4KK8C 4XO9A 2AEPH 3HNSH 2CDGA 2NR6C 4MNQA 2ZUSA 5D2LF 2WZPA 2HVKA 3T0ED 3TYYA 5CBAA 1XGQA 3BPOC 1L4IA 1FOSE 4Z7QF 5CZKA 4XPGL 2FYNC 3IAQA 5DUBB 2JIXA 3TK1A 5HYQB 3WTXA 1YQVL 3SEPA 2W1NA 4PBDA 5DI8B 3ZDXF 1PGOA 2P28B 2DEYX 1FFPA 1WMKA 1XR8A 2H2PC 1WQVT 3DIFA 4P2QB 1RHZB 3O6FA 1KTLB 3SE9L 1V3KA 1JTTA 2AQTA 2A74C 4UB0L 3ARFA 3P9MB 1DBMH 4WK2B 5HGDB 1CLYL 2XVLA 3BZ5A 2JI2A 4LEOB 1AYOA 2YKPA 3EYUH 4RNRB 1K6QL 5F1IA 3IJHA 3ARDC 2YUXA 1OAUH 2WQAA 2EKSB 4NQDE 3WMQA 4FTVA 4JFZL 1T1WB 2ZP0T 4CUCA 3H1LE 3SY6A 4U2ZA 2IWKA 2XTJC 3G7TA 3A21A 5J8OA 3ZTJH 2DWEA 4L75A 1ZJBA 1G9NC 2JTYA 3QBTB 1R46A 5CINH 2QJKC 4N0YH 4DN3H 2KS1B 1EV2E 1GTFA 4YBQC 3ABMB 3UBXB 1JD7A 4TL4A 5CBOA 4ORGA 2XV5A 5FK9A 3ZHKA 1UC6A 3HKZA 1SEBA 5JR1H 2HTKD 1ODAA 4TNWF 2NTFA 2AXHA 3TBCA 1YMHB 2Y7QA 4P99A 4Q9QH 3EYVA 2IMMA 4WHYG 5AB2A 5JW3L 5KAQG 1FFRA 4I3SL 4H2AA 2O5NA 1J8SA 3COOA 2KT6A 4BM7A 4ZFOA 4EMZA 2FX7L 5DD0H 4EUPB 5FHBL 4JLRA 3QDJB 4M48L 1YEHH 2F54A 1A47A 3SCMC 4WZ9A 5IGXH 2CK0L 2Q86A 3C9NB 1FH5L 4F7CA 1KBKA 3C75A 1GOHA 4FXGA 1AIZA 2W94A 4YUEH 3QIUB 1FNSH 4LT7A 1OARL 2OSLA 2YPKB 1URIA 5IG7A 2B1HL 2LR4A 2RBLA 4LEXH 1N5YL 3LHAA 4BA0A 1JD9A 4BZ1H 5EC1B 1VL2A 1KPRB 1AKJB 5DGRA 2PTUA 3V7MA 4RVBA 4ZX5A 1RZ8B 1PGPA 1RK1A 3CDCA 4N8VA 4KTDL 4GIAA 2C0WA 1U8MB 3D50A 5I17B 5MEQB 1CSBA 1UD5A 4OIAA 1SQPK 1NEUA 1NQBA 4KMTH 2X89A 3GSQB 1B2WH 3FN0H 4LEBA 2IBZG 4HAKA 4KRMB 4PGEA 2ESVA 3AGVA 2Q8BL 4LKCA 2P1YA 4K8RL 1Q81Q 4UU9B 1A6ZA 2P49B 1OTSC 1YTZT 2WV3A 2ENPA 3ISWA 3RYMA 4DK5A 2VM9A 2VDNL 4Y4KC 1AQKL 1RKRA 3HPJA 4LP5A 5KJRL 2AHIA 1IZNB 4ZTPH 1HAUA 1N0XL 5KVGL 4A55A 3JTSB 5HY9B 3LD8B 5F6HJ 4IHOA 4EOWL 3FCGA 4ICXA 4XCNA 3MRFA 3IRZA 4QHKI 1KPVA 4S1SH 2W5PA 4R83A 5T3ZE 5I75B 5DS2A 1RU9L 2FEEI 1BD2E 4GI8A 4IBUA 5FKPB 4U6HA 5D70L 2EXSA 4QY8A 3VAEA 1JZHA 3F7VB 2DLGA 4JG9A 3F89A 4Y99B 5APVA 4DT0A 2EEAA 2OSXA 3A23A 3DECA 3CX5J 1IGFL 3US1A 1PLCA 2RCSL 3B4SA 4M7LT 2E76C 1G7HA 2G5BA 3TJPA 2A2QT 3T0EE 2Q3XA 1D7DA 1A6VH 3K1KC 4AENA 2XV3A 3D4CA 4JY5H 2IOOA 2NX5D 3OKDA 3RWCB 1FYTB 5BUPA 5IM7A 4N8VG 1LWJA 3HCVB 4IU3A 1NKZB 3IJSB 5C0JB 5DZ9A 2N56A 3R0MA 3OL2A 3Q5OA 4O2EB 5IBLC 1RP9A 5F9OH 3FHQA 3VXUB 3PP3K 3GB7B 4Q9CA 5HD8C 4BIKA 3HC0B 3GRWA 4XNYH 2R1WB 4CU8A 1LEKA 3CXFA 3RL0B 4LRIA 5F1KC 2P46B 2NCMA 2P5WE 1UTDA 4UAOB 3GTTA 1NOLA 1JNNL 2HVJA 1ID5I 4BH7A 1YNTF 5JIMA 4JEGB 3EGSB 4GXVH 3RVVC 2X6BA 2X70B 3HS0B 2FXMA 1JGEB 5KSBB 2MCG1 1SOXA 2Q2LA 3L72E 4N3UA 3L5IA 3MCKA 1LM8V 4KI5F 4XAWL 4D3CH 3IVKA 2XZCL 1A5FH 5FF6A 1VADB 1D9KC 1SF5A 3VFVB 3ULVF 4GKNB 2AQSA 2TRYA 5FO9B 3V4VH 4DQOL 1WWWX 1AS7A 1LO0H 1WG3A 1NUGA 2D0FA 2JKWA 2W95A 3BP5A 3MLVL 3LEVH 2LLNA 4P4KA 3TCLA 2FAUA 1DQJB 5BU5A 1E9PA 1EZLA 4LLDA 3AEEC 3PP4H 4LOUD 4NWTL 1A64A 3HI5L 3RB5A 3ECVA 3TA3C 3SDXF 5E4IA 2IALB 3U7AA 1DBKH 1B4LA 1OWAA 2J58A 5TDOA 3OW2O 1RV6X 4JFEA 4OLZH 4XNMB 5A1AA 3SYPA 3LDBB 2ADGA 2DJ4A 3A0HE 1A6AA 3DURB 2WYTA 3HIZA 3KPLA 5GRVK 4LCVA 3SKNA 1VQ9P 3DXAD 1HTLC 3WFEH 2WKOA 1GGIL 1A7NL 3QJSB 1KV3A 4ETQB 1KYOD 4FYTA 4UQ3B 1IAIM 4I2XE 3C60A 3U0WL 2EVJA 1OL0A 1QFWL 1MFEH 1UM4L 3M88A 4UUJA 3Q7JA 2J4WL 3S36L 4OZIB 3MLZL 4ODWB 5LGJB 3WJJC 4N0UB 4FZ8L 3C8VA 3DIDA 1MJ7H 4WI7A 4JDEA 5CMAB 4BUGA 2CIIA 3AC0A 5AAMC 2IG2H 1FBIL 2AEQL 2OJZL 3KXDA 1EH9A 2C9UA 2EZ0D 1ZXGA 4IJTA 3WBDA 4OBSA 4HLZG 5APSA 4AEHH 2PCXA 2X2UA 1AVYA 3HG1B 1RZJH 5C08E 4GSXA 2Y2TA 2W0FB 3L6FB 3QPXH 1G9MC 2JKTM 3VWJD 1PZ3A 2I9LA 1K8IA 1T83A 1AGDB 3H3BC 3BI9X 3GMOB 2VDOH 5EU6A 4LAQL 3P3RA 5F7AA 3AREC 1UXLA 2HJFB 3HN3A 2QR0B 1HEZB 1A8ZA 1XH1A 4IOIB 2EAEA 4QF1A 3SBRA 4MA3A 1INEH 4Z0XB 3T4AC 3IT8D 1FVCA 4JHVA 3FONA 4PJ5B 1RZFL 5B1JA 3PP3H 4G8GD 3AS1A 2FE0A 2ZYIA 3RHWF 1IGTB 1URQB 3CBKB 1QI3A 2XN0A 3ZE0B 2W0LA 2WP3O 2GBVA 3ZO0A 1RSFA 2QTVA 2AJSL 3QEUA 4Q0XH 4GINA 3B2UD 2IX7C 3RP1A 3PAUA 12E8L 4HS6B 1FZJA 1JMZA 1GS7A 1M2OA 2QPUA 3O4LB 2EXTA 2KI7B 2F0CA 3CFDB 4ZMVA 2WYHA 3L70J 4HEPG 4YHPA 3KEHA 3LPOA 3OPZH 2JB6A 4Q56A 1MCPL 5JLZB 3MNZB 4HJ0C 1A1NA 1CL7L 2D3NA 3EYOA 3P11H 3PIQA 3KYMB 1QEWA 1SXNA 4G72B 3GJEB 5HBBA 1RF1A 5I0VA 3D0VB 2UYLB 3TBTB 4PJ9B 3VMXA 1BGYE 2R69H 4QRSA 1YYMH 3SGDI 2WXFA 2E46A 3HZVA 2AITA 2R4SL 3J27A 4WY4A 2FX8L 5EORH 2ZX6A 4EZMA 2PXYB 4P5KA 4YFLI 2J55A 5B5EH 4I6MC 4YXKL 1I8KB 2WJ7A 5C0CA 2BIIA 3CWBG 3QDMD 5F7DA 5D7EA 4L8BA 4HC1A 4JGJA 2VSKB 2FQEA 5KANG 1UG9A 1YEGL 3BH9A 2WHVA 4X6CF 1X5YA 3QI9D 1AFVL 1M6OA 4BSWA 4JPIB 4XBPA 1FZFA 3EWKA 4L9LC 3BAEH 2NNFA 1E8WA 5CEYB 1Z66A 5AYTA 5I1IH 1E4XI 2QV4A 2ZYHA 3ZE2E 1ZA6A 2YGPA 5IJKC 3QEHB 3M86A 2CKBL 3NEXA 4AEEA 3PS6A 3V4UL 3WXVL 5F0JB 4OI7A 4FYQA 4F1SA 3FQWB 2YXFA 2XICA 2FYUJ 1I1AB 3WHE1 4PG9B 5ILTL 3SGKC 1TQCC 3OAYK 2X4QB 1RE3A 4QXTB 3ZSSA 5AW7B 3DGCR 3VNZA 2D9CA 4NO2A 3TFKC 4PB0H 4LLVA 2EYTB 2BS8A 2IV9A 3LEXA 1KYOE 2XZQH 1U95B 2R0LL 4X7TB 3TX4A 3NFSL 3FO2B 4ZDHB 4I0PA 5DEGB 4TULL 4FG6D 2WWMC 3BT0A 3WD5H 2VAJA 4C54A 5BQDA 3OKNA 4PY7B 4KJPC 4R3SA 3SE3C 2HUEA 3KPEA 4PP2A 2E75D 1T7YA 2BCKA 3EO9H 1FNLA 3MUDC 5I6NA 1FH2A 4KI1A 4L4VB 4N2KA 5GZND 1GS6X 4Z8FL 2IWEA 2QQQA 4MWFB 3KPMB 4OZFA 3NH7H 2M0BA 5AVQB 2CHWA 3L81A 4YDLC 4MB3A 5DQDL 3VFGL 4BH8B 2XPGB 2NY3C 4GSDH 1VZIA 4RQQB 4I48A 5T3XH 5MP6L 3RLSA 4YVNA 1ZY9A 1GIGL 3K8LA 1FNAA 1CR9H 3MJ9H 3X1EA 3NA9L 2NSXA 5EBWA 2AS5M 1OO2A 1IAMA 4MB1A 4HIEB 4QLWA 1S5LX 1DEEB 1ZHNB 1BGXH 4N8UA 5JW5B 2UWEB 2XKMA 1MFAL 1USZA 2OMYB 4LCIH 2BIQA 3PQYB 2K8QA 4P5TA 4G8GE 4ZS6D 4FYRA 1XIWB 4GOSA 4LVOC 3UDWA 2R39A 2WWOA 4MDIA 4ZOAA 4P3WA 3FSZA 5ICYA 2BNUA 3VXTA 3JTTB 5E9DD 3V52H 4DEUA 1ESOA 2OI9C 5ETUB 1S72P 1D5BA 3F3HA 1KJ2H 1VGKA 1EA9C 4F15B 5E99L 3D39A 3KJ4B 1OB0A 3FB6A 2EDLA 2BHYA 4GKZA 1DE4B 3QEQD 1SYSB 1F41A 1HHKB 4UNTA 2Z93A 1VF5B 3BSGA 4NUGL 5F1OB 1JVOA 2IANA 4LMQE 4BYHA 3IJYB 3CFCH 4AGLA 5SWSB 4J12A 4YE0A 5E6ID 2G2RB 1NIFA 4F9PA 1IBDA 2Y1ZA 4MMXA 4DGVL 2LOEA 2DQGL 3JVGC 4OZFG 3VG9B 3DX6B 2QEJA 3O2VL 1BLIA 4IRSA 2FD6L 3FT9A 1FV1B 4KAQL 4YFLF 2VXVL 1CDUA 1Q90D 2EDKA 3B9KC 3FT4B 3WO4C 3O9WA 2YAFA 4W6XB 1W8OA 2P8MB 2BCMA 3L7EB 2JLLA 1A22B 4P23B 1UT2A 4FFZH 3BUQA 2XVKA 3QDME 1VFOA 4HJJL 5D7SH 2X3BA 3OAYH 3PRZA 5JQHC 3ELAT 2G30A 2X0WA 3Q48A 5TJHA 1SLQA 3ABKB 3OHMB 3BIKA 3VO0A 4KVNL 2JJUA 4PG2A 5CKGA 1M57D 1CGSL 5FFGA 3ZOAA 4BXLA 3ISRA 3S88H 1LL1A 1WBYA 1SLVA 3NAAH 4WY7L 1L0ND 5IB2B 3FFCA 1NH6A 3DETC 1IKNC 4JFDB 4ZSOE 3V5HA 1KFMA 3O8ZA 3BWUC 1EXJA 2FWOB 1SY6A 4QKXB 1V10A 2O5ZL 1F11A 3AU1B 3GSXA 4RFOL 2ZFCA 3NRQA 2JMRA 4PWGA 4WW2A 2KQMA 4XNAA 3RTQA 3V7AE 3W67A 4ZFGL 3QE5A 1NGWA 4XNDA 4P5RA 3HKFA 4IRZH 1WS8A 2Y23A 4X8CA 5DK2A 5EH1A 1H8OA 2BVYA 1OTTD 4F8PA 2ZCKH 5DD1L 4ODTH 1OLZA 2ZCHH 1UXSA 1XCQA 3G04B 2NY5L 3FUNA 3WS3A 4WUKH 4O2FB 1KJVB 2HTLC 4OCLC 3CZFA 2FYUK 1TKWB 1JWUA 3RWFA 3B5ND 3MXWL 1JY2P 1YCSA 3RJQB 3HZMB 2DBLL 5DQJA 2WLIB 4FTDA 3UAJD 4Z7NB 1DP0A 1H5BC 3TESA 1IC5L 1JTOA 4K5MA 4IKJA 3RGVB 1I4FA 2F8IA 4HKJB 1KYAA 3U7YH 3AUVA 4J3OF 3C5ZB 2EVIA 1B0RB 3VYPA 3E7JA 1WISA 2VMFA 3MZGB 1H15B 1LJMA 3TBSA 4QRTA 4TV3A 3RPKA 1EK3A 1I7ZB 3IE4A 5F7KC 2IBZI 2J8UA 4C56A 2FSEB 3RZCD 3KL3A 5JQ6H 3MRHB 1IU1A 3EOAB 2CCVA 1YJDH 3RVXC 2Y9RT 5CLYA 4YSCA 3TZVD 3HMWH 3U1QA 3KYNA 5GS0H 1W72H 3EFOB 1L9QA 5J12C 3DKHA 3DUSA 2CSPA 2VRSA 2FL5A 2LLLA 2VZSA 2YPLB 1M1JB 3KLKA 2PAJA 3AG4B 1JHKH 4YHIA 5T1KD 1SQBG 1HKLL 3BCFA 3FN3A 1H6FA 4P2RB 1G43A 1GXEA 5KG9B 2W9LA 5KBMA 1JPFB 2CHNA 5E9DE 2GTZA 4BFKA 3FXIC 1LEGA 2R23B 4PGDA 1YNLL 1P5UB 4YSSA 4GG8A 3TGUG 2O61B 2VR9A 3FQNB 3LS5H 4LBAA 4P2CG 5D71H 5JPNC 3LZFH 4JB9L 1JY2N 4FLSA 1SDDA 1DJZA 1Q9OB 2YRLA 2FYNB 3SYOA 1FNFA 4MDJA 1UZ6E 3UC0H 1D5IL 1ORQB 3ABLB 4B9KC 3TBYA 2PUQT 3BDXA 3GGWB 4XT1C 2X4NB 1I9RH 2AJVL 1C5BL 1NPJA 3K2IA 2A74B 4PP1D 4BFFA 3UCRA 4ZKPA 4X5RA 3MOBH 5T1LA 1HXYA 2XJKA 3EJUA 4MJJA 5DZAA 1T20B 4OLUH 3RI5K 4XCYB 4MAYA 3UTQA 4GUPB 1TU3F 3S3PA 5I9QC 3QUMB 4M8RA 1TETH 3MZTA 1CK0L 3D7PA 1NGZB 4C7NA 3GSNB 4HS3B 4JG1L 5CZXC 35C8L 4OAWA 1KCRL 4IGBA 5KVDH 2XTJB 4I85A 3HLAA 4PD4H 1GW6A 1JZFA 1UD6A 1NEZB 2QJKB 5HHOD 1JN6A 4JDTH 4ZAKC 2DLTA 3GMNB 1CDCA 4HETA 1B4JL 2OTJP 4WEMB 4WVRA 2ERJB 1NMBH 3FZUD 3FU6A 3NIGF 3N6YA 3MRBA 1L0NE 1FUNA 2D73A 2AEJA 4JG5A 4F2ME 6TAAA 2JJTA 1HNYA 1NFIA 3FT2A 3Q1EA 2RR3A 4JM4L 4XPBH 1J9TA 4M7LH 5KAQF 4Y2DD 3LVTA 3ZDZB 4HK3N 1I85A 4PH8A 1U93B 2H1PL 2GIYA 3KLAB 2BSBA 2MIZA 3FSAA 1X7QB 3T2OA 3MRDA 3MJWA 2WSDA 1D5XA 3HZKA 3AITA 4TXVB 5HGGS 3ZZ1A 2C1OA 4NPFX 3FAXA 3EJQA 2VCOA 4LP4A 5DO2D 4Y9FA 2FEJA 5MEOA 3GSWB 2ARJQ 3EJZD 1ED3B 4FQHA 3FU8A 3RUGA 3SCMB 5F3HB 3PWNA 2FIRT 5KZCD 4HV8A 1ZV2A 2NUPB 2IO5A 3ESMA 1M90Q 3RK3D 3NFPA 4JVWA 4PUBL 5E9NA 1TZGL 1XF3B 3CLEH 4IEFB 4L0ZA 1UJ3B 1YO4A 1YRKA 3PL6A 2GJ6D 4F58H 2WTRB 1JPTL 1WZKA 2DJUA 2WN3A 1YMMD 3ILQC 4HIHA 5DJ2B 3ZIMA 3BYYA 1WD9A 2EKJA 3DX9B 3N43B 3ORJA 4NN6C 4PJXB 4KQ4H 3WUUA 3TIDB 2QFPA 5L2KE 5LQBH 4UTBH 4OR1A 4RMBA 1BV8A 3K0YA 4MS8C 1QFPA 4FQLH 1XGTB 1IUZA 5FUZL 1OEZW 4EEEA 4I9WD 5IQ9B 2HZHA 4PJAB 4Z5RA 2NRDA 2VB5A 5E70A 1RZJC 5F9WC 4ZX6A 2BVTA 3MV7A 4PJHA 4RMTA 4ZMWA 1NAMA 3VXMD 1XL4A 4CVXA 2RD0A 3QG6A 2E9BA 2J8HA 2W8CA 3DV4A 4ODXB 1UHVA 3O0RL 4Y4KB 2CO4A 1FE8H 1BAWA 1GZPB 3JZYA 2E7BA 5DZOA 3H1HG 4FS0A 5B3JF 1BZ8A 1OOWA 2LU7A 3L75D 3CZNA 4YGAB 2VZOA 4MJIB 3RDJA 1RPQA 4HF5L 4KXBA 4G9DA 4AQ8C 2VDMB 3LMJH 4JFSA 2XKNA 3TO4A 2LKMA 3AACA 1JVLA 3U1SH 3BQUA 2XWTB 1SOKA 5FYLH 4F8OA 1UT1A 3UTTA 2WC7A 1LK3L 2Q5UA 3G5ZA 5D5ME 2ITFA 5DFWH 3FU3A 5DEJA 4D9RE 3GLAA 2NY2B 2NT0A 3D48R 3MMEA 2DQ6A 4N2LA 4QRFA 4EIGB 5J4MA 1LMIA 3ZTDC 1SVFA 2E76B 4M93C 5KVEH 5I19H 1JPSH 3NJLA 1WCBB 4BK5C 4K94L 1IBGH 1YJWP 2EDRA 4JFPB 1ERNA 4G7YL 1SDYA 3GYRA 4YHZL 5SWQB 1EVUA 2IQ9H 2O01N 3WU2E 4ELMF 5IQ7L 1I7UA 2E74C 1ES0B 4OB5L 1BAFL 4S2SA 3UJJH 3V4PA 2BEZF 4B60A 3QUZA 4HJEA 3H42H 5HDRA 3CK0H 3PNRB 4JY4B 4GBXC 4N9GB 5D7LD 5FW6A 3IMRA 3GZPA 4KXZI 5AQ0A 3WOVA 2C9PA 1IFHL 3QP3A 2E7HA 1F3JB 4H20H 1KBWA 5E03A 4WO4C 1XSJA 1QFWM 2HKAA 2NY1C 4OT1H 4TQEH 2CGZA 2EIZA 4LLAA 3R06B 1QBLL 5EMYA 5HHOE 1D9KB 1GAFH 1W80A 2J1WA 3Q6GH 4RFEB 3ULSB 2B2XL 5IMOA 3V4VA 3OZLA 3PJSA 4V1DB 4A2LA 1IB5A 5J1AB 2DQDL 1LT9A 1HCYA 2KP8A 3UEZA 2AABH 2YRZA 4FI6A 4Y7MA 5D93B 4G9FA 1JZGA 3QIWC 5C0DA 1VFMA 3GD1C 3ROOB 3UCQA 4XE0A 4C83B 2Z7WA 5JIKA 3H3PL 3KCPB 1MCLA 5AW8B 1T22A 3CH1A 4CU6A 2FBJH 2YMKA 4RGNE 1UJTA 1A9VA 4TOYL 1EEYA 5APUA 3G4SP 3DDFA 4S1RL 1JXJA 4L1TA 1MAMH 2RHEA 1LTAC 3V4WA 3KPPB 2J59M 1C7TA 5KS9E 1NKGA 1XCXA 5C0GA 3IPBA 3F85A 2BSRA 5EB9A 4CNIA 2YD2A 2VN6A 3RK3E 2L7JA 2ZT9C 5FKAB 2WBWB 2RAMA 3KGRA 4G6ML 4XBEH 2XWDA 1EO7A 2NZ9D 5D6DA 3IFOA 2IC2A 4WFED 1YN7B 2C1PB 4N78E 5E79E 2IBGA 3MV9D 4NO3B 5GTHH 4QRPA 4JDVA 1HSAB 4NNXB 1G0YR 5CEZD 2FQFA 3ALXA 3DVNB 1MW2A 1LYQA 1A8JH 5KYXB 1FF5A 4I9WE 4OIBA 1PDKB 3NZUA 1OP9A 1N0LB 2D7TH 3JV4B 1FNGB 3CXHE 2SODB 1XGUA 1UZ8B 3FF7A 3S37X 3IGFA 5I26A 3L1EA 3M46A 4LSVL 3LS4L 5TE4L 2D03H 5BNXD 1WAAE 5DUBA 3SGEH 5HYQA 4PJDE 3T4AB 2UVEA 2R7EA 3NK4A 3L75E 2ZWYA 1CFNB 3GEWB 3HUJE 5DI8A 4B9PA 4OJFL 4BFRA 1TEYA 4YO0B 1Q9KB 1BCCG 2FWSA 5CJ0A 1KTLA 3W5NA 2WKOF 1BAGA 1VIWA 2XU6A 4HSCX 3W68A 5FW7A 1IBZA 2P5PA 4ODVL 4CSPA 1ZHBA 2NYYD 4YPCA 2ZAIA 1NDMB 3P9MA 25C8L 4WWPA 2OYIC 5FUOL 5GGTH 5HGDA 4JRYD 5I5IA 5IMMB 1INDH 4TUUA 2JKJA 4F7PB 4ZS7H 1RURL 4LEOA 4RNRA 4ENED 3IFLH 5AL0A 5JA9A 4FQXD 5D7IB 1TSRA 2EKSA 4XX1G 5DJDB 1T1WA 2AKRB 1TYJA 5I0ZA 2WOYA 32C2B 1KLUB 2BRRH 4PGZA 2Y2YA 1S5LH 2AEMA 1DH3A 1CGXA 5GS1C 4R4FL 3PHLA 3GLDA 1BE3G 3RDTC 5HDWA 3UBXA 4EPSA 1GZQB 2PWDA 3CAFA 3L4ZA 1RMFL 2WUBL 2XDHA 3N44F 2N1TB 2FQDA 2OP4H 4V2BA 5DT1H 3POCA 1AQTA 3HHSB 3AWEA 3TNUB 3LOWA 5B4MC 1DLFH 1YMHA 1J0JA 3MODH 4NWUL 5D7LE 1AJ7L 4FD0A 4G7VL 2FUTA 4BKSC 1B2YA 3LQAH 1CDBA 1ML0A 2ZG2A 2A99A 2JQAA 1OSZB 1CE6B 5F9JB 5KVMC 2UXTA 1F6AA 4NKIL 2OTWB 3L1OH 3QDJA 4X9BA 5I0DA 5FYJD 3MGOA 5CJQH 5JPMC 3C9NA 3MGNA 1H3VA 2A6DB 2GY5A 4L9LB 3TH3T 3QIUA 4PLKC 2Y36L 2YPKA 4G59C 2VZ1A 5HGHB 2WCPA 5JIPA 5EC1A 3G9RA 1KPRA 2K6WA 2VYRE 4W6YB 5F7NC 3PE9A 4FQ1H 4RMWA 1RZ8A 3GHGB 2EH7H 2VR4A 3CVIH 5FUCC 4XCFH 2E8ZA 1I3GH 4QYAA 3WL9A 2ZCLH 4GSRA 3LIUA 1TQCB 1U8MA 4FNPA 5I17A 5MEQA 2V7NB 3TYGL 3P4LA 2DQHL 2KC0A 4I18C 4B9FA 1IKFH 1M71B 2N7AA 4YXHH 3GSQA 4I7ZC 1YA5A 4OKDA 3PWPA 3OV6A 3QQ9D 3QEGL 3BX7C 4POZD 4UU9A 1MZYA 4Z95H 2B77A 3FO1B 1D2PA 1T2QH 5HYEA 2WNGA 1R3HA 4Q7DA 2D2OA 5DF0A 1SLWA 4OVVA 4UTAH 3JTSA 3LJ3A 4FLOA 1LO5B 4YHLH 2YS4A 3BE1H 4NX0A 1LE5B 2GJPA 3LZOA 5GRUL 1NUDA 1YITP 3MV9E 3UO1L 3ZL4L 5ABAA 2HUHA 2ZJSL 4EUPG 1E4KC 5CEZE 1TVHB 4RX4D 5FKPA 4MD5B 4PJBF 4G6FB 4QLRA 1AYRA 2B20A 2VE6B 2NY3B 1EHLL 1DBJH 4FLHA 2BJMH 3OLEA 2W0PA 4YSQA 3MJ9A 1BDDA 1A1MA 4APQD 1IZJA 3LNIA 4TQHA 2VMDA 1YJDC 3RVWC 3TT1L 4PGBB 5GS0C 3RWCA 2W83C 2IADB 4PYHA 5B1KA 3QWRA 4MA8L 1RUPL 3HCVA 3IJSA 5C0JA 4O2EA 2QJDA 5ICXB 1SUJA 3ZXAC 1P7QD 3K4DA 3VXUA 3GB7A 2BY1A 4PV8A 5EV7A 3HC0A 3OLDA 2AERT 3IDYC 1IEBB 5KTEH 2R1WA 3QQ3B 1ZIAA 3QJHB 1PIFA 2OI9B 4U6YB 1F13A 1KJ2A 1OD9A 5ITFB 1MWAH 4BCYA 1HHIB 4JFFE 1FHGA 4GXUM 2HG5D 3D52A 3FQ1A 5I8OH 1JCCA 1JF1A 5AWNL 1EJFA 1C7SA 2OR7A 1P6FA 1KPUB 3IDNB 2WVSA 4L3FA 1HCFX 1VADA 3VFVA 4G6JL 5CCGA 5CLXA 3G6EP 3IAOA 3KHUA 1JRHL 1KENL 3TT3H 4AOFA 4OZHB 5FLUA 1GYVA 5GGQL 4N1CA 1PVHA 4GG6B 3AM8C 2AJYH 1DQJA 3QZMA 3GHBH 5IB3B 1RHHB 3ECUA 5H35B 1AACA 1DCEA 5B3SB 2D7NA 1MRFH 5C39A 2IALA 3WGVB 4FFZA 1EX0A 3KH4A 4X42A 2K45A 2D8KA 3OGCA 3DXAB 4QHNB 3EUUA 4FQIL 8FABA 3VRJA 1AGBB 3GG2A 2DEWX 2I5YL 4OCSH 1SQVD 1ECYA 4JANB 4LGSB 2KERA 2VH5H 1CGVA 4PTUB 1WC7B 3D6GA 1J1XL 1NLBL 1DBAH 4MDRA 2N3JA 4ETQA 3GXMA 4N2AA 4UQ3A 1EFXA 4R7XA 2ED8A 4OF0A 4XPAH 2CR6A 4OZIA 4ODWA 4XMLL 5LGJA 1JI2A 3IRPX 4N0UA 1H3WM 5KSAC 4WUUB 5CMAA 1KN4L 5T3ZH 4AGNA 4N26A 3T3ME 1PSKH 1ZT7A 3O41A 2HLOA 4P5SA 2YRBA 3VCLA 1OVUA 3KZ8A 1XCTB 2AI0H 5KAFE 2BDNH 1MFZA 1JPGB 1WA2X 2COVD 3HG1A 3KYOB 1SQMA 5BO1L 4H8WH 1EJOL 2W0FA 4IKKA 3L6FA 1PFIA 3BH8B 3DVGB 2BW5A 4ZUSA 1RJZA 1MCRA 3HA0A 2YQ2A 5DTFB 5D2LE 1FLRH 3RWDB 3GMOA 1P7BA 2VDQB 4JHAH 4ZO8A 3EJYD 4Z7QE 4KROC 3L73J 2WXOA 2YKLL 1OSPL 2G2NA 2HJFA 5CUSH 1M42A 2QR0A 4ENZA 3ZDXE 4IOIA 3EBAA 4Z0XA 4LSQL 4PJ5A 1N6UA 2W0KA 3AMLA 4P57B 3CCSP 1URQA 1IGTA 1B88A 3UJTL 4TF4A 2KYVA 1EVTC 4DKFL 2ZUXA 4MA7H 1Z9NA 5I1JH 3NEOA 2AJXL 1PP9D 3OJMB 2GYSA 1HQRB 5DS8A 2IAMA 1TIUA 4HS6A 3RVTC 1GC1C 1IMHC 1LNUB 2GAZB 3O4LA 1CC3A 4NBYB 4AEFA 3CFDA 3ESUF 5B1AB 2Z4TA 1CFMA 1ZLVK 1A02F 2CMRH 3T4YB 1KCLA 3QR1A 1UWFA 1SP4A 1S9XB 3MNZA 3P0VL 5DUMH 4WW2F 5D1ZI 5GRJH 4AGMA 3KYMA 4KI5D 1RE4C 5J12B 4WF7A 3GJEA 1ZSDA 4ZMAT 3ULVD 3BFOA 3F64A 3D0VA 2H6OA 2UYLA 3BGAA 3IF4A 2DTMH 4K7PL 5AVXB 4MHHI 1Y6MR 1A25A 4PJ8D 4PJ9A 3TBTA 1XTGB 4BWWA 5I6XC 1U7JA 1IRAY 4DGYH 1G5GA 4L1BA 3NCJH 3L2LA 1FAKT 4JFWA 3GNML 2PXYA 3SZ6A 2PKDA 4YDKH 1TOXA 3ZDYB 3S9OA 4YEFA 2JXMB 2Y5QA 3A0HH 2HKFL 4X9FA 3USSA 2F5BL 2LQRA 1I8KA 5HJ3B 1CYWA 5FM5O 3W81A 5DS1A 2VGLM 1N3NB 3K4AA 2C0XA 2WTYA 1NU1E 1F4XH 1I9IL 1X5KA 1S9KE 4LOVA 1VFBB 2Z64C 4YBLC 2I1KA 2MKVA 4XX5A 4CGUB 4JVPA 4G5ZL 2J8UF 3H25A 1QRNA 1E3ZA 1U8NB 1GU5A 3DX2A 4E42B 5CEYA 2WZAA 1YQVH 4RMQA 1ZLLA 4BZ2L 1KB5L 3IB4A 3L8QA 3VN0A 5C09B 3N41F 5ID0B 1K8DB 5HSFA 2J73A 3CC4P 1T6WA 3KWXA 4Y19D 4FX5A 2C3GA 1UD3A 2CDFB 1N73A 3FQWA 4Z1MH 2WITA 1I1AA 3M8OL 3OPUA 1BEXA 4GMSL 2BFVH 4PG9A 1RJYB 2BNRD 2BSEA 1E43A 4OVNF 3CHPA 3L70G 1L0LE 3E7KA 5IROA 2X4QA 2QIWA 4HWBH 4BFJA 1SQVE 2W27A 2C9VA 4K7FB 4JFZH 1A0QL 4ZAKB 4R4NC 1IVLA 3M1BA 1U58B 4U7KA 1LQSR 2DLHA 3P02A 2X4TB 3DYPA 1FG2B 1U95A 1KCWA 3OC5A 2OCJA 4X7TA 4KQ3L 4W4OA 4ZDHA 2Q1KA 3FO2A 4MZIA 5DEGA 3ESNA 3KNBB 1JEKA 5GGRY 4K55A 1E8ZA 3MKGA 2I60H 4PY7A 2EABA 1PD0A 2K6YA 4KDTC 4XVUC 3D71A 2JJSC 2H3XC 4DKEH 5CD5D 8PAZA 3UPRA 4A63A 3BUBA 1TNMA 1ONQB 5J13B 4L4VA 1CD0A 1LDPL 3HMXL 1AZBA 3RAJL 4MWFA 4Q97A 3KPMA 2K1AA 1DL7H 5EOTB 5JW3H 4BH8A 2A06E 4GMTL 1MCEA 4QEGA 2XPGA 1FGVL 3NIDF 4UOZA 4RQQA 1T66D 5K5GB 5HPMB 3AQDA 5DFTA 1JBJA 3ILEA 1K8AQ 3WS6A 3RIAK 1NBQA 3BD5A 5DUJA 4M48H 2O30A 2D3JA 3L37A 3HHRB 1DEEA 4WBAA 1P69B 1Z3GH 1ZHNA 4EI5C 5JW5A 2UWEA 4NRXB 3LN5A 2OMYA 4FXKC 3PQYA 3PWUB 4PRPD 2YMTA 1OSYA 4PU2A 1N5YH 1XIWA 5CGYD 1HINL 4HEMA 4FHJA 1HL9A 3KVPA 1Z5HA 3AQYA 3JTTA 5K39A 3V8CA 1PP9E 2FYUG 1OIPA 3QUYA 1J11A 3UP6A 5BV7H 5EA0H 2WBJD 2AJ3B 4KTDH 3ZVVA 3QEQB 4PVNA 2YD1A 1YYLL 4W9JC 3CPUA 4HWNA 5ETUA 3VH8A 4H8VA 1TQUA 4IDLA 1YDPB 2K6ZA 1WEJL 4JO1L 5KEZA 1A9BA 2GI7A 3D18B 1DE4A 1SYSA 4FJYA 1HHKA 4K3GA 3SO3B 5E6IB 4U3FE 2Z9TA 4Z3FA 4KI5E 4G7SB 3V4LA 3IAGC 2VLLB 5HI5C 2QSQA 3ULVE 4EDFA 3IJYA 3BISA 3CVCA 3A4AA 3L9RB 5AVRB 2VDNH 4IDJL 2G2RA 1KGWA 2HH0H 3ARXA 4NUMA 3JQOB 3TBVA 2ICES 2FFDB 4HOWA 4XWOC 4FNLL 4RWYL 4EOWH 1FV1A 3SDCD 3SDXE 1JZ6A 1NUFA 2PFXA 4HIQA 2VISB 4OIIL 5LWYH 2P8MA 1UADC 2R3CA 1L0NJ 1V54B 5A43C 4P23A 3AW5A 1QTSA 2JV6A 3ALPA 4M93B 4H13C 2AEFA 1DEEG 2FX9H 3JV0A 3SPCA 2PGDA 3CG8A 3LXCA 3S37H 5CJ8A 1SFCC 3IN2A 2RCSH 1KYOH 4ZPTB 1BP3B 5HI4D 1HF9A 4DT2A 3ULUC 2FB4L 2FECL 2DS4A 2KSJA 2V4HA 5EUKB 1UWEL 2B1AL 3NSDA 1U8KB 1GCYA 2Y07H 3CBRA 2GM4A 1I3RB 4PJHF 3AEAC 4OLWL 5IB2A 3DOIA 2E74B 5ISZA 5DRWB 1FFNB 4HMCA 1FVEB 1JYWA 1MJUL 2FWOA 3GXIA 3RFZA 4GBXB 4GP8B 4BJLA 2A45H 5D1XD 1JY3O 5KAIE 3AU1A 4G5AA 1EAQA 2JJVA 2FWUA 3VU2A 5JW4R 1YYCA 5FCUL 3T8XA 5E2UL 3LQAC 1O7SA 1IC4L 4PLJD 3S4SB 3KYKL 4Y2OB 2R29L 2NY1B 4MXQD 4PVMA 2DI8A 4F8LA 4YSEA 3TF4A 4GP5B 4D6TJ 3G04A 1VEOA 5CILH 3QA3B 5J9PB 1UM5H 4O2FA 4O9BA 1KJVA 1H8SA 2HT3D 3QUGA 4FNUA 1PAMA 1TKWA 2H89C 2I7OA 4XAWH 3ROLB 2KB7P 3HZMA 2H6PA 3QIWB 2I25N 2NNRA 3A6BL 4PJ6A 1OAZL 1KIRB 1SN2A 4Z18A 1DVFD 1TXKA 4EDXB 2BSCA 4HKJA 4AJWA 3DX0A 5KBDA 3RWGA 2FDBP 1YAIA 3EBGA 1OAXL 3C5ZA 2P3YA 3HI5H 1B0RA 1R33A 3TFBA 3BFQG 1H15A 1WT6A 1VQMP 1I7ZA 4ICWA 3CQPA 2K8MA 2FSEA 2ZG3A 2AQPA 3KBHE 1SQQD 4JL1A 4KK6D 3UBXI