5AW5B

Kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 2.2 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw5B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw5B02
4C7NA 2VRSA 3V4WA 1OXZA 4JYBA 5AVSB 1T2KC 1GTWA 2ZXEB 3A3YB 3T97A 2W6AA 3MGNA 3P32A 1SP4A 5APUA 3L37A 4JYCA 1IO4A 1GD2E 4AQRD 4RESB 1CZQA 3KQGA 5AVRB 5AW3B 1FOSE 2WTYA 3LIDA 1FOSF 5AW0B 4AUWA 3A7OA 4HYTB 3P8MC 4B86A 5AW5B 2P7JA 1A02F 5AW6B 1MV8A 3VMXA 1JUNA 3M9HA 2YNYA 2Z5IA 2QM7A 5AVVB 1S9KD 1GK6A 5CMZA 4EOTA 1GZLA 3NXSA 2H7HA 3HE5A 3LIEA 1DH3A 2E42A 3M9BA 5AW4B 3VTPC 1GU4A 4RETB 2P2UA 3TYYA 3VMYA 3HE5B 5AW8B 3MD0A 2Z5HA 5AVYB 5AVZB 1H88A 3WGUB 3KDPB 5AVWB 2C9LY 2BASA 2XZRA 2WPQA 3O8ZA 4LC1A 5APSA 1HBWA 1S9KE 1X8YA 3A2AA 1A02J 2R32A 1MUUA 5AW7B 4KHXA 2Q5UA 1FAVA 3VN0A 3SWFA 1CI6A 4GT1A 4C46A 2R5DA 2XV5A 5APTA 4M3LA 2P67A 4AYCA 2W27A 2R5BA 2WPRA 1H89A 3B8EB 1CSBA 3IR9A 3VMZA 1HWTC 1KQLA 1CI6B 2KP8A 4DZOA 3M0DA 1JNMA 4XE5B 1YYCA 5APQA 3M06A 2E43A 5AVTB 1NWQA 3UIAA 2WWWA 1G2CB 3TNUA 4I6MC 2Q7CA 5APYA 4GKGA 2ZFCA 5AW1B 1GU5A 3WGVB 3HE4A 4I2LC 2C9NY 1NAFA 2N9BA 3TNUB 3M91A 2QM8A 5APXA 4C7NB 5APVA 2R3CA 2WT7A 3V5BA 3VYIA 2XU6A 5AVUB 1SLQA 3TK1A 3HE4B 1HUCA 3L35A 3V4QA 5AW9B 3P7KA 3A5TA 3HTKA 3NMDA 1H8AA 3NFQA 1HJBA 3NTNA 2Q3IA 2WT7B 2JJLA 1OWAA 2IPPA 5AVQB 1GK4A 5AW2B 1J2JB 5AVXB 2YO2A 3I5CA 5APWA 2WPSA 3M0AA 2YO3A 3L36A 3OAKA 1MFZA 1T2KD
chains in the Genus database with same CATH superfamily
2YMXH 3RPIB 3D30A 4M61A 5CU9A 5CCHE 5EU6E 2WXQA 4F1SA 2W6AA 4FL4C 3REVB 4NFBA 3U4EA 1HIMH 4JYCA 1T1XB 4PS7A 4BHUI 3D2UA 3IPBA 5FLUA 4B9ZA 4YNYB 5E8EB 1ZLDA 1PMYA 5EZOL 3LEVH 1UH3A 1Q90A 1RZJH 4JDTL 1QPXA 4Y8AA 5A16A 4HCFA 2WXLA 4JREC 1JZ5A 5KKZC 3N40P 1FOSF 1QLRB 1RUQH 5AW0B 1XGQB 2GTZB 3NZ8A 4KMQA 4XP6H 1MJJB 3EOTL 3NJFA 4APXB 4WF7A 1K8DB 1T04B 1R1CA 4RAVA 5D71H 1RPKA 1N73B 4KHTH 1MRDL 1X6LA 4OZ4B 1E4KA 2UYLA 4TQEL 4WI4A 4FG2A 4PY8J 3ZDXF 2AITA 4FERA 3V0GA 1WQVT 5GS2H 4OV6F 5DZAA 3QHZL 5E2TL 1EH9A 1KXTB 4JDVB 4LU5L 4CC1A 1OCOB 3UGUA 3HHSB 3O41B 3S6CA 3QDGD 3QARA 2N7SA 1XF4B 3G6JA 4I0PA 2NY2D 4U3FD 1KYAA 5IMLA 3RJOA 2NQDA 2R39A 4ZOAA 4WEMB 1JDCA 4TTDC 2ED8A 4Z3HA 1I8LA 4N25A 3RNKA 1X22A 3MNWA 3VRLF 1VLXA 3LTVA 1ZCRA 5EDXA 3MLYL 1I7TA 1RJCA 1ZLUH 5I16A 1E9OA 4KK5C 5E9DA 2GJ6D 3QPXL 3T2OA 3H1KD 4A2HA 4NRZA 3AAZB 5A43C 3ETSA 2IXQB 2LU5A 1JMMA 1FRGH 2X89A 5BMFH 4LLAA 1SFCB 3WENA 2AEMA 5IZ7A 4ZFFA 2Y72A 5D5ME 1CURA 4LAQH 3PRZA 5CEZD 3UEQA 3J7HA 5SV3A 2AEJA 2OM5A 5T3XL 3P4MB 2VN3A 3CD6P 2Y7SA 1SBSL 5EUOB 2ZYDA 3H1IJ 1HKLL 4FEIA 4XAWL 4FL4B 3B5NA 1EIBA 2L7UA 3RVWC 3O9WC 1TG8A 4GBXB 5ECGA 1PPJG 2X2HA 1TETL 4PREA 1N6QH 2J8HA 4H1LB 4FEMA 4I87A 4YBLC 5I0DA 2XBZA 3HJ0A 2Z7WA 3HS0B 4NZTL 4JO4L 2KI7B 5EBMB 4LSSL 1PDKB 4NB7A 2PMZA 5J7CC 1I7RB 4IOFD 1HEJC 4OLYL 4U6YB 1U8MA 3QFGA 1P4LB 4J3OG 3O6KH 5DD0H 3KCWA 3GF8A 4F91B 3R7RA 5EOCH 3OXRB 4H5SA 2Y1AA 3V5HB 2XNAA 1WE5A 1R24A 1P1ZB 1V3MA 3V6FB 2AJUL 1KIUA 1LDSA 3MLSL 2R4SL 1BCIA 1YQ4C 3EH5B 3IJHB 3TGXA 2MKVA 1BREA 3QJXA 2F15A 1KTJA 2N1TA 1KOAA 2A06D 4QDGA 5AD0A 2EJ1A 4B9YA 4N9OB 3O6FC 4ZRGA 2C9VA 2AS5M 1Q9LA 3VFVB 4W6XB 4OIBA 4UZUA 2NSXA 4UM8B 4I9WE 1T0MA 3Q8FA 2V2TB 5I8KL 2HWZL 3RB7A 3VMXA 3EDFA 4MA3B 3CMOL 2GUOB 3ZKXC 2VDMB 1L9QA 1HYRC 5D4IA 1NBZA 3IK2A 1U91B 1TJIL 2DM4A 2P10A 1FL5A 1U8NB 2OYLA 3ARBA 4JM2A 4LASL 2IVFC 5C8JB 5DMGD 1B88A 4P3DA 3GWJA 2C1OA 3MNVA 4OFVA 5C97A 1TMCB 4G43A 2WQYC 2GI7A 1NGYB 2CKNA 2A83B 3AVEA 3MUHL 6CGTA 5DVKA 3HAEG 3CPLA 1TQCC 2RN0A 4LQ1A 3RKDC 1N2DC 4LNVA 2Q87A 1JBJA 1HXYB 5CR1A 1CF8L 3KPLA 5MEPA 1E42A 1BZDA 2FO8A 3HAEA 4HIIA 5F9DC 1TUPA 4Q9QL 3BIBX 5J9PB 3ZDXB 5ELIA 2J4WL 3O9WB 1BD2D 1MLBB 2QHRL 3LVTA 2Z1PA 3QDAA 1WO2A 3D4GA 4MXVF 4RAUA 3CHSA 3WIHL 4G6AD 4GIPD 4GSXA 3UROR 1G9HA 3RVVC 1KUMA 1M7UA 5D2LA 1FG2B 4HUNB 1UADC 4GXUM 3D2UD 1QFUH 1JGDB 1S9VA 1Q94B 5APQA 2DQMA 1B2WH 2X53A 1VPOL 1CI5A 1A3RH 1UB5A 1E6JH 3UAFA 1Z5HA 1Q90D 2MOQA 3NG5A 3KH4A 4N0FA 2FHBA 2JWYA 2WSEH 2PETA 1GS7A 3T65B 1ZVSA 5I0XA 2EVGA 2HUHA 4IU2A 3Q3DA 4LK4A 4G8AC 2N9BA 2XIIA 3KVQA 4LCIL 5EULV 2XIBA 4DEPC 4X4ZA 2OFQA 1WF5A 2W07B 3C60A 3FHEA 4UTAH 1P5UC 3QPQC 1A6AA 4Z77B 3V4QA 3OC5A 2XG5A 3O6FB 1LLAA 1IGTA 4W9GC 1IU1A 2VQ1A 3L1OH 4I2XA 3EOYG 1KLGA 3DMMA 4BM7A 5IIEA 4OFKA 3QR0A 3POHA 4I0PD 3FT9A 2BM3A 2CPBA 2WPSA 2WZ5A 3QS2A 2B7DT 4JRXD 1TCRA 1N59A 2UUDH 3DHMA 3U36A 4IEFA 3SYPA 4HEME 3JWOL 1AFVL 3BZFA 3ZKXB 3ZUCA 5KYXB 1CBVH 1L4AB 4PLJD 5L88H 1KJMB 2MIZA 1YY9D 5KSBF 3CK0H 3LZQA 3WFCL 4LLUA 5KTEL 2ZAEB 1M6UA 5GJTL 3JTSA 5SWQB 3RK2D 5D7SL 3C09C 5E9DD 3HG0A 4URTB 4L76A 4F7EA 3FUJA 1OAQH 5IROA 3VGBA 3WO4C 4DO4A 4ZXBA 3TYGL 2ZICA 2VISA 1ZOXA 2R0WH 1PZCA 2O72A 3NABH 4LRNH 4J28A 5EFWB 2X89D 4M5YL 3AQYA 1E28A 5AB9A 5KYNA 2ICWI 2TAAA 3QXDB 32C2B 4H8WH 1B6UA 1NMCB 4OSUL 1C5DB 1AGCB 3AEGC 3T0EA 2F53A 3FS9A 5ACMA 5B4MD 5AKVA 2BNUB 3BSHA 4XP5L 4KDVA 5IHLB 5E9DE 1RF1C 4Y4KA 3ULUF 4MMXB 1SF5A 3GKWH 2FYNC 4X6DF 1X9UA 3UAJD 2ZXCA 1CLYL 2X5PA 4NYLA 1WZKA 4MFHA 4Y5XC 5DO2C 4UB8H 5DRXA 5I1DB 1LO2L 1R5IB 2CALA 4EZMA 3B5ND 2DWEB 3S3SA 3O3EB 1HAWA 3C8KA 1JJUA 3LIZL 4FNLH 3MP7B 4NZJA 3SQOH 2V7NB 4KFMA 5D2NB 4HOMA 1JY3O 4LC1A 3FQTA 4FCHA 4FXLA 3WDIA 3BRVB 3IVKB 5EEUA 1QO3A 2Y36L 3KBFA 4Z3TA 2N59A 1WBXA 1KN4H 3M8OH 1IGIL 2MNJB 1RE4C 4ZUWA 4IGBC 2D31A 5FKAA 3ATDA 1RZ7H 2KLUA 1VRSA 1PIFA 2ZAGA 4BZ2L 1XCTB 2DS4A 3LZOA 2NY4D 3EH4B 1MZYA 3GMMA 4J3OD 4PRIE 3W68A 1G1CA 2Z31A 4JM4H 2QGCA 3MLZH 1NFDB 5ANMA 2R2HB 2E56A 1PU0A 2X6UA 1KPRA 3VXRA 2AJZA 3ZYZA 3DETD 4K7PH 4D2NA 1GL2B 4B0MB 1XL6A 5DJYA 2N1TD 3S97C 3VDBA 3TFKD 4CMMA 4TSCH 5CEZH 3VGEA 3QNZB 5AALA 3Q6GL 1B4JL 4RBPK 3VX0A 1GIGL 1SXBA 3NSXA 1KG0A 3RILA 3TGUG 4C8XA 1M05A 3QORD 3ILQD 4L0PB 3RTLA 3TJHD 3T0WA 1RIUH 4L0ZA 3II6A 3GSVA 4PBXA 4CW1B 1ONQB 3QEUB 1DJXA 4KXZH 1ZK5A 3L5XL 2R51A 4WY7L 5ESQB 3WO4B 2P48B 2M26A 5E00B 3B8YA 4ZW8A 3K6SB 1ZPLA 3FT2B 2FIRT 1ITCA 4KKQA 2ZYRA 4RGNB 4NT6B 2OSLB 3O2WL 4AJWA 3HN8A 5L9DH 1BG1A 3E3QC 2X6AA 3TV3H 5EMYA 1DBJH 3NIFB 3MRMB 1S7UA 5BQDA 2UVFA 1F00I 4JFZL 1JZGA 4ODHH 2CKBH 1A8JH 3FUHA 3CFDB 2OR9L 5C0GB 4AMWA 1MAMH 1Z9LA 2WWOA 3MNDA 5LQBL 2CIKB 1XH3B 4XPGL 4EN3B 1KCSL 2YAQA 2BHUA 1IBHA 1PGJA 3FUFA 4Y5XB 4YIQB 5H2BB 2A6DB 2FJFA 3TSIA 3SFEC 1Y0LB 3BKJH 3SDDA 2XETA 1NTKK 4PJ8A 5JR1L 1QFWI 4IRZL 1J7VR 5B1BB 3KL5A 4OZIE 3PGDB 1ASOA 1FZCC 1HH6B 1QEXA 2DIAA 1FFOA 5C2UB 1I9JL 1Z5LA 2JIXB 1NEZB 3PWJB 1J1EC 5DS8B 3L4WA 4UZGA 4IGBB 1U93A 1C9SA 2E42A 1LDPL 4HP5A 3STLB 4R96A 4GIFA 3GSXB 3DOHA 1YPZF 4WU7B 1SMOA 2FFDC 2QGEA 1H0DB 2Z92A 4Z7VA 3C60D 2HPCB 1IFIA 1G0DA 4EF3A 2XY2A 5I6LA 5DC2A 4I9XA 4KROB 5F3BB 4NLAA 4QXTB 3MRJB 2HMID 2J3SA 1TIUA 4U2YA 4W68A 1IQWL 1NJ9A 3DMMD 4G9FA 1DFXA 1PQZB 1AA0A 3F00A 2VXQH 3UH8A 1DFBL 4NP4L 3QCVH 3U9WA 4B0MM 4BSJA 4YSSA 3KPOA 4WW2A 3ULVL 4CUCA 3L9RB 5EOTA 5EEXA 2VJ0A 4NCC1 4X6DB 1ET7A 3K6DA 2PXYD 2W9LA 2LQRA 3D18B 1EEYB 3BJLA 4K3HA 4R26L 1QSFD 4I2XE 4X8JA 5L4MA 1E2VA 4UUJB 1OFCX 1EO8H 2XRAH 4OR1A 3A0HH 3CXHD 3I02A 4NERA 4ZXBD 4JBZA 4A7TA 2HG5A 4QAMB 1A9VA 1I31A 1IEAB 1F1AA 1YRKA 3AREA 3WTUA 3TEUA 3SFDC 1FSKB 2H8PB 3OMAB 4KX7A 2YSTA 2DI7A 3VI3A 5CZXC 5AOIA 3BI9X 1WWAX 3TTSA 3P8CD 2APWA 3VSUA 2CBOA 5ALBL 1BSHA 3T0ED 2JP3A 2P7TB 4GMTL 2CLZA 3H7BB 5KSAC 1UH2A 3GS0A 1ZLVH 4Y4KD 3WXVH 5F7EL 4HKBB 3ZDZE 2QTEA 3T0BA 1J5CA 4TULL 1EVUA 2X9XA 1FZCB 3KPQA 1OP5H 2ALWA 2BH0A 1JAEA 4JUTA 2ERJC 5FF6B 2F7PA 3UYOD 1NFIA 1XF3A 1RUAH 3TN0B 3UBXG 3PUUA 2DWDB 2WNXA 4D0BB 3CVIL 3LRKA 2KSJA 5BXFB 2HB0A 1WAAF 1NKRA 1YEEH 1EEUA 4Y16A 3BH9A 5GGTL 2C3VB 1QR1A 3RWFB 2F53E 4PG2A 3T0EE 5IHZA 5JW5A 3UBXA 3GQFA 4K55A 2LE9A 1NIDA 4HHAA 3TIDB 3IPEA 4UQCA 4Y2NA 3O3AA 5I0VA 5KJ7A 5FFOA 1GD2E 4AQRD 4G8FB 3SE6A 2H3NB 1OIOA 4QRSA 2W92A 2FGZA 3HOGA 4GUPB 3EDKA 1BXVA 5KYWB 1OCWL 3FYEB 1FIGH 2DLIA 2VXUH 1A6PA 3V5KB 3OM3B 4JLRA 2J43A 3DHJA 2W9DL 3BPCB 3QEQE 3VXRD 3ZKMC 2ICWB 1E30A 3IRPX 1G7QA 2RQEA 1T6VN 2QJYB 1JUNA 2EDLA 3QFDA 3U7AA 1GRWA 1IBDA 1GYAA 1U58B 2VIRA 4EIJA 2DAVA 1UZGA 3DUSA 3OGCA 1IQDA 2HRHA 4U3SB 2E74D 1NGZA 2A45G 1I3RA 3LPFA 8FABB 5C6TL 4PG9B 4K23H 4J8RA 5BRZA 2WVVB 3KPPB 2BS9A 3VMYA 1D5IL 2EC9T 1S7QB 5F3FA 3M7FB 2G5BB 2MCPH 1H3WM 4NQVB 2YD9A 3BC9A 3CBRA 1YQ3C 1MQKL 1Q1JL 3JTTA 4OD3H 5D5MF 3V8CA 4ANKA 5IJDC 2PO6C 2QLYA 3OL2A 4O9HL 5EPMA 4QNPE 4DCQA 5CZVL 5KSUB 2YAEA 5D7LD 1CD9B 5HHMB 3AY4A 2LAGB 2WIMA 3UP6A 43CAA 1XCXA 4IIQB 3HI1B 1FFNB 3KPSE 2VWEC 2BRRH 3L2LA 4L1TA 4EDXA 1YHPA 1BAGA 2NY7H 3GSUB 1TKWB 3QJSB 1FFRA 3LZPA 2ZXGA 5D4HA 4ZMDA 5M1BA 5CEXA 4I48B 3D52A 4NDMA 1DJZA 3H1LE 4KO9A 1D9KD 2ZP9A 4XX1E 4JZJC 4YXHL 1JF1B 3EJZC 3G5WA 1IJNA 1HQ4A 4J3OH 4EXPX 5JHDB 5JNYB 1YYCA 1YPZB 2UXVA 3EGXA 2OYPA 2FIKA 3LRSB 3AG4B 3L4CA 2EILB 1IT9H 4GQZA 1VGEH 3FTGA 5EDSA 1JFQL 4PJ8D 2WGNB 1KT2A 2ZG1A 3N50A 4C57C 3FRPB 3WHXB 3H0TA 1WK0A 3AS3A 2HT2C 1GOFA 5C0IB 1UWYA 2QVMA 2VW6A 5KAIE 2YLKA 1CU4H 4TUKL 4AMKL 4JO1L 4KKLC 2NY3B 2OA9A 1ZLEA 4U1LA 2A4EA 4PJ5B 1A7RH 1R5WA 3N1PC 4IMKA 4ANVA 4HU8A 4GO8A 5I1KL 2VC2H 1PZ5A 4HJGH 4QLRA 5JDSB 1ZR2A 1MQ8A 2IBZY 5FA4B 1BQHG 4JDEB 4K3JH 1MWAB 1AP2B 1IC0A 1ZANL 5T1MA 1FNGA 1W91A 1SQQK 1ML0A 3DRQA 3FH5A 3LV3A 3VGAC 4U6XB 4IJTA 1BQHA 2XXFA 2NYZA 9CGTA 3Q5RA 3HB3B 1YEFH 2BY1A 1WS8A 1QTSA 2EIKB 3VFMA 2BFGA 3BX7C 4NRYA 4ZX5A 4KNTA 3FB8B 1RY3A 4WVZA 3WTWA 4PVBA 1Y18B 2WKOA 1FDOA 2IH3A 2QQNL 4G9FD 1WUZA 3UC2A 5EU6B 3CIAA 3EFDL 3IDUA 4JFHD 4YHYC 4LSQL 3A4EA 4ISVB 2Z1KA 3D7PA 4WEUD 4XBPA 4D9QD 3HAEH 3CFJB 4UMSA 4Z7VE 5M94B 2FEDC 1D7FA 2VZOA 4YC2C 2PO6B 4N8VG 5E8DH 1KYOI 4LQFH 2FQDA 4NHUB 3DV6A 5CD3B 3S9DB 3O3BB 2JK5A 2VXTH 5C08B 3K5BA 1KIRB 4MMYA 4D6TG 2YFOA 4XP4H 3QUXA 1G9NH 3FF8A 4JFHE 4EI6A 2JJSA 2HG5D 2Y22A 2B20A 1QTYT 1OGAA 2GT9A 3TF5A 3NXSA 2XWZA 4M93C 2O5YH 1TLKA 4ABVA 3ARED 2V4HA 1Z9SA 3H9SB 1ASPA 1TZGH 4QGTA 5D1QE 4MMZB 4NUJB 2VLRA 4NUGH 3VG0H 2CHXA 3AROA 4M8QB 3MLPA 1ID5I 2AANA 4YDIL 3IS1X 4DJMA 5IMMA 5J06A 4UNUA 3QG6B 4FQCH 5ICYA 3AT8A 1A21A 1A9EB 1NMBL 2FGWL 1AQKH 3FK3A 3U1SL 3WE6B 1AACA 5HYQA 4NOFA 3RL2B 4EBQL 2WBWB 4Y19E 5F71A 3V9EA 2BVEA 1ZWIA 5EO1B 4P5TA 2KPWA 1NDGA 1BF5A 1DEEG 2YXWA 1IAOB 3H55A 3H25A 2XN2A 4I18A 4JZNB 4W9FC 1Z3GH 4W9IC 5JMRA 2Q3AA 4Y16D 4B60A 4Q58C 3S4SA 1YMME 4Y4FB 3ZU8A 5JW4N 4IFDK 1L9PA 5HGDA 4FQXB 1UB6B 1FZBA 1M1KQ 2ZWKA 2EACA 4HGWA 1F56A 1I3GL 1DO6A 25C8H 5JUEH 1ACCA 3DYMA 2UWEE 3VGAB 4MS6A 1OIPA 2YXVA 3MTRA 4GMSH 1N7SC 2EYSB 3MZGB 2YWZA 4RZCA 1N7MH 2O1JA 3CXHH 3DC0A 3EH2A 4HS6A 5D5MB 4YN3A 4XB3A 5DUML 1PJWA 1W8OA 4LNRB 4MHHI 4WFGE 2HKHL 3V7MA 4ORZC 2WN3A 4JO5A 4HS8L 2FJHB 2GSIA 4AL8L 2G2NA 5CCKL 1OKEA 2WT7A 3BN3B 3IDMA 3SPVA 5KJ7E 3VWKC 1BX2A 2OMYB 4XCYA 3GGWA 1SDDA 3LPWA 3RTQD 2Z4QB 1UCBL 4UT9L 5C0FA 3DIFA 2KZJA 4E9XA 4TVUA 3X1NA 3SDYH 3CSYB 2NSQA 1V55B 2GHWB 5JA8B 2FR4A 2JXMB 4RSVA 3ABGA 2H2SD 3MV11 4JFYA 4G1EA 3SEPA 2B08A 1R3JA 2FJSA 5AYUH 3FSZA 4YE0A 2JB6B 4JFPA 4JYBA 2DI8A 2GG1A 4OFYD 3SE8H 4M93B 1FCCA 4WEEA 4KFZC 3L4XA 2JKIS 3S4RA 1QFWM 5EC2A 3BCCE 2XKNA 3ASWA 2F7OA 5BRZE 2WITA 3A4AA 1K72A 4F2EA 2DIBA 1M56D 5EEZA 5C6WH 5DC0A 2MPVA 4O2CA 1L4IA 4LE8A 3EJSA 1QLFA 2QADB 1OT1A 2NSMA 3D3VA 4NKQB 1BFTA 1PTZA 3U4AA 4X0KB 4N3UA 1USZA 2NR6C 2ZX9A 3QUZD 3JZYA 2VMCA 3HZVB 3R4RA 5IM7A 1BCCJ 1AR2A 4LHQB 2DQEL 3ZHFA 1KJ2L 2AMUA 3AM8C 4BFNA 1M7DA 4PJ9B 4I8DA 2ZKWA 4BWTA 2WBJC 3HBGA 3GDCA 1AGBB 3UJTH 1MVYA 2BSDA 5F7FA 1IC7L 3F7YA 4NM8H 3CX5J 4RETB 1HHIA 1RUPH 5HYJE 1A14L 4MJIA 4IKIA 2W9EL 1HINL 2N3JA 5I1GH 3MRGB 5KLVE 4I3GA 2YD8A 4NWUH 2BRQA 5D7JD 5FUOL 4K07A 4K3AA 5DRWB 3RURA 3TYFA 1OE2A 3CVHB 5CKAA 2OK0H 1P4IL 3K0WA 4FZ8L 2MKLC 3CHQA 2B89A 4PJ0H 1G6RL 3PWUB 3ESMA 1HH0A 4KRPB 1W80A 3OKLB 4YQXH 4HIEB 3MCKA 2ICCA 4QI3A 4BFGA 2Y5QA 2VDPH 3VWKB 5BPPA 4HJEA 4NQEA 4GLRI 2HLEB 4X4KA 2Z3FA 2ZSVA 2O30A 2WW8A 1FJ1B 2B0SL 3I6LE 2Y2WA 3FX0A 3L9YA 4YPJA 4E0RB 3ORJA 4U1NA 1M90Q 4QHLB 3VI4A 3B2UC 1RZGA 2D2CC 5K5YA 5F8RC 3IXAB 3L3IA 4KKBD 4NQDE 4ODWA 1H8NA 5HI5D 4JQIA 3HNTH 3E9TA 4YSOA 5DJ0B 1XGPA 3MGAA 4CVUA 2X2JA 4HOWA 2OTJP 4UQBA 1KNOB 3O0RL 4LRIC 3R0MA 1J48A 1M3IA 4IIZA 4HXBL 4OJFH 4LCUB 1OGAD 4AYGA 1J1DC 1RHHA 3QW9A 2AAAA 3H2PA 3T4AC 5C7XH 5D9SB 3KW8A 4JM2F 4S10A 3US1A 3BE1H 3EO1B 1BQSA 3GS4A 5E0FA 1ILSA 4XT1C 1DJYA 4OGYH 4ODTL 4OZIF 3QHFH 3GKZA 2H47C 3W0WA 5E1QA 3X1GA 4AIXA 2WSFH 1XAKA 1B4LA 3VOPA 1CJYA 1I85A 1MG2C 3NZ8B 3GW6A 5TPWL 3S35L 4GT7A 4R4FH 1ROWA 4FFZA 4K3EL 4ATTA 4L8CA 3VRJA 4N4YB 2Y69B 1OGAE 2QR0A 2UYLB 2CJUL 3OJ2C 4M62H 3WFHA 1KN2L 2Y6SD 5TF1H 3A67L 4P5TD 4BA0A 2VLRE 3GMNB 5KANG 5KG9B 4PJFA 1QPKA 1T80A 4LSRL 3K80A 2ZWYA 4YE4H 5EOQH 5IT2H 2CLVA 1SJEA 2WTYA 3F04A 3PRJA 4M6OH 4D7PA 1FLTX 3INUH 1FVDA 5FV2A 3MRLA 5DDHA 1XGYL 3RX7A 4J4PD 2B3IA 4KNSA 3ZIYA 1LEKB 2OS7A 3PWPB 2J88L 4HAGA 4CKVX 1W72B 1PZUB 4DO6A 1KYDA 2AXGA 4QTIL 1NOFA 1HZKA 1YJ9P 1KLFB 1KB5L 1FGVH 1IBGL 4GT0A 5KVDH 4XTRD 3MRDB 2R23A 1K9TA 4AK2A 5EF0A 3AEFC 1GSMA 3PREA 1ZRUA 1G9ML 3BWAA 2PTTA 3LB6C 4Z18A 4U6TA 1AR1D 3F58L 2IFFH 4DOHE 4E9YA 2PWGA 3GMOB 3L70G 1IC5L 5CHNB 5I66A 3LNHA 4ALAC 1RKRA 5E99L 2A9NL 3Q2LA 5DFTA 2YHGA 4G6JH 5DLML 5IB2B 1RK1B 1NFKA 4KOCA 4PJDE 1T03L 5ENWA 4HIHA 2D9QB 3UMNA 2IMNA 3KJ6H 2DF3A 2YRBA 3QJHA 3X13A 4H26A 1WCBA 4XNQB 2IIJA 4QXUH 1OAZL 1AXSA 4A38A 5MHSE 1J1DB 1SYSA 3FU3A 1PZSA 1CI6B 3NFPB 3IB4A 2HR3A 4PCSA 5E79E 1EQWA 3NGBC 5L8JB 4PRIB 4PREB 4OZGF 1S3KH 2FEEL 3WKYA 3HG5A 1YJDH 2X4QA 1PKOA 2GK0A 5JHLL 2JKTM 2B88A 2OCJA 3PHAA 3D3VD 1KV7A 4BUHA 1QACA 2BIPA 2VH5L 1OHQA 2WYTA 3LNGA 3Q8BA 4LDEB 1E7UA 4P46A 5HHOA 5SX5K 4ENEC 3WU2E 1PVHA 4H5SB 4HSCX 3UZEA 5LGHL 5MI0C 3C08H 2XNAB 5C9KA 2VDRL 4GW4A 1X9LA 4M3JA 3DOIA 4NZ8A 3FOMA 1F4YH 4WFHE 3WSQL 4P9HH 4D9RD 1AVYA 5GZNA 2WHVA 3EOBA 2RH0A 4JQVA 4FF9A 1K3IA 1GZPA 2CUAA 1I75A 3DX9B 3RL0C 2CHNA 4FFTA 2EICA 2QJDA 3JV6A 4P4KA 1KILE 5AD0B 3ZHLA 2B1OA 5CJ4A 2A45H 1MFZA 5F7HA 1Q9LB 1JV2A 1A7PH 4ORGA 1JK9B 1G6VK 4EOWL 1T0MB 3VFGL 2ATAA 4UQ9A 3WHE1 4OGXL 3SKOA 4HSQA 15C8L 1UM4H 2HVKA 1ZAGA 2IDFA 3HHRB 3M07A 4WTWA 5DHXB 3WIHA 2H3KA 3UTSE 5GS3A 3I50H 1PGOA 3T4YA 2WYHA 4R8WL 1NBZB 1CLVA 1I7ZA 3H1JG 1JZFA 2AVGA 4TQIA 1QFPA 3VXPB 1BBDH 3FN0L 4MJIE 1MEXH 4EIGB 5H8DA 1E5BA 2HVJA 3ARBB 4FTDA 4NQED 3T8XB 4CADA 4JM2B 4UB6H 3MV9A 4P3DB 3MNVB 4FLRA 3H3KA 4TNEA 4QNPF 4G43B 4OZIB 1GZQA 1AJ7L 2QSIA 2HG0A 1JEKA 1G4RA 1XIWC 5KZCD 1OWWA 3CPLB 5E7BA 5BUPA 1LTAC 2OMUA 4E36A 3VWJD 3C5ZC 4G7VL 3KPLB 2R2EA 1C8QA 4PJAE 3MGTA 4GS7B 2XYBA 3E1ZA 4HIIB 1UOKA 2P2UA 3BRGC 5ACZB 4WJKB 5T5FH 4AQ8C 3B2VH 4WK2B 2OMBA 3GI9H 1KYUA 4YXLH 2R1YA 1U7JA 3ULAB 3S8GB 4N2AA 3W39B 1UGNA 1JGLH 2R9HC 2XV6B 3O4OC 4PB0L 1KQFB 2DYPB 2FH6A 5HGBB 2IALA 3HLAB 2UXTA 3W0WD 4MZRA 2EE2A 4OI8A 2WXRA 2YD0A 4EUPG 4WWNA 1EXIA 3TVMD 4MXQD 1TQBC 5CWSA 3TC9A 4KUZH 5I17B 2DD8L 2JQMA 1VCAA 4EUPA 3I56P 4QHUA 4XXDA 4HWEH 2XN9A 2X70B 2XPYA 4KX8A 1JMZA 1CGTA 1WBYA 1O75A 5B1JA 5ISZA 5CJXC 2XG5B 2HJKA 3IFLH 1IGTB 1TJMA 2VQ1B 4I2XB 1SJVA 1J5OL 5DWUL 5IIEB 3PJLA 2ZUQC 1J9QA 4XHJD 1FDLH 1QWNA 2BINA 3FKUS 1TTRA 1LJMA 4DGYH 4ZAKA 1H3TA 3D4ZA 2YA0A 4IEFB 3V4VL 5I1AA 4GAFB 3CCLP 3BZFB 4QMEA 3SB3A 4A2LA 4ZZFA 4JFXA 2DQHL 2YRLA 1TJXA 2BOLA 3EOAA 3CX5K 3LIZA 4PJFE 3TH2T 3MODH 3VFTA 4MJ5A 3ES6A 3JTSB 3RHWF 5T3XE 1JTOA 4TL5A 1P84E 4LF3A 3L7EA 2F1BA 3ZDZB 4F7EB 2BOCA 1L0LG 1EERB 3BO8A 4UBDC 1XIWB 2H1XA 5IFJB 4HDIB 4BZ2A 3BDXA 3CU1A 1MHCA 1NIFA 3L70D 4P2RA 1GC1C 1WWBX 1X4XA 4PI2A 2F53B 2XWCA 3IBEA 4PQXA 4JHAL 4HZAA 3X3FL 1CZQA 3NK4A 3B2XA 1ZTXH 1GZHA 3OA7A 3FU7B 3EQ2A 1KELL 2DKMA 2DV6A 3VI3E 4NYLB 3W2DH 3QIWA 5DRXB 4YJZL 2GHZA 3RVTC 4NNXA 1KYOJ 1JWSB 3IXTA 4YX2L 2H0PA 4DN4L 6PAZA 5I75B 3FUDA 4RGOH 1OTTC 1VDFA 2ZOKB 2ZXWB 1X79B 2XQ0A 4ADIA 2AP2A 4PMFA 3FQTB 3QEQB 3KE0A 1HZHL 1S7WB 3BMWA 3H1HJ 5D72H 3FQWA 2WZPA 1DH3A 1TQBB 4UINL 5D8JL 3PG2A 2P58A 2EKJA 4P9ML 3QUMB 2I25N 4P46D 4QKXB 4ZUWB 4XBEH 5G4NA 3PV6A 1BSIA 4PCYA 1DJGA 4KVPA 3QIBA 3I9IA 1NAKH 1NIEA 2Z31B 3LN5A 1UD3A 2VZTA 3MGOB 3BLBA 2UWEF 4N0UA 5GZND 4BFRA 5DMYA 1N5AA 1QYGL 1KPRB 4P2OB 2AJZB 1J1OL 4XPTH 3OF6D 1RUKL 2NYKA 1QSVA 2H88C 4Y1TA 5ESAA 3G08B 4F93B 1X0TA 3DKHA 2HODA 1CFSA 5HHOE 3V0HA 3KPSB 1KG0B 3ESVF 4NFCA 4HOXA 4M7JH 2DW5A 2CLRA 3VNYA 1M05B 3H3PH 1SBBA 2ENQA 2GEEA 2ZIDA 4ZFOL 2B1HH 3VFWB 4ODUB 4Y88A 5E70A 4Y2DA 5EU7E 3C8VA 4PEEA 5D1QC 1KWKA 1XBRA 1R9FA 4F20A 3TA4D 2BEQD 2JNZA 3ABVC 4AZUA 5KYYA 2RACA 3RZCA 1HL9A 4I6MC 1J8RA 2AKRA 5B39G 1QBLH 5ITBH 2OQJA 3SE9L 1WFIA 5AW1B 4Y4HA 4QRRA 3H1JD 2Y9ZA 1W5CE 3DO4A 3MV9D 5D7IE 5DA4A 2NW3A 1AZCA 1WICA 5JPNC 1S7UB 3WTVA 3JCUE 4OM1H 2L3BA 5F0PB 1OGTB 3REWA 4YHKH 1RJZB 1SNRA 2ATKB 2DLGA 3BATA 3CU7A 4K5OA 2WLKA 4ZS6D 4BINA 2XG4B 2WBXA 1MCDA 3UBHA 2JJLA 1T0PB 3K6IA 3BZ4B 3TWYA 3DX2A 3DYOA 2QFPA 3SDDB 4UI2A 3G3ZA 5DGRA 1SQPJ 1BZEA 3NFNB 4DP5X 1F58L 3RB5A 4KUCF 4FXGA 2P80A 3H42H 1AV1A 4E41A 1WH0A 5EORL 2DY2A 4Y5YA 3OWRA 1JD9A 2CSPA 4OJAA 2WZ0A 3SGKA 3MJ6A 4AJ0A 4UQIM 4D8PB 1G94A 1NCOA 4IOIA 1IO4A 5LAXA 5IG7B 1NTMD 2HLFD 3QAZC 3SODB 3AG2B 3F85A 5JPMA 3U7WH 4YSTA 2YK1L 5LGJB 2J8UA 3A6CL 3OKEB 1MRCL 4WI6A 3AACA 3QWOB 3EFOA 4J2XA 2OXHB 4DNLA 1QP1A 4QRPE 1PGRB 2LW3A 5KS9E 2FO1A 4KDTC 4JDTH 5JZ7D 4FAAB 2VDQB 4HLZG 3FTWA 5TK2A 3FT0A 4NEHB 4PW3A 1GHFL 2WJ7A 5ICZA 4OFPA 3QYMA 1DLHA 2ZTBA 3ATAA 4YFLI 1TVBA 3RWIA 1LO0H 3PPEA 2HT3C 5ADOL 3K72A 3QHZH 5KWYC 4IK6A 2VLMD 5E2TH 1PZQA 4JQIH 1DQIA 5FO8B 2RCSH 2XQBH 1AO7A 2XN9E 4HU2A 5D1QB 4DQOL 5AVYB 3WKNA 2BIHA 3BP7A 4XN1A 5ISZE 4KAQL 3MBWB 1QNZH 3M1OA 2GUSA 3ZHDA 4JQ0D 4HG4J 4PJ7A 3GXNA 4X8JB 5DURD 5GGTA 3BW9A 4N2BA 4JZOA 3KCPB 1PX3A 3MYJA 3PF2A 3UTPE 3GLEA 1AI1L 1JXDA 2KKQA 1B0IA 4Y19B 2WXMA 4HV8B 5J5EA 3CFUA 4NN7C 2WKOF 3HMWL 3OTTA 5KBPA 1SMAA 4PVMA 3F8UB 1L0LD 4FZEL 2QVTA 4KI5D 4P2RD 4FFZH 3M17A 1FVCB 4JFOA 2W8ZA 1JGVH 1YMMB 3KWWB 2ZT9C 1IFGA 1KZYA 1NGXA 1WPCA 3NZHL 4NS0A 4OF5A 1CR9H 1AOHA 3QUKB 5CIPH 1XH1A 2ZXDA 3Q44A 4O02B 2N1KA 3TT1L 4QRUA 1NCJA 2UWEB 3QIWD 3HPLB 3KPQB 5KVFL 2K8QA 1SOKA 3FU5A 4KXCA 4XVJH 5K9JL 1NFIB 3D09A 4FTVA 2WQWA 1A7QH 3O0LA 1SBSH 4JE4B 1ZSDA 3DBXA 3MV01 3N3EA 3BH9B 1HKLH 1O9ZA 5IHZB 1PP9J 3QAZB 4MBOA 5H35A 5JW5B 4XAWH 2ADJA 4HHAB 4PS4H 4NNYA 2IFNA 5JOPE 3O3AB 3DK2A 3ZK0A 2ZCKH 1TETH 1DANT 2XX0A 4JK0D 4UZSA 1FBIH 1F42A 2P8LB 4PP2A 1NA8A 1IILE 4JO4H 2C3HA 3EHBC 3HRZB 4U05A 1OW7A 2BP8A 4LSSH 1JE6A 3QIBD 5DMIH 1MCHA 1H0TB 1HNYA 2FLMA 5INCA 2AXFA 4JLRB 1MW3A 4U1JA 1E5AA 3CWBE 2WO2B 4QYAA 2B39A 2B2XL 3V95A 3ZR6A 2HP4A 1G7QB 1OTUC 1YYLL 3P32A 2HN7A 2YIHA 3F6LA 4UQ3A 5J3HC 1FC2D 2KQMA 2VLKE 2DW3A 4GG8A 3FZUC 3DUSB 2VDNB 1IQDB 3MLSH 1KCVL 1ECYA 2Y3NA 2C9RA 3C5JB 3B9KA 4IW4C 3QULA 1MCFA 3UYPA 4F5CA 5BRZB 4KZDL 1OSYA 2YPKA 1KSRA 4XMWA 3VB8A 2Z93A 1VQOP 1DDHB 1MCQA 2E86A 2XWTA 4KKCD 4Y2DD 3BT2L 4M6NL 1NUNB 3OKMB 1DBKH 4G9DA 2CCVA 4PJDF 4GOFA 1IC4H 3RZCD 3QNFA 4KJPC 3U0TB 1VQ9P 1ZIBA 5TQ0L 1L3NA 2VLLA 4NO0B 4DT0A 2XTJD 1KCUH 1DN0A 1SQVJ 4RWYH 4E5XG 2QELA 3OKDA 4KBPA 4OW6A 1J05A 3VH8G 5CEXB 3COOA 4D0DB 5BW7C 2IH1A 4DAGL 2Z5HA 4HB1A 2GC7C 2MJZA 3V2RA 3B56A 3V52H 1CGWA 1X9QA 2DBLL 2GB2A 3OX8A 2H2PC 4LASH 5HYJB 4LSUL 3KH3A 3PHOB 1A4KB 3LKPA 3HUJA 4X6FA 1L0ND 1TSHA 4WZ9A 3EGXB 4LIQH 4N26A 4KK9C 4MNGE 4KMLB 1FZAA 1QVOB 4HISA 1N7LA 4QRRE 4N6JA 2F5BH 1KT2B 1RCYA 4KZEL 3ISYA 1DQJB 2EDJA 1WD9A 2P80D 4KJWD 3L73J 1CF8H 1XGRA 4E41D 5CLTA 3IETA 4Q9QH 2NZIA 1A4JB 1CSBA 1CT8A 1XTGB 5FUCC 5EO0A 3P2DA 1R5WB 1L0NE 2Z8SA 3VXUD 5CCGD 3KPNA 2OR8A 5J6GA 3EHBB 5FYJU 2GBUA 2RFXA 5FO7B 2FSEB 2YRZA 3A6BL 1KYOK 1VPOH 3AWFA 5T1MB 3TOPA 1FNGB 4E41E 4ZKPA 2P26A 4JO3L 5E6UB 1VJSA 3Q8CA 1KCLA 3RDTC 2K0RA 3MBXL 4NN6C 1T2QL 4NQDB 3ULVE 3VCLB 3UO8B 5I71C 1KIQB 5KJRL 1BM3L 4LCIH 4J3BA 5FYJL 1TYJA 1KV4A 2ZVOB 1PFOA 3UO1L 5C2BL 2HT4C 5DZNA 1TU2A 4I3RL 3RL1B 4UAHA 4KQ4L 1YEJL 4OF7A 4RDQF 1P84I 3D6ZA 2CMRL 2K8MA 2YD7A 4RCAA 1D5BB 2IFGA 2KS1B 2J5UA 1UJTA 3M86A 5A6IA 1CL7L 2VGLM 1ZLWH 3QCTH 4AMXA 2JK5B 4WB4A 2ZCZA 2QPUA 4XC1L 4DUVA 2ZWNA 1KC5H 1CVSC 2K6WA 4U7SA 1AFVH 2YXFA 3QUXB 1SVCP 2CUIA 4KC3B 4O51A 4PJAF 4XOAA 2GT9B 2X6VA 5BO1H 1JDAA 4G6KH 1X7QB 5JMOC 1Z9SB 1MFVA 3WFCH 2JI3A 4WWKB 5IB1B 1AO7E 5BVZA 5GJTH 2P45B 3WY1A 2VLRB 1Q9WA 3BT0A 2YGQA 4W9CC 1RH5B 5DZLA 4IKJA 1D2OA 3IMBA 2BVTA 2AQTA 2HTKC 4NBZB 3TA3C 2VL4A 4EUPH 4PJ7E 5IMMB 4PJCF 4FHJA 1SOQA 3LKSA 3LH2L 3WO3B 5ICYB 2F2HA 1VESA 4KK6C 3CC4P 1XHHA 1JUFA 4OSUH 4NO3A 1ETZB 5CEYB 2ZWZA 2NYYD 5GGQL 3VFSB 5HYQB 3BP6B 2P4AB 4N2EA 1YVLA 3TWCL 4A6YL 4AGLA 1ZWIB 3QDJE 4PAZA 3QQ9D 1ZOYC 1GH7A 2RMNA 1QHPA 3MRQB 1CFTA 3U9UA 3SCMC 4UT9A 4XP5H 3O6MH 4FTVD 5TDNB 4H40A 3MLXH 1ACZA 3BQUA 3MJWA 1X5ZA 3S4SB 1EBPA 5C0BE 2QSVA 3EF7A 1RV6X 3LDBB 1VF5C 2C9LY 4H0LB 4DOHB 4HGWB 4GIOA 5B8CA 1BZ8A 4YXDC 1SQPK 2NXZB 3IDIA 1F3JA 2LR4A 3BVNA 2EEFA 2EABA 2NPSA 2CO7B 1NPUA 4FQ1L 5IF0A 4L3EA 2Y07H 4FTVE 4HS6B 2Y36H 4NCC2 6TAAA 4XN9A 5LCVA 4PJDB 2G5UA 1IGIH 2B14A 4P57B 3C8DA 1DSYA 4NPKA 4GKZB 3D6YA 4HS3A 4RFNC 4XWOD 5DQJB 4BZ2H 3SQBB 5EUKA 3UXFA 4FXKA 4XCFL 4PJFF 1BX2B 3GGWB 2J12B 5H2FH 4G72B 1MHEB 3TZVC 5IUSA 3L3OC 4IRJA 1BVOA 1CLZH 3B9KD 4WJ5A 4WNQB 1KJ2A 4NAMA 4J3TA 1HVVA 2C9UA 3UTZB 2C7UA 1T83C 5APVA 1GIGH 2A5UA 3IMRA 1XEDA 4G5ZL 4JFPB 5CUSH 5DJ8B 1UACL 3GI8L 1BVLA 4Z1MH 2A6JA 3MLWL 5EC2B 5E2VL 5T5NG 2XKNB 4P49A 1EDHA 3TBYB 3GUTA 3THML 3VI3F 2ESVA 1UVQB 2NNRA 4WY7H 2OYOA 1CGVA 3NQIA 2CJTA 3BAEH 1VEPA 4XGZB 1QLFB 1BECA 2N01B 2Y2YA 3BSZL 4WI7A 4HG4K 3I6SA 4KY1H 1KILB 1VFBB 1X5GA 1OY3B 2QKIC 1F90L 2W90A 3JWDL 3VQMA 3NJKA 3MBEC 1YI2P 1H3UA 1LT9C 1Q86Q 1DBBH 4JFZH 3UJJH 5D1XA 3QI9D 3VD1A 2I9LA 4RESB 4F7TB 2OR9H 1TTUA 4ZNCD 4M5TA 3GSRA 5JXEC 5LN8A 1JNNL 4XPGH 1RZJC 3UTSB 4XB8A 2BO0A 1M9SA 2E27H 2ICEC 3H9HB 4Z0BL 5F6IB 1VF5B 2HH0H 3B2PA 2SEBB 2O5NA 3PL6C 5FWRA 4N1HB 1IVLA 6PCYA 1JNLL 3GDBA 4MJIB 4RFEA 3SKNB 2OL3H 4PD4D 3G71P 1U92B 1HILA 3QJOA 4PCTA 43C9A 2CXKA 1Z9PA 2YEZA 2AXCA 2CR6A 3GJFH 4UDTA 3D9AH 1SQBJ 1OL0A 4P4RA 2BVUA 3V2NA 4RJTA 5GS0C 4E9QA 3RWEA 1Y6MR 4RFNB 4HQQL 2IGTA 1WT6A 2YFNA 1LDPH 3D87B 4JHVA 2VDOB 4PJAB 2Y5EA 4NKDA 2NRDA 2NXYC 3HFFA 4RAHA 4X98A 3RBSA 4MZ2A 1QRNA 3CMEP 4WO4C 1T0NB 1CDCA 4JANA 5HYSA 1TTAA 2VKXA 1F11A 3Q2VA 2VT0A 4OKVB 1CE1L 3V9FA 4BE5A 2Q6WB 4PJCB 4H4NA 3S5LG 5IGXL 2X4TA 5D7IF 2YKOA 4PWFA 3GIZL 4ODWB 2IPUK 2P67A 4HK0A 3VAEA 3P9MB 1JRHL 1XGPB 5IREA 5JIMA 1DFBH 2ZVNB 4NP4H 5JW3L 4NENA 1JNMA 3RL0g 2OP4H 3HE6C 4MCYB 3EFFA 1G43A 4IOIH 4AQ1A 4IBVA 3F62A 3NSDA 2LTQB 4XBGA 4JY6B 1NBYA 1VQLP 3KPMB 2DTSA 4LVNC 2O6CA 5HD8D 3O3DA 4LLMA 5CP3A 3L71J 2QKIB 5F2FA 1KB5A 3P3TA 1OP3H 1AQ8A 2Y7NA 3MBEB 1NTZE 1LT9B 1NH6A 2NY6D 3I2CL 1R5VB 3MRKB 1UKSA 2BSRB 1CGUA 1XZWA 2CUHA 3KYKH 3FONA 4O2FA 3WS3A 5K1VA 4CJ1A 4GG6E 4L8CB 4XNBA 5E6RB 5JIHA 2QR0B 5I19L 1SQVK 4TPRL 2ALAA 3NFQA 3MJGX 4HLZH 4JG9A 5ALBH 5IBTL 3UTTE 5DJXB 4GMTH 1OP4A 2R1WA 5TE4H 2HFTA 4PJFB 1J0ZA 5KS9F 2CLVB 3U2SB 3CXDH 2XVLA 3FO0H 4PP1D 3AEDC 2EXWC 3VD5A 4C7NA 3MRIB 5DDHB 2B5IC 3KHOA 2VW7A 3QHTC 3UG5A 1LP9A 3VSQA 1JNJA 4C4KO 2NPSD 5GGTH 2YUZA 2AXGB 2XZQH 5FW7A 1JGUH 3ARDA 4MNHB 1JERA 4KK8D 1E5ZA 1I8UA 1VGKB 3AJ7A 3KLQA 2UZIH 2D3NA 3LEYL 2ZOOA 4QOKA 4GRWH 5JHLA 2IDBA 3HI6L 3BFWA 3MRNA 1HEHC 3R4DA 1IUZA 3PLNA 3P8MC 2PTTB 1UXMA 4LLVA 4XOCA 1MW1A 3QZMA 3WNIA 1UYWL 4MX7A 4N8UA 4P2AA 3VI3B 1XSJA 1A6WH 4M7ZB 5D6CA 5E23A 4RMBA 5CGYD 5I66B 1U9KA 4IRJD 4L3EE 1MFCH 3WUZA 3HHMA 3RGVA 4QTHA 4L74A 2H7HA 4JQXA 3PIQA 3NAAL 4BQ8A 3GMAA 1E67A 4FNSA 2PYFA 4NXKA 2OLDA 3EZ8A 3MVSA 1WGVA 1VQ5P 3HE6B 1ZKAA 3AEAC 5C6TH 5TQ0H 1AXSB 1AGDB 3U83A 1U3YA 4PV1D 2K1MA 3S96A 4EJ1C 4H0IA 4NPJA 1I9IH 4HJUA 4CC4A 5I1CL 4G80B 3OV6A 5F8QC 1P7KA 2Y5TA 4G2AA 1MQKH 1PJ9A 2A9CA 2ESVD 2RQ8A 3PLYA 4WEBL 4ZQKA 5DMKA 2GK0B 2GSMB 3MREB 5C39A 5IB3A 2QDVA 4JRLA 1FV1A 4M3LA 1G7JA 3PWNB 5HHOB 4LB8A 1XV8A 2CDEB 2TSAA 2V7HA 4N2FA 5GGVH 3I6GA 5D1XD 4YXHH 3FOMB 4GSDL 3VU1A 1ACXA 4Y8DC 4BFIB 4PTTA 5I8OH 5F7WC 5AWNL 1TYRA 3EOBB 4MQXC 1MLCA 1EJOL 5J1AB 2XBTA 1I82A 1WWWX 5CINH 3RHWK 1UEYA 4WW1A 1KCBA 4KH2A 1S9XA 3JV6B 4P4KB 3KLAB 4IBLT 2VDML 2VUKA 4YXWH 4AUUA 1BBJA 4I2LC 2AI0L 3M91A 3VE0A 3T6VA 2N4IA 1JPSH 2E7MA 3FU9A 3VXQB 1PKQA 2YA2A 5D7IB 5AVUB 4L4TD 4FJYA 1Z6JT 1UATA 3GHGC 4JHWL 2VO5A 3Q5OA 4AMKH 1P9MA 4MYWB 3VYNA 2NUPA 2P5PA 2H26B 2V9QA 5I1KH 4YSAA 5EIIB 4KRMB 3MCYA 5D1ZA 5J1SC 3FT4B 3ARFA 1I7ZB 3MCLH 3ZMEA 1G7MA 1M7XA 1C5BL 4PSRA 2XV2A 4TLTA 1KIPA 4P23C 3W9DB 4Q9CA 5EN2B 3H3BC 2OYHA 2VAJA 1T1WB 2KLRA 3IJ7A 3IAOA 3HPJA 1YECL 1ZANH 4AGPA 2YR3A 1O9VA 3C6SA 3EJCA 1QRND 4DKEL 3L3HB 3IWVA 1GZQB 1NU1E 3MRCB 1D7BA 3DTDA 4MJ6A 2CO6B 4B6ZA 5A1AA 1KFAL 1N64L 3G5XB 3PU7A 1AZUA 4F7PA 2NTFA 3E2HB 3EFDH 4L73A 1JXGA 2BFVH 4GKSB 4HKJA 4LSQH 3T1FA 4DFHA 1JHKH 1HS6A 4HUUA 3RDJA 5BS0A 4U6HA 1S5IL 3OQ3B 2PW2B 2R1YB 3BVUA 4QRPB 1J0KA 2V9TA 1U8OA 5KS9B 4PD4H 2BCKB 4XXCA 2BDNL 1GMJA 4MDRA 5FYLL 3NQKA 3V4VA 1EX0A 1RJLA 1WAPA 2EDRA 5T3ZE 2ZXXA 1YO4A 3MFFB 3HR5B 1TO5A 2OSYA 3GIVA 4HFUH 2BVPB 4Y28J 3CFNA 4XNMB 1SYVA 3W0WE 1FGNL 3U9PH 4EVNA 2KYVA 3NCJH 4P0DA 3ZVVA 2BP0B 4Y5VC 2K3HA 5DK2A 3SZ6A 3TP4A 2AJSH 4X5WB 4I1NB 2NY2C 5F9WB 1FYTA 5B3NA 1EANA 2X4UA 3DX3A 2XN9B 4G8GA 1A7OL 1F5WA 1Z66A 2I7OA 4KPHL 3RGUA 4WV1B 1T2XA 4G3YH 5C3IA 5HVFB 5ISZB 1NMBH 4QLWA 2GJJA 2HJKB 4DHLA 1MCPH 3U1SH 1HU8A 1OAYL 2WCSA 3C75A 5DJDB 1H3VA 3LXCA 4EBQH 3OKNA 3QK0A 2Z9TA 5TF0A 1JNHA 4AY0A 4ZAKB 2ZJSE 4LMQE 1UZ8B 1JXKA 3N91A 2H6PA 1FE8H 5JW4R 3VJ6B 1T1YA 3MR9B 4QR7A 3VG9C 2ZF9A 1RQVA 3L1GA 4JFXB 3ARDD 3IN2A 5IY5B 4NQCA 1NWQA 1E8YA 4AOFA 3F5HA 3VFTB 5FS5A 3IDNB 4LF3B 2J2ZA 1M7IA 2E0PA 4M8RA 2D0HA 4K35A 4U1IB 4HZLA 2WINA 3BO8B 2AK4A 3FGAD 2X4SA 3D0VA 4NLHA 1C7SA 1E5UI 2WLNA 1SQBK 2NDFA 4L4VA 5DUMH 4A7VA 3HEIB 3VYIA 3PUCA 4FLQA 2X1PA 3LYRA 3WJJC 1J8KA 1G1KA 3KGTA 5I6PA 3LPGA 4JPQA 1KFNA 4F37F 3RGVD 2BMKA 3S5ZA 5IW1A 5HDQH 4DPCX 1YTZT 4QOKE 2JMRA 1GK4A 3B9VA 5C07E 2VL5B 1UCBH 3P0VL 5DI8A 4UT9H 3DUHA 3JVGC 4XZ4A 4JMNA 4UIMA 4IOFC 2JJUA 4GAYA 4NKIL 1L6PA 3RJQB 2I26N 1B0RA 3J8F7 3IXTB 4NNXB 4R0LC 4ODSH 2F1AA 1FNEB 4N0CD 5IK3A 5AVSB 4UTBL 2Y7QB 4WUUB 4EO5A 5DLLA 3MV7E 2AABL 4IHOB 3MUDC 1KDJA 1PIGA 5IV2B 2Q1EA 4ZFOA 1MFEL 1BIIB 2ADIA 2OTPA 1K73Q 3ZSSA 3U2JA 4J8QA 2EYRB 3ZTEA 2IYPA 4JPIA 3HG2A 5LCVH 1KC8Q 2VLKB 4G83A 4JAMA 3OXSB 5EG6C 4L1BA 2M8XA 3A7OA 4W80A 4GXUN 5FYKU 5A2JH 2COVD 5G55A 1CXEA 3OMIB 2QFRA 3SJVA 4WNJA 2F58L 4N3TA 5DHVB 3DPBB 3FN9A 4LHUA 3TBTA 3HD7A 2DQEH 3MLUL 1RFDH 1MCKA 1KJ2H 4HUXB 1XX9C 5FYKL 3VG9B 2W60A 1EXUB 4FG6D 1H6UA 3S37L 2Z8WC 1IL1A 4XBMA 1NDMA 1PY4A 3RX9A 2K9JA 1BOGB 2KS0A 1DQDL 1A14H 1N9PA 1YQVL 3O6LL 2WUCL 3L5WA 5IW3A 2EDMA 2W9EH 4NJAH 4M03A 1U8JA 2QIWA 2EO9A 5ILTL 1IGFL 5KYYB 5DJTB 1TSRA 3ARFD 4GSRA 3LKNA 3DX7B 4LSTL 1P4IH 2X38A 5K5GB 4MNGB 4R2GD 5F1OB 4B3VA 1ZXQA 4P3CL 4QRRB 4Y4HB 3NEXA 3V9CA 4AIEA 1AZNA 2NW3B 5AZEL 1SJMA 1M71B 2IANA 3CE1A 3WFEL 2GM4A 1KXVC 2BP5M 3ARZA 1CLOL 4G6AC 3REWB 2TRHA 2E43A 1F41A 5F21B 1SHXA 1JN6A 2QQLH 1LTTC 2M2DA 3EYUL 4FMVA 3CLEH 3GXUB 3G5ZB 5EOCJ 1BJMA 3PWVB 4FQ2H 2RJMA 1FZKA 3C9IA 2B0SH 2VRKA 3QIUC 4RRPG 3LW5H 2NY5L 5AUMA 4C4KT 5BS0D 5CJ8A 2YSSA 3R19A 1YEGH 4ZS7L 2WMPA 4PJXA 3MLTA 3L5JA 1IFJA 3GBDA 5BU8B 1UD8A 4FQHB 5B38B 2I07A 1BGYD 4PB9L 3QO1B 2BIIA 2BZ7A 3KYOA 2EEXA 1A65A 1K4CA 3O0RH 5LAXB 2OULB 3D8MA 4WY4D 1WAEA 4FA7B 5LVEA 1ODAA 3DDGA 3UPRA 3HTKB 3RY5A 5K93A 2C3WA 4Z5RA 1T7YA 2FZ3A 2BSTA 2WXPA 5CAYB 2N9YB 4GP5B 3C2SA 4PRHA 4OT1L 1BGYE 2ADGA 3CSPA 4PLJC 3ULUL 1YY9C 5ICZB 4NQTA 1GMEA 4K3EH 2W65A 3P9LB 2CJUH 1TVBB 1E4WL 5DWPA 5BVPL 3A67H 4YHZL 3RK2C 1MHPH 4PH8A 1AKPA 3CZFA 3K72B 1EV2E 4Q97A 5B66H 1E5YA 12E8H 1FYTE 1K6QH 2IDSA 5I15H 2YEVB 4RMUA 4E9TA 5CD5D 4LSRH 1EXGA 3L75G 1YQ2A 1AO7B 1MH5A 4G8GE 3ARRA 1HVXA 1KBPA 3RX5A 3U7YL 4NQCD 3UYRH 35C8H 2Y0DA 1XGYH 2E9JA 4PJ7B 5C71A 1YLBB 4IS6A 5B4MC 1DQTA 1KQSO 5CP3H 2OZNA 4LVHB 2I1JA 1GU4A 2AK4D 3UAJC 1Y47A 3FOLA 3QDJB 3MRHA 4L4VD 5E4AA 2BWDA 1V8HA 3QAQA 3B5NC 2DDQL 3ESPA 4I77L 1G9MH 3M17B 2VN7A 4QRQB 2WSEJ 2APBA 4YSCA 3IDXL 4JFOB 1JG9A 3QIUB 5C0BB 3ZTNL 1IC5H 4DKTA 2QDWA 5F7BA 5FGBC 2QV2A 2OMNA 5E99H 5E6IC 3P69A 2FYVA 1UHVA 5EFIB 2AQ2A 1T03H 4GQ9L 1C5CL 3ARGC 4Y1AE 4AYSA 4YXKH 3UG4A 4GG6F 2XQYG 3FXEA 1BPLB 4YDLC 1YZZA 3ZZSA 2NY4C 3SOBH 1WSST 1KEGL 4J3OC 1BVKA 1H5BA 4K9EC 5H35B 1OAZH 1SOXA 3ATFA 4DPBX 3VD2A 1IFPA 2FWOA 5GSVA 4MNQE 5DQ9A 3DETC 3SDAA 4G82A 4JNXA 3BVHA 1UA3A 2N1TC 3RK3D 3VQ1C 1CDBA 4BFKA 4JM0A 2EUZA 1N8ZB 1NCAH 2FX9H 3EYFB 2J73A 3E6HA 4LBEA 3T9WA 4PY7A 5INCB 3LQZA 2AXFB 5DJ6B 1URIA 2IAMD 3L16A 3QORC 2C7FA 3ILQC 4U1JB 2XU6A 1HESA 4WFEE 1TVDA 3SDCA 1CXKA 3TJHC 3WFDL 1NSNH 3W5MA 2WBKA 2EECA 2WB1A 3HD7D 1YDPA 5LGHH 2UY7A 5ERWA 1CXIA 1VIWA 3WSQH 1KLUA 4JFEE 4W4OA 3FAWA 2Z7ZA 4GG8B 3RE0A 2ORBH 1CBJA 3ARYA 4GDOA 2C1PA 1G7HA 1KZQA 4MCNA 5A7BA 5F0MB 2YPKB 1MN4A 3HNSL 1X9RA 3KDMA 1GY2A 5DS1A 5EF2A 3HIZA 4J3VA 5DFWH 3SJVE 1A3ZA 2FATL 4OLVH 2P5WB 1OSEA 3DVGA 2CRZA 3S36L 4G9DB 3QJFA 4OF6A 3VFGH 2YN3A 4UDUA 1A1NA 1CYWA 1G1JA 3PHSA 4OGXH 4WHCA 3IAPA 4U3FJ 15C8H 2VLLB 1MFBL 3P77A 2JELL 5GQBA 1S5HA 4UT7H 1NQBA 2C4XA 1NCHA 2MEJB 5KJ4A 3RI5F 4GW1B 3LIUA 4HAKA 2X4NA 3NIDE 3P4OB 4R8WH 1K05A 1GGBL 2IAND 2G30A 3Q9QA 3PWLA 3S8WA 2NUTA 3HS9A 1AYRA 3DTXA 3LKQB 1LJ2A 4YHML 2YNYA 3GG2A 2Z5IA 4MAUL 5E6IB 3EFGA 1G9NC 4MSWA 4ONGL 3PHQA 3ARGB 5F96L 3H1KJ 2VXVL 2KHAA 3OAZH 3B5GA 1IC1A 4N6RA 1VQNP 4ZUUA 2LLNA 5IFHL 1A6ZA 3WNKA 1T7WA 2XWDA 2XWBB 3WS6A 4YVNA 1OF2A 2BNRE 5I23A 3SKJL 4UIKH 2JSFA 5IQ9A 4I88A 3E8UL 4E9SA 2X3CA 1L9SA 1P84K 3KPNB 3HZKB 4G5AA 2HMIC 2G3MA 1R17A 1UD2A 2RFXB 3K4AA 5DVMA 5JO5A 4CRPA 1S78C 2AGJL 4BKTC 5IQMA 2DZEA 4X99B 2EINB 1QNIA 1H9VA 1J11A 4PRHD 3X1BA 3KR3H 4HJGB 2D7OA 4QO1A 4ZFGL 4YGVA 3W1ZA 2Q0ZX 2BSBA 3VXME 1QFWL 4U1SB 5IFAL 1FNLA 4OIIH 4LMQI 1FP5A 2PXYC 4PJIA 1JV5B 2DD8H 2E6QA 4PRAA 5FGSA 3WNNA 1OOWA 1CE6A 1AHKA 4JPWL 4M1GL 4P99A 3SGDI 3TNUA 2RD0A 4ZXBC 2UVEA 4GKGA 1U6AL 2EZ0D 1Y07A 3NACH 4Y9EA 1I1AC 3LS4H 2E5TA 4A6YA 4BSWB 2DQGH 3NJMA 5DWUH 1URQA 5IR1A 1JZEA 3B37A 3EO0B 3L75D 3FB5A 4CC0A 3RPBA 4YR6A 1X5YA 3PAZA 3JSVC 1X5FA 3V4VH 5A6LA 4GG6B 1EZLA 3V0WL 5LJYH 4Y4KC 3CH8A 2V9UA 3UTTB 2WLHA 4XE0A 5KVFE 3AABA 3CHPA 1NANH 3A23A 1E27A 3IKCA 5D7EA 1V3JA 4OI9A 4Q0XL 3NSJA 2X05A 3FRUA 2I5YL 4ODVL 2C26A 2ZXEB 1FFTB 1HNFA 3LKSB 4FFWD 2HX9A 3HFML 3AE3C 2YXMA 4JS7A 2MMXA 1JUFB 2XIDA 1FPTL 5B21A 5I8CA 2JH2A 1AE6L 3T8MA 1CQYA 4AYFB 3B4SA 2PUQT 4JHAH 3X3FH 2ZPKH 2OMTB 3O2VL 3QG7H 4RDBA 4XZUB 3ETBJ 3BQUB 5EBLB 4H7VA 5EA0H 2CO1A 5HDLA 5FXCH 1XCQA 2AXWA 4BCZA 1CFNA 3TO4C 2AEFA 1A6VL 5AZ2L 2EXTA 4ZUTA 1T89A 4YX2H 1GKEA 5B8CB 3IDIB 4R97C 4APQC 1SHSA 1V7NL 4GO9A 1GXEA 3JUZA 3P54A 3ABMB 3BCDA 4XMLL 4UB0H 2Y25A 2VQTA 3V4UH 4L3EB 3FXIC 3AE9C 2E74C 1BE3G 5E4OA 5LB1A 4UINH 4M4RB 4YPCA 2LT9A 3SDCD 1OVUA 1WA2X 3ARXA 4R4LA 3RZWA 3BSZA 1N6UA 1RP8A 2ZCHH 4U49A 3WN5A 4XN8A 3Q6FA 2KLSA 1CF1A 5MEQB 3VRIB 2Q3EA 3D50A 3B9EA 3MKKA 3QUYD 4EEEA 5BNXD 1I1AB 1ZVYA 4E9LA 4OFDA 3MZWB 3BAYA 1J1OH 1F3DH 5L8LB 1FAVA 3SWFA 1ZA3A 4M7LL 4WJ5B 1UWEL 3FCUB 1N0LA 1UURA 3QNYB 1RULL 1VFAA 2YWYA 1QOKA 3RWGB 2F8IA 4P2YA 1EAOA 1D9KC 3WLWC 2JKXA 4LSPL 1WT5C 2W0LA 1QASA 3TBVA 5CBEB 1E3ZA 3M06A 1B0WA 1BVLB 2X1QA 4UOJA 5CFHA 1E2WA 2A45I 4XMTA 1X9VA 5FA3B 4W93A 2EUXA 2NY1B 3VFNA 1LTJC 3PQYA 4PJ8C 5HDRA 2XHNA 3CFKB 2AXTE 1UQSA 3H2WA 1G6RB 3N44F 1S7VB 3IKKA 5J12B 3DJTA 5HJDA 2J56A 5F44A 4AJYV 4MRBA 3IFPB 2EDDA 1WISA 3O8XA 2M5AB 1U95B 1QWUA 5E8PB 4YO0A 1MDAA 5FYJD 4O4YL 4F9PC 2I9LB 3MOBH 4Q9RL 4NM4L 3HVDA 2KZIA 5CJQL 3RPIA 1XF2B 4OI7A 4X6EB 3B34A 2H6UA 3TO4B 1MCSA 1XSKA 1F45A 4QHKI 1T1XA 1VEMA 4APQB 4RFEB 4FYRA 5E8EA 3U4KA 2OMVA 2A3TA 1JY3P 1CICD 1MI5E 2GY7B 4BK4A 1NC4A 3MA9H 3TPUA 5FYJE 4KI1A 3LMJL 3MUGB 5EORH 2IZ1A 1VCBC 1XGQA 2D73A 3QXVA 3WUWA 4ZMTA 4YBQD 1SQXG 1MJJA 3W56A 2VO8A 1NTKD 4APXA 2MSPA 3DUUB 2W81C 3BKYL 2ATPB 2IOMA 1IGJA 5INDB 1I8IA 4LVOC 3JWNG 1ADWA 2NX5E 2YK1H 4B9GA 1HOEA 3WIIH 4M5SA 4OD1L 4WW2C 1MRCH 3IGUA 3E7KA 2UUDK 4QY8A 1UIIA 1KXTA 4JDVA 4X98B 3HHSA 1GVIA 4JANB 4ZX3A 5HYSB 3DX4A 2MKWA 1XF4A 1EZUA 4JKMA 4AM0Q 4PLKC 2B4CC 3SGJC 4XVUD 3TYYA 2ITAA 4TN9A 1U8HB 4G1MB 1R8EA 4D3CL 1KMIZ 4HULB 2D7QA 4WI3A 3WXWH 5AQ0A 2WQ8A 4R9HA 3VMPA 1JZIA 1XMWA 4XCCH 3T6XA 1AG6A 1ZJBA 5J0BA 4Z78B 3L72G 4NENB 3CNKA 1EDQA 2VDLL 4L0YA 4DVRL 3H1IE 1K85A 2CBMA 2KNCB 1LTJB 1AVAA 1XTLA 2AHIA 1X8YA 3EFFB 3FCTB 3WHE0 2IF7A 2JLPA 4KAQH 2HUEA 2PR4H 2FX8L 3AAZA 3M9QA 3JUYA 3LN9A 3BDBA 2IXQA 3INOA 3O3DB 1OAKL 3Q7JA 2A9DA 4LLMB 1BQKA 5I24A 3QRLA 4F9LA 3PDDA 4BH7A 4U33A 1KB5B 4BFBD 4IL6X 1AI1H 4GKOA 3N4XA 3QDHA 3GJEB 4Y16C 4XPBH 3FTXA 5F1SA 1JGIA 3B9DA 2XVGA 4PG2C 4AXWB 3P4MA 5D6DC 3FONB 4N2GA 1L9TA 3PH0A 3DX6A 2VB5A 2MCAA 3ZJAA 2ZX6A 4JDZB 2ZNWA 1TTCA 1YJDC 3WY2A 2BY0A 3R4YA 3ZQXA 3TNNA 3P73A 4H1LG 2L91A 1W72L 4WLCA 2MNUA 3TT1H 4GBXA 4D9LH 1A1MA 2V6HA 5JQHC 1UC6A 4H1LA 1T21B 1T6AA 1U8KB 2AERT 5K39B 3HS0A 4WI9A 4C7NB 3X14A 4Q6IC 4OLWL 2B59A 4YK4C 1B4TA 3KYQA 1NLBL 1PDKA 1Y8AA 4NCDA 4P9HC 3BVTA 2Q2LA 1DL7L 1P4LA 1HTLC 3E80A 4OCXH 3RTQC 2JKNA 3ZZLA 2YMKA 2QQKL 4ZNEA 2Z64C 2BOBB 3OXRA 3Q1MA 5HPMA 3V5HA 5FWQA 2LV4A 2WO3B 4J7RA 1P1ZA 4QOKB 1PL5A 3V6FA 3L36A 4ES9A 3LXUX 2X1OA 5ESVB 2H2SC 3MRNB 4LLVB 1BE3D 2GI0A 3H4FA 5C07B 3A0BE 3WD5L 5E5MB 3E38A 2FBJH 1N0XL 2HYNA 2EDYA 3HBPA 4FFYL 4Q4EA 5IQ7L 4GKLA 5GRVK 3MV7B 3N44B 3SYCA 3VFVA 3PIQB 4PRDB 1SFDA 5IHUL 3NDZE 1NOAA 4AT6A 2V2TA 3G3LA 2PYFB 2QE7H 2B1AL 3F7VA 4AUWA 4MA3A 4ETQB 4B86A 1KCVH 5CILH 2GUOA 4IU3A 2D3VA 4LLYB 4ERSL 2PF6A 2DQIH 4BKLB 4S1RH 4F2MA 1MCOH 3IJYA 3BUQA 4ZMVA 3M9HA 1IFHH 3QUZC 2Y7MA 1T7ZA 3BKCL 3BP5B 2VERN 1P7KB 1XSIA 4NPYB 3LIEA 5DMKB 2ZNXA 3GTTA 1ESOA 5IB3B 2ZOWA 1Q0XH 3SPJA 4IJ3B 2RTTA 5KVEE 3BD3A 3SKMA 2H1PL 1G7JB 5F9OL 4LCCC 1HXYA 7FABL 2R0ZL 4OIFA 2FH8A 3CXHJ 3K1KC 1YA5A 3O8XD 5HJBA 2G4EA 2CGRL 3L4TA 1LWUC 3MYZA 5D7JC 5J9PA 3O9WA 3V6BR 3PQYE 5AW7B 4PTTB 1MLBA 1MLCB 4LSUH 4AVHA 4DP8X 5L4JA 1FBMA 1AMXA 5E95B 2C4FT 3AT9A 4Q6IB 1S9XB 1YAIA 1PY0A 3X3GH 1NCCH 4YDZA 1IM9B 5F7KC 1ANUA 1BBJB 5MP6H 2P3YA 4J6IA 3V6OC 1Q94A 3KYMB 1AXTH 4KZEH 4L2LA 3CQQA 4DPRA 2ICES 4NAJA 5C1MB 1I53A 4F37K 4ALAL 3T65A 4W7YA 3VP8A 1N19A 2KI6A 2FXOA 3CFCL 3QQ3B 3N42F 3FUIA 4A7QA 5MEOB 5GISL 4ICWA 3DHUA 3T77B 3DURA 5D1ZB 2W07A 4GFXA 4G70B 4FQLL 1D6VL 1DZ0A 3A6BH 3M1BA 5L4IA 4Z77A 5HI5C 1AHWC 4Z7NE 1NEUA 1NEPA 4UMGA 3FTVA 4MAYB 5DRNB 1NMAL 2G3ZA 3O6FA 1IKFH 1U33A 2Q8BL 2DLHA 3NSYA 2G75B 3CLFL 3FL7A 3RVUD 1SN5A 1KBBA 4MJ6B 3EXLA 4JFQB 4UQAA 4BQ9A 5E08L 2G60L 3RVXD 4BDVA 1X5LA 5DS2A 1YEIH 1EHAA 3P0YL 1SQQD 3NIDF 1E79H 2NTFB 1L4AA 1PG7L 2DQJH 1P4UA 3K6FA 4OH2A 5GTHH 3T1FB 3UO1H 3L74G 5CNHA 4LBAA 5C2BH 2YIUC 4I3RH 2E6JA 4KQ4H 5ADPL 4EKJA 2IEPA 1CUOA 4PVLA 4S0HA 4BHUA 2WWKO 1QQDA 4UANA 1U8OB 3MJ7A 4UNTA 2XN1A 3UZVB 2YZ8A 4KZ0A 3L72D 1LM8V 2Y6SC 3BN9D 3EJPA 4XC1H 2AC0A 1DVQA 3GIVB 3MPCA 1IGCL 1BQ5A 2NDGA 3NCYP 1A0QH 4HBCH 3TBSB 1NPNA 1SFCD 4LCCB 32C2A 3TGUJ 1C5DA 1R0AH 4EVNB 1BGXL 3MLVH 1OP5K 1YEDB 2XJLA 1ZTMA 4V1DA 4QWWD 1LWUB 2BNUA 3DPDA 4UV4L 1O7DC 1FYTB 4FMFA 3R1GH 4U0RC 2KDYA 3R18A 4J4PC 3GXPA 1WTLA 4G8GB 5JORA 3MMEA 2EIBA 3LH2H 5I1DA 3LX9A 1NC2A 1IJ9A 1XVSA 3VGDA 5BCAA 1FE6A 1VACA 1OAUH 3KPRE 4TSAH 4EZJA 3O3EA 4YDKH 4GBXD 4OWFA 4NWTH 2WANA 2NCEA 4XTRC 3DARA 2C3XA 5C0EB 4PMEA 5D2NA 3TWCH 3OKNB 4A6YH 2W94A 5DEGA 2WYZA 1JZ8A 2DQDL 4R83A 1JMBA 4FNQA 5GRZA 1AR1C 1X44A 4ZSOE 4FGMA 5GRUL 3MACH 1T1YB 2ZG3A 2YXRB 1O6TA 4UTBA 4O9BA 1ADQH 1XCTA 3WEMA 5L0QC 3BPOC 2GYSA 5E5RB 4NNPL 1FHGA 1TPXB 4MS8D 2HRLA 3GSWB 3HNVH 4Z95L 5C3LD 1CXLA 3CCRP 4U7JA 1M7IB 4FQ1H 3LOWA 1GYCA 4J3SA 4N8VB 3V2AR 2V8MA 1AIZA 3UGXA 1GL2A 5LBVA 4Y89A 3O11B 2PCXA 1U8LA 4Y1AB 4HWBL 1XD0A 4LEBA 1FZMB 3BGMA 3QNZA 3ZW3A 4ZNEE 1N12A 2EDKA 4AKOA 4E2OA 1C08B 2BMKB 2WSFJ 2M0BA 3R0NA 5HHXH 3ISWA 2WXHA 3V6ZB 1QBML 1OB1B 3MAWA 2E76C 2CU9A 1QUNA 2YIUB 3EO9L 2WWMC 4FMKA 1WJ3A 4MNQB 1RURH 4CW1A 3DO7B 3DTUB 1O6SB 1ONQA 3FF7A 5HI4D 3UGEA 2AJ3A 3V0IA 3S34L 5ESQA 4XP9L 1F02I 4F57L 2W59A 3DV4A 4F2FA 4Z7QE 3K6SA 3FT2A 4YTPC 5BV7C 3H6AA 2WCPA 4NT6A 2OSLA 4GAJL 1F4WL 4ZFOB 1QHQA 3IN0A 2ADIB 1YNLL 1SMDA 3AG3B 1UACH 2DJSA 3H9ZA 3MRMA 4HJJH 4PLOB 2P46B 5DFAA 3MLWH 2AQSA 3DI2B 4JPIB 3TCLA 5EHFA 1RF1A 1ZLSL 3CFDA 3QT2A 1HHJA 4JFEB 4PGDB 3THMH 4U0RB 1F1GA 4RVBA 1KB9D 1PZAA 4PY8I 2J72A 4F2ME 3N42B 2QPEB 4EN3A 4Y5XA 4YIQA 5JXAL 5MERB 2KOGA 2FD6H 2A6DA 3BSZH 5FM5O 4KGJA 5DHYB 3RVWD 2VZVA 3O9WD 1TNNA 3D0AA 2YKPA 2GABA 3D85A 3SJVB 4JKLA 3WLBA 1NEZG 3PGDA 1GPOL 4LHUB 4N90E 1JCDA 1IE5A 4R90L 4DVBA 1LTBC 1J0YA 4L9LC 1FOSE 2A9BA 2D7TL 2IG2H 4OLXL 2JIXA 2O01N 1E9PA 3PWJA 1D7DA 4KO7A 1RE4A 2QGDA 2Y4SA 4L23A 4H8QA 5DS8A 3DVNB 5GSRA 4IGBA 2CJSA 5E6ZA 6FABH 1IL1B 1XCWA 1SF3A 2XTSA 1KTCA 1WTGT 3BPOB 2K9JB 3E7JA 1MV8A 3NIDB 3STLA 5GGVY 1GC1L 2R1XB 2VOTA 1JNLH 5KSBA 1CL7I 2DQTL 1EEZB 3GSXA 4HMDA 4Q89A 5FYLD 3APMA 4WU7A 2FT6A 3NCYS 1H0DA 1EZVE 1HSAB 3NCEB 1ZN5A 2FB4L 1QBBA 1LTGC 3CDFA 2FXMA 3BAKA 3VWJC 3DJRA 2NRGA 1ZMYA 2XKMA 1MPAL 2XWEA 4A2GA 5F3BA 3O6FD 2G8YA 1TTGA 2KUTA 2H32H 2E5EA 1WFTA 2ZUXA 4HQQH 3LCYA 1PQZA 4A55A 1JK8A 1IKNC 2PP8A 3QJTB 2E76B 3RFRA 3M6DA 4BZYA 3KZIE 1DP0A 5C9JA 2BNRB 3DSFH 4R7DA 1URZA 4OKDA 2H41A 3AMKA 1L4AD 4ZW5A 3QEGL 3L9RA 2OARA 4X6DA 2EE0A 3ZYOA 1CE1H 5AUMB 2DLFL 5LWYH 3D18A 4TL4A 1T2JA 5BV7B 4BGLA 1BF2A 4I7ZC 3HS8A 4UUJA 5IGXH 3TVMC 4MXQC 1VZGA 1MFDH 2OMXB 3PGFH 3LXAA 3L74D 4YSRA 3MA7A 3GIZH 1RJYB 1ZRTD 4OFIA 3MKGA 2GFBB 4X7EC 1M7LA 3MLTB 4P48A 4C58B 1IEAA 2EIJB 2VDQL 3ESNA 4JKWA 5D4QA 1T3FB 2K9FB 3GBEA 2H8PA 3KYOB 1K4CB 4OCSH 3VXMB 5JW3H 3FULA 3CSGA 5KBLA 1PLGL 1RUMH 3ZKND 3CDGB 4P59L 5GPRA 2WCGA 1NWPA 2QTVA 2XY1A 5EZLA 4Z5RB 4XHJC 2X41A 5IOPB 1OK8A 4PJBE 3SE3A 4A68A 4HKBA 1BIHA 5IEKA 5L6YL 4ZX6A 1OZHA 3JWNH 4JR9H 4N78E 1FZCA 2XXGA 5JIIA 5HVGB 1OQXA 2ADGB 4L9LB 5FF6A 1CFVL 2FY8A 3TN0A 4D0BA 2IGFL 1HTYA 2DWDA 3K2UH 4MD0A 1OVVA 4DP6X 1AAJA 1J9CT 5AVQB 2EH7L 4HF5L 4MBRA 2DQCL 1ZT1A 1QABA 2EDWA 2WXJA 1L9MA 3GZKA 2C3VA 4V1DE 4WNSA 3RWFA 4X4YB 1UGKA 5IBTH 1ETB1 1WZMA 2D4DA 2GITB 3QFJE 3CZFB 4Y2OA 4ZO7A 2FYUG 1JVKA 2XZCH 3RI5K 4UNIA 4PS8A 2IC2A 1KBGH 3K8KA 4YDJB 2DOCA 1MXDA 2G9HA 3CCVP 1MH5B 4KXAA 1DQQB 5HVHB 1R3IH 5LNDA 2FFDA 4G8FA 2H3NA 3RIFK 3R06A 3OZ9L 3AU1A 4ZTOL 4DGVH 2DJUA 3QZBA 4C47A 3HZYB 2CDFB 3T2NH 4F7CA 3GD1C 1H3PL 5KYWA 1L2PA 2EDHA 2AQPA 3BPCA 4DK5A 2DTML 2ICWA 2VKWA 4O02L 3AGVA 2Z35B 1GL2D 3FOLB 3MRHB 2NQCA 3ATEA 1PZBA 4W4NA 1U58A 1YEKL 4DGIL 4LPXA 4K2UL 4NC0B 1L7IH 3HI6H 5KUMA 1EK3A 3IMUA 3VUAA 1F6LL 2CM5A 4FYSA 8FABA 2WVVA 3C6LB 2ZYGA 1AQ5A 2XA3A 3KM1A 3G9AB 4ZK8A 4I7ZB 4WBAA 2CUMA 2AQ1A 2OI9B 2G5BA 5BZDA 1OD7A 1S7TA 4QYOA 3GT6A 1GW4A 1EHKB 1C16B 1N26A 3N41F 4LLQA 4H1LH 5KSUA 4TVPE 5FYKD 5E8OA 5CIPB 5I1EL 4RGND 2CM6A 5E8NB 3HI1A 1FFNA 1WEJL 1H5BB 3BIKB 3GSUA 5GZNC 1TKWA 1C1EL 3VW3L 5GSVB 4I48A 5MENE 3K71A 3SDAB 4OLUH 4R4BB 2FCBA 4MKTA 1LE5A 2HJFA 4F58L 4OCYL 3FFCE 3Q1SL 4WEBH 5CLWA 1Z32X 4KKRA 5JHDA 5K9OB 1AY1L 4EN3D 4MXVE 1YPZA 2X6MA 4LBEB 3MRBB 5DO2D 3FTZA 4X4MA 4BA8A 1NGMB 1RXLA 1NU1K 3LRSA 2V5YA 1KQLA 3BYTA 4D6TJ 3OC8A 1JY2N 1U8QA 3EGSA 2KC0A 3LKRB 2WLIB 3FRPA 5LUMA 1ID2A 1EAQA 3MV8B 5IKCB 1RIVH 2UY7B 5C0IA 1PV3A 4S1DC 1IE4A 1LO4L 1P7QA 2JIXD 5TGBA 2ZUVA 3TFBA 5AWNH 3EJRA 2V7QH 2BSSB 1EJOH 4IGBD 3QXAB 4H0GA 1CK0L 1G7HB 5KVGL 2ZKHL 3RY6C 1FVEB 4WTZG 1ACYL 2CIIB 2EIZB 2AFNA 1CFMA 2VDMH 4UQDA 5FA4A 4JDEA 2WNWA 4B3EA 1DJIA 3L35A 1I3VA 3P7KA 4GSUA 4WTZA 4YVUA 2OXGB 3PNRB 1RQ5A 3SQRA 4H13B 5E24E 1G2CA 4UDUB 5TE7L 3SWKA 1FJPA 3VP9A 4HA1A 4KROD 3P77B 3CSTA 1OSPL 5I9QC 4PYHA 3CG8A 3V79C 3GEWB 4BUGA 4EMZA 1U0QA 3FO1B 3TBWB 1HHGA 1A8ZA 1KB9H 5KSBE 2NUTB 1RMFH 1DBML 4ISVA 4P06A 3MGNA 4CGUB 3CFJA 2I69A 3CCHB 4KI5F 4ONOA 3ULUD 3FN3A 4NZUL 5T33L 3BWUF 1MI5B 2PO6A 3HBZA 5C0JA 1WA1X 3IGAB 2ZD0A 1MDTA 4NHUA 3CMGA 1BQRA 1TFHA 5CD3A 5C08A 1KFAH 2DKSA 1KIRA 2XJKA 4N6RB 4ZUUB 4UQ2B 4HYTB 2HRPH 3G04A 4FX5A 3HG4A 1T22B 2LXBA 1WAAA 3CAFA 1NAML 5CCJA 1OSZB 3MLRL 1OF2B 2HPTA 5JZ7C 2NX5B 3PNWB 1QGKB 3CN0A 1K04A 3H9SA 3I3DA 1S5IH 2H8PD 2AJYL 2J55A 5AVVB 4MMZA 5B1JC 2ZYAA 4NUJA 5FO9B 4H8HA 2VMDA 1D5RA 4OZFB 4M8QA 5FYLH 1RVFL 4NBXB 3DX8A 3M9BA 3NCBB 4MDIB 4ODXB 4EE2A 2E3VA 3QG6A 3UJIH 3ZUNC 1CO1A 1A9EA 2BCCD 2A77L 2DMGA 1H9DA 1QA9B 3LN4A 3WE6A 2AMGA 1U3NA 2YPLE 4NIKB 4O5LL 4YGVB 5EO1A 4BZ1H 3TN0D 3PDOB 1IAOA 3I6KA 1WBZA 3UPCA 1DVXA 4LARL 4U3FG 4AM0B 5IHBA 3K7UA 3CFBB 2J1WA 5TH2B 4Y4FA 1A7OH 3H2QA 2X3AA 1CD8A 1DDTA 1UB6A 4FQXA 4GT1A 2EDEA 2A9ML 4Z7NF 3VX1A 1YEHL 1ZV9A 2EE6A 2R0KH 4TLKA 2FYUD 5IR1B 1URQB 2J59M 3VFRB 2A1WH 3ZMNA 2KP8A 1VFUA 2O6DA 4KI5C 3FB5B 1OAXL 2K6ZA 4YR6B 4L8SB 3BWUC 5D5MA 4HPOL 4K0OA 3DBSA 3N41B 5I9QB 5AVTB 3TASA 1A02N 1PG7X 5J6HB 1IBYA 3VDCA 1N5YH 1FH2A 2FJHA 1N67A