5AW5B

Kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 2.2 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw5B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw5B02
1H8AA 1HWTC 3V4WA 3O8ZA 1CI6B 5AW9B 4AUWA 3A2AA 5AW6B 4HYTB 3NTNA 2XZRA 5AW4B 1CI6A 3OAKA 2WTYA 2H7HA 3NMDA 3LIEA 3TYYA 5APQA 3V4QA 5AVXB 3P32A 4AQRD 3UIAA 1T2KC 2Q7CA 3TK1A 1OXZA 1CSBA 3M0DA 3M91A 1KQLA 1SP4A 1H89A 1A02F 2E43A 1H88A 2R3CA 3TNUB 1JNMA 1OWAA 3WGVB 1MUUA 4RETB 3IR9A 2YO3A 5APXA 1NAFA 2N9BA 3TNUA 3VMZA 1GK6A 5AVWB 5AW8B 3HTKA 5AW0B 1X8YA 2W27A 5AW5B 3T97A 3P7KA 2BASA 2YO2A 4EOTA 2P67A 2Z5IA 1CZQA 4DZOA 5APVA 3HE5B 5AVYB 3L37A 2WPSA 1NWQA 1IO4A 2P2UA 2QM8A 1J2JB 3VYIA 1S9KE 1A02J 3L36A 4M3LA 5APTA 4B86A 2IPPA 1DH3A 5CMZA 2ZFCA 3M06A 2R5BA 3NFQA 5AVRB 3HE4B 4I6MC 3MD0A 4C7NB 2P7JA 5APWA 2Z5HA 5AW3B 5AVUB 3HE4A 2R32A 4C7NA 3SWFA 1G2CB 3MGNA 3A3YB 2R5DA 1GTWA 1HJBA 4AYCA 4LC1A 5AW7B 5APSA 3I5CA 3KQGA 1GU4A 3P8MC 5APYA 2WPRA 3LIDA 3WGUB 4JYCA 5APUA 4KHXA 5AVSB 1HBWA 5AW1B 3HE5A 1T2KD 2XU6A 1FOSF 2Q3IA 2W6AA 5AVVB 3M9BA 3VMXA 2YNYA 4GT1A 3NXSA 1YYCA 2WT7B 1GD2E 3VTPC 2JJLA 4RESB 5AVTB 5AVZB 1GU5A 3V5BA 5AW2B 2WT7A 2ZXEB 4C46A 2C9NY 3M0AA 1MFZA 2WPQA 3VN0A 2WWWA 1S9KD 1JUNA 2C9LY 2XV5A 4JYBA 1SLQA 2E42A 5AVQB 3A7OA 2VRSA 3A5TA 2QM7A 3KDPB 2Q5UA 1FAVA 4I2LC 2KP8A 4GKGA 3VMYA 3M9HA 4XE5B 3B8EB 1HUCA 3L35A 1FOSE 1GK4A 1MV8A 1GZLA
chains in the Genus database with same CATH superfamily
4QD2E 5F1KC 3V4VL 3H1JG 4PLNC 3FN0L 1RZ7L 3GSVA 1USEA 1WBZA 2K1AA 5CKGA 5IJKC 3ARQA 2X1OA 1I8KA 2BS71 2ZOKA 2L7EA 4I85A 3E1ZA 2DKUA 4XPTL 1BFSA 3QWQB 1G7IB 5EN3A 5HVHB 3H8NA 4A37A 3JVFC 4KRMB 4HK0B 3RGVB 1FZJB 5FHAL 2APSA 1MNNA 2DICA 1JWUB 3IE4A 3L17A 1MJUL 4J6RH 4K55A 4FHKA 1MWOA 4PTTB 3MRBB 4RWHA 2POHA 5CEYA 1PZDA 2CJUL 3T1WA 1QLEH 3Q0HA 4YHPB 2JJVA 4OGQD 2VYRE 4XCNB 1YQ3C 5C86A 3D4ZA 1QI3A 1KB9I 3FUMA 3KG5A 1P1ZA 1FE8L 3RL1A 2F54E 1BGXL 3H9SA 3MN8A 1EEYA 3F62A 3QUYB 4F20A 2MKWA 1MRFL 2E6QA 3QSKB 2YKKA 5L2KE 1D2PA 4Z7WA 4DEPB 1DQJB 1F97A 4PV9B 3PXJA 1OGTA 3S37X 3CVHL 5A2IH 2X41A 3VG0H 3L73D 2ZT9D 3VQ2C 1BCCJ 1ONQA 4D8PB 1NTKE 4MYWB 2NPSB 3DNKA 4I87A 1G6RA 5FYJH 7PCYA 4KZEH 2R15A 1P4IL 2Z5HA 3LH2H 3QUMA 3DJZA 3G6JF 3RTQA 4KKRA 2Y1VA 4R3SA 1E79H 2X89A 2RALA 4WI0A 1ZPUA 2X4PB 2QGCA 2Q3AA 4PWEA 5LG1A 1OE1A 2HLEB 4ODUA 5HI5C 1PQZA 1R3IH 3ECBA 2BNQB 1EZLA 2GJ6E 2QLVB 4LLYA 5HHNB 3FYEB 3T3MB 4OCMC 3TVMC 2I32A 4OT1L 3FO9B 4GAYB 1GYVA 2F53D 1A1MB 3BXNB 4PAZA 1UZ6E 3VX1A 3CC4P 3D33A 3ISRA 3O8XB 3ZZ1A 4BDVB 4CSTA 4HS8H 2DW3A 2IGFH 2P48B 4TYUA 4W6YB 5DC0A 1A1OA 2AXGA 2XV2A 3LNGA 2JKRM 2Y06L 3MX0B 5ELIA 1QLFB 2HUHA 4Y19D 1KXHA 3O4LD 1KQSO 3QJFB 4WUUA 4P4KA 4K07A 4RESB 4M48L 4CADB 1BEYH 2OSYA 1RCYA 2VDNL 1XGUA 1ZT4A 1WTLA 3BPCA 5E5RB 4D0DA 2JIXA 2KS1A 2WINB 1S7UA 4W9DC 5DWUH 2HSIA 4N0FB 4HKZH 5MI0B 2D8KA 2J25A 3PWJB 3LH8A 1B6UA 1T1XB 1NANI 5EZLB 4MQXD 2M83A 3AE5C 1GL2A 4R0LA 5HGDA 3S34H 2JDIH 4LPUA 5IM7A 1EFXA 3U9UB 1JZ5A 2B8OT 5I2IB 2RKLA 5C0NC 4MJIB 3D6YA 3UBXG 4NXSA 4XA4A 4Z7QE 3F05A 4OCYL 1U8PA 4LQ1A 4R4NC 4APQA 4N8PA 5D1ZB 5C0FA 2H32H 3L5HA 3ZTJH 1FVDA 3B4NA 5HI5D 1CE1H 2WLMA 2WXNA 1P1VA 1SJVA 5FCSH 4ELKA 1NFDE 3BVWA 3O6LH 4Z95L 3GIVB 4K9EL 3IPEA 4S1RL 5FK9A 3LIUA 3WMSA 5DJ8B 2DQ6A 1S3KL 3FB8B 4W9FC 5CEZL 1KULA 1WZMA 3M91A 1KQLA 4G6FB 5IEHA 1MAML 1YEEL 1IIIA 3WKNA 1ZWIB 1SXBA 4GW4B 1RJYA 1UA7A 4UM8B 4G59C 5F9JA 3SBWC 1MPAH 3G6EP 32C2A 4M3KB 5SWZB 4QYOA 1NMCC 4QRTA 2A9NL 3KHOA 4QUOA 3MA9L 4BH7A 4CPGA 5KBLA 3HZKA 3EO9L 4R4FH 1JGIA 1V7ML 3SFDC 2KLRA 3TH3T 3FFCA 1EAOA 1W8OA 2IFFL 2K45A 4Y5XA 2A77L 4X4XA 5TQ0H 4ZW5A 3GMMA 2KPNA 3FXDA 2ZKMX 3G5VA 2FZ3B 4M93C 3QQ4B 4Y2LA 4YXLH 3BRDA 2WSPA 1ZD6A 2DBLL 2AK1L 4U1IB 5I1KL 1F4YL 3CFCL 1FC2C 3O6FC 1GDTA 1E4XI 1HJBA 2NX5E 2PR9A 3ARFA 4D9QD 1FNFA 4NRYA 5CHNB 1HOCB 4WWKD 3RWDA 4R4ND 1F1GA 3TYGL 1R1CA 4Z0XA 2GCYB 1KGCE 3LIZA 4HKXB 3LRSA 3FCGA 4LP8A 1L4AC 1PFOA 4N8CL 1EXUA 1MFEL 3HS0C 3GMNB 3JTBA 4N1EA 5F93C 4TUJB 5LWYH 5L0QC 3D4GA 4LKCB 4YHNA 5F0JB 1K73Q 1JWMB 1JY2P 3F2LA 4X6CA 4LLQA 4A2EA 2VSDA 3BPNC 4YSOA 2XBZA 3AE2C 4HCRL 4HDIB 4IRZA 5CGTA 1FFPA 2Q87A 4AL8C 1GGBL 3QI9C 1MLBA 3M07A 2YEQA 1QFUH 2A1WH 2VO5A 1IGYA 3KJ6L 1MFZA 4Q6YA 3ZDYB 5ADOL 1T21B 1KN7A 5JQ6H 1VFBB 1FJKA 5JOFA 5IF0A 3FCBA 4O02L 2HRLA 1KENL 2ZX9A 4PRPA 1F4AA 4UQ3B 3SDCB 3EDEA 3PWUB 3KYQA 4ZG1A 2BC4A 3MRCA 1I1YB 4JLRB 3U36B 2K1MA 2QQLL 4M61A 3W67A 3NJVA 3UDWA 3VGHA 4HIEA 4FYTA 4NKIH 4AQOA 1FC2D 1DVTA 2VDQH 5B1JC 1ORSB 1AFVH 2D2OA 2VLKA 2Q0ZX 2DKSA 4JFTA 3FTWA 2C5DC 4NPEA 2Y2WA 2FECI 4N6RB 5DJXB 4B53A 5F7KC 3UG3A 4OIBA 3EJTA 3HE7B 3T6QC 1BM7A 3KLQA 1LWUA 3WY1A 5DK2B 1PGOA 4MMZA 5D2NA 1U8NB 1L4AD 2CG9X 5GRVL 2YOAA 4AQRD 3S0PA 1BVNP 3O3BB 3S5ZA 3WEOA 2GIXA 1CZ8L 4EN2A 3FQRA 2E4FA 4JREB 2PYFA 1E2ZA 4F15B 2BY0A 4EI5C 1NAFA 1NEPA 2IH1A 1A9BA 1XO8A 1WIPA 3QI9D 1X8YA 1QACA 2J57A 2OJEB 2WTPA 3C2AH 5EOCH 4F7PA 4L9LC 5TE7L 3P77A 2AW2A 2GT9A 3UAAA 3TBSA 4BGDA 1X5KA 4L76A 2AJSL 3V2RA 1DBKH 3ARBA 4Q8BA 5F9OL 3AXLA 4KH2A 1NVOA 1TZIA 3TGXA 5T8IA 5CBAA 4JMXA 3K71A 4JKPL 3MIWA 2UVEA 3F04A 3II2A 5C09D 2O26U 4AE1A 5FOBB 5JXEA 2QEJA 5T3XH 3ZE1F 1MY7A 5DK3A 2XQYK 4PRHB 2EKJA 2FD6H 2FFDA 1WD8A 3AREB 4GI8A 4YHIA 1PY0A 4ALAH 5C0BE 4WFEE 3P4OA 4LKXB 4X8JB 4ZZKA 1BLNB 5GSVA 1SJXA 3PV6B 3U6XS 2BSSB 3P40A 4Y4KA 3TO4B 2NZ9C 4XWGL 1KIUB 3L4ZA 2ZICA 1FOSF 2CZNA 4JZJA 2J3SA 2Y36L 4Q2ZA 4Q89A 1QFWL 2ZD0A 3EFGA 1M2VB 1DJIA 4G1MB 1KWKA 4Z76B 5BS0E 4E9WA 3B5HA 1S72P 3LD8C 1R46A 2YAOA 3CZNA 4AQEB 3BAIA 3ZTNL 2DLHA 4PJ7E 4EN3A 3VTPC 4ZNEE 2V3FA 1LMIA 4M1GH 3MCG1 4LF3A 3REVB 4YVNA 1OOAA 3L16A 1LEIB 4P3DB 5TDNA 2YAPA 1MCCA 3MV8B 1S9WA 2V9UA 4PWKA 4CVUA 1S7VB 4S0HA 2E7MA 1AQDA 3WTYA 4I3SL 1NBVL 5F8RC 1UADC 4BINA 3KDPB 1RVFH 2HLFD 3QIBA 3KDMA 4MB5A 3HR5B 3M9HA 2NXYB 4HIPA 4K94C 2E7BA 2Y1YA 3T0DA 3E9UA 2G2RA 3WEAA 3U0TB 1BQRA 3HNVL 4WFHD 4P46D 1S9YA 1BQ5A 4JHZA 4CMMB 3DBXB 3MRLA 1G1OA 2WZ0A 3IJHA 2EIDA 5TE4L 3TNMA 4ANKA 4WJ5B 1U9KA 2A6JB 1QPPA 5IMMA 1RUMH 1N0XH 2NZ9D 5I0WA 2E76C 3AXIA 5JW5B 2O30A 2OMYA 1E4KA 1JI1A 2A6IB 4MSWB 5D5MF 4KTGA 5B39B 3RWJB 4JO1H 3ARYA 5FKPA 4UM9B 1R0AH 4JDTH 3GSNH 3HAEA 4PJEA 3TT3L 5FA3B 1RSYA 4LCVA 3QFJA 1OWAA 3SE9H 3RWFA 4Y4HD 1UYWL 2Y6TE 4MA8H 1H0TA 3MOAH 3ZE0B 4D9RE 2OR9H 2Q8BH 3T3PF 5I18L 5DFVD 3Q1SL 2BSRB 1UWXH 3FQUB 1VHPA 1CZQA 3CFDA 1S9VA 3L37A 1ZTXE 2X3BA 2AABH 3ILPA 4NP9A 1CFTB 2AEQL 4LEOA 5KANI 1LT1A 3NDZE 1OKEA 1ZIAA 3HRZC 3V6FB 5GRWA 3K6NA 3M1BB 1UA6H 3VVVA 4B9FA 4IEFA 1ROWA 4PJEF 3SYAA 3VGFA 5CGMA 5FDWB 4FNLL 5DEGB 4FEMA 3VACA 1QW9A 4G5ZH 5CS7A 1ZR4A 1A6ZB 1X3DA 1J88A 3F7VA 2CUIA 4U6XB 1BQLL 3MTRA 4D94A 3PIQA 4PG9B 1U41A 4GG6B 5DRXA 3W3BA 4DP5X 1L9RA 4Q14A 1H8NA 4ONGL 3KS0H 3C6LC 2LV4A 1G84A 1F13A 3VA2C 1ZK5A 4PJFE 4RO0A 1OARH 3PABB 1OGPA 3BZ4A 1BXXA 3C5SB 2YGOA 3NACL 1F90L 1IBDA 4YDMA 1A3RH 5T33L 1QRNB 4QRUB 2V8LA 1WFJA 1YYCA 1JPEA 3IF1B 3CC2P 3QUZA 4A39A 1DQLL 2BSTB 3ULUC 1QW8A 3BAJA 3D71A 4S10A 3GGWA 2NZ2A 1U3JA 3TBWA 2YZ8A 2QTEA 4HSAC 6PAZA 2XDJA 1XFPA 2TRYA 3LY6A 3CFIC 4PJ9B 3S96B 2YMKA 2BSEA 4M7ZC 3F83A 3KE0A 2EZ0D 1MIML 4HJ0C 4U3XA 3PL6A 1LDPL 1EEZA 4MZ3A 3SOBL 4DP7X 5IHZB 4J3OG 1PLGH 1QSFE 2OV0A 3DX7B 3QNFA 5IKCB 5CCHC 2XWZA 4JPVH 1TVHB 4N2FA 4CW1A 4GO6B 3LZQA 5EC1B 1L0LJ 3TCLB 1U8OA 2PXYA 1OW8A 4IOIB 2A06G 1ACXA 4FA8A 5DMKB 3Q6GH 3GYRA 1HCZA 3X11A 3F6IA 4TM9A 5F7DA 1IFJA 3C6LD 5E6YA 4JO3H 1A6AA 4MJ2A 4N0RA 2NCEA 2NY3C 1I8IA 2VRKA 2E7CA 1KTDB 5I5RA 1YA5A 4I1PA 4A2DA 2N59A 4MAYC 1LP9A 3IMSA 1ADQA 1NTZG 3X1NA 4Z7OE 3D06A 3VWJA 4FTVD 1T83C 1PF3A 4QXUH 4L8CB 4ETYA 3HE6B 3JZYA 3TA3B 5DSCA 4NM8L 1RF0A 1IVTA 1OVVA 4RGNB 4KFMA 1WUNT 1OCCB 4WU5A 1FRGL 1R3LA 3JT0A 4PJDA 1I31A 1YG9A 2VW7A 3WEXA 4AM0A 1K8IB 3T0EE 3ULUD 3ZKQD 1FO0A 4TNWF 1ZT7A 3P7KA 4YDVB 1OAUH 2J88L 4HD5A 1GH7A 5GRJH 4XNUH 4Y28J 4YL4A 3UAEA 3O2WH 3OAYH 1IO4A 4HJ0D 3RL0B 5GGQH 1WBYB 1ORQA 1S9KE 2NYYC 2MSPA 1CD9B 2DB8A 2VGLM 1LP9F 3ES6B 4WENB 5CNHA 4XN7A 1P9MA 4I6MC 3H2WA 1QWUA 5JIHA 2BMKA 4ZFFB 2VR8A 3GMQA 5ECJE 1AKJB 3B9KC 1U33A 4TS6A 3DV6A 3WEMA 5HD8C 2RTTA 3CDFA 1KY6A 2Y2YA 1HILA 4N6QA 2FBOJ 3VMNA 1R3JA 4JVUA 2IWEA 2HTLD 3MXVL 3I85A 3IAGC 2QJKB 1J8SA 1D5MA 2NY3D 5B1BB 1J8HD 2K37A 3MLSL 3WN5C 3TNNA 2NNRA 1JY2N 5F6HI 3OMNB 3CCLP 2Z31C 3FB6B 3Q43A 2H0JA 4XB3A 4ZFOA 3J7HA 2Y7OA 3DI3B 1CGSL 3B9DA 3U7YL 4KJWD 4L8SA 3GRGA 4EXPX 4UTBA 4LCWD 4UTAL 4OF8A 3FOLB 4M7LH 1JTHA 4X6DF 3K7UA 1SQQG 5E79E 1E2VA 2HG5A 3H1JJ 1JMXA 2LQRA 1KLFB 2BNQD 2P5PA 3S3PA 3UJIH 2AJZA 2R7EB 4EUPH 1LWHA 4Y0GA 3ZE2B 1MY5A 2LHAA 4MMXC 1NBZA 2GPZA 3FO2A 2D31B 4RX4D 5E8NB 2J8UB 3T4AA 4P5KB 3L70E 4BUQA 3O45A 4IU3B 1G43A 2XCMC 2A2QT 5G4MA 1P0SE 1UWEL 1BYOA 3OKLB 3VM5A 3NQKA 3NRQA 3AE6C 3PS6A 1LTJC 2EDRA 1UOKA 2K0RA 3H1LD 4OLYH 3G08A 4FQHA 2YD5A 4W9ZA 3VH8G 4HQQL 3A5TA 2WMPA 4I0CC 4H44B 1MAJA 1PP9E 5I5JA 5GGVH 4HJSA 1P7QD 4PRIB 5LVEA 3D7PA 3T0BA 1KXVC 3HPLA 3DARA 3AEAC 1X6LA 3VE0A 4DAGH 2Z6FA 3S2CA 1DVYA 5KS9A 2HR3A 4RFOH 3W2DH 5DK0A 4PRDB 2LVEA 3B9KD 4M5ZL 1LO3H 2W81C 4MXQC 1LNUA 1YY9D 3CVDA 1E4HA 2W5PA 4X80H 1VL2A 3AG1B 2XKNA 3D39E 3QDME 1ZS8A 2FJFA 2CUAA 3FU6A 1FNSH 2D0FA 3V0VB 2VZTA 5JORA 1PEZA 3H7BB 5LCVA 3OR6B 2Z31D 1RLWA 3HJEA 4AG4L 2A74A 4OY9A 5EBWB 1KFNA 3V52H 4B3VA 2VJXA 1CT8B 3VFUA 4DEWA 5K59F 1Q2NA 1A3LL 2RBLA 1MUUA 2P1YA 2PRRA 2VNCA 7FABL 1P7BA 2GITB 1G7MB 2QVFB 4J3VA 5SX5H 2EO7A 4Q0XL 2FNBA 2V7HB 4OLEA 3SD2A 3IN2A 4EI2A 1U36A 2VABA 3ABMB 4GKSB 1HH0A 3KPRB 3PGDB 1BW8A 5C3LD 2CA3A 3ROLA 4AV0A 4HUVB 3CXHD 1FORL 1RZKC 1S5IL 2QR0A 3BN9D 4JFQA 4MFHA 5IVXF 3RUGB 3VXOB 1UKTA 2R1YB 1INQB 3D85B 4JZNB 3RDTB 2A38A 3LHAA 4WI4A 3VFVA 4YFEA 3TIDB 1NIEA 2WBXA 5AVRB 5C0AE 3UTTB 1EHLL 3JWOH 2PWHA 1FZOB 2KT6A 1SLUA 5B3JE 4BZ2H 3HC3H 2FIRT 4ABUA 3HN8A 2F8IA 2WLKA 2PTUA 3FQYA 3QEQE 4YHKH 4GP5B 4HAFA 1A6VH 3G04A 4WDIA 3KQGA 4KZ0A 2B9BA 3OM3B 1BGYG 1OZHA 1N4XH 2TSAA 2BIPA 3CE1A 2IFNA 1CFQB 1FC1A 5F9DC 1RZJC 2CBTA 2FWUA 5DJ6B 1RUKL 1URLA 1ZMYA 4U7KA 5CLWA 3S37H 1OM3H 3JWNE 1U8QB 4PD4E 1YTZI 1HQRA 4JDVB 5PCYA 3MNMA 1IGTA 4WKZB 3WSQH 1KJ3L 2LAAA 1JPTL 3RY6C 3LHPL 3KHUA 1EGJL 3C8KB 1DN0A 1SDDA 1GGTA 2DWSA 1I8MA 1Q9OA 1AO7E 1B4JH 4WNQB 1K5WA 4CN6A 2EADA 1KYDA 3PWNB 5HHOB 1ZT1B 3U1CA 2Z64C 2ZUTA 4OLXH 1PBYA 3CWGA 3PWPD 1GMJA 2VT0A 1N19A 2P5WE 3AEBC 6TAAA 1UUSA 1EDYA 2ED7A 1NGZB 2J59M 3L72G 2VE6A 4ODVH 4Y5VA 3B9EA 3IU3B 5CWSB 4RNRB 5HHVL 4DQOL 4Y16A 3V0FA 2OMTA 1PLCA 3EFDL 4ZOCA 5DT1L 2NUTB 1QTSA 5IHUL 1JTTA 4PJ5A 1TZHB 2I9TA 3WAKA 1SN0A 4XXDA 5DD0L 5T1KB 1LTSC 5HGGS 5TH2A 2YD8A 5KVDH 4YAQB 5DD3L 5AYTA 1AG0A 3BDXA 3SDDA 4ONFL 2QQNH 4ISVA 4X9BA 5DTFA 1YNKH 2UZPA 4OZFB 4W70A 2YARA 1DCEA 3Q01A 1SP4A 5F0PB 4ASVA 3FH7A 4PJIE 3HKZA 2OSLB 4OCNC 3UAFA 5LDUA 2EC9T 2AAAA 1DBML 3LH9A 4HFUL 5EBGA 2IAMA 5FO9B 4AYGA 1KB3A 5J1AB 1PNDA 1JPGA 3ML9A 2QE7H 1OTTC 1M1JB 1U92B 3UTSD 4BWTA 3OMAB 2W9DL 2GSGB 1TQWA 2VXQL 3C60B 3BHBA 1OAZL 3CBKB 2W92A 3L9EA 3IDMA 3KXFA 4JR9H 3IJ8A 5IBTH 3W0WA 3WL9B 3NA9L 1LE5B 2FATL 3CIAA 4F7EB 5C9JA 1OZUA 1EZSA 1JV2A 2EDYA 3RVUC 3UG4A 5AL0A 5DCCA 3LN5A 3UBXB 1YPZF 3HE4B 5FB8B 2V3EA 2VLLB 1C5DB 2JQZA 1AZNA 1IGFH 4LMQE 4WUKL 3U9PL 3FFDB 3S36L 2CLRB 1Z9MA 3HLAA 4JW3A 3S7GA 2DQUL 1MOEA 1IAKA 3GS4A 4KO6A 3G6DL 3SGKC 1AQ8A 3VXNB 1MRDH 1UM4H 5LGYA 2YMTA 4LU5H 4M7KL 5CJ0A 3HC0B 1WG3A 3ARED 4E9QA 4PVMA 5AOLA 2EUWA 4K7PL 4BCXA 3UAJC 2VUKA 4KTDL 4PLKC 4UOJA 2JJWA 5GIRA 4O5LH 4Z78B 1IM9D 3B5NC 4P2QE 1KB5A 1DBBL 3TS8A 3DV4A 12E8H 2ZKHH 1IGML 1XIWB 4HJGA 1JNJA 3NEXA 1D3CA 4KTEH 2CMRL 2XWTB 2VDOL 3DSFL 3H1KD 1XGRA 4K5PA 3DURB 4IRJB 4OVVA 2UZXB 4JKMA 5EZIL 1PFIA 5KLVD 4DKFH 1P6FA 5G55A 4JJOA 4UNVA 2QFRA 5C71A 3KYOB 1SQBD 2DH3A 1NEUA 4WO0A 3QUHA 4JFFD 3EBIA 4LAQH 5L8JB 4A6YB 5EPMA 4W9CC 1FVCB 5EWIL 4ZQTA 5F44A 3RVUD 1E9PA 1HINH 5TPWH 3T8XA 1U8KB 1OCWL 1XB3A 4UUJB 5D72L 3DROA 5IJVB 1XH2A 4MJ6A 3K5BA 4D6TG 2ZXDA 1UG9A 2XWRA 2PO6A 1G7QB 1YUHB 2P3YA 5KYUB 5K9KA 5F0MB 3BT2H 3V0HA 1U2YA 2NXYD 3KPPB 3I6KA 4FXTA 5LN8A 3O2VH 1T89A 1OGAA 2NQDA 3PDOA 4QHUB 2C7FA 2W07A 1QHQA 2N3JA 4PW4A 5DR5H 3UAJD 1KJ2A 4PLKD 2ZVNB 5GS0H 2FYVA 1SRDA 3B5ND 2YRZA 1OIPA 3CDCA 2HLAB 2XV3A 4YHLL 4JFOA 1A0QH 1QI5A 3NFPA 4UAOB 2GEEA 4AW7A 4UM9D 1XH3A 4MNQA 4XHQA 2NNAB 2JWAA 2Q1EA 2WQSA 1DDHA 2BP5M 5IBUG 2P49B 4Q52A 3LKNB 4YZWA 3VUAA 1OSPH 3S88L 5D1XC 1JIBA 2G2PA 1FL5A 5EBMB 1LO5A 5GRXG 4J39A 2HKAA 3L1OH 3VRJB 3FRPA 5GS2D 3KBEA 4MA3B 3MGTA 2DTSA 4B86A 1RKRA 3MRDA 1RZPA 3ZIYA 2ZFCA 1CICC 2BHUA 2MJWA 4MB4A 1J1PL 4N85A 1G0YR 4KU1A 2I8DA 4OB5L 3GRWL 2YAMA 4YXHH 3MV7A 3H3PH 2G75A 5HJ3B 2VQ1A 5C0DB 3TP4A 3OLIA 1YBKA 1V5JA 4LSDA 3AAZA 4RVBA 3IDIB 1L0NE 5AW7B 5APSA 1ZA3B 2VR7A 4C55A 4DVRH 5BVPH 4P5MA 4MRBA 4BFEA 3CXHK 4XCFL 5KSBE 5FECB 4CDGC 4QXTB 2XFGB 2CDGA 5J8OA 4EIBA 2IZ1A 2DOCA 4RMBA 4XMPH 5E1HB 4LK4A 3VMXA 2XRAL 4AK2A 2FX7L 2ZYDA 2B39A 4N4YB 1N0LA 4MCNA 4AYFB 4OJFL 5DJAB 5J11B 4M29A 5D96C 4HD9A 3IU4L 4Y7MA 1ANUA 1HCVA 3L9YA 4IRSB 3SKJH 1FYTB 3FT1A 2P8LA 3MRJB 3NH7H 2Y0EA 4U4IA 5EV7A 3OLGA 4YWGH 4YDIH 2Q7YB 1DQML 5HHXH 3R0MA 3QDJD 2A6KB 3A4DA 3ZN6A 4XXWA 4NQEB 2XNXA 3G6JE 5D1XD 3ZBMA 5KSVB 2GM4A 4X99A 5IOPA 3HHSA 1Q90A 4CGTA 3GSUA 4XZUA 1MHHB 3GZOA 1RPQA 3CZUB 4HB1A 3L7FA 3FGAD 3RK3E 3D12B 1HWGB 1KCVH 4ZAKB 1A9EA 4HOMA 4UDTB 5L4FA 1F11A 2C9QA 4JFEE 1WF5A 4GODA 3NTCH 2WXGA 3M6DA 1CICD 4JCWA 4XCEA 4ZO9A 3WLWD 1CLCA 4HIHB 1J5IA 4G8GE 5AAMA 3VG9C 4F80A 3SKOB 4RAUA 5EU6D 1JXGA 3L71D 5CJOH 2XIIA 4GAFB 1QO3B 1RE4C 4CU7A 3O8ZA 2E9IA 1UOVA 3T6WA 5JW4Q 5ACLA 1MW3A 3WHXB 2V9RA 1NCOA 1CDGA 4DP1X 1KIRB 3UZEC 1PX8A 1D9KC 3POHA 5CCGE 1JGDA 2FEEI 3TBCA 2WIIB 4CC4A 5JPMC 5J6HB 2J72A 5C0CB 4KO7A 1OB0A 4RDQG 1D7FA 1JRHL 3OC5A 4UV4L 1IBFA 3Q9PA 5MEPA 3APMA 1FNEA 3APNA 3BMWA 2CDEB 4P23A 4CC0A 4OM0H 4U1LA 4C4BA 1AIFB 4WGVB 3FT0A 4LASH 5H37A 4NN7B 5AKVA 1LD9A 3D6GA 5GTHE 4R4LA 2PR4H 3CFQA 3MBEB 3EFOA 5CJBA 4CVZA 5EU5B 2NSQA 2P1JA 1D6EB 3OPZH 1ULVA 4KK9D 2N4IA 1QMUA 1OAJA 1JDDA 2BWQA 3CPLB 2M5AA 4TN9A 5DJDA 5DRNA 3E8VA 2XKUA 1D5BB 4Q58C 5GSRA 1NIBA 1ZSDA 3OAUL 4WW2B 3MO1B 3O6FB 3NIFE 2AITA 1JN6B 4KUCF 5TF1H 2X1PA 4NCDA 2KZ1B 2APFA 3RL0D 5D1ZI 1CGWA 1C5CL 4HX1A 1HGVA 3DX1A 2WD0A 4ZZFA 4OFYD 4NKOB 1IAIH 4BM7A 2R1XA 5I1IL 3TEYA 5KLIB 1BFOA 2FT6A 4DOJA 2RMNA 1MSPA 2UWEB 4J1UB 2AMGA 5JHMA 1T7VA 4YLQT 1E9OB 1X7TA 1YAZA 2XN9B 4FMFA 2D3JA 1AKJD 3BGFC 4I9WE 1H3TA 3VXUD 4X98A 4ZOAA 5HJBA 5HYJE 3AU1B 3WTTA 4GAAA 1ZV9A 2A9CA 4EQ2A 3IGKA 2J6EA 4I1NB 5LHDA 3QWOA 5FUCE 3QIUA 2XV0A 5DJCA 3M9BA 3FT4A 3FXIC 3L3GB 1T6BX 2Y9ZA 5AAPA 1JEKA 1LT9B 4GFTB 1SS1A 1CD1B 1ILUA 4XNQB 1BGXH 1HH9A 1PLBA 1VGEH 5CEZD 1V05A 3AT0A 4ZRGA 4PREA 1ICTA 3MR9A 2W0LA 3SE3A 3OJDA 2MPAL 3VI3A 1MRFH 1SY6A 4N3UA 4TF4A 1R75A 4F9PA 4WF7A 2OCFD 1AI1L 4L3EB 3UROR 4F27A 5FW8A 1OCOB 4K35A 2WXRA 2N1TB 2V3DA 5ID1B 4DFHA 1PKQE 3ARDC 4PJHA 3TL5A 2A4CA 4KJPC 1PZ3A 1RUAL 2IBZY 1NM4A 2WSEJ 2AK4B 4ODWB 3BKJH 3J07A 4Z9KB 3TZVC 4IOIH 3ZLQC 3WJLC 1QBLH 3B8EB 3ZUCA 2O72A 4KX7A 4K3HA 4XCYA 3VD7A 1ZP0C 3O6QA 4DERA 1AHMA 4AEFA 4H44D 4YHZL 1D5IH 1YDPA 2NCMA 4PRID 5KLVK 4O00A 1IK9A 1IC0A 3VI3F 4GG8B 2WGXA 4OT1H 2EDTA 4KXDA 4P59H 5FO2A 3I6SA 3LZOA 5D6CB 1SFCB 4YEEA 3L3IA 1WQVT 3HUSC 4G7YH 4CBZA 5A2FA 2CLVB 2CQVA 1MI5B 3QC5X 3ZO0A 4W9EC 2ZWYA 1XR8A 2HVKB 4F37K 3FO1B 1YVLA 2CHZA 3OJVC 3IBOA 1N73C 3MREB 1K85A 4AYBA 4HS6A 1BOGB 4XCCH 3RJOA 3KZ8A 1CLYL 2EVIA 2ENJA 2HJLB 1C7SA 4NQCD 2VLRE 4E2OA 2RA1A 3ARDD 2G2NA 4NB7A 1J2JB 1SQQJ 2C3VB 3H25A 4G8AC 2ALAA 2IDBA 4KJPD 1VZGA 3APFA 4G43B 5JW4N 1FL6A 1S5LX 4OJAA 2F7IA 3TZVD 4OLVL 2QPEB 4K7PY 3L4WA 1DVFC 1R24A 3JV6B 4FLQA 4PJCB 5GGTL 3CWBG 2VRQA 5AVUB 1WTGT 2WZAA 3RDTD 4S1QL 3MGNA 3D0LA 1KCSL 2V5RA 3UTTD 2UUDH 3S9DB 4JRYD 43CAB 4Y2DA 1UOLA 4K9EH 1VLXA 1AACA 5DC9B 2X0WA 4NQSA 5CEZH 2CKNA 4LLWB 2ADJA 1AHWA 3MZGB 5FM8A 4YGVA 1HL8A 5MENE 5L4JA 2VDRL 1MKFA 2LR4A 2BSBA 3S36X 3AE9C 3MOBH 4FFVC 2L91A 4MRCA 5GRUL 3PQYD 4FQXA 4EI6B 1QYGH 1REIA 3F5WA 5FUZH 5MERB 4OGAC 4TUKH 1IAOA 2XWJA 1A6UL 3P0VH 4M43L 4AEHH 1MDTA 4UQCA 3F8UB 4RJTA 3FQNA 3NEEA 5I8CB 1NFKA 2WT7B 1R47A 5IROC 4RWYH 1RZIB 4OF5A 3UIYA 5DJZA 3V4PH 1VB9A 3FB5A 3B71A 4O9BA 2DQTL 2YD9A 2C9NY 3CCMP 2JEEA 4O9HL 4XH2A 2JELH 3BVNB 5EOTB 3V5DB 3U1AA 3DKHA 2B1AL 4XVOA 3COOA 1U91A 3H1HG 1RUPH 2BNRE 3ESOA 3IPFA 3TJHC 4BZ1H 5D1QC 1AY1H 1F4YH 2MCPH 1DJHA 5ESQB 2OYHB 4FNRA 5FYJE 5HHOD 5GZOC 5DU7A 4L4TA 1DVFD 3CC5B 1FOSE 2BW5A 2NY4B 5K9JH 2VLJD 3FU7A 4BWWA 1GZLA 5E8EB 5CJ8A 2Y3AA 2XPZA 3IBEA 1SBBA 2I9LB 4QRPB 1SQPD 3FF7A 1OGSA 1VGKA 2VIRB 4YZFF 4WFFD 1CI6A 3OAKA 1AS6A 1AV1A 1RLBA 3PLYA 1SJHA 2IDUA 4ZTOL 5AOKA 4BHUI 1VZIA 4MQ7B 4FFVD 4HCRH 1MWAH 4Y1AA 4IFDK 2KZWA 4K8RH 4NQDB 1PX3A 1G7PB 4OGAD 2V17H 3L4XA 1JZHA 2G9HA 5I76A 1AJ7L 1FZBA 3IAQA 3WGVB 4GI6A 3TBTA 1K9TA 5IROD 5H94A 2N9BA 2XWXA 4MCMA 2YK1L 1N6QH 2E9WA 3MJ7A 4TLUA 3AE8C 1BGYJ 2CU9A 3BLKA 3EJCA 2B1HL 4WW1A 5GGUA 4EBQL 4FQLH 4F33B 4XT1C 2FUQA 3KPSA 3HN5A 1MHPH 2FGWH 2VXSH 4UQAA 4O2FB 2NY0C 3ZE0F 1TU3F 1IFHH 1RHHB 1XGPA 1F00I 4G72B 3BAEL 3EYVA 5LXGL 5EF2A 1NEZG 1I8LA 4PVLA 4TQEH 5D1QD 2ESVD 1USDA 1CG9B 1MCNA 4MX7A 5I1DB 1OPGH 2ZX5A 1NAKL 3LVEA 1FIGL 5K1VA 2ITFA 5D5ME 5DUBB 2C0XA 2DDQL 3JWDL 1AD0B 3UO1L 4PJXA 1QSED 1SM3L 4YHYC 1IT9L 1B6DA 1H3PH 2J73A 3PP4L 3TGUE 1I7UB 4YXWH 2ADFH 2DLEA 3CBJB 1JDAA 2HH0H 4QI3A 3P3RA 2O6FA 3EBAA 1NC4B 5E1IA 2K9FB 1M1SA 2I60H 4YSTA 1Q4NX 3L4YA 3T3PE 1YMMB 1HYSD 4X0NA 4UV7H 1TOXA 3V6OC 3GKWL 5KAFH 3L72J 2VB5A 4POUB 2F8XC 3BWAA 3OTTA 1KIPA 5I1HL 3MACH 2HP4A 4RMVA 2ZPKL 4Y99B 1E5BA 2A45I 4IOFC 5KEZA 5IB3B 2OXGB 4ZXBB 2AF2A 1AXSB 4H25B 3EYFA 4PJXF 4PGJA 1Y0LA 3T4YB 3A4EA 4ZNCA 2JCCB 4K5LA 2V7NB 4M7ZB 1OL0A 1S7TA 2O5ZL 3L3JB 4GW5A 1U8IB 2ENPA 4PRNB 5AUMB 2WSKA 4JHVA 3GS7A 3F5HA 3VN0A 4BFIA 3WFHB 4J3WA 1D5ZB 2VM4A 1ETZA 3EZJB 3BISA 4M4RA 3BSGA 2YD7A 5GS1C 4Z1PA 1MRCH 1I7RB 4CNIA 4R6UA 3GI9L 2K4WA 3RVXC 4YTPC 1FZCB 2RCSL 1IAII 4AT6B 3QXDB 1J1OH 2NNCA 5J1TC 2WUBL 3EYOB 2OMNA 4KI5F 4ZUUB 4BH8B 3A24A 4LPTA 4AH2B 3WKQA 2VDML 3I9PA 1L0LK 1W2BO 1WE5A 2XXMB 3H42L 4MAYB 1M1XA 4B9PA 1ITCA 1E9QA 1WAPA 3WU2H 1UHVA 2A9ML 1VADB 2YA1A 2P43B 4NUGH 4WB4A 1R3KB 2YSTA 4ENZA 1CXFA 1OTSC 1YQVL 1ZLDA 1SJEA 1QX8A 2KDYA 2ALWA 4LSSL 2WB7A 2C4FU 3ZW3A 3BP6A 2CKBA 4JFHE 4BKLA 4ENEC 5CJ5A 1CE6B 1CYGA 1HAWA 1ZKAA 1QHPA 4GQQA 1WA2X 1S78D 2OJZH 3V7AE 1MUJA 3ZL4L 1ASOA 2GHWB 4TOYL 3GS0A 1YEKH 2F58L 3MBXH 2BOCA 1JGVL 2E4TA 1DUZB 1JVOA 2UY6B 2WCGA 5A2LH 3IDYB 1NBVH 4NJ9L 1AZCA 1YC8A 4OUOA 5L8LB 5FV1L 5ISZD 3IM1A 4JFXA 5A1AA 1YUKB 4U1NA 1JI2A 1A14L 2EUZA 1J5CA 1RL1A 3FB7A 3TBVB 3RVXD 3GSWB 5SWQB 3VSVA 4IBVA 1D5RA 3TFKC 1OXYA 1WVZA 2DV6A 3DJSA 3QG7H 3JTSB 3U0WL 5ANMA 3QUXC 3CZFA 2WKOA 3T9WA 4XGZA 1FZKA 5D7JB 3CU7A 4IS6B 3OBAA 4Q6KA 2HB0A 1NCAL 1RSFA 4M00A 3GF8A 1YSOA 2JLLA 2Q5BA 2XC8A 2YN5A 3LRMA 4NT6A 4UAHA 3U4BL 5L2JA 1ED3A 1L6XA 3GO1H 3I6LD 5J12C 1OAYH 4D6TJ 1OTSD 3ET9F 3EOAA 4RZCB 1HTYA 4L8DB 1DTUA 1IFRA 4ENED 4LCUA 5I18H 1PZBA 3GQFA 2ITDB 4HU2A 3CUPB 3KCPA 5CZXD 1EZVG 1I7ZA 3IDGB 4KZDH 2ZCZA 5K93A 1E2WA 2KZIA 2P5ED 4JM2B 4AGNA 1VPOL 3ELQA 2VUOA 1ZANL 4P9HL 3U4AA 4I2XE 3ZE2F 4A6YH 5DGRA 1CF8L 1NLBL 1GL4B 4L1DA 2E7LC 1GZHA 3GSOB 3I6GA 1FYTD 1BPLB 2KSEA 3BKCL 4KROC 2E74C 3L08A 4O2CB 4QLWA 2H5UA 4YLCA 5JHAA 4F7MB 3GLAA 4AIEA 5T3XE 3TBYB 3ETTA 1XBDA 2JXMB 3LKPA 2QFPA 4DZ8B 1MCIA 2JK5B 1AQMA 3C5ZC 3TFKD 1J05B 5GRVK 4ZW3A 1I75A 4ZAKD 1UB6B 4HUXA 4NNPL 1NU1G 1G9ML 1KPVA 4ONGH 3QUXD 4YDKH 4X6DE 4I18A 3TCXA 4WCYL 2DH2A 5EULV 2RMZA 5FW7A 2ZUVA 2C9AA 4L18A 4KJYA 3GKZA 2KZBA 4FS0A 3NACH 1SDYA 5TGBB 2F0CA 3H1IE 5DJYB 4G9DA 3EHBD 1QP1A 1BVKA 2HODA 5KJ7A 3SEPA 3ETBJ 2VDLH 4FZ8L 1J0ZA 4FJZA 2R69A 2XTJB 5JHDE 4ECNA 4GIFA 1W6LA 4URKA 2FR4A 3DRQB 1DQLH 1N64L 4K5OA 5CCKL 1ZTXL 1FGVH 3PWLB 4W9GC 3OJ2C 3V2QA 1DANT 4YFLF 3V0WL 4FKEA 3U2JA 2Z65C 5C0CD 3BUPA 3AQYA 1NTMD 3SSGA 3L75E 2APWA 1INDH 4QRSA 1SQPK 1FL3A 1NCTA 3QEUB 3BUQA 4OZGA 4XBGB 5EZJB 1MIMH 1BFVL 2QHRL 1O75A 4JN2B 5K9QI 5BZWA 1SXCA 3NFNB 2PKDA 4G6JL 3P3SA 4YGAB 3SOBH 3VTTA 5FV2A 5HSFA 5DJUB 2VZUA 3KH4A 4GRMA 1XF4A 4MD5B 4UDUA 5E2UL 3ULSA 3C08L 1A02J 2EYSB 3B56A 1A7PH 5TD4A 3RUGF 3NPZB 1JNLH 4CILA 3DMMB 3FAXA 3V0DA 3C5ZD 4KHTL 3EUDA 3UPCA 4NM4L 1T3JA 3MUGA 5CBEA 4ANUA 1GC1L 3ZZQA 1T3UA 2P8MA 3X3GL 4KO5A 3GT6A 2I7OA 2D7NA 5DDHA 5HYSA 2PN5A 5I6LA 2OPCA 1UT1A 4L4VD 1ILSA 1H6UA 4QY8B 1NCBL 3SDXB 3HN3A 1G9HA 1V8HA 4QJ5B 2YUWA 3WNLA 3OQRA 2C34A 2WN3A 4MBOA 3VQ1C 3RX7A 1FRGH 4GDOA 3VFTA 4F7CB 5MHSD 4MXVF 4UZSA 1ZXKA 1TYEB 5IVXE 3MJWA 4KXCA 2NLJB 3BIBX 2I07A 5E6SB 4OD1L 4J5VA 3QZBA 4L9DA 5IBUB 3WS6A 1WCQA 2J88H 1NKNA 3MBWA 3UC0H 3WNJA 2DLIA 3DVGB 4HH8A 4HJTA 4K15A 1KLUA 2OYIC 3QUKA 1COBA 3GSQB 1KJMB 1CYWA 2EXWC 1HKFA 5LBSH 5FIEA 3V8CA 1KJVB 1NYHA 3GD1C 3UZQA 4PPTA 1HE7A 1UD3A 3QIWD 1AP2A 5HY9A 1GOHA 3F7LA 3TO2B 4L3ED 3PGFL 2N1TD 4G9FE 4LSTH 1N7SB 5HYIA 3FPYA 5GTIH 2H1LM 2R29A 2J58A 3EFFB 3T0VA 5HHMD 4HG4J 2C4XA 5IMOB 2GJ6B 4UOW1 1X5YA 2UVFA 4QAWA 4G7VH 2O3JA 3DIDA 4LBEB 4B5ZA 1ZHKB 4PI0A 3HZYB 4WHDA 2QJYB 2FQEA 2HMIC 1LTGC 4UI2A 2H8PB 4N22A 4JM0A 1CGSH 2VMFA 3GTNA 5ADPH 4GUOA 1AXIB 4R96B 1J48A 3LDBB 1BBDL 3QJHB 4NRXA 2HPCB 2DWDB 5C0RL 1H9VA 4PVNA 5D55A 3RB7A 1HSAB 3RL2B 5H8DA 5EUOF 1RULL 4JJ5B 5D8JH 3W82A 3X1FA 3KVPA 5F7BA 1MDAA 2HKHH 3A23A 1SFCD 3KYMB 4TSBL 1T22B 1JCDA 3P0YL 5IMLB 1UD4A 2Q6WA 2QGDA 4F8OA 1BXUA 1U8JB 1I3GH 3FQXB 1OF2A 5K1JA 3A22A 3EGSB 4EDXB 2CJTA 1EX0A 1VACB 3SGDH 2ICES 2AZUA 3CX5D 1T7YA 3OW2O 2EXWD 4ORGA 3O2DA 4V1DE 3IDNA 3TJPA 5I16A 5F0LB 4X6FB 1EDKA 2GBUA 2VERN 1SDAB 4Z7QB 2VN6A 5LGJA 2L5GB 3AEEC 2CSPA 3DDFA 4ZUWB 3SQOH 3H85A 1FGNL 1FZMA 1JZDC 4XP4L 1BD2D 4X4ZA 1R5IA 5IQ9A 2FQGA 2FGZA 5DURD 2HJFB 2GJRA 4M5YL 5DQ9B 4FQJH 4RBPH 5DQJA 2OXHB 4F57H 2CPUA 3HTLX 4HISA 1CJYA 3P2DA 4WEBH 1GTFA 4H13C 1YJDL 2A06D 3RTQC 4UTCA 3T5WA 2HMID 4AG4H 1F6FB 2IANE 1KEML 1DLFL 1T6AA 4WBAA 2JJSA 5I17A 4FXKA 1SXNA 2MKVA 3EO1B 2NY6C 1YJWP 2IGTA 3PF2A 5L9DL 1H8SA 4N2BA 1FS0E 3CCVP 1QA9B 1CMOA 3O3EB 1ZHBB 2AJYH 3B8SA 2IBZD 4Q0XH 5JR1H 2FYNB 2Q20A 3STLB 3R4YA 3N1PC 4ZPTB 2O5YH 2X0VA 3EWKA 3MFGB 3CDZB 4B0MM 1RUQL 3BP4A 1LK2B 1YEIH 2X2UA 15C8L 3VOPA 4WY7L 1TJIL 5KN5A 2HVBA 3AUVA 1F0LA 4FAAB 3UBXI 4NPKA 3VXRE 4BSJA 3KLDA 2F53A 4CJ0A 2VRSA 1PG7L 2E7HA 2OMBA 4XOBA 1QEWB 3Q2CA 5D71L 4PR5B 2ZOLA 2R27A 2FEDD 1FN4B 1I1AC 4Y19A 3O4LA 3CFNA 3QARA 5C0EA 1GL2C 1V7NH 2DW5A 2YJQA 1SQXG 1QZ1A 4GW1B 4N8VG 1SQVD 4N0UE 3HG1E 3QDGD 4JN1L 1OB1B 4KXBA 2VLME 4ZT1A 2X6BA 4H13D 4DFIA 4DP9X 3AEDC 1KILB 4N2AA 5C2BH 4G80A 4HGMA 1B0RA 1DVSA 2YD3A 4AQ1A 1ES0A 1TEGA 3C12A 1Q0YH 4APQC 2NY6D 4DGIL 1JF1B 5AD0B 2YUXA 3MP7B 1ETB1 2HX7A 4RSYA 2VR3A 5HPMA 2IALB 1ZA6A 2JTDA 3CWBJ 3BQUC 3CD4A 3QJQB 2IIJA 1H89A 2C3HA 3QORB 3TYFB 2WITA 1QX1A 3ZQWA 3LHPH 2JJTA 1D5XB 2NY2C 2YMXL 3GMOA 1AC0A 1WS8A 3L54A 5K69A 1B9KA 3IJSA 3O41A 4Z8FH 2GY7B 2YKOA 5JLZA 2CO3A 4WHTB 1FP5A 1M9SA 4J3OH 2R23A 3E6HA 4NQDD 5T1LD 3RI5F 4HC1H 3BDBA 1IC7H 2FYUE 5ITFB 4RH4A 2W0FB 3MXWL 3RAJH 4U3HA 2KDGA 2ZX8A 3HKFA 2Y7SA 2AXTH 4ZFZA 4ELMB 1RFDL 4X7TA 1F1DA 1E42A 4XNDA 2BVEA 1KBKA 4O4YL 4HXBH 1A22B 1NGXB 1AXTL 3BFQG 4JHAH 2HFFB 4P57B 4HLJA 1XAKA 2ZXGA 2IOIA 4PJAA 4DQOH 1I1AD 1VFUA 5CKAA 5IW1B 3HBPA 2D7OA 2UZYA 1EMTL 3WNKA 1ZLVK 3T1FB 1EJOH 1KTKE 2HJKB 3M7OA 3RX5A 3GB7A 5DD3H 3PHQB 1PZQA 1DANU 3MRHB 3H1HJ 2R0WH 1ZDSA 1G9EA 2WSEH 2OMXA 4ZW8A 1RZGA 2HWZL 3BDYH 1NAML 1Z5LA 4W7ZA 3GF7A 5E4IA 5J4MA 2IF7A 3A4AA 1NC4D 3BQUD 5CILL 2OMUA 4NSKA 2UXVA 3AACA 1UH3A 1QQDB 5I19H 1WZLA 1SVZA 4S1SL 2NY2D 1YMMD 3ZHDA 1S5LH 3C6SA 4KK6C 4F8NA 1NC2B 1DVZA 4H0LC 1N59A 2AP2A 4XPHH 1OAZH 1F02I 3WDHA 4NQVB 1QNZL 3HJ0A 4QTIL 2FCBA 2Z34A 4WWKA 4EDWL 2L0DA 4RFEB 1Z9SA 4PS4L 1Z56A 3LCYA 5D7SL 2YMOA 1K8DB 4AQAA 3CNKA 1PAMA 1M1KQ 4BRYB 1PD0A 1WISA 3B2VL 3O3DA 4PY7A 5C0BB 5KKZC 5I1EH 2KSJA 3QO0B 1SOXA 2A6DA 5JPNA 1RXLA 5KG9A 1CK0L 1YMHA 3FU5A 3RWIB 3S36H 1FH5L 3D18B 2DQUH 3S4SA 3E6FA 3SBWA 1GK4A 3EOBB 3VXMB 3NEOA 2A9DA 3OHMB 2EE2A 2XDHA 3OHXC 4GMSL 5IQMA 3SDYL 3GUFA 1U8LA 4M7KH 3MJ9A 4XBEH 3WKML 2AJXL 3QPXH 1YHPA 2OL3A 1TLKA 4MJ5B 1T2QL 3P4NB 4YL9A 7CGTA 2WTRA 1IK7A 2G3AA 1G7JB 3CXFA 2YWYA 4MMZC 1F86A 5KYWA 5D2NC 3L2NA 5BOPA 3CK0H 5LN4A 4I77L 4XB7A 2ARWA 5C8JA 2QSVA 3V6ZA 1LEKB 1NUNB 4L29B 2Q10A 4ZQKB 4APXB 2JB5H 3WO3B 1GK6A 3OGOE 2W6BA 5F7EL 3BIKB 1DD4A 3QCTH 2GFBA 3MROA 3IETA 4O51B 3NJNA 2H41A 4UIKL 1L4AA 4NZRL 4R7DB 3RNKA 4EI0A 4NPYB 2MRYA 1G0XA 2MOQA 3UJJL 4C4UA 4I1LA 4X4ME 4HIIA 1JE6A 3VYIA 1CFBA 3ARBC 4LQFH 3L74D 2FH8A 4MJIE 4Y5YB 3WE6A 5KYNA 1HZLA 2IPPA 3UZVA 1U8CB 4OI7A 3WIHH 3VD9A 2AEIT 1FG2A 2YPLB 3QI9A 1KV3A 4MZIA 3EJQA 5DRZB 5J6GB 4Z7IA 4OLZH 2W94A 1OMIA 1GAFL 4QRQB 4LLMB 1UFGA 2VL5B 5EF1A 4GJTB 2FFDC 1NBQA 5IFJB 2H6PA 4K3EL 4D8OA 5KVDE 2ZXXA 4NS0A 3GSRA 2W0KA 1ZE3C 2UWEF 4YBLB 2XXGA 3N6YA 1PCSA 3B7RL 4JFDB 3KL3A 4OCXH 3ZRCC 4Y4KC 4P2OB 2EDFA 2XWBA 3C9NB 1CIUA 4YQXH 3WOVA 1EJFA 5T1DL 5KJRH 2CBPA 3D69A 5SWZE 3SKMA 3V0AC 2W6AA 35C8L 2ZG3A 1EO5A 1H8OA 4I3GA 4X6BB 5KOVC 3LB6C 1G7LA 1OAKL 2W59A 4G3YH 2WNGA 5ICUA 3GBNH 3SGDI 2LTQC 5IR1A 3W9DA 1CTOA 2ZCKH 1C8QA 4EN3C 3V5BA 4WZ9A 2A0LD 4Y4FB 3KMDA 4XNYL 1KNOA 5KYXB 5EO0A 3K4AA 4N28A 5CP3A 4XPGL 1PZCA 4LB8A 5DMIL 4Z7NB 1AJYA 1S8DA 5DD1L 3IDJA 2OFQA 5KSAB 2FBWC 1J1PH 1PZAA 5TJWK 4OB5H 4JRXB 1NTZK 2CIIB 1NUFA 4KRPC 4BQBA 4GKNA 3MODH 4P2AA 3AU0A 3GIZH 3EH4B 1KCRL 4FQPA 2ZOTA 4F8TA 4G1EA 2L8AA 1YY8A 1NIFA 4L9LA 5F9WC 1I8UA 1OQXA 2V4LA 4H5SB 3FCSA 4KVNL 1MCLA 4WU7A 5IVZA 2N0MA 2DWXA 1CD8A 2IH9A 3EJPA 4NGHH 5APQA 4PYGA 2XRAH 2CWRA 4PIRF 2FX7H 4KKPA 5C1MB 1KYOD 5AVXB 3K5SA 4A04A 3IU4H 3IXTA 4PB9L 3VFMA 3OJAB 4U33A 4N1HB 3P11H 1KIQB 2FWSA 1I4FB 3LXAA 4UWQB 5DZLA 2C3XA 3VXSE 4AQZA 4F7TB 1JUFA 4P46A 1EO7A 3PGCA 1BIIA 1SQVK 3KPQA 3ZHFA 4X7FC 5LXVA 2XG4B 2ZAHA 3MLRL 2W60A 4ZUVA 2C1OA 1A4JB 4MCYA 1M57B 5TDPB 2BVQB 4ZSOA 4PGDB 3E38A 4LLDA 1OAXL 1UENA 5IUSA 4FG4A 3Q5TA 2NY7L 1PS3A 4KRPD 1BF5A 5GISL 1NDGB 2IQ9H 5GJTH 2EINB 5JO5B 4GAJH 4Y4HA 2JI1A 2DEWX 1T4KA 3HCVB 1GZQB 1I7TB 1L9SA 3FDWA 1GZPA 2ED8A 4BKTC 4OZ4A 2D7TL 2N9YB 3BVVA 3IXAA 3VI4A 4PJCF 1OWWA 1JJUA 4U3FG 1NFIA 1TVBA 4J6IA 1QBBA 4G8IB 2Z8VC 1UXLA 4NUJB 4UV4H 3RVVD 4F8LA 5EO9B 2AJUL 5BRZE 5I6OA 2ZCLL 4PLOB 5F88B 1AE6H 3CZGA 2FJSA 3ARVA 1NU1J 2BOBA 2FYYA 2JF1A 4U0QB 3L3HB 4DSYA 1F4WL 2ZXCA 4NDMA 4U1GC 3GBMH 1KXTA 4YJZL 2F54D 4MVBC 4XFJA 4JPKL 3VFGH 4NO5B 3QUZC 3VRIB 3GXPA 3RHWF 1B90A 3LSOA 3K3QA 2YSSB 4UYPA 5CCJA 5L2KD 4KHXL 1NDMB 2KHAA 3EJUA 3M0AA 2WLIA 4EIGB 4BK8A 3OAUH 3MRGA 4CBPA 5I0XA 1N5AB 2X4NB 4PRHE 1OP3H 4P8QA 4XBPA 5IJCC 4XNAA 4R7XA 3VXTA 1NTKD 1GJWA 2MQGA 3L6FA 3PL6C 4JQXC 4Q6IC 1AS8A 1H8LA 3KPLA 1IUZA 1JDCA 2O6EA 2Q76A 3NJXA 5EU3B 2WBWB 2WYIA 4HWNA 4ZJ9A 2KZKA 3ZRFC 4HZ1A 3L35A 5I15H 1YNLL 2OI9B 4XPBL 2ZIDA 3ITKA 2PXYC 2EYRB 1LEGB 1JK8A 3A47A 3QJOA 4DTGH 4DCQB 1V27A 1SHWA 2GJ6D 2PFXA 3L3OC 1DEEB 2QADB 4EUPA 3SQRA 3LXBA 4WFGE 3MRFA 3OKMB 4BFJA 2VAAA 2NR6D 2QELA 3WHE0 3TJEH 3HMXH 1KC5H 3ABZA 1A6WH 1F5WA 2R3CA 1IU1A 1UB5B 2EDOA 3AWEA 3MV8E 3MNZB 3BH8B 1U95A 1RZKH 1ID2A 2WVVB 1RF0C 1FF5A 2V4HA 3MRKB 4MVBD 1R5WA 1MNUH 4D0BA 3HD7B 1E5UI 2PPCA 3E80A 4H4NA 1K8AQ 3CMAP 2LR2A 2CM6A 1KFAL 3BCCG 3D2UB 2A83A 3C6LA 4HETA 4AGQA 1QKZL 5AAWC 4LDOB 1CLOL 4WI2A 1UQSB 2X1XR 4NKMB 4Y9CA 5CAYB 1MCJA 3HE5B 4BYHA 2ARJB 1GS8A 1KDJA 1BQUA 5E99H 5DHXB 1E4XL 4FTVA 4KQ4L 1HKLH 2DRUA 4YZFE 4OGYL 1N5YL 3FCTB 1JHTB 2AKRB 1VFMA 1XD1A 5FA4A 3OXSA 4DWHA 4JY6A 3MRRB 4L8BA 1QWHA 5BVZA 3LS4H 4WJG3 1P9MC 2C9UA 5ESVA 1FZJA 1N7MH 1RZJH 5ABZA 4PJGB 4XTRC 1JWUA 3K72B 4DO5A 5A16A 4M6NL 3MRBA 4R90L 2QVTA 4AYCA 4XNXH 4YHPA 2XZCH 2WXLA 1JS4A 4XCNA 4ZUTB 4C56B 1A3QA 1N2RB 1OAQH 2ARJQ 1B4TA 1T20B 2ZUYA 5EOQH 5FEBA 4A1RA 2WWKT 4LPYA 2WANA 5E0QA 4M6OL 4FQCH 3RIAK 4IYKA 3QS3A 1F4HA 1HXYA 1MW0A 2ZAIA 3ZE0E 2GBAA 1THAA 1XSOA 2R2EA 4PV9A 3HAEG 1UM6L 4Z3FA 2FXOA 1TTCA 3HC4H 1BQHB 2W65A 4OCLC 3D3VB 3RFZB 5E2TH 4D8PA 2AEJA 5CJXC 2G30A 1EPFA 1T1WA 3L95A 3OZKA 3U25A 2C1PB 3N7NA 2ICEB 1F8TH 4AC2A 1Z6JT 1ZIBA 5C0AB 5ICXB 1J8HA 1PW3A 5I8EA 2JCCF 4IIZA 3VXPB 2V8MA 2M26A 5M94B 3LKSA 2TAAA 5GS1B 3UOAB 1JNNL 1OIOA 4BD4A 2VR4A 1T83A 2GSIB 4LCWA 4BZ2A 3QRFM 2OTUB 3F3HA 3NN8B 1CFVH 1CR9L 2BNQA 5HHNA 1T4WA 1USQA 4YXKL 5KWYC 2CHWA 4M1DL 3FO9A 5G4NA 1NTMJ 1A1MA 5IIEA 2Y5QA 1P5UC 2BZDA 2NX5D 5A2KH 4BDVA 2FH6A 5E8DH 3DHJA 4P3CL 5ETUB 1NCWH 2AI0H 4RX4A 3ULVC 4Q9QL 5EUKA 43C9A 3GUTA 2XZQH 1KG0A 3IFMA 5IWLC 1QLFA 3E9TA 1KGCD 4KV5F 3QJFA 2WTOA 3FTYA 3USSA 4R5XA 1QRNE 5B21A 4FQQB 3Q8AA 2PYEB 1L0QA 2D0GA 1AZZC 4E9YA 2X28A 3BVHA 3PJSB 4HOWA 1BAFL 1E6OH 3GHGB 4M43H 3EYUL 3KGUA 4W4OC 1P7QA 5DUML 5E5LA 1JK9A 4HPYH 3ZR5A 1OP4A 3Q13A 3QNYA 4P2YA 4TPRL 1Q0XH 3PWJA 3B9KA 5EZLA 4Q9CA 3D25A 2J5WA 4O9HH 4J28A 3UP1A 4OBRA 4F24A 1FAIH 1OP3K 3MCKB 3U9UA 4FFYL 3MRQB 5I2IA 8FABA 3WN5A 4KI5E 2Z31A 3MKGA 1JZIA 1RIUH 2WSSH 2W0PA 2YIUB 2DL9A 2XUWA 4J27A 3RIAF 1K5NB 3U1QA 5K5YA 1RE3C 1RF1C 3ME0B 3BZ5A 4UZUA 5AZEH 4P5SA 1FV1B 3TOPA 4OQTH 1MVUA 2BVOA 2FLRT 1U2HA 1SOQA 2JLPA 3ALXA 4YK4B 1MHCB 4GSDL 3M06A 1J9SA 4U1HB 2YPVH 3C9IA 4N3YB 3GIVA 5EMYA 1OT1A 5DJ8A 4MMXA 5J89A 4HA1A 5K9OA 5I0VA 1SNRA 3HBZA 1G2CB 1CL7H 4P2RE 1D7BA 4KAQH 4KO9A 4M9PA 1AFOA 1QLEL 5JW3H 4PJIB 5ID0B 1T80A 4ZTOH 4MMYB 1ZXGA 3REWB 4NXKA 4WEUD 1LTJA 1YN7A 2YEZA 4RGNE 4N2DA 2HA1A 3RWGA 2CDFA 1HBWA 3JT2A 4HAKA 2HRPH 3UABA 2ZSVA 4U0RB 1SQXJ 2GJZA 2A3TA 5E00B 4FQ2H 1RZ8B 2YNYA 2AFNA 3FUNA 2R39A 3CVCA 3IKCA 3VG0L 4HSCX 3WNOA 4I5BB 3DGCR 2CA4A 1T0PB 2BRQA 4YNYA 5D7LB 1YRKA 2OAAA 5FYJL 4KZEL 3LH2L 5BCAA 3BAEH 4KROB 3HFMH 2V2XA 2ZUWA 4C58B 1JL8A 5LXGH 4ZPVB 4A2FA 3IMTA 3V95A 3ZSSA 3PPEA 1BBJB 5ERWB 3ARPA 2MJZA 1GTNA 3U2SB 3JWDH 3RVTD 1T66D 3U1SL 4YHML 1J8RA 1R3IL 2ENYA 4JKKA 5AKSA 3PP4H 4F5CE 4G5AA 4JBSA 2O1AA 1TEYA 2P24B 5CIPH 2GI0A 4Y2NA 2DM3A 4LKCA 4HS8L 2IGFL 1SPDA 4Y5VC 4FXGC 5C0BD 2VISA 3CX5J 1GKEA 4HDIA 4Y16C 5CO1A 2ZSWB 4GUQA 3L48A 1JRHI 4EEEA 2XNDH 3GKWH 3CMGA 1HVXA 3UPRB 1L0LE 1JY3O 3CPWO 2VMCA 1BZ7A 1FIEA 2GIMA 3PWPA 1OVUA 3D34A 3V4QA 4ZFGL 3P9LB 3C8HA 4G8FB 5GGSY 1OW0A 3ZE2E 1BVLB 1XCQB 1NTKK 5BS0D 5IHHA 4UU9B 1UJ3B 3KD4A 4HGWA 4C7RA 1HHGB 5C0JB 3QQXA 4ZYKB 5CUSH 1JXFA 1RH5B 4RAVA 3VNYA 4AOFA 4M5TA 4F2FA 4RETB 4OJCA 5APXA 2GABA 1CTMA 1WCBA 2KK7A 3S34L 1I1YA 2E59A 2PPEA 2YIHA 1VFAA 4R4BB 1FH2A 2ZYGA 2WBJB 3MRIA 3QH3A 4POZC 4QHLA 3TT1H 1ZGLB 3T77A 3D9AH 2BIOA 1C9SA 2OZ4H 2Z92B 4H2CA 3FQWB 3WLBB 5HYQA 2GBTA 3H54A 3HHRB 4BUHA 4A55A 2RCSH 2X4UA 4PWJA 5DHVA 1N12A 1CE1L 1SUHA 3P9MA 4LEBA 4QO1B 1L9PA 4KVPA 3EADA 4UT9A 5DK2A 3VQLA 4AGOA 1K4DA 3O6LL 1EVTC 3QPQD 4NZUH 5IFHL 2AVFA 5G5DA 1EJ6A 5EIIA 3CCHA 3OKOB 3W57A 2X5PA 3IVKA 2K9JB 5CGBA 2OR7A 3EJJX 1NTDA 4FMVA 3UTSA 3Q5RA 4OV5B 1M7IB 5C07E 3CC7P 4PG2A 2A9MH 1MPAL 4XXCA 1NDTA 4OJDH 1KY7A 2IWFA 3SDDB 1GPOL 4P05A 2WPRA 1GC1C 4TUUA 2GTZB 3MRNA 4JO5A 1CGYA 3VVWA 5KYYB 4R4FL 3SDXF 2SEBB 2L4OA 5H4ZA 1N70A 2VJ0A 4MA1B 5IZ7A 3KPRE 4R83A 3WDIA 4UILH 1QVGO 5TQ0L 3VFSB 2OYIB 2F58H 4UCFA 3IMRA 1E8XA 1A6TB 4D9RD 3RUGE 1PZUB 5FOBA 4F2MB 3SDAB 1RP9A 1YQ2A 3QXVA 4NJ9H 4YXLL 1TMCB 2X4OB 4JZOA 2FBJH 1XTLA 4UNTA 5GGSB 3H1JE 4U1SB 3AREA 2W8ZA 3CN3A 2CR3A 3K74B 4C4KT 3MLVH 2FIKA 4HMCA 3QAZB 1X4XA 3HZ3A 3PTZA 2XV5A 4X8JA 2ICWJ 3BCDA 3NCYS 4OLWL 4Y4FD 3U2IA 1IM9A 3A7OA 2BSSA 2IX7C 3WFCH 2UXTA 2V5TA 3GSXB 2ZUQB 1AR1C 4Y88A 3BZEA 4JQIL 2XIBA 3ETBF 4NZJA 3HUJF 2IH3B 1TU2A 3PAYA 5LWYL 1FLTX 1TTRA 4FFZA 3ARTA 3GSVB 2BXYA 3FNKA 3CN1A 3QCVH 4MXVE 2OYOA 4BEIA 1I8KB 1U6AH 2ZOKB 2E75C 3FF8A 4NO2A 2PO6C 4JUTA 3Q6FA 4QTHA 5I75B 4BHUA 1X7QA 1TG8A 1MCSA 7PAZA 3RKDC 4JFFA 2JKVA 5KAFE 1KACB 1A2YA 5J7CC 1LEIA 1YEFH 3UTPE 1QFUL 2A1WL 3VYPA 1IMHC 3RQ3A 3D6ZA 2GBVA 4AWJC 3US9A 2XWDA 2NW3B 4OZHF 5CEYB 3TNMB 1K04A 4D3CH 5JQ6L 1A64A 1A02F 4IBSA 3M88A 4OGXH 4PP2A 4ATWA 1IBHA 1WHPA 3T0EC 4XAKE 1D6VH 1VPOH 3QEGH 1P1ZB 1ZANH 4GSUA 4NENB 4P9HH 3RL1B 4KKBC 3H9SB 2QKIC 1EEYB 1Q81Q 1TO4A 4HHAA 4ZD3H 2VDQL 3VD2A 3U4KA 2D4DA 1OD7A 1AFVL 1TENA 4Z7WB 3RLSA 3DBXA 5SX4H 3EOTH 1OGTB 4FFTA 2DJ4A 2IPUK 3UAJA 1BM3H 1QSFD 1XSKA 4F8QA 4YLBA 3B5NA 1NCCH 1ONQB 4U3SB 3P2TA 2DJSA 3V0IA 4UT6H 3KYNA 2A6IA 5B39A 4Z3HA 4WCYH 5FYLL 4B7IA 3RTQB 4S0SD 4UM9A 4R3SB 1XTCC 1KPUB 4TLSA 1B3IA 4WI0B 5EUOE 5FA3A 1DQKA 3QXTA 2ORBH 1HNGA 4N8UA 4ODUB 3RL0g 4R2GC 1PQZB 3ECBB 3WU2E 4FZ8H 2GW5A 3MLZH 3RKDD 5EOCL 3C2AL 4FI8A 4PVBA 1Y47A 2D9QB 4GFXA 1TQTA 3BD5A 1CO1A 2EE0A 3V4UH 1YJDC 4X5XA 5ITBL 1A1OB 2AXGB 3RWCA 3CCQP 4YDLB 2ODHA 5E9NA 1DBKL 1CFTA 4PB0H 5D4JA 4Z7UA 4G70B 4WUUB 4P4KB 4S2SB 3T0ED 3BWSA 2DQMA 2Z35A 1U58A 1XGUB 1ZT4B 3BPCB 4KKBD 5IHWA 4D0DB 5T3XL 2JIXB 2KS1B 2R0LH 1QVOA 3U46A 1X5JA 3H0TA 1WEJH 1IFMA 1A6ZA 1HU8A 3C08H 2FD6L 4AEEA 3V5KA 3V4VA 4HT1H 5LNGA 1OO2A 4PRAB 2B3IA 4ALAL 1S9KD 1NKRA 3ASNB 4FYQA 4XXWC 4GG6A 2YXRB 4DJGA 1H9DA 1LK3H 3BEVB 1NSNL 3AB0B 4L0PB 4KHTH 3RTLA 4R0LB 5HGDB 3II1A 3AE4C 4AGPA 5IM7B 2RJMA 3PABA 4AVHA 4HULB 3C5SA 3GXTA 2H0EA 4R26L 3TFBA 3DGGA 1RK0A 5JZ7C 4EDFA 3DWTA 5AAMC 1CL7I 4AY0A 1N18A 3T09A 1MV8A 4NQXA 4KFZC 2NPLX 1U8PB 2X9XA 1NCBH 3QDJA 3VDBA 2AQTA 5D1XA 1FVDB 3IF1A 1VF5B 2X0UA 3QWNA 2H88C 3HI6H 3QH9A 2A99A 3GXIA 1UA3A 2DPKA 2BSTA 4ELKB 3EF7A 3FN9A 5FK9B 4PJBA 1GIGH 1RJLB 4UTBL 1UJTA 2V7QJ 3CX2A 1CICA 1UVQA 3RZCC 3TK1A 4MYPA 1OXZA 3ZKXC 5JDJA 4CC4C 1MXGA 1TQBC 2EXYC 3FTSA 5HHQA 2FHBA 2QADD 3QCUH 5EU6A 1AD9B 1RJYB 5HDBB 2QSTA 3CVHA 5F9JB 5ICYA 4AV5A 32C2B 3KM1A 1RVFL 4FMKA 5E1GA 1X7SA 4QRTB 4U3FJ 3L70D 3W11C 4BH7B 2NYZA 5EC1A 3HZKB 3TCLA 4HJJL 5F3HA 2YHGA 1IEBA 4NO3B 4XNMA 3QZWB 5BJTA 3HD7D 2YBRB 4OJYA 4PM1A 3D2UD 4Y5XB 1EJ8A 3P73B 3GMMB 1BZ9A 1PP9D 3PUUA 1RUML 1PPJG 3C5XA 5H2FH 1KTDA 3U83A 4ELMF 2C26A 1M4KA 2VMJA 2RB8A 3ZT7A 2M2DA 1M2OA 2WJ5A 2EIKB 4JO1L 5JZ7D 4NNYA 2E9JA 3CD6P 4RGOH 2ZF8A 1TZGL 3S5LB 4L8CA 3ARFB 4PQXA 4BGLA 3MLYH 3D39D 1NAYA 3MVSA 3QDMD 4NRYB 4M8VA 3RWDB 1UWYA 3DOSA 4Z0XB 3SE9L 4MA8L 1JHKH 1BBDH 2F7PA 4OM1H 5D2LA 4NZDA 1X9LA 3H32B 2WAQA 3MOAL 3TEUA 1FDIA 2OR9L 3L1FA 4TNVK 4XN4A 1KT2A 1NGWA 1H3VA 4N1CA 4GKZB 2X3AA 3Q3GA 4NQQA 3JWNC 4IQHA 4X6CB 4LLQB 3RZCD 5KVFH 2E56A 1J5HA 2BCMA 4BCYA 1FFPB 4OFDA 3QIUC 1WBYA 4U6VH 2QJPB 5IB1A 4OFYA 4QMEA 1LVEA 1UA6L 3GJFB 2DIBA 1TCRA 4OSUH 4XVTH 3W11D 2H3NA 2HFGL 3V9EA 3ESUF 4ZMWA 1IGYB 1URIA 5BV7C 5IGXH 4G5ZL 1OK8A 4ZFFA 4WV1C 3SE3C 3UZEA 1AKJA 3VXUA 5A2AA 4F9PC 4RQQA 1KYOJ 5JOFB 5IF0B 3AS2A 1FGNH 1YNTA 1WAAF 5JPMA 5IG7B 1CXKA 2COQA 4CA4A 4PRPB 1SXSA 2DQGH 4YX2H 4LOEA 2BC4B 3MRCB 5C0AD 4YPGA 1CGVA 3FRPG 1OARL 4M61B 4HIEB 2K88A 1RURL 4YO0B 3AS1A 2WWMC 1S6NA 2IBBA 2JKJA 2ZJSH 1AVAA 2WXQA 3BYTA 1PLAA 3FOLA 1A3RL 3QQ3B 4IM8A 1HF9A 4RFNC 5E2WL 1T04A 3QEQD 3RPIA 3VDCA 3J2PA 5D7KE 4EZLA 5CD5D 1Q0EA 1LWUB 1QLEB 3T2NH 2PW1A 1XGTB 1F3RB 1YEWA 4AYEC 3LIEA 1WS7A 2J8UA 4P5KA 1I9IH 3PE9A 2EH8H 2XSKA 4IU3A 4XN8A 4GYBA 1XGYL 2RHEA 6CGTA 3FQRB 5F7MC 3ZE1B 2XZZA 2PYFB 4PD4D 5IB2A 1UKQA 2FJGA 2BIHA 3O6KH 5C08E 4A7GF 1TETH 5LAXB 4NQEE 2BP0B 3RWHA 1PLGL 1TJIH 4JPVL 4F7PB 3RVWC 1AO7D 4PRIA 3P77B 1UXSA 1EHKB 1QBAA 5AFAA 3TBSB 2AEOA 1B2YA 2OSWA 4MGXA 3Q6GL 4JQ0D 5JIQA 2P5WD 4XMLL 1L3NA 5B7EA 1CFMA 1TZIB 5CBAB 2Y7LA 1ZVSA 4GUCA 4IW4C 4LLVB 3R7QA 4JO3L 4UT7H 2X88A 1TPXC 3KJ4C 1I3RA 3EO0B 5GTIE 3V0VA 4LFHD 3F6JA 3OR6A 3JBG7 4X5WB 3E8UH 2WWMD 3ZDZB 3A5VA 3S5YA 4YHIB 2P7JA 4QXUL 1BCCG 1URQB 1VESA 3OKKB 4W93A 2QGEA 1EV2E 2FL5A 3E0GA 1GTWA 2BFGA 1ZR2A 4Y4KB 4NQCA 4BQCA 4FULA 2WUCH 1RIVH 3ARDA 1MJ8H 2DQIL 2JKTM 4HBQA 4QPEA 4ODHH 1OM9A 1OAUL 4JZJB 1VCBC 2WLHA 4XNZC 4Q2ZB 4DZBA 5C6PB 5GRJL 3PGDA 4XNUL 5B8CC 4ODTH 3O2WL 3TZVA 1OT4A 2MMXA 4HUVA 1CW5A 1JHLH 1WDAA 4XB8A 2JP3A 4O02A 3NXSA 2EILB 1EUUA 2Y6SC 4N2MA 4IKNA 4UINH 3RDTA 2HTKC 3MXWH 4LF3B 1Q9LA 2WO2B 1Y1UA 3UTTA 4JRYA 4ODBD 4PW3A 3OX8A 5H37G 5SX4I 3T0AA 3VMPA 2HPTA 2F8OA 4IGBB 3CHXA 4O4YH 5CBNA 1DQQA 3FXEA 5T5NG 2HCZX 3HUSA 4DW2H 3AVEA 2QVAA 1SBSH 3K6SA 3LS5H 3S8GB 3DETD 1M7UA 3QIBB 3PQYA 3KDMB 3AXHA 4Z7NF 2J56A 4ANWA 2OM5A 4OIIH 2UWEE 5FF6B 5IB4B 4P4RB 2G2RB 2BRRH 5I6XB 1L0XA 1CFSA 5F7UA 4B7LA 2WLLA 2XN9E 4M7JH 2CUHA 1S9YB 3L4VA 4H8QA 3T3PB 1ZLWH 4M7LL 3A0HH 5I9QC 5BZDB 3UJIL 1U8QA 2R51A 3ZUNC 5KSUA 1ZV8A 2YXVA 5IMMB 3GXFA 5C7XL 3NTNA 1KXQA 3NCYP 3QQNA 4PYHA 1BJMA 3WXVH 4N3TA 4CU6A 4PRBB 3VTAA 4CMHB 3S8WA 4U7JA 3GRBA 4LDLB 5FKPB 3B83A 1Z3GH 1BDDA 3HAEB 4PJEB 4WNQA 1KB5L 4P2QD 5CZKA 5HHOA 4ODXB 4FXLA 1ZT1A 3ZU8A 3QFJB 1KPRA 4MXWH 1DVFA 4OLYL 3SE6A 3RWFB 1KF9B 2Y6SD 3WIAA 3C8DA 3RGUA 1H0TB 1QFOA 2ZP9A 4RMRA 3PNRB 5GGVL 2VR9A 1VPCA 4AJVA 4DAGL 3CFDB 3IU3A 1S9VB 4KT0J 1EANA 4RFOL 2XA8H 4RNRA 2AK4E 3W2DL 3ILPB 1LO3L 3DBSA 1U3ZA 3TF4A 3EF4A 3A0BH 1UACH 4LEOB 1DO6A 3QULA 4X80L 1TZHA 2YC1A 4HHWA 4LSPH 2CJSA 5IW6B 1FNSL 3BLBA 2WBJD 4IEFB 3VNZA 1QUNA 1UXWB 3DJTA 4AKOA 5D7IA 2DF3A 4YAQA 4DK5A 2KBGA 3EDKA 3K0YA 4U1JA 3WFDH 5I0ZA 1F1AA 5IROA 2C3WA 2YLHA 4JGMA 3V52L 1URZA 4OZFA 3B2UC 4DIXA 5JIIA 1EDJA 2VKXA 5DRXB 3TESA 3FQ1A 3C5JA 3OZ9H 3M86A 2EIJB 3SE4A 3PHOB 2B7DT 1IM3D 1MI5E 4LVNC 5J1AA 5DZVA 4KGLA 3BZ4B 1M1JA 3EOYG 4DPBX 5D1QA 2ESVA 1ECZA 3LZNA 4NN5C 1ZLSH 2OTLP 1P53A 2Y4SA 1LTAC 1QSEA 1JFHA 4E36A 1LE5A 3QUZB 4FNPA 3WJMB 1PIGA 4GT1A 5F7EH 3T0XA 5FO7A 4OQ1A 4JPZB 1RJCA 4H8UA 2W9LA 3TBWB 3GGWB 3FUDA 1NU1K 3WJJC 4NLHA 4NZRH 5FB8A 1XHHA 2AXTE 4X0KA 4QRRE 2ZE0A 3IMVA 2VITA 3ZKSD 3UJJH 4FOMA 3ARSA 3GK8H 1GVIA 1PGJA 1LL1A 3HC3L 1X5FA 3RK3C 5DJ0A 2WO3B 1EEZB 3ZGIA 3SDAD 3H2PA 5AEAA 4I7ZC 2EEBA 4PJCE 4YHKL 4CRPA 1J11A 4HEPA 1A6VL 4YMPA 1EQWA 5DYOA 1W8NA 1N4XL 1TZAA 4CW1B 2ETWA 2AC0A 1NTZE 3UTZA 4LVOC 4DHLA 1A1NA 1U8OB 3Q8CA 2F7RA 3B2UD 1G9NC 4Z78A 1NICA 5E4EC 3S37L 1HI6A 1OM3L 1L0ND 5F7DB 2IDTA 4YE0A 1ZDQA 3T6XA 2UZIH 1FDMA 1A6AB 4TQ8A 1GCFA 1P84D 1I8IB 3KR3H 5T5FL 2KKQA 5A2CA 2DMCA 3DURA 2WCSA 2UZXA 2RACA 5J57B 1LP9B 1NA8A 4LDCA 3VWJB 1B4JL 1CDHA 2ZAGA 4HUNB 4XZ4A 4YVUA 4IU2A 3EQ2A 2PW2A 4EXKA 5DSCB 2FO4B 3I2CH 4ZX4A 4WU5B 1S5LE 1S7RB 3EKCA 4PJDB 5E0FA 1M53A 2OQQA 1GJIA 4AM0B 1SMOA 2YJLA 4XOCA 4KK8D 1FO0B 4XNYH 1AOHA 1QZNA 2C8NA 1ZT7B 4UUJA 4HEME 4LDEB 5IJVA 1A7RL 4ODVL 1N3NA 3RK2B 5DD1H 1RHZB 3RX8A 3GTTA 3N41F 3STZB 1G7QA 3RK3D 1ORQB 1XMWA 3V6OA 3ZXAC 1M56D 1QASA 4BSWB 2X70B 4E42B 3VCLA 4JFED 3DLQR 4AGMA 4EZJA 3U6XA 3NBNA 1BLIA 2XJLA 3QUGA 1ZLWK 4G8GD 2YD2A 4QRPE 5KVDL 4JFUA 3G5YB 2BMKB 3IS1X 3OPUA 4OF7A 4A7PA 5EDXA 2QQNL 3GMQB 4JRLA 4AM0Q 2Z4QA 3M0DC 1YNKL 1FSKC 1VQKP 3DV6B 2GAZA 3ECVA 2DI9A 5DA0B 4KVNH 4RRPA 4AXWA 5KW9H 3POCA 2WLZA 1SQQE 1R3JB 3CFTA 2YFOA 4P5TC 1IAMA 4K9JA 4J23A 1INEH 2X4QA 1D5MB 2C9SA 4IMLA 3BUYA 5EORH 4LHQB 4PJGF 3TNNB 1DE4A 5ISZA 2AJVH 4ZFOB 5TE6H 5DO2D 1DEDA 5CCGD 2EVHA 3W39A 1HH6A 1R5VA 4L8SB 5FUCC 1MAKA 1VIWA 1ZXQA 4DPRA 3UH8A 2PNDA 1K3ZA 4JR9L 1J9QA 2HG5B 2EDMA 3HS9A 5IBTL 4CN1A 1MCOH 3NCMA 5EBMA 2R2HA 2BCKA 4ERSH 3H9HA 2E9GA 1BE3J 1PD6A 3PNWB 4LSRH 4MA3A 1H3XA 3MLRH 4EYYQ 4UQDA 5FFLA 1NBZB 3FO2B 2YS4A 2W1NA 3Q5OA 1UEMA 1XR9A 3T4AB 2R56H 2BIQA 5J3HC 5ABAA 4G6AC 1S46A 2P52A 3EUUA 4JVWA 2CR0A 5HJ3A 3U4EA 2AJ3B 3G08B 4FQHB 4G11A 1VCAA 5HDLA 4LSQH 3QFDA 4UQIM 3BAXA 1JGEA 1NPUA 4DUWA 2WMPB 1GZHC 1MRDL 1P84H 1AIZA 3SHSA 4G6KH 4LU5L 4L2LA 3SO5A 1UEYA 2HYMA 3QDAA 3HPLB 3VE0B 2P45B 2J5LC 4QXTA 4X4KA 1ZOYC 5KS9B 2D7TH 4PJ6A 5DK0B 4YN3A 4GS7B 3QRLA 5J13C 4O5LL 2J44A 1LNUB 3MJ8A 4GKLA 5ENWA 4R7VA 12E8L 2P5EA 2ZKHL 4P5TD 2EO9A 1ZS8B 3DX8A 2X4TB 1VSCA 5DJAA 1G1JA 3SO3C 1SOKA 1U3HC 4I18C 5FHBL 4Y9BA 2FWLB 4KTEL 5IVXB 1XSJA 4I9WD 5LGHH 5HYJD 1MQ8A 3VSTA 1FYTA 2A74B 4FTDA 1UZGA 5DEFB 1EIBA 3PHSA 2Q7YA 2PTVA 4DKFL 2BW4A 2A6KA 2DWYA 2BP8A 2JCCE 5KSVA 3OGCA 2BCCG 2XI9A 3BAWA 3VFUB 4BFFA 1U42A 4LAQL 3N9GH 2X2HA 5E03A 1R3HB 1J9RA 1RJZB 4ZAKA 5AWNL 4HWBL 1HINL 5TPWL 3QUXA 4QKTA 1UH2A 2YFNA 4FKHA 5CCHE 3WKPA 2PCPB 4HIHA 1EAJA 2E8ZA 4GBXC 4J3SA 5J3HD 4AITA 2CPCA 3OSVA 4G6AD 3BGMA 3RA7H 1QO3A 2VSKB 2QR0B 4JFQB 4XRCA 2X53A 3BT2L 1F3JA 3H4FA 4JANA 1G6RH 3LZPA 1BF8A 1HCYA 4KV5E 3VFVB 5FM4A 1I1CA 3U30C 1BGYE 2I69A 3IRPX 4A2HA 4N2KA 1IE4A 1ZMEC 4H2AA 3VGDA 1JPFB 5DR5L 4XE0A 5C0CA 4LCYA 5GS0L 5BPPA 4LVEA 2VXVH 4G71B 4UTAA 3NZUA 1P4UA 1BP3B 1THCA 5FYJU 2CDEA 2IYOA 5EZOH 3OR7A 3G04B 4PH8A 1U3HD 4WDIB 1A0QL 1J1EB 4LVHC 4IJTA 2E7LA 1AIFA 4G42A 4JPWH 4HIQA 5HDRA 3WXWH 5I71B 3MV9E 3O0RH 4MQSB 5AKTA 4XI5C 1ROCA 3GEFA 5EU5A 4Z18A 1AZUA 1OSPL 5F7YC 3MUJA 4KDVA 4XBMA 3C5ZA 3IWVA 4ZX3A 1ADWA 1IGTB 1MFTA 4X9HA 3NPSB 2H3KA 2LU3A 1D5BA 3SE8H 2FVNA 4WW2A 2O5NA 3B6SA 3N42F 4GBXD 3L72E 4QOKE 5FYKH 2PCYA 2VZSA 2G3ZA 5D4HA 2DMKA 4RMWA 4M02A 5EDSA 1A66A 3EGXA 4YXHL 5I1LA 3H3PL 3UBGA 2VLRD 3F64A 3ZYZA 3H4HA 4BWUA 2NY1B 3FK3A 2WWWA 4DVRL 3F7YA 5BVPL 3OWEA 4L37A 4LT7A 2E6PA 5F89A 2I1JA 1O6TA 4L1BA