5AW5B

Kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 2.2 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw5B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw5B02
5APYA 2P7JA 4AUWA 1CI6B 1GU5A 5AW8B 3A7OA 1FAVA 3NTNA 2E43A 3MD0A 5APXA 5AVUB 1FOSF 3P8MC 4KHXA 2WPQA 1G2CB 1S9KE 1X8YA 3L37A 2WT7B 5AW5B 3OAKA 1SLQA 2XV5A 3L36A 3VMYA 3M0AA 2R5DA 3O8ZA 3I5CA 1MFZA 3NMDA 1GZLA 5AW1B 3TNUA 3M9HA 2XZRA 3P7KA 5AVQB 2N9BA 2R32A 1JNMA 1S9KD 4GT1A 1OXZA 4C7NB 5APVA 1IO4A 1J2JB 1MV8A 3HTKA 2YO2A 5CMZA 3HE4A 2IPPA 1HBWA 2XU6A 2R3CA 3NXSA 3SWFA 1H8AA 3LIEA 3WGVB 5AW4B 1GK4A 2Z5HA 3WGUB 2Z5IA 2P67A 1CZQA 4LC1A 4M3LA 4B86A 2C9LY 4DZOA 3HE5B 1GTWA 5APTA 1HUCA 4JYBA 1HJBA 5APSA 5AVTB 1HWTC 2E42A 3V5BA 3L35A 3A5TA 1YYCA 2WT7A 3KQGA 5AW6B 1OWAA 1JUNA 2WWWA 3LIDA 4GKGA 2YO3A 1T2KC 3UIAA 3V4WA 1A02F 3TYYA 4C7NA 1CI6A 2ZFCA 5AW9B 5AVSB 2W27A 5AW7B 1DH3A 5AVVB 1CSBA 1A02J 1GD2E 4AYCA 2H7HA 1NWQA 2R5BA 2WPRA 1GK6A 1MUUA 4HYTB 3KDPB 3HE5A 5AVRB 2P2UA 5AVWB 3A3YB 4XE5B 5APUA 1GU4A 5AVZB 1H89A 4C46A 2JJLA 2KP8A 2WPSA 3TK1A 3A2AA 3V4QA 3VTPC 2YNYA 2W6AA 1SP4A 4I6MC 5AVYB 3HE4B 2ZXEB 2QM8A 5AW3B 1FOSE 3P32A 3B8EB 4RETB 3MGNA 5AVXB 2Q3IA 5APWA 3M9BA 5AW0B 3IR9A 2Q5UA 5AW2B 4AQRD 4I2LC 2C9NY 3TNUB 2QM7A 3M91A 3M0DA 3NFQA 2VRSA 3VMXA 4EOTA 2WTYA 1KQLA 3VN0A 1NAFA 3M06A 4RESB 3T97A 1T2KD 2Q7CA 3VYIA 4JYCA 3VMZA 5APQA 1H88A 2BASA
chains in the Genus database with same CATH superfamily
4JBZA 3RWGA 3OSKA 2OYHB 4KGJA 3T2QA 3WEMA 1MAJA 4NQQA 1L0QA 3WIIL 4QT5B 3MX0A 2VABB 3DBXB 3C6LD 4ONFH 4TUJA 3FHEA 5IBUG 4KHXA 1MW3A 2WY3B 4HH9A 3S3BB 1KIQB 1ILUA 5J1AA 4L8DB 5A40E 1SQPK 1FFPB 1UFGA 1VCBC 4ZUUA 1OGAE 4RGOL 1VEOA 2Y0EA 4JHZA 3SD2A 1NIAA 3GXUB 2G8YA 1YMMA 1HQRB 2CKBB 5D7JA 4P2QD 5EOCJ 2X9ZA 3GJFB 2VIRA 3L5WA 4N68A 1VQ7P 4IEFA 5DMGC 3MLXL 5D93C 1NFAA 3A5VA 4QHLB 3QNYA 5HHQB 4QRPD 1XGPB 4JQIL 4XNMB 4ELKB 1AQTA 3QR0A 4N2CA 2PCPA 3P0VH 3FB8B 4WHYG 1FLRL 2YC1A 4I9WE 1X5KA 3VFVA 4AI7A 3LZNA 2WCSA 2J57A 1WGOA 4P2RB 4X5WA 2N59A 5EO1B 5H94A 3WS6C 4MAUH 2GJ6A 3EJZC 2NY6D 5CR1A 2OCCB 3CXFA 5HYJB 2GK2A 5EUOE 2Z5IA 4LC1A 1YEFL 1U3HC 3LNFA 2DQEL 2I69A 4ODWB 1NMCC 4WI8A 4FX5A 2GUYA 3T4AB 3ZGHA 5K5YA 1OXYA 3ECQA 1NPUA 2NQ3A 4NQDE 5BV7H 1R8EA 2YXVA 2FYUJ 4P05A 4QYAA 4EI5D 1PVHA 2C9PA 3S98A 5J0BA 2UWEF 3CLEL 2AJSL 3ABMB 3QIWD 4K3HA 4CILA 3U0WH 1JG9A 2OR9H 1I85A 4YR6B 4J3WA 1OTUD 2A99A 3I50L 4PY7A 1K8AQ 1BFOA 2WW8A 4K9JA 1QO3A 4NOBA 2L5GB 4JN2A 3II6A 2VXQH 4D2NA 1A02J 1TPXB 1WBYA 2YA2A 3II1A 1BZ9A 1VESA 3FXIC 4YHOH 5AWNL 5B8CC 5K9OB 4HHWA 1SHMA 5LNEA 1M6UA 2XQBL 4HDIA 2RMNA 2NNRA 5HVHC 1RP9A 5HGBA 4NN7C 3IKKA 2CO2A 4Z7OB 2RIKA 3A6CL 4D9QE 4RDQG 2OL3B 2QSQA 3RVXD 1C7TA 4H8UA 4WFFD 2ZX5A 5LBSA 4ZXBC 3MLPA 5BU8B 3RK3D 5HXMA 3MODL 2UWJE 1YMME 3T3PE 3OKDA 1CQKA 1FH5H 3P32A 3BVNA 1QRNB 3HHRB 2EIZB 4Y19A 4QXUL 3DTDA 3BVUA 4PCKA 1AKJA 2LLLA 4B7IA 4G6FD 4N3UA 1VB9A 1E5CA 2HPTA 3TA3C 3H9HA 3FJTA 1PLGH 1RF0A 1E9QA 5CJXC 2HZHA 4XMLH 1N7MH 1ORQA 1FZMA 1HSAA 3ULUC 4EVNB 1C16A 3PF2A 4N2KA 1EMTL 3KJ6H 3QAZB 1AQKL 4IRJB 4PW9A 1T1WA 2Q1KA 2DLFH 3K1DA 1WLHA 3S9OA 3VMZA 2BRRH 1VFBB 5E9DD 5T3XE 1A5FH 4XN8A 3HB3C 3UO1H 4Y4HD 4Z8FH 3ARXA 5JQ6L 1T89C 1LP9A 4Y4FC 1SYVA 3H2QA 4X6CF 4PJEB 3MCKA 5HYIA 1ET5A 2L04A 3CK0H 3POHA 2F54E 1DCEA 2O3JA 4P8QA 5DQJB 1L9MA 2EVIA 4YO0A 1HWWA 3MNVA 1X9LA 2YXQB 5AAWA 5EEVA 3IS0X 1J1OH 4KXAA 4PRBB 1B0RB 4GXUM 3FT4B 3VGBA 3PJSK 1GY1A 1XH1A 4WK2B 2OSLB 1WUNT 2CUAA 4ZAKD 4JPKL 2FWUA 1S7TB 4HUMB 4I89A 5E00A 1NFDA 2BP3A 4Y5XB 1NCIA 4M93C 4P04A 3RWDA 2OYOA 1XTGB 2WWNA 4UNIA 4DUWA 2FTAA 2APVA 3DWTA 3U59A 3OLEA 4YFLI 5SX4H 4BA0A 1QL2A 2V7HB 4Y2LA 3TBVB 3F6JA 2XX0A 4DP8X 5HI5C 2DI7A 1TZ8A 3BPCB 4Y2DA 4CNIA 1FL3A 3Q13A 1YHQP 3TJPA 3A6BL 3X13B 3VQLA 2VN4A 3ARBB 4DGVL 2IANB 3RBZA 3FQ2A 3CCQP 3EHBD 5EDXA 4IBSA 5DSCB 3SDYH 1CFVL 4PV8A 3VD9A 4NGHL 4X42A 1J0ZA 1NAMB 1VENA 1HHGB 4BRYB 3P3YA 1N4XH 5DYOB 3TZVC 4D0BB 2PTTA 3H42H 1U6AH 2PYED 4JFDE 1E9OA 2JJSC 5IB5A 4FQQA 4GMTL 3PNWA 4YUEL 4BINA 3KPSA 2I5YH 2W0KA 3BYYA 2J2ZB 3BKJH 4HKBA 4E0RA 3LRLA 2BC4B 4RRPA 4L73A 3O0RH 4NRXB 2BEQD 3TZVA 3FN3A 1FUNA 5BZWA 4WK4B 2HLFD 2W07B 1DJHA 2X4OB 2VLRB 3IWVA 1B9KA 5LN4A 2AJUL 2VQTA 4XBGB 5DEGA 3RVXC 3NFSL 2EAEA 3CWGA 4GRLB 4PR5B 2HTLD 2VJ0A 3GEWB 3VGHA 1B3JA 1MFDH 4ZD3H 5FWQA 3TK1A 4L2LA 4OCYL 1NJIQ 3OLIA 1KFAH 4G5ZL 3U25A 3ULUE 3WN5B 1SYSA 5D2NE 4UB6H 2VKWA 3RKPA 3O4OB 4TT3H 1XGQB 2FJUB 2Y5TB 1LTJC 3R2PA 4MJ6A 1KT2A 1SBBA 2OMZB 1CE6A 1A4JB 2FLBT 2NZ9C 5CEYB 5DMIL 4FDWA 3VMAA 1QR1B 3SZKC 1J1XH 1CICA 1OGPA 4XNMA 4RH4A 2I1JA 1KELL 2G75B 3WBDA 4XMZA 2Z92A 4IEFB 4W4NA 5EOCH 5EULV 4UV4L 5JXED 4K3EH 1HIMH 1FN4B 3K46A 3MJ9H 5BS0E 2JWYA 4L4TD 2FBOJ 3TO4D 4HIJB 4BK4A 4ANUA 1NKZB 1MIML 2A6IB 4EZKA 1S8DB 2RD0A 3QJHB 1TF4A 3WFHB 1QSEA 3PQYE 4X6CB 4YIQA 4X4XA 1DVUA 2QQNL 1HOCA 4JPVH 1E8WA 2WXHA 1S9KE 1HH6A 3OJDB 5LAXB 3UTQB 5HYQA 3N4XA 4JRXB 3VI3B 1QVFO 2I24N 3JXAA 4YXLH 1PP9D 1PL3A 4HWBL 4WUKL 4BYHA 3BP4A 3IN0A 2I8DA 3NA4A 3QE5A 1NGWB 2W9LA 1YO4A 2FGWH 3V0EA 1KB9K 2QV4A 4JFFE 5KTEH 4E9TA 4GYBA 4AZ8B 2I85A 3MLRL 1W0YT 4TV3A 3V5DA 4G83A 5LCVA 2G0LA 2Z7ZA 4XVUD 4L1SA 4ZUVA 15C8L 3T6WA 3EBGA 3WLBA 2J58A 3WD5H 3RRQA 5C0GA 3NIDB 1MUJB 1EJ6A 2MTPA 3ZU8A 4BSVB 3NGBB 3OA7A 3U6RB 3ENEA 1IKOP 5A43C 5CLXA 1FAIH 3CCUP 4L4VB 3QEGH 1GTWA 4FJYA 4TSAH 4X4KA 4CKVX 4G9FB 3ARZA 3OKYA 2EJ1A 4QRRD 3GJEB 2Y07H 4YZWA 2UXTA 4YJZL 1PMYA 5DJDB 3VXUB 1SQQE 1BQKA 2AEWA 3QEHB 4WO4A 5GHWL 1CI6A 2QDWA 3HNSH 4JVPA 2MQ0A 4N2IA 5AAMA 2XQYA 1S9WB 2ZOOA 1J8KA 4Q6IA 5PCYA 4LLQB 3DX9B 3DK0A 3MJ7B 2BHUA 1AVAA 4B0MB 4WW1A 4FQLL 4CN4A 4JQ0D 4XAKD 4MJ5B 5BZWB 3RNKA 1S7VA 2HT4D 3BZDA 2Q6WB 4AM0Q 2HWZH 3VH8G 1QFHA 1G1KA 2FQGA 4QYOB 5I74B 4ODXA 3RQ3A 4PD4D 1UXSA 4RQQB 1BSHA 4U7MA 5I1KH 3OZLA 3O81A 1CDGA 1QL1A 3MA9L 4U3FJ 1FIGH 1IGJB 4PYHA 3VSQA 1UXSB 2WSFH 2WNXA 3KL0A 4RQQA 1SN2A 4PUBL 1D5MA 4FE9A 3VWKC 4B6ZA 1KTMA 2WSEJ 1EPFA 5CJ0A 2R69H 3S37X 1JWMA 5HHOB 2KLUA 2Z1KA 3IDYB 4HH8A 1OV8A 1D5XB 1E4HA 2C9NY 3IDJB 4A2MA 4X7TA 3I6GB 2MH4A 4P57B 4YDMA 1D5XA 5DJ2A 1OZTG 3FO9B 1CVRA 3IN6A 3HC0A 3KGSA 5JHDD 3EXLA 5G55A 4YXKL 4ADGA 1L0LK 1ZLLA 2L0DA 2YFNA 5CN1A 1K04A 5C7XH 2ADGA 2YKLH 4OVNF 3QDJE 1FV1B 1R24A 4KKCD 1ACYH 4RMWA 1J5IA 5AZEH 4XBEL 3F58H 3F7LA 3LQAH 2FD6L 2PP8A 4I0PB 4HH2A 3D39E 5FGBC 4LCUB 5BRQA 5IUSA 2X2UA 1H3PL 5T33H 1IAIL 4B53A 2B9AA 3PGDA 5AW5B 3G5XA 3BRFA 3HS0C 3ETTA 5I26A 2QJPC 4X7CC 3N41F 3IJHB 5A2FA 1XF5A 3VFNB 3B1UA 4HHGA 2IBZY 2ZONA 2Y7NA 3FSOA 3AE3C 2QLVB 3H3BC 4S2SA 4M7JL 2XFGB 1QLRB 2ZWZA 1GA2A 5DS1A 2MQ3A 4GXUN 2WYZA 2EADA 3BMVA 4WO4B 5CU5A 3ME0A 5CJOL 3TF7C 5DJYB 1A1MB 3MXWH 5D55A 2DDQH 1NTMD 2AEIT 4H26B 2IQ9H 2FL5A 3FF7A 4U1JB 5C0EA 4Q6YA 1WAAA 4WI4A 3BC9A 4LFHG 5HDWA 2LAAA 1ZEAH 2H8PD 4XZUB 1I9RL 2UZIH 3ARRA 4AZ8A 4N90E 3DO4A 4MXQC 4HS3A 5GTIE 1FCGA 3SYPA 2R0LH 3N1GC 2C9RA 3LH2L 4MA8L 2RCSL 5BVJA 2AV7A 4RZCA 1U3ZA 2O6CA 4IKKA 3KLDA 4LCCB 5FV2A 2OMVA 3STZB 2WXKA 1R19A 2R1XB 4X4ZA 3KQGA 4HGKC 4H25B 4WNJA 5J9PA 3CZEA 1NCDH 1QPKA 3MLVL 1A9EB 2VDMB 5BZXA 3LDBB 3GHGA 1J5CA 2ZXQA 3P2TA 3D0VB 4P3DB 4YSAA 5DD3H 2B20A 5BQ7A 2M5AA 1H6UA 5ISZB 1OLZA 2E8ZA 3AQDA 2IBGA 4H25A 3ARGB 3LKRB 4IHBA 1GGBL 3TH3T 4P4KB 3PDOA 1F0LA 2JJVA 2XA8L 3MIWA 4N1CA 4QRUB 4Y4KA 2H88C 5SWZA 4ZOAA 1MEXH 2O1KA 5DHVB 4XWOD 4P23C 1UKSA 3K2UL 3ZE2F 3OHMB 2DJSA 3QORB 3U48A 4ERSL 3IJ8A 3MNZA 4G80A 4WU5B 1G7QB 1IJDB 3SO3B 1JK9B 3E6HA 3ABKB 1MJ8H 3VTPC 4Z3FA 4KVCL 2OK0H 1RULL 2LU3A 3NQIA 2A45G 1KJ3H 3RDTD 5JHBA 2WC7A 2FWOB 3MLSL 3N44F 3EQ2A 1F00I 2CZNA 2X0WA 3ZDYF 2WKOA 1QFUL 3IE4A 4XP9L 3F7QA 3HG2A 3QAZC 4W6XB 4W80A 2QA4P 3TGUE 1DQQA 3Q2VA 4KVNL 1LNQA 1XTCC 1HCVA 3E8UH 1L7IL 1EGJA 2IDBA 4JYCA 1DLFH 2KLRA 5D1XB 1S7SB 2G4EA 3KW7A 1ZLDA 2GTQA 2R7EB 3BPNB 2KQMA 3X14A 2CDFB 4WHTB 2VW7A 1TQSA 1U33A 5T1LD 2ZYSA 1NCCH 4PG2C 4IBWA 5FHAH 2D3NA 3L54A 5HTSA 2B14A 2NQDA 3S36L 3SE3A 1JNNH 4Z1PA 4U6XB 1H8SA 2CKBH 4H0LB 1SVZA 2NXZC 4IIQB 1NH4A 3H1IG 1N59A 4A55A 3LTVA 2NCEA 4DZBA 3HZMA 1CYGA 2M26A 5SV4A 1MIEH 4G6JH 4F9PC 5IHLB 1IEHA 3GLEA 1P6AB 3KPLB 4OKDA 1RURL 1JJUA 3WY4A 2VLLA 1OXZA 4UNVA 3QIBD 3SDDD 3H9ZA 5FX3A 5DEFA 2P52A 5D1ZD 3UBXI 5JW4Q 3A6CH 1QG3A 4PV1B 5I1JL 3A22A 3GXFA 2VRQA 4WHCA 2R3SA 1SM3H 2UX7A 2Z64C 4M1CD 1HBWA 4XHJD 3SWFA 4BWWA 2XWDA 1A6UL 2C5DC 4LKXB 5H37G 5I16A 4Q9QL 3WTYA 3MLUH 1QZ1A 2EDEA 3D69A 4AC4A 1E43A 3P54A 4UM9D 5D70L 3HLKA 4LPXA 3TTYA 5IOPB 3GMNB 2ZX9A 4ZDHB 3SPJA 1T0NB 3L08A 3T3PF 4Z18A 3MOBL 3HB3D 1NOFA 2EYRB 3L7FB 2NPSC 1EQ7A 1CC3A 1RHHB 2J8UA 4LU5L 4L2YA 2TSAA 5DJAA 4BDVA 2BNQA 4N4YB 4Q9CA 3CFJA 2AJVH 1SZNA 1UA7A 2FH6A 3DHMA 4PJEA 4NPJA 2I9TB 2ZFCA 5E08L 2CDEB 2W27A 4AGPA 1AG0A 4XP6L 3K91A 4S1QL 4L3EB 2E7LC 1D6EA 3ARSA 4IM8A 5E0FA 2YPKB 3EDFA 5I1DB 5AG8A 1AIFB 1BM3L 2CHXA 1EFQA 3CQQA 2FT7A 1DTUA 1GW3A 4MCMA 3X11A 1XGTA 3LN5A 2BJMH 3CJJA 5B4MD 1EJOH 3MBED 5C92A 3DYMA 1CLOL 4PREB 4BK8A 4WJKB 4X6DB 5D93B 1HYSD 1TLMA 4WZ9A 3D4ZA 1VHPA 1FU1A 3L1OL 4XNZB 3KPSE 1U8QB 4ACTA 1PY4A 1G7MB 3TFBA 3IVKB 2VMEA 2UY7A 1G7IB 2XRAH 4RETB 2QQQA 4CN6A 4OZIF 4YWGH 4NZUH 2FYUG 1S7UB 4NNPL 3LKQB 3IFNL 4M6OL 3CI9A 3IFPB 4XPTL 3VGAC 1OSPH 1AYOA 3P3SA 3IMTA 3VWKA 3L71E 3HUSA 2FECI 1GPOH 1RJZB 2YMOA 4WDIA 2LABA 1GL2C 1JGEA 2JWAA 4NC1E 4AXWB 3EDDA 3RFRA 1U91A 2HH0H 4K8RC 5DVMA 4A7VA 3FSWA 4UTBL 3AREC 3VXUE 1QYGH 3B2PA 4HQQL 2Z35A 3QZWG 4PBXA 1KXVA 1QLEL 3BP6B 3ZQ9A 3QWNA 1CFVH 1Y1UA 3BXNA 1HL5A 4RFNC 1QNZH 1X7QA 1JVOA 3D2UD 4N8CH 2VKXA 4OB5H 4GRWH 5FO2A 1NU1D 2EABA 1MQ8A 3RX8A 2ZWKA 1NTZG 1VFUA 2WVSA 4LIQL 1QTPA 4GXVH 1OW7A 4KJPC 4CJ1A 4QI3A 3UJIH 2EKJA 4PJAB 5D1QD 1MVFA 4PJHA 4UOW0 1J0YA 2F0CA 2JE8A 1LT9C 2X2JA 2O5ZH 2F19H 4HD5A 4N8VB 4NHCH 3RJOA 4IL6X 3L71J 1SJMA 4GT1A 4IKJA 4LSVH 5JUEL 4Y7MA 4APXB 2YRPA 4Z7NE 4YHKH 3D05A 2XX1A 3EFFA 3F84A 3HE4A 1G6RB 2IPPA 1JY2N 3KS0H 1DEEA 1FZCB 1NAKH 1VA9A 3AT0A 5KKZC 2W94A 3DSFH 1AXSA 3F3HA 4XNXH 2IXQA 5TISH 1U8KA 3RVVD 4RGMC 2TRHA 1KWKA 2DW5A 3NJLA 5C2UB 3VRJB 2CK0L 4DERA 3BH9B 5I1CH 1YMMB 3T3PB 3ESNA 2Z34A 4K7PL 5D1QB 5F0PB 4DVBB 2EXYC 1PIGA 5CLTA 4NXSA 5B7FA 4M1DL 2IV9A 2BWDA 1WCBB 2ZAGA 5DJ0B 7FABL 4GRWB 3P8CD 1BM7A 1L7TL 1NBVL 2F53B 4RNRB 4WI3A 2IOOA 4QHLA 1EZUA 5HHQA 4QXVA 4MLSA 4AV4A 1F4WH 3RK2B 3HN8A 2V2WA 2YBRA 4KH9A 2X9XA 2DMHA 3M8OH 1T21B 2R2BA 3TN0B 3L4WA 1CICD 1PSKH 1T6AA 4RSVA 2IG2L 1U2HA 4GAGL 4YFLF 3DGCR 5IEHB 4J3OD 3EYSL 1ZOXA 2IWKA 1Q7YQ 4AGNA 2QSVA 2QDVA 4YDVB 2PW1B 2OZ4L 1GGTA 5EEUA 1SLUA 3V0WL 2HKHL 2XXFA 1M6OA 4OF7A 3SKJL 5DQ9B 4OZIE 2EIJB 4KO7A 1WISA 3ATAA 4D8OA 3M86A 1E0OB 2PTUA 4IGBA 4G1EA 1YEEL 1F41A 2AXJA 1A2YB 3A6OA 2OMWA 3L4XA 1N7SC 1J0HA 3V6ZB 2NYYD 4P5MB 3TN0D 4OAWA 2AANA 5DK3A 2ZP0T 3SGKC 4L05A 1HOEA 1KQLA 3WJJC 2UY7B 2VWEC 1YNKH 2XG5B 4NO0D 3QNFA 1KXTA 1VQOP 3OGCB 3IDIB 3CZFB 5GRUL 4W1TA 4ZS7H 1GW0A 1VZGA 4HJTA 5F3HA 4JANB 5KVEE 3MN8A 4MLIA 2J6EH 3PL6C 4M29A 4IU3A 1WBXA 4X9GA 3VA6A 1SUJA 5CCHE 4AQOA 2DYPB 2NNFA 4X99A 3SQRA 4TOYL 2YFOA 4J8RB 1OSEA 2QJPB 4IOSA 2I25N 2NYYC 3CCHA 1VKXA 4JZNA 5DJCA 1H6FA 4UM8A 3QZMA 5IFJB 3TCTA 3NPSC 2W0PA 3HOGA 5CGTA 2R5DA 5I30H 2YGNA 4PJAF 4KNSA 2Y36L 1LWRA 1PLAA 2Y1AA 5KUKA 1JWUA 5FUOH 3ZDZF 2BNQB 7PCYA 4TL5A 5EIIG 4NPDA 4EDWL 4MA1B 2VITB 5CCGD 3NABL 2XG5A 4X80L 2Q7YA 2A4ZA 2V3FA 3VFRB 3FT3B 4TULL 2VSKB 1IFJA 4XN5A 3TPKA 1NUGA 1RHFA 1RMFL 4QTIL 2VTFA 2A73B 4EPSA 4V1DB 3FQ1A 3TF4A 5ERWA 5DD0L 3NN8A 4C55A 2J6EA 3QG6B 3FUIA 3I3EA 5IGXL 2EO9A 5GQBA 5GGTH 3EZ8A 2FE0A 1JMBA 3IDXL 3RKDD 5T1DL 2YXWA 5DJ6A 2F61A 3RAJL 4YDVA 3HBGA 4KGLA 1DDHB 2A83A 3SGDI 1VDFA 1VADB 2ENJA 1XGZA 4JVWA 3BZEB 1KLFB 2R27A 4KK8C 4B96A 2YKQA 3TBWA 2FT8A 1OF2B 4K35A 3IAPA 2YEVB 2CXGA 2Z7UA 2QHRL 3KS0J 4G9FE 2C9VA 2ICEB 4JFUA 3CH1A 1HZHH 3H32A 2GJ6E 4WI0A 4H8PA 1BF8A 2MNJB 2YD8A 5F1IA 3VXQA 4TLKA 2Y7MA 1IM3D 1SQBG 1KCBA 3GHBH 3DLQR 1AOZA 3V4VH 5JW5B 5LKNA 3R19A 3UCQA 1UWGL 3G7TA 4JQIA 1T1XA 5SWZE 4MN4C 5CHNB 1E5YA 5ETUB 1I3GH 5FR3A 1M3IA 1QRNE 4QEGA 2JDIH 2E0PA 3B9KB 5HYJA 2SPZA 4IOIH 4ISVA 2WZ6A 2Y7OA 3O6MH 4P5SA 1VQKP 2ITAA 5HHPA 1YEDA 4LK4A 2OJEA 2HX7A 3LVEA 3VFOB 4QWWC 4TKWA 1T03L 3EYOB 4WSGA 4M7JH 3QFDA 4PP2A 4DPCX 4BRJA 2W95A 3H1ZA 3WAJA 3P4NA 4K3JH 2CO4A 1X5GA 3OF6D 3MGOA 2VIRB 2VRSA 3NYKA 3EFFB 4YHZH 3PNRB 4HJSA 2OMUA 5D1XC 1OAZH 4APQA 3VXOB 4U7SA 4DGUA 4FFWC 5DLML 2YIHA 2L3BA 1XO8A 1SQBK 4HXBL 1R0AL 2Z31B 3QUZD 5E8PB 3FHQA 2YN5A 3C6LC 5KVGE 1YEKH 4AQAA 1J9SA 5I17B 5DHYB 3QIUB 2JKXA 2IBZD 5AW8B 1TQVA 1KYOJ 4FNLH 4G42B 2NY3B 1FQ9C 5LGHH 3ARGA 4CSSA 4BZ1H 2IDFA 3KYOB 5IG7B 1G87A 4WCYL 3AY4C 3D0VA 2FX8H 1WZAA 1KIPA 2CA3A 4P3DA 4Z95H 4AYGA 1ZSDA 1A66A 1NCJA 4J4PA 4U1MB 4AYFB 4BXSV 3IETB 1MSPA 3VVWA 4XCNA 1KIPB 1KCRH 2NRDA 1TQWA 4WGVB 3IDGB 4QHKI 1L5GB 4O2EA 5FO9B 2B5IB 3GDCA 1JPEA 3FCUB 5A3ID 1ZANL 2A4EA 1EV2E 5LB1A 1TU2B 3L48A 5T8IA 2Q86B 4PJIB 2WZAA 4Y9EA 1FSKB 1J0IA 4ERSH 3FO1B 4GAFB 3CX5D 2X2IA 1FWXA 1I31A 5IJDC 5BO0D 1FL6B 1FO0H 4TUUA 2HFFB 3GSXA 3SKMA 3ZQXA 2X44D 1OAYH 3I55P 2VLKE 2P43B 2B4CC 1OMIA 2XDJA 1RSYA 4R4ND 4OQTA 5IIEB 4MDJA 2Z7YA 4PRAA 2QGDA 3FB7A 3HC4H 1JHKL 4MHHI 5TE4L 3WFEH 3WXVL 5D8JL 2EDHA 2FYUD 3KPNA 4I5BB 3QFGA 4X6DA 4FGMA 2W9DL 2RTTA 2ZICA 4NZTL 3T0EB 1UA3A 4JQXA 4X6BB 3C2SA 3X1EA 3VD2A 1JBJA 5JHDE 4IU2A 4MD4B 3ZHKA 1BVKB 1DSWA 1FL5A 2B88A 4GO8A 5H2BA 1LTBC 1S7QB 3FXDA 1WD8A 1ZK9A 35C8L 3EJYD 1X4YA 4LCYA 1E4XH 4MJ2A 3M1CA 4IK7A 4RWHA 5FGRA 3EJCA 3RDJA 5F7EL 3CFKA 3QDJD 4ZKPA 1T3FA 3ARBD 1D7DA 4GNKB 2WXJA 3RL0D 4O5LH 2ATAA 1E3XA 4A04A 1FGNL 4BRYA 4XPAL 5DZJA 5K1NA 5KBPA 1EDIA 4XHQA 3GMAA 5DRNA 1JY3N 1FJPA 4GSDH 4F3FA 3EFOB 3BAYA 3NTCL 3Q6FB 3A0HE 3KPQA 1AJYA 3HN5A 3NK4A 3I6GA 2CRMA 4I0CC 1JPST 2KOGA 4DW2H 2VZ3A 1RURH 5K5GB 3EFOA 3FN0L 5EWIH 2IGFH 3T0WA 4UU9A 3NESA 5I16B 1IGYA 3K6DA 5H2FE 1QTSA 4F57H 1WV7T 3GEFA 5FYJU 4ETQB 1GL2B 2BCCJ 3G5WA 2H26A 3GYRA 3VG9B 4EOTA 1SXSA 3L2NA 4J6RL 4E41B 1JXFA 1N0XL 3C6SA 2BWQA 3FU8A 1SXBA 1RVFL 1TEFA 1IILE 1LGVA 1AS7A 3N7NA 2B3IA 2VM4A 2AHIA 1G43A 3V4VB 4OCWL 1R47A 1S7VB 3K4ZA 1IK9A 4XC3L 3BQVA 3ZTJG 3U1AA 3UTSB 2WV3A 3PWNA 4MDIB 4IIQA 4P5KA 3A7OA 1SF3A 3QH3A 1XFPA 3NSYA 3VMPA 4LCWB 3P4MB 3BCDA 4WFGE 1VACA 3MV8E 2D7QA 1KB5A 1G9ML 1FYHB 5DJDA 1MREH 2ZKWA 5MEQA 5T3ZD 5DJCB 1F4XH 4DPRA 2O26U 5IQ9A 1W72A 5AVQB 5FGSA 2XI9A 4N8PA 1BVKA 1A4KB 2FXMA 3B2VH 5I6XB 4PJGA 5MEPB 5JHLH 1Q86Q 1A64A 2AEMA 3Q8CA 2QEJA 5AKTA 4QJ4B 1EXUA 4ZXBB 4RGMB 3JZYA 3EJQA 4XMVA 4R97B 3TWCL 2Z8WC 3G6AB 4OD3H 5D1XD 4PVMA 2YS4A 4DP1X 2YPVH 4ZXBA 3LEXA 3AREA 3W5MA 1FNEA 5INDB 1SOQA 1GKEA 5F88B 3FQTB 1I8UA 3BSZA 1BGXL 1NJ9A 2EH8L 4XGZB 3SDAB 5JO5A 5JIHA 4M8QB 2GT9B 3IDUA 4I0PD 5BJTA 1SNRA 1KEMH 4Z7VF 5G5DA 4PP1D 1RL1A 3V0VA 2ITFA 2V5YA 4DGIL 3L1FA 2WWWA 1ZRUA 2X3BA 5ELIA 3VDCA 4NN5C 1CE1L 1OAKH 2J1YA 2GG1A 3CCLP 2PW1A 4UTBH 3GMQA 2VDML 4AH2B 3CVHB 5ILTH 3CX2A 2WWOA 2KERA 3F04A 2W59A 1BWMA 4WU7B 3HE7D 1NGZB 3BSGA 4GRLC 2X2YA 3N9GH 4HJGB 3NACL 3VXOA 1UOLA 2XG4B 3FGAD 4EI6B 3AWEA 1XDTT 1N86A 1KENL 2NDGA 4HIJA 4P5TD 5F88A 2OFQA 4YR6A 5KN5A 4FL4B 5TPWL 2FQFA 3TESA 3L71G 1I8KB 5DVPA 4JL1A 4UT9A 3VGEA 3VP9A 3HE6D 1ITCA 4JRXE 3VI3E 3QIUA 4N9GA 2NY0B 3IMRA 1PIXA 1RUAL 3VM5A 3I6LE 5CCGC 3TSIA 5BV7C 4PJCB 2X0VA 4R2GB 5HP5A 4QRPE 3ABGA 4XN1A 3L73D 1FYTB 1E7UA 4NJ9L 2JMRA 1SQQK 4RDBA 1LTTC 3ZE0E 2Y5TA 9CGTA 2QTEA 2YEZB 4L3AA 4GLRI 4JX0A 3GBLA 4UNTA 3LPGA 3BISA 5E5RB 4G3YH 2UXVA 4ZFZB 3PTZA 4G72B 4JG0H 2COVD 1QLRA 2FJHA 4GODA 2X1QA 3WEAA 2P8MB 2Z8VC 3APFA 2GYSA 3DUUB 3N55A 2AXFB 4L76A 3EFDH 3TZVB 1M7UA 2O93L 1NC4D 3KZIH 4ANWA 3SPIA 1H0TB 1UWEH 2CUHA 2JI2A 5D2LB 4GP8B 3Q2LA 2BC4A 1WG3A 3ESMA 2X89A 1FYTD 1QSZA 5HYFA 2OYIB 5F0MB 1L7TH 3L74E 1X4ZA 4DTGH 2CHDA 3T0EA 4QT5A 4MNGB 4NRZB 5FYKH 2WAQA 1X5YA 1P4LB 1YEIL 4MMXB 4KKCC 1QBMH 3QG6A 4ZFZA 2CALA 4PJDE 1N6QL 3K6SB 4JO3H 3DVIA 1OIOA 2VXTH 2XWRA 3L6FA 5C0AA 2OJZH 6FABL 3M7FB 1MNUH 1EDQA 4WFFE 5EOTA 2KT6A 4BE5A 3WNJA 1NM4A 1OB1B 3FRPG 3N85L 1MFBL 1QPXA 1YNLL 2YXMA 1T22A 4X5PA 3DX4A 1Y7VA 4JM2F 1NTKE 2QPDB 3VD1A 3OWRA 1OVUA 2WLJA 3LKQA 5I8KL 5KS9F 4HEPA 3MLYL 3V4PA 3K8LA 3ZYJA 3H3PH 4O02A 3GLZA 4W9GC 2Q6QA 2XXMB 2XNXA 1MCPH 3H1LG 1ZT1A 2WLLB 1OWAA 1P2CB 5HHNB 3DGGB 1OAUL 3HI5L 1KQGB 4GKGA 1R3KA 1G7JA 3H7BB 4DO6A 3SDCA 2PR9A 2R39A 4AYSA 1QOKA 1FAKT 1XD0A 4GOFA 5B1BB 1XH3B 1BHGA 1GIGH 4M61A 3B43A 5LJYH 4A2HA 1F45A 1P9MC 4DOHE 1LT9B 4N5ED 3H1KE 2IFFL 1G7JB 4FLQA 1T8ZA 1W0WA 4PV1D 2YAEA 5C0BE 4NZRH 5CZXC 5CM1A 4WUUA 5APUA 3GQFA 3LRMA 3OAWA 1ADQH 4Y2OB 1KPRB 4RGOH 1GTNA 4NQCB 4Z3IA 2KYIA 2WN3A 3V4PB 2HMID 4JMNA 5IR1A 3ZK0A 1IE5A 1IU1A 1OHQA 3T04D 3RWFB 3B6SB 1E9QB 2FYNC 2QEXP 1XCTA 2AQSA 2HVJA 2J5LB 2AJZB 3BEVB 3T8XB 4DQOH 4ZJ9A 3U1SL 4BSWB 4JFZH 1SHWA 2OKMA 1T7ZA 4TUOB 3CV5A 1YMHB 3ZO9A 5C8JA 3BRTB 4TULH 4E5XA 2QVKA 1M2VB 3LMJL 3U7YL 2WZPA 3NFQA 3RZCD 4FFYL 4JFHE 4JM2D 2ESVB 2HYMA 3K2MC 4MAUL 3SCMA 3CAFA 2VXUH 1OTTC 1VZHA 1RZPA 1JP5A 3UO8B 1WFOA 4HXAH 4KJWD 2UZYA 3IDXH 2NY3C 3QWOC 2GABA 3D70A 2Y6SC 2AXTE 2ORBL 4RNRA 2FXOA 5BW7C 2VM3A 4GIPD 3KDMA 5TISE 2YD9A 3WE6B 5KVFE 4UB8E 2J43A 5D7EA 2V7NB 4MA7H 5ANMA 4LARL 4L37B 4M4RA 3E38A 4FQ2H 4JGJA 4P3WA 4WI0B 4ANKA 1UJ3C 3WFHA 4QKXB 1ZGLM 2AW2A 1MVYA 5DQDH 5ADOL 4Z7NB 4M9OA 3O6LL 2LKMA 1E8XA 4RRPM 4ZMPA 4JM0A 3PL6D 5CLZA 4UQBA 4N1EA 1MFEL 4U3XA 1ZHLA 1KGWA 3QJRB 5KJ7D 3X1GA 1NICA 2CRZA 4XOAA 4A66A 3X14B 2P1YA 4G7SB 4R4FH 4OF3A 3ROLB 3GK8H 3ECVA 1S7SA 1N10A 4KKRA 1JGLH 3MA7A 2PPAA 1W5CE 1T6WA 4GAJL 1X6NA 5D1QA 2DQJL 4XCCH 3BJLA 5AQ0A 3RLSA 4CAGA 3Q3DA 4LCCC 5DJZB 1IC4H 4A68A 5KVFL 4KQ0A 1ZIAA 5LG6A 1U7MA 5CCJA 3L3HB 3ROLA 4PJAA 1RJYA 4L4TA 2B59B 4AQEA 1RZFH 2RALA 1F3DH 4F37K 3O3DB 5A16B 1PLGL 1OAXH 2DKUA 3MNWB 3PHLA 5FV1L 3RWFA 3QO0B 1O6SB 3MJ8B 5E8OA 2JI3A 1KPUA 1JAEA 1NPNA 2OR7A 1DD4A 4MD0A 3DDGA 4NT6B 2F58L 2FATH 3B7YA 4K15A 2QVIA 4X8GA 4FQ1H 3RTQB 2E74B 3RILA 3ZVVA 3LXCA 5ES4B 3QPXH 1NFDE 2IDTA 1KB9H 1WC7B 5KLVD 1O7VA 5AAPA 5GS0L 5ID0A 2WXFA 4QUOA 1RJZA 3PJSB 5HGAB 5LGHL 1ETA1 2F74A 4ZFOL 1Z7JA 2HTKC 4WCYH 2F8OA 2VL4A 3LPWA 3L5HA 4KVPA 1Q90A 3UTZA 4MNHA 1XR9A 1JFQL 3UTSE 3ISYA 5AL8A 2FYYA 4N90D 2QQKL 4PLJC 4YFEA 5EHFA 4JPKH 1NCBL 4OIIL 3T2PA 4HKZB 1NLDH 2JVUA 2C1PA 1NTMK 3BAEL 3VI4A 2V7HA 4BFEA 3NCCB 2BDNL 2G5BA 4LCIL 1EDLA 2CO6B 3O4OC 4OLWH 5HHVH 4PJBF 4DAGH 1H19A 1BW8A 1QGKB 4S0TD 4U0RC 5EU5A 1OCOB 2J72A 4PREA 2DI9A 3MLTB 5ENWB 1YVLA 3SGEH 1XD1A 3HFFA 1Q9OB 5DMKA 2DW3A 2G5BB 1CGUA 5E9AA 4HFWB 2AJ3B 3PP4L 4XPFH 4RZKA 4KPHH 3QPQC 5JXEC 3L6FB 3IVKA 3NJJA 2Q87A 5GJSH 2PRRA 1JHKH 2ZXDA 4RMVA 3WXVH 2DJMA 2V33A 2VN6A 3TBSB 2MPAH 4OCRH 2P5EE 3CFCL 4WI5A 4XE0A 2FLRT 2EYRA 1G94A 1ZPLA 1KN4L 1M56B 3BKJL 4G9FD 2Y2YA 3WMPA 4XP5H 1F42A 35C8H 3V6ZA 1M57D 2WBXA 4Y4FD 2Y2TA 5C3TA 5C0CD 3GSOB 3H85A 4JFED 3GRWA 5JDSA 4P5TC 4LLYB 1B0GA 1FVDB 1SQPE 2YK1H 3TV3H 4KX9A 1X5FA 2ITCB 3LKNA 3C2AH 2BCCG 4JN1H 1ZVSA 3D4GA 3QFDB 1V5JA 2A9DA 2HJFB 2PYEE 4JO1L 4EXKA 2C9LY 4KJQC 3IDJA 2XWJA 1H8NA 1WAPA 4OUUB 3CX5I 1OQOA 3C6LB 5CSGA 3MRBB 1HAUA 4Q52A 2EDBA 3PG2A 1L9TA 2OX5B 2CIIA 2A06E 1M7IA 2CO1A 3IM1A 3F7VA 3CSFA 1ACXA 1T5WB 3CU1A 5EEYA 3B5NB 1AGEB 1U8PA 1WZKA 4W7ZA 4MQSB 4NI6A 3BKYL 4KK8D 1W0VB 2ZUVA 4KXZH 4N24A 4RMSA 3B2UC 3CCVP 2DY2A 3BWUC 2ZOKA 3BZFB 1U2CA 1M7IB 4HJ0C 3UBHA 2ZUSA 1BX2A 4CMMB 3BKCH 1UT9A 3VMOA 2Z4QA 5HYSG 1EXJA 2DLGA 4AT6B 2DQUH 2ESVA 3EYVB 3V95A 5AOMA 2A77L 1G9NC 4A6YB 2WITA 1A3LH 2ZXGA 1QX8A 5JIIA 4C46A 2LV4A 3ZHFA 5C86A 1D7MA 1FSKC 1JPSH 4NLHA 3B7TA 5E1IA 2R83A 3MJWA 4JJHA 3VXUA 2ZUQB 4PN6A 5KTEL 4HLZH 4Q9BA 3ARYA 1C5CL 3B5GA 5EZIH 5I1AB 1JGUL 2FY8A 4ZAKB 1EA9C 4U3FD 2JKLA 4RFOH 2BSSB 3GM0A 2IMMA 3MOQA 5DCCA 2RHEA 3HA0A 5JA8B 2JQAA 1MCDA 4GAYA 4PMEA 1K4CA 3QNYB 3AREB 5FYLE 3ZRFC 1XL4A 1V3JA 2H9GA 2YMYA 3L17A 4QF1B 3T0EC 3VXNB 4M7LL 2W80C 2X70B 3R0NA 1BLNB 3HJEA 2YPVA 3EOTL 1MHCB 4DGWC 1G9HA 5B1CA 1PYWB 1EUUA 4YDLB 2G2RB 1ZSDB 1I82A 2OLDA 4HV8A 2BZCA 1KYDA 4MQXC 2YLHA 3AEAC 1PFOA 1Y6MR 4OJAA 2A1WL 1ZAGA 4KXDA 4JO4H 1DJWA 3CD6P 1VFMA 4OQ1A 3HNSL 1A7RL 2ZUTA 2M3EA 4P07A 4MZRA 5LQBL 3C9NB 3V0AC 1EFXA 3Q5RA 1QVGO 3IDIA 5CMAA 3C5SB 3RL2A 5HVHB 1SQVK 4OZFH 2F18A 1U3HA 3DPDA 2XIDA 4HZLB 1P5UB 1ZT4B 4L0PB 1RSFA 1MH5B 1QUNA 1KB5L 1G7IA 2RMZA 2Q76A 2W60A 2OR8A 1I1YA 2A6KB 2UWEA 1FZAA 1A0QH 3OKEB 4CJ0A 5JXAH 3ILDA 1S9YA 4DGYL 5KJ7A 3CTTA 5I1KL 5DK0B 5JQHC 1R5VA 5GTHH 1U95A 4S2SB 1CZQA 4AQ8C 4Z7WE 3LSOB 3GMPA 4AX3A 1PEWA 4PJ7B 5CP3A 1TJHL 1I75A 2E42A 2V7QJ 1KJVA 2ILLA 4KZEL 1PG7H 1K3IA 1TETH 3PJLA 4TQPA 3TX4A 4F24A 4TN9A 5HHPB 1RD6A 1KYFA 2AP2A 2NLJA 3HZVB 2AXFA 2PAJA 4Y9BA 4F58H 5JIKA 1A6WL 3TPUB 5I8OH 1FC1A 1KGIA 2JJWA 3WFBH 2ICWJ 1OL0A 1YLBB 1UOVA 2DMGA 3PDDA 1Q72L 1URQC 3K6NA 3P73B 5C7XL 4Y4FA 5C70A 1QFWL 4JDZB 5CP3H 2AK4E 5K69A 4ODHL 2C9QA 1E8YA 4C83B 3QW9A 4FXLA 4XBEH 4IMLB 4FQIL 4LQFL 1C08B 5DDHA 3ZDMA 3ZL2A 3HG1A 5I8EA 5F7FA 5CBAA 3NA9L 4GRMA 4DEPB 5CILL 1JWMB 3MV8D 4AMKH 1B4JL 5GZOA 3DIFA 1AGBB 3V6BR 1YEGL 4QXTA 1RF0C 3RGVD 2CRYA 3QORC 2AXHA 3C8KA 2O1AA 1CBVL 4U1HA 1KCWA 1PG7X 2H26B 3FUHA 3FU9A 3QPQD 2G2PA 1FVEA 3TGUD 3I02A 3SPHA 1N7LA 2DH3A 3BEWA 4HIHB 4POZC 3ZYZA 2X12A 1YY9C 4AQRD 2XBDA 2ZAHA 3C12A 3SDAC 3GSUA 1RZ7L 2LGNA 1N5AA 1P4UA 1UT1A 3RIKA 6FABH 2F9BT 1JTHB 1LO4L 3L16A 2WBJD 3PWVA 4F7CA 1MH5A 1QUNB 1JK9A 1X44A 4HJGA 3F12B 3VFRA 2JXMA 4HJJL 4NDMB 2KUBA 1DN0B 2PF6A 2V7NA 3DNKA 5B1KA 4OQTL 5J6HB 4JDTL 4ODXB 2IBZX 4K23L 1LO0H 2V2XA 1O6TA 5APXA 5AVUB 2AABH 3KCWA 4DK6A 5IVNA 4RFEA 1MWOA 2A9NH 1Y6NR 1OAUH 3ULUD 4J3VA 2EDYA 1QQDB 3JWDL 3TIDA 1JPTL 5KYWA 1HHJB 1PYWA 2X7LB 3OAYH 2IH9A 4CPGA 1RJLB 1U8NB 3M9HA 1H6TA 1GS8A 2FNWA 2DRUA 3CHSA 3QDMD 4JDVB 3UAAA 4NUJA 3SFDC 3GMQB 2O6DA 4MZIA 1S3JA 2DAVA 2IFFH 1H3GA 4GRWE 1BYOA 3ZHDA 3WKYA 5C2BH 3CBKB 4R2GC 2P28B 3H6JA 2Z93A 3B7SA 5AKVA 5ICZB 5GZOC 1OP5K 2BHYA 3U2SB 1KFMA 1ID2A 1JO5A 1RIHH 3BN3B 4JPZB 1CFQA 3HR5A 4U1SA 2Q8BH 2EILB 1A2YA 2IAMA 2NNAB 5L7XL 2NTFA 1KZYA 4NCDA 1RULH 2P67A 5ICZA 1H9VA 2BSRB 2B39A 1KOAA 3KXFB 4FNSA 3QSKB 1S9XB 1DIPA 3A67H 1BE3G 5GS0C 3WIIH 5IB3B 3VFMA 4JFYA 3WIFB 4URTB 4XP9H 3T8VA 2L4OA 1AJ7H 4PP2B 3IMVA 1QBAA 3Q6GL 1RJLA 3NH7H 1U8OB 5I66A 1LQSR 3X11B 2X88A 4NC0B 3PY9A 3PPSA 5H2FH 1Q1PA 3VYNA 1EZVG 3L3KA 2CIKA 4FP8H 4PAZA 3VDBA 3PHAA 1F4YH 3EG9A 4FS0A 1CTOA 1NU1K 3LH8A 3RZCA 4WY4C 1S78C 3W0WD 1RLBA 1YJDC 2ZCZA 5J6HA 2GJPA 3O3EA 5KJ7C 3CFJB 1F2QA 1OWRM 1NOAA 3NZHH 3WS6A 3P0VL 3L9EA 4IRZA 4B5ZA 3JWNC 1D5IL 4NENA 4EUPA 4UILH 4XNDA 2UVEA 1A4JA 4NN6C 3K4AA 1NIFA 1NLBH 4JRWA 4YIQB 5DQDL 1E3FA 1XXFC 4G8FA 4JW3A 5TJHA 1NSNH 4KV5F 3EFGA 5FO8B 4HX1B 1YQVL 3U9PH 3OM3B 1Q0XL 5EIVA 3UXFA 3D2UB 2PWFA 1SYSB 4LL9A 1KWGA 1WFMA 2UZPA 2Y9ZA 4GUQA 3CWBD 1MDAA 3BAXA 4LASL 4FXKC 5C9JA 3A4AA 3GMRA 1MRDL 2BCKB 4BM7A 3EJJX 3T6QC 2DPKA 4HS6B 5DRXA 4JMXA 3VXUD 5IHUL 2ZXCA 1K5NA 4WWKA 4LOEA 4UQAA 4JO5A 1IL1A 2P26A 1NEPA 5I1HL 5IVXB 4Z76A 1IFNA 4WBAA 4N0YH 2NX5A 3IJ7A 5I5RA 3IJYA 1JM0A 3AXLA 4BQBA 2GJJA 3KPQB 1E40A 1A7NL 3HD7C 4FFZL 3QXWA 5EFIB 2XQBH 4LL4A 3TDKA 3UJJH 4KKNA 1OALA 2WJ7A 1CTMA 1PIFA 1RUPH 2JH2A 1BGYJ 5DSCA 3UZQA 3PIQA 5JIMA 1BCCJ 2W90A 2R2EB 3PXJA 2Z35B 3ESUF 4P2RD 3TCXA 1KZQA 3RL0g 4ZG1A 4Z1MH 1HL8A 3MBWA 3TA3A 3HFML 1NMBL 3MNMA 4ORGA 5E6ZA 4GQZA 1MV8A 2F5BH 4YN3A 4UDUB 1KTBA 2ZSWB 2WBJA 3OMAB 2CUIA 1NEUA 3UZVA 1FNLA 2EYSA 4F8QA 3WFCH 3V55A 5KKZB 5D2LE 1OCWL 4M3LA 3EH4B 4HKZA 3QUXD 1HILA 5LDSA 3WMSA 3QZPA 3B9AA 4J4PD 4P5MA 1A5FL 5FO8A 5LLIC 2H2PD 4WNQA 4G6MH 1PF3A 3LQAC 2EICA 2XPGB 1FHNA 3DDFA 3FT3A 3QI9D 1MLCA 1ET7A 1RXLA 1OT4A 2PWGA 2A6DB 3H2WA 5CBOA 2CPUA 5AW6B 3ROOA 1DSYA 2GIXA 2H6PB 2HX9A 3QWRD 4NO0A 4QGTA 4X6FB 2XIBA 4L1LA 5AB9A 3PFQA 4M00A 1FO0B 3DUSA 2VR7A 3RVWC 4L1BA 4LHUD 4C7NA 1S7XB 1BIIB 2A06D 2V8LA 3I9GH 1CL7L 4NQCD 5C07E 1JMMA 3S5YA 1TR7A 2CO7B 1AACA 2YHGA 4ZNEE 3ZW3A 5I75B 4XVSH 1ADQA 3FQ4A 5BOPA 2B8OT 2WXGA 3M9QA 2D0HA 1CGSL 2GBVA 1PNCA 1XIWB 3HS0B 3VG0L 1CFBA 1FNEB 1KXVC 1QBLH 4HEPG 1EEZB 5I6PA 1HTYA 1MLBA 1TITA 5LAPA 4Q4IA 1CXIA 2R0WH 1PZ5B 3ZT5A 1EZLA 5ALBH 1CCZA 1SDDB 1TSHA 1ZE3H 12E8L 1WCBA 4UDTA 1AXTL 1DQKA 1F86A 4QTHA 5IKCB 4ZTOH 3O3BA 4G82A 3HG0A 1J0JA 3NSXA 4QO1A 4ZFOA 4I77L 3KLAB 2EIBA 2ZVNB 2NXYB 1U7JA 3R8QA 2QFRA 1GGIH 1HCYA 5IVZA 2VMDA 5E79E 3DJSA 4NQEE 3B3BA 3EJZD 1BEYH 3EUDA 2D4DA 3V0HA 4K9EC 4F7MB 1LWUC 2BFVL 3P4NB 4FCHA 2A9MH 2GSIB 4WJ5A 4UIKH 3G6JE 5EPMA 4JPIB 2C9XA 3H2PA 2R29L 3ZL4L 3Q5TA 5C0IA 3H6AA 2QLYA 4Y0GA 1CDBA 1H0DB 4P9HL 1PY0A 2E74C 5E1QA 3SQOH 1JDDA 3WKMH 2AQ3A 4HS8H 3UACA 1WWAX 2J20A 1JN6A 2AXCA 1T6VN 4Q7DA 1ZIBA 2KS1A 5HYJD 1YEHL 1F1GA 1FV1A 2AQQA 3M88A 1MG3C 4Q0XH 1VEPA 4Q2ZB 3O2WH 3SE4C 3EOBB 4OLUH 4P4KC 5IMKB 1IMHC 2WWMD 4YAQA 5CUSL 5ISZE 1SLWA 1FRGL 5GS2D 3H4FA 2NY1B 2XTJC 4R4NC 3NN8B 1AY1H 3ECWA 4P23B 5APVA 4PLKC 3D3VE 1UCBL 4WI2A 3QULA 1TTUA 4OVUA 1KLGB 3HI1B 3Q9PA 2JKVA 2M1KA 1KB9E 3A4FA 1G4MA 2A3TA 1CDYA 5HHOE 1LEKA 1AZBA 4PJDF 1ZHBB 4CVXA 4K73A 3K2IA 5KS9A 3FPYA 2QVAA 1JWUB 3EXJA 4KMQA 2SEBB 5HHXH 4PR5A 5FYJD 5CEXB 1U3JA 2RBLA 4PQXA 1C5CH 2ESVE 3RX7A 4JHAH 3PHSA 3VG9C 3REWA 1R3IH 4GW5A 4X4ME 4M7ZC 4BCYA 2R0KH 3VCLA 2PP7A 4PY8I 4JPVL 2PPCA 4YGAB 5FYLH 5I8EB 4LVHC 5ITFB 1VGEL 4NKMB 1NDTA 4P23D 1QLFA 2VABA 2K3HA 1KCSH 2H3NA 3IJEB 5KS9E 2FECL 2WO2B 3UPCA 1W2KT 1SJHB 2W81C 4V1DD 2XWXA 4O02H 5DI8A 2Z4TA 4JLRA 3SB3A 4B7LA 1JYNA 2G2NA 4P3CL 2RA1A 2HODB 1IT9H 2X4UB 4JKWA 4QAWA 1I7TB 3WNIA 1NBYB 4KQ4L 4YSSA 5I2IA 4WI6A 2XKSA 3HE5A 4L8DA 2NW3A 4DKAA 2D7OA 4IFMA 1GU4A 1I7ZA 3D39B 3ZSTA 3ARWA 1WT5A 4LLUA 4NUPA 3BLBA 2DKSA 4ZUWA 5JQIB 4XCYA 3CVHH 3KEDA 3B9KC 3BH8B 2AK1H 8PAZA 4ONHA 1J12A 3HZKB 3JT2A 4FYQA 4WIQA 1TQBC 3PAUA 4QHNA 3EWKA 1B0WA 3HZYB 2EEBA 2NY3D 3SKUD 1S9YB 1XIWD 1TZGL 4JFEE 3QRGL 2ERJC 2KSJA 1T83C 1W8OA 5EDSA 3WELA 2JK5B 1J88A 1I8MA 2JWDA 2Y07L 5I19L 3VN0A 2FL5B 3OMNB 5DD0H 3OR6A 2BERA 2X4UA 3LB6C 3MNVB 3T77A 3VD7A 1XHHA 1P7QB 4Q4EA 2WXRA 1E4WL 3MROA 2KH2B 5DQJA 3ZE1E 3PJSA 4MS8D 2K1MA 3PWPD 3OAUH 4KK9D 1YEWA 3S35L 1IAIM 3BP4B 3MYJB 4OIBA 5FIEA 2EKSB 1ZT7A 2AI0H 4XNQB 4KZEH 2WSSH 1DQLH 1SFDA 1B88A 3LZOA 4JS7A 2OR9L 1URIA 3LIZL 2CO3A 4G70B 4L3EE 4U49A 3M17B 2I1KA 3FTVA 1LP9F 3BIAX 2ZZUT 4DFHA 2CSPA 4XX5A 5IBUB 2KMWA 1E6JL 1DVTA 5F8RC 2BY3A 1FDIA 3CN3A 5CJ8A 2B77A 3MJ8A 5E1HB 4FXTA 5E8OB 3MA9H 3TIEB 3RA7H 4ZPVB 3CSYA 3GSNA 4MVBD 5JW4N 4JG9A 2WB1A 3O3DA 1XR8B 3CFIC 1RERA 5IQOA 1CG9B 2LU7A 2OQQA 4XO8A 4FL4C 3T0XA 3GDBA 3QI9C 1RU9H 3BVNB 4HJUA 4MNQA 1JSYA 4JUSA 5BZDA 1DJZA 1DANT 4G7YH 4L3CA 3EADA 4N2EA 1EDHA 1BVLA 1SOXA 4DK5A 5HPMA 1CI5A 3ZT7A 3MODH 5BV7B 2WLIB 1CFSA 1WFTA 3FQXA 4RAVA 5DJTB 3OKMA 2K9JA 3CC5B 4LEOB 3ZR5A 4AG4L 1SY6H 4NBYB 2ISDA 1SEBA 3RU8L 4KTDL 4EAEA 2IWFA 3CU7A 1F3DJ 3BGMB 4QYOA 3CFQA 2WTPA 4KWUA 3S4SG 4I13B 3KXFE 4JY5H 4NFCA 3ZTNH 2F1BA 3L3JB 2NY6C 4AT6A 2X4OA 5AYQA 3W67A 3OX8B 4XTRC 5DLMH 3KPRD 4F9LC 1L0LE 2VLRE 3TC9A 3MTUE 1MFUA 3L72J 4JZJA 3H9SB 4AEFA 2JO1A 2J55A 2QQLL 3D52A 4DZ8B 5T1KB 2G9HA 3QJUB 1ZK5A 3BWAA 3UP6A 2GTWA 4WFED 2YGVA 1USQA 2AABL 3GIVB 3GSQB 4X5RA 4H20H 1RE4A 5EU7C 4IOSD 4R9HA 3ZE2B 3B9KD 2VDQB 2AJXH 4Z95L 5DWUH 5FFGA 2IIJA 1T2JA 1LNUA 1L9NA 4OCLC 3RUGF 3S5ZA 5MI0B 3T2NL 4QHPA 1KJMA 4MB5A 3U7AA 3LEVL 3D0AA 5KSBE 3Q2YA 3MMEB 5KVDH 2RCSH 1G7MA 4KBPA 2PUQT 2J3SA 4PLOB 1SQVJ 1U91B 2YXFA 5I24A 5AOIA 3O6QA 1GMIA 3ZR6A 3A4DA 5C2BL 3GZKA 3B6SA 4J23A 3KZIE 3BEVA 4U1GB 3T8XA 3U4AA 5IK3B 4KOBA 5J56B 4I48A 4QRTA 4KO5A 1S5LH 1FG2B 1S7RA 1X0TA 1JHLH 1NA8A 1IQWH 2EYTB 1IGTB 2C34A 3TVMC 1TMCB 5DA4A 4BZ1A 2YQGA 3TT3H 1HFUA 6CGTA 4KI5E 1KB5B 1NBZA 2F54A 2EUZA 2W0FA 1ZA3B 5D4HA 1MEXL 3SE4A 1A6ZB 4LPWA 4YLBA 3K0WA 3IEAA 3NH7L 1YJWP 2F54B 3VTMA 1Q9KB 1HHHA 2E59A 3RK2C 3T2OA 2BRQA 4WWPA 4HCGA 2P5WE 3E3QE 4FEIA 1TVDA 4WEMB 3DXAD 1SN0A 3HE7C 3K6FA 3O0RL 1VQ4P 4N0CD 1DQML 4WAFA 2IGTA 5B66H 4ODUB 4XMPL 3T97B 1RZGA 1GCFA 3V2QA 2IAMD 4QRTB 4A6YH 1A6PA 1VGKB 1AHMA 4NP4H 1LVEA 2XSKA 4P59L 4OM0H 2CJUH 3JWOH 4PJXF 4HUVA 3W9DA 1MFDL 1PKQB 3ROOB 5F8QC 3NXSA 2P5WA 1D9KB 2Z31D 3QUZB 4G5ZH 4KHTH 4AVIA 2OMTA 3F5HA 4LLUB 4ZUWB 5J6SA 5C0FB 2FYNB 1N64L 3QQDB 5KBDA 2PYEA 3HE5B 2LU4A 5FCUH 3KR3L 1OY3B 4EUPH 3D08A 4MNHB 3EHBB 3LRGA 3K6SA 3QB7C 4JHWH 4XT1C 5DMIH 1VQNP 2C4XA 1TJMA 3SY6A 4YEFA 4HWUA 3K6OA 1ZJAA 4K94C 5EFIA 1JYVA 1BOGA 1JZ3A 3BASA 1AGDB 4TVPH 3W9EB 4UV4H 5DJ0A 5E8EB 3JWNG 3G5XB 1K3ZA 1ZXQA 2OPCA 1IGML 4XP1L 1MCFA 2ALAA 2K70A 2VJ8A 5A2AA 3KCPA 2QELA 4Q9RH 1DQQB 1DD3A 3QDJB 1OD7A 4DESA 3DPBB 2QFPA 4KKLD 3MRLA 1EGJL 1SQQJ 1IKNC 1R6VA 1SM3L 4QJ3B 3V5KB 4AY0A 5L2JB 3OV6A 1T1YB 1N26A 4BUHA 3VVVA 2IOIA 4F7MA 2NR6C 4NQDB 5GS1B 1K2DB 5AW3B 1QX1A 1H5BB 4PU2A 2YEZA 3L71D 1MFVA 2VQUA 1BZDA 2KZBA 3ATEA 4R7DB 2XXCB 2ZYGA 1TTGA 2HFED 2AEQH 1Z9SB 1ZXKA 3B2VL 2ALWA 2AEPL 4WVZA 1FFOB 1I9IL 4EF3A 4NI3A 3IS1X 3DRQB 4GUPB 5AOKA 4GMSL 4KI5C 1WCQA 2VMJA 1ZS8A 2QPEB 5F89A 1LTJA 1XGYH 5MERA 5KZCB 4ZI8A 3TWCH 3B56A 1MHEB 2G9KA 1HNFA 1IE4A 2H8PB 3I3BA 2ZXXA 3IAOA 1QVOB 3L73G 1JOCA 1JWSA 1OW0A 3CMOH 3RIAK 2CMRH 3AAZB 5EN2A 2NRGA 2CH8A 2MOVA 2YJQA 5IQMA 1JZ7A 4G8FB 1WZ1L 3G08A 1EJOL 3CX5K 1RZQA 3P8MC 2UY6A 3LNDA 1XF3A 4JFXB 1G2CB 4LLQA 4ZT1A 5GRJH 3W2DL 4E9XA 2GIMA 2I32A 3RB5A 1J5OH 1S7XA 4JFYB 3FUFA 3BIKB 4HIIA 3MRPA 2OYHA 4R0LB 3SKNA 3S1KA 3BCCD 5MP6L 4L1DA 5ILTL 4NN6B 3QQNA 4F8OA 4LF3B 2PXYA 1G2CA 4A7GA 2AKRB 1MCLA 2FB4L 4KK6C 5T3XH 1MKMA 1PDKB 2GJZA 4HT1H 3IXTA 1UD2A 1K8IB 3O3BB 1C5BH 4XGZA 3JV4A 1W16A 1DQJB 2OTPA 5ISZD 4LEEA 1RV6X 3KWXA 3V0GA 1BLNA 2ZWLT 1PZ5A 4D0DB 2PGDA 3VFMB 2RJMA 2R0WL 1OM9A 4FNQA 4G11A 4AL8H 5CJ4A 1IO4C 3KHQA 1SQPD 3GKWH 4AVHA 4D9RD 4PBVC 4HB1A 4DKEL 4XN2A 5EUOB 1DQJA 4QRBA 4HQQH 5E8DL 5BO1H 3QEQB 3ZYOA 3QJFA 3SKOB 3MUZ1 5DVLA 5KVGL 2DM2A 1VPOH 4C4BA 4B60A 3O6KL 4JHBA 4LSSH 3HUJE 4WV1C 5D5MA 4JG0L 2WUBL 1HKLL 2ADGB 2NUTB 1AGCB 2IPTH 3ULVH 3ILPB 3TP4A 3G5VA 4BDVB 5LBVA 3RPIA 2R5BA 2F19L 4LSTH 4NHCL 4Y1AD 2QVMA 1TTAA 4F7KA 6TAAA 2WZ5A 4IRZH 5JUEH 1AHWC 1RPQA 5EN2B 3CDYA 2Y25A 4KO9A 1H3PH 2V6HA 4UAOC 2NY5H 1CLZH 4KROB 4OIAA 1QTYT 3L74J 1MVUA 3QJZA 1U8HA 5IF0B 4OFVA 2WINB 1N7SA 4G43A 5D7SL 2IVFC 4P2OC 3QC5X 1DEBA 4O51A 3V0JA 1GOHA 2BCKA 4QTFA 4P5TB 4MNGE 2R1YB 4AUUA 3DOSB 3ECBB 2DDQL 1KLGA 4LRIA 3P77B 2J5LC 4R7DA 2EZ0C 1H9DA 3AW5A 1Q1JH 4I9XA 4P4RB 3KGRA 1T3JA 2RFXB 1YJNP 3NRFA 2Q7YB 1ZHNA 5HYSA 5KYUB 4JKMA 1O7SA 1UM6L 3MAWA 3SBWC 4HK3N 1C12B 3P02A 3GXPA 4LT7A 2FEEL 3FXEA 5KSAD 5I8KH 3WY1A 4EKXA 2WYHA 4JFPA 1JNLH 2OYIA 1R3IL 3EIFA 3QQ3B 4ESKA 2K6ZA 4WUUE 1T20B 2Y3AA 1J1PH 3L3GA 5TDOA 2WK2A 4GFTB 1VGEH 2F7OA 5C6PB 3SKOA 2OZ4H 4TUJB 3OR7B 4XFJA 1I8LC 5IFHH 1BOGB 1UH3A 1XSIA 4KROD 1UD5A 3C1LA 2EEDA 3DMMC 3TNNA 5E4AA 3NK3A 4JO8A 4HJEA 4X4YA 1KGJA 1KIRA 2YPLA 3WIFA 4LNRB 1EJFA 1HHGA 4XZ4A 4LBEA 2ZOLB 2NDFA 4HBCH 3OG4B 3V7AE 4NZRL 3V0IA 5BUGA 1S46A 3C5JA 1YJ9P 3HPJB 5ESQB 4ZFFA 2DYSB 2R3CA 1U3HB 2JJTC 5HJBA 1WZMA 1BXXA 3AB0C 2J1ZA 3FO1A 4X50A 4G1EB 1UM5L 5IZ7A 5GRUH 1QWUA 5BRZB 3VXSB 2FX7H 4DZOA 5D1ZI 1RZJL 4ZAKC 3NCWA 3O3EB 4DQOL 1KBPA 3FYIB 5DK0A 1S1CX 4PCSA 4W9JC 1BDYA 1S5HB 5HDLA 2K8QA 4TQEL 4AEHH 1A6TB 4FZEL 3QIBB 1JY3O 4BFNA 5EOQL 1YDPB 5IESL 1FDLL 3I2CL 5GISH 3KXDA 3QIBA 4WU7A 5ACMA 4F2ME 1CDUA 1BD2A 4ZPTB 3V4PH 2Y36H 4HUCA 2N1TA 1YYMH 4TRPH 3RGBA 4MCYB 2F74B 2UV3A 2CLRA 4G6KL 1JHTB 1CLVA 4EDWH 1CD9B 1A3ZA 4KAQL 3D6ZA 2Q0ZX 1I3UA 1MJJB 3LY6A 5DHYA 5GRWA 2DQHL 3QR2A 4FEMA 5DD5H 3RGVC 2UY6B 2CKBL 4FLHA 4JFXA 1KGXA 3WTXA 4BUQA 5HYJE 1J5HA 2OA9A 4NKQB 4PJFF 3WIAA 4IOIB 5CF3A 4U1JA 5IK3A 5IB1A 3TFKD 5KSBA 2ZYRA 2MOQA 5AVXB 2HT2C 2EC8A 5CP7A 1U8KB 1ZHBA 4LNRA 5FLUA 1QFPA 4YSTA 2IBBA 3SJVA 4KJYB 3RL0C 1U8NA 1YJDH 2P3YA 3N40F 2NNCA 4L18A 2OYPA 5F44A 1BJ1J 2VR3A 3GSNH 2VR9A 4IK6A 2Q8AL 5CCGA 3I56P 4M8VA 1JK8B 3VSUA 1SDYA 3NSJA 4XTRD 2JB6B 3HG5A 2AV1A 4NCC2 2QL1A 2Q3AA 2Y0DA 5IMLB 3O8XA 1LO3L 1MCEA 2GBAA 4AG4H 2UYLA 1R3LA 4KHXH 3PNWB 3ES6B 4KTDH 4C83A 4N1HB 4WGWB 2E7MA 2J44A 2EVJA 1M53A 3MV9E 2H41A 1L0NJ 3HRZC 4G6FB 4N2DA 5F1IB 3C60D 3ISWA 1KBWA 4PSPA 3UTSA 5KAIE 2VDNL 2GTZB 3ZPDA 4PRNB 1DJYA 3BYTA 5FO7B 1FE8H 2OMYA 3VOPA 4GW1B 1Y07A 4X6EB 3QISA 2DMCA 3QQDA 4G1MA 5IV2B 3CHPA 3BZEA 2AJYH 4R2GD 4WEBL 1TQBB 3QUZA 3M1BA 3AS2A 4TVUA 2VDKB 2FO4B 4RKUJ 3DX8A 4FYTA 4WWKB 4BV1A 5CCKH 3US1A 4Z3TA 4XPBH 3U0PB 3LNIA 5BUAA 4U1HB 5J1TC 3PGFL 5G4OA 3Q1EA 3RPKA 2OCJA 1P7KB 4M8UA 2OMXA 2VDKL 3L1OH 2WYIA 2HG5B 4S1RH 2JTYA 3ZKSD 1A9VA 1ZDQA 2W60B 4ZQTA 3WSQH 3IFLH 4LPUA 5KVDL 1WRGA 3UP1A 1NO4A 4OKVB 3D85B 1NLDL 3LN4B 1DQVA 3UO1L 4Z8FL 1QLED 3LZFH 5JQ6H 4FNLL 3S2CA 3E2HC 2HKAA 4W6YB 4Y2DD 4HGMA 4ODVH 1F11B 1YN7A 2BP0B 2HJLB 1YUKB 3ZMEA 1D6VH 3FSVA 4QOKB 3MUUA 5TF0A 4R83A 5GGQH 1QA9B 5E6IA 4W9HC 3VXPA 5K39B 2X6VA 2CCVA 2JF1A 2CGRL 4O2CA 1JZDC 4P9ML 4HV8B 4PBDA 5FW6A 3BVXA 1FS0E 2NW3B 3NFNB 4UOZA 3HNTL 4O2CB 3ARDD 4ZNEA 3P3TA 5IQ7L 5SX4I 3LW5H 4LLMA 3TT3L 3S88H 4ZMZA 4F33A 3DHUA 1CFTA 4PIRF 2WPVB 1HEZA 4JM2A 4DUXA 3G3LA 2XCMC 3JTTA 3GWJA 3WN5C 1XAKA 1N5YL 4XNUH 3F7YA 3BE1H 4LZKA 3VI4B 4OTXH 4CVZA 4Z7QE 2VQ1A 4ZMDA 1D5RA 3V2NA 3L3OA 1ZJBA 4OAWB 4MMXC 4XP5L 3UAJA 2M2DA 4PJ8C 1ZT4A 2NTFB 5ITFA 3VXRA 1EHAA 3CQFA 1FG2A 2VLJA 1USEA 2GEEA 3MBXH 1F13A 2FSEA 2Q5BA 2Z8SA 4RIRB 3CNKA 5EBWA 2IBZE 2APBA 1QASA 4R26H 1SXZA 3QAQA 4K71C 4CMHB 4XC1L 2ADIB 4YUEH 3BIKA 3DX8B 2W91A 2C7FA 4M3HA 5IVXF 3TO4C 2NY6B 3KWWB 1INEH 3QO1A 5JLZA 2XBZA 2DWDA 4KV5E 3UAEA 3PQYA 3GIZH 3OD3A 3HZMB 4HSQA 5GS2H 4FTVD 3QHFH 4TTDC 4PVLA 5DD6B 1GGCL 1GRWA 1RUKL 1XF1A 3NFSH 5I82A 1OARL 1X5HA 3AMKA 2XNDH 4I3SL 3MRRB 3X3FL 5CD5D 3VI3F 1AGFB 7FABH 1EHXA 1YIJP 1RIUL 2HVBA 2R4RL 3E80A 1ANUA 3BWAB 5I17A 1KFAL 1MJUL 1ZE3C 4PRPE 1NQBA 2F1EA 2EE3A 4HPYH 5AEAA 2GJRA 1FIEA 4WY4B 4CW1A 4YSCA 1M57B 3FQNA 2NX5D 3DI3B 3VCLB 5HPMB 4NPYB 2D0GA 4N20A 2NZ1A 3TT1L 1Z3GH 4ZQKA 4HS6A 1KELH 1NVOA 3H1JD 3A0BE 1H3XA 2EC9U 2IH1A 1OSZA 3V0WH 2XZZA 4ZQKB 4Y89A 3RWEA 3WGUB 2ZP8A 3HC2A 1LO5B 4K3EL 4S1DD 3T65A 4HOXA 3IPEA 3O41B 7TAAA 1WS7A 2DEWX 1H8LA 4NBXB 4OLZH 1QNIA 2V2TA 4N0UA 2GJ6B 4KZ0A 1KYOE 1EK3A 1NCHA 4KO6A 4B9PA 1G7QA 4KKAC 3CL3D 4HHAA 4JQVC 4Z3GA 2CPSA 1T1XB 1SBSH 2Y7LA 3WLWD 2IWGA 3IJ9A 5BU5A 1AE6L 1BJ1H 8CGTA 1NEZA 4YXLL 1JZ4A 1ZOYC 4ASVA 2B87B 4OGQD 2NPSA 4ZS7L 4AIZA 2FX9L 2P5PA 1CFNB 4QHUB 4UQCA 3K5BA 1XIWC 4JVUA 4PV8B 1DQDL 4Y16D 2E75D 1WZ1H 3GO1H 4LDLB 1BGYG 5AYTA 1EAPB 5L2KD 3DETC 5D2NB 1FE6A 2EC9T 5TE6H 4HUNB 5F9JA 5JDJA 1J8RA 3F6LA 1MDTA 3KYNA 2X4SB 5FC9A 1S5LX 5E2TH 4P2OB 3WJJA 1P84J 1JFHA 4TUOA 1YPZB 4YSOA 3WHE0 5MP6H 5D6CA 5C08B 3DXAE 3VWKB 1MFAH 5EC2A 2HA1A 3I9PA 4E2OA 2CD0A 2PYFA 1FOSE 1RFDH 1FFRA 1F3JA 2QSIA 5GRYA 3WHE1 4AM0A 4NJAH 1X7SA 3G9RA 2K9UA 2C1OA 3OKEA 1N8RQ 1DSFH 4NQCA 3ULAB 4Y28J 4FYRA 3VXRB 1UENA 2D2CC 5DUML 5DVOA 1LWUB 2KXPB 2ADFH 3A0BH 2HN7B 4JDEB 4ATTA 1OK0A 5I2IB 1IFRA 2YGOA 1P84D 3BD5A 2RQEA 5IGXH 3DUHA 1AC0A 2APXA 2WQYC 2JELH 5B5EH 2V9TA 4UMSA 2X4RB 3GF7A 3WENA 3QIUD 5C08D 1YYLL 3HZKA 4LKCA 3RAJH 4Y4KD 2IDCA 3H3KA 5SWZD 5T3ZE 2VN3A 3RURA 1PG7L 5KYWB 3KPRB 4ZX6A 3LRSB 1II4E 3VSVA 5LCVH 3RGHA 5E70A 1VFBA 2EH7L 4UQ2B 1KYOD 4CSTA 2PR4H 3DMMB 1FBIH 3RTQC 3HC3L 4I0PA 2OCFD 1X9UA 3GS0A 5IY5B 3S3JA 2H4EA 2P5EB 5I75C 4YX2L 1QFWH 4MBRA 2P8LB 2FIKA 1RHHA 1F11A 1YN7B 2BP0A 4B9IA 2IOMA 1E4KA 2H9GB 2PP9A 3G6JF 3LKSA 1KXTB 3PREA 1T2XA 2R2CA 1H5BC 2G5UA 4R6UA 3WIHA 2I26N 5B21A 3ZO0A 1TYRA 1HC1A 1UYWL 4NJ9H 2OI9B 1BMZA 2XZAH 1PZQA 4PJXB 4PJ0E 5DC9B 4J1UB 5F96L 4PIBA 5CILH 1JGVL 2CJTA 5KSUA 3S8WA 4K7PY 1I3RB 1BBDL 4NUGH 3CDGA 4P23A 5ALCH 3TL5A 1YEGH 3ECBA 3L5XH 5A1AA 4HIHA 5EU7E 5D7SH 2Y1VA 2EXTA 1T03H 1P1VA 4P5TA 1DBAH 4S0SD 3L72D 1JV2A 1KLUA 3ZQWA 5DEFB 3VM7A 1HI6A 1AZVA 3KHOA 2XVKA 2WTRB 3M6DA 4H2CA 5KS9B 1YPZA 2J6WA 3BUDA 4JFEA 5F6HJ 5HVGB 2VB5A 3O4LB 1BAGA 2FD6H 3RY5A 3LDBC 1UB6B 3B3IB 1S5LE 1RZ7H 3IDNB 2DLIA 4NKOA 3AXHA 3WO3B 2Q6WA 1KCUL 1U21A 5I71B 4N6QA 3C09C 2MJZA 2BVQA 3NPZB 1Q9LA 1U41A 3MRHA 4DTGL 5D7JC 1GOFA 1CK0L 1F8TL 3CC1A 3QO0A 4HXBH 4YLQT 4TSBL 5A16A 2XU9A 1CUOA 1TCMA 2C0XA 2UZXA 4HIQA 4QHKJ 1NTZE 5DK2B 5C08E 2K9JB 4Z77A 4XRCA 2P2UA 1JV5B 3EYUL 3L3KB 1IC2A 4WEUD 3GB7B 4KKZA 1MRFH 3LXAA 4QRSA 5HHOD 3MRCA 5BNXD 5KUMA 2EDKA 3GZPA 5M1BA 2KQNA 4M43H 1ZTMA 3V52L 4CC0A 3HBPA 2VAAB 3B8EB 2L8AA 3GTVA 4DP9X 4TLTA 5E6UB 1AI1H 4GQ9H 1ZHKA 3ULUF 3QARA 2PCFB 2KPNA 2X38A 4GSQA 3W1ZA 1IGIH 2XTJE 1FDMA 4FQXA 4MJJA 3FU5A 3GS4A 3UGEA 2X6BA 1K8IA 4PRDA 1AR1D 3WXWL 3CUPA 3MI6A 4AMWA 4PGDA 3X12A 3X3GL 2YKKA 1UM5H 1RE3A 1MI5A 1NFDF 3FTUA 3SYCA 1NMAH 3DSNB 5I8CB 5IJVB 1UJTA 5JZ7D 2H1PH 1KDJA 1SOSA 3K5RA 4Y5YA 1HXYB 4QHMB 2Q20A 3A67L 3NZ8A 3MBEA 3HRZB 4XH2A 5KVEH 4MYWB 3DJ9A 1DYZA 2Z65C 2N7BA 4LMQI 4P4KA 4MCYA 2F2HA 4PLKD 4PS7A 3P3UA 1JHTA 3IDGA 3K2UH 4NZTH 1U6AL 2X7LA 3IXAB 3C8VA 1P6FA 4PEEA 4EZJA 1Q0EA 3NP3A 1YQ2A 4K5NA 1QSEB 4X6CA 5T1LA 3DVNB 3ZDZE 2LAGB 1MXDA 4LCVA 1E50A 1AQDB 3P0YH 1QSFA 2H0PA 3V5HB 1I53A 3CPLA 3G6AA 4OF8A 1W8EA 5F7EH 4UBDC 2FSDA 1NTMG 1F97A 1WTLA 2AJUH 2GC7C 2ARJA 2DQIH 3PWLA 4LCCA 3MJ6A 5HI4C 3V2RA 3NZHL 2V5RA 4AQ1A 4QHNB 4D6TG 5BRZA 1SQ2N 5IR1B 3CZSA 3CLQA 3V0VB 4AIOA 1XH0A 2Z0BA 5I6OA 1GZQB 4W9IC 4X6CE 4Z5RA 4BBWA 1L9RA 2ZUQC 3NDYE 5CR8A 1OM3L 3RP1A 4YFDB 2JQZA 5CLYA 5C0EB 4L9LA 3NCXA 3VP8A 3OKKA 3FHAA 3U36A 5LNDA 2ERJB 1IVLA 3IAQA 3PIQB 3S96B 3ZTDC 3RE0A 4UB6E 2YSSA 4OVVA 3QYCA 4CA4A 5C6TL 1A4CA 5L8KB 3BUIA 4IS6A 1UTDA 5FHAL 5KVMC 3TNNB 2BVPB 1P84H 3AS1A 4U6YB 3D0LA 1JNNL 4NNYA 5D1ZB 5JHDA 1YHPA 1VF5B 1FPTL 1MCOL 3GI8L 1RVFH 2YXRB 5I1HH 2IFMA 5MENB 4DKDC 3VWJC 4R7NA 5DR5L 3IF4A 2ENYA 5TDOB 5ICXB 1P4BH 1UM4L 4JFSA 5IT2L 1Q94A 1UH4A 3HPLB 4C4KO 3VUAA 5E2WL 3QWOA 2D3VA 2VDLL 3DO7B 2EIEA 5C97A 1O6SA 1PLCA 3VI4E 4Z7QB 2JIXB 2YD0A 4LAQL 4PRIA 4FZ8H 3M1OA 3ALXA 3VYOA 4TVPD 2BP8A 4L74A 2HR3A 4GAJH 1HGZA 1GYWA 3FU7B 1TZHB 3W68A 4ZUSA 1HGVA 4AE1A 3P77A 3D69B 1KLFA 5L2KE 2IMNA 4KITB 4FFZA 1MCKA 2IFGA 3HMWL 4OZGB 3AU1A 4U1GC 3KYQA 1CICC 3MOBH 3MLRH 3KVPA 1Y1DA 2HRLA 4OM1H 2G3ZA 3W81A 1PPJD 2N7SA 4AYID 4EDXB 5JHLL 3QZNA 2FWSA 5I23A 2D7MA 3MRDA 4MX7A 3DJZA 4IJ3B 2VDKH 2BNUA 2K9YA 1TFPA 1ZHLB 2Z8RA 2HP4A 4EIJA 2KSEA 1MVUB 1NFDB 2B3RA 4F20A 4FQ1L 3QEGL 4PJHF 1H88A 2XPZA 2X1OA 5HY9A 2ESVD 3O45B 1ZV2A 4MD4A 1F2XK 1UWXK 1HE8A 3H1KJ 2BO0A 4B0MM 5K9JL 2VQ4A 3PV7A 1EIBA 4HEMA 1EFXB 4OSUL 5DUJA 3HHMA 4YS4A 3RL1A 1ITBB 4IS6B 4RX4A 4YHLH 3F89A 3AJ7A 2ZCLL 2W0FB 5GTHE 4Y1AB 3CFKB 5B1JC 1URQB 2BW5A 2EE2A 5TQ2L 4WF7A 1FZJA 3HG4A 2D4FA 1CL7H 3MLZH 1U3HD 2MCPH 1QEXA 3NJFA 4LXFA 4Y16A 1PX8A 2NNAA 1UVQA 1I1FB 3MTRA 1FL5B 1A6VH 1FL6A 2W9EL 3CIAA 1SLXA 1NEZG 2XTSA 3N9GL 1QMUA 4LCIH 5TK2A 1DEDA 4XWGH 1CXFA 2V37A 2QBWA 3BDXA 4H8WC 4A38A 4KZDL 2AEJA 2ROYA 2HWZL 1OO2A 5MI0C 4GKOA 4L4VA 5LUMA 2NZIA 1NCAH 2YA1A 5CP7B 3FB7B 3V5HA 1JZ5A 2IFNA 3UCRA 2CDGB 2X1PA 1LTAC 3EHBC 2ED8A 4PRPA 3IPBA 3BQUB 1JI2A 3PP4H 2VSCA 1MWAB 4XCNB 4H5SA 5E9DE 5T3XD 3D18A 3D3VA 1NDGB 5JPNA 1CYXA 1ODAA 4QRQA 1F5WA 3DTUB 3UBGA 4D8PA 1JF1A 3IKCB 2MPAL 2WCPA 1MWAL 1DBJH 5JOFB 1WGVA 1W0WB 3ZT6A 1NDMA 3QRLA 4YHIA 4PJIA 5TQ0H 1IC5H 5AG9A 2APFA 2BFVH 3BSZL 1ZVYA 4MB1A 2Q3ZA 1SF5A 3UJIL 1NDMB 4YHIB 5L0QC 5D7KE 1KN4H 3RWCB 4HIEA 4HKXA 4LCWA 4Y88A 3VD3A 2L7QA 1OE1A 5EO0A 3CLWA 1KB9J 3QUML 5EZJB 3QNZA 3GTTA 3QHFL 4MD0B 1BFOB 4HW6A 3AECC 4JKPL 3AVEA 5E2UH 3SYQA 2R15A 4PG2A 2WGXA 3HAEG 3FQTA 5HSFA 1NIEA 4ZMWA 3TV3L 1MCIA 3MV9D 4WSJA 1LEIB 4Z0BL 3BH4A 3BEWB 1YEHH 4A1RA 1GJIA 4YDIH 1RH5B 2EQDA 2AS5M 1WRFA 4LHJB 2R56H 4HPYL 5J6GB 3IF1A 4KK5C 3ILEA 2BSED 1RK0B 1WFUA 4K7PX 2BW4A 1CB4A 4ADJA 2BIIA 2VDOB 5I0ZA 3UYRH 4F2MB 1N6QH 4QGYA 1H5BA 2Q7AA 3EYQC 4DQAA 1ET8A 3VRJA 5CN2A 1TZHA 5AUMA 3LD8B 5D7LE 4ZFGL 3E2HB 1A25A 3GSUB 3JBG7 4PJ8A 3RK2D 1ZSHA 2I07B 3D71A 3ZHLA 4IGBD 1KIRB 2YPLB 3NEXA 1KTDB 1OGTA 1YNLH 1QUPA 4Y9GA 3SFEC 1QABA 4TMPA 4OJEH 1UUSA 3L4CA 4XBGA 2PXYD 3UC0L 1FVDA 5CCHA 1P84E 3BO8B 4GRLA 1A9BA 1BQLH 2XN1A 2ZX7A 4M6AA 1N2RA 2E7DA 4PV9B 1I1AD 5EZOH 4Q56A 4GAGH 1RY3A 3NPSB 3QUYB 1GZPB 2BLFA 3UTTE 3EO0B 5LN8A 1J8HB 3HMXA 3L13A 2ZOKB 4LBAA 1I1AA 5GZOD 4RMTA 3U30C 4DJMA 3NSCA 4M6MH 5DJ6B 5I15H 1PZBA 2DM3A 4GG6A 4NS0A 4PTUA 1P0SE 3DARA 4R90H 5HI3D 5DYOA 3T0EE 3WEOA 4Z7WA 3CN2A 5DRXB 3RBSA 2PTTB 2XZRA 3GHGC 3VFPB 5KYUA 5HYSB 1SQQG 1JNMA 4PJDA 3SE9H 4ZW3A 1A65A 3GO1L 4PJ8B 6PCYA 2FEJA 1F02I 5I76B 1LLAA 4FXGA 4UQDA 2NY7L 1F3RB 2WMPB 1UZ6F 3IDNA 1UHVA 3FQWA 4NKOB 1G4RA 2PO6A 2WTOA 1OAJA 3QI9B 3FCTA 5GJTL 4U3HA 2KZIA 3GC3A 1FZEA 2AK1L 2NYZA 3C5SA 5KLVK 1OTTD 3MACL 2E9WA 3W9DB 4N87A 1KYAA 2ZNXA 1T3FB 3MLSH 1CPUA 1ES0A 2MQGA 2VLJB 4MRBA 1NANH 3E8VA 4JFZL 4NNXB 4TS6A 2NY5C 2UWEB 1I8LA 3S9DB 4UF7C 3GMLA 2OXHB 3SPVA 3C60B 3NJKA 4ZS6D 1Z0NA 2DWSA 2AK4D 3TEUA 5ADPH 2AXWA 5BXFA 1M05B 1WJ3A 3J2PA 1UQSA