5AW5B

Kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 2.2 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw5B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw5B02
3A3YB 3SWFA 1HWTC 3MGNA 3TK1A 3LIEA 5APTA 3M0AA 1GU5A 4LC1A 1IO4A 3V5BA 5APQA 5AVRB 1KQLA 1JNMA 3VTPC 4KHXA 5CMZA 3VMXA 3I5CA 2QM7A 3L35A 1FOSE 2E43A 5APUA 2R32A 2YNYA 3M9BA 5APYA 3VN0A 1MFZA 3WGUB 2WPSA 3NMDA 2Q7CA 2XV5A 2VRSA 3L36A 1T2KD 3MD0A 2R5DA 3A7OA 2WPQA 5APXA 3TNUA 5APSA 1A02F 1CI6B 3VYIA 1J2JB 1CI6A 4I2LC 2C9LY 4I6MC 1NWQA 3HE5A 1CSBA 5AVZB 1DH3A 2N9BA 4RETB 2P2UA 4AQRD 5AW5B 2YO2A 1OWAA 4DZOA 1SLQA 2IPPA 3VMYA 1X8YA 1GU4A 4JYCA 1GZLA 2ZXEB 2WTYA 2WPRA 3M06A 4C7NB 3HE4B 3V4WA 1FAVA 3NXSA 4M3LA 3UIAA 2WWWA 3NFQA 2WT7B 3NTNA 3L37A 2QM8A 3A5TA 3HE4A 2R5BA 3M0DA 2C9NY 3OAKA 1OXZA 3P7KA 2H7HA 2E42A 3IR9A 3KDPB 2YO3A 3VMZA 4C46A 2Z5HA 4RESB 4AYCA 1HBWA 3P32A 5AW4B 4B86A 3HE5B 5AVYB 2Q5UA 3M91A 5AW2B 1GK4A 4XE5B 2W6AA 1YYCA 5AVVB 5AW9B 2XZRA 2P7JA 1JUNA 4HYTB 2P67A 4AUWA 5APVA 4GT1A 3LIDA 5AW0B 1HJBA 3P8MC 5APWA 3M9HA 3T97A 5AVXB 2BASA 5AW1B 3TNUB 1NAFA 2ZFCA 5AW8B 2JJLA 1CZQA 3V4QA 1FOSF 1S9KD 1HUCA 2KP8A 5AVSB 1GTWA 2W27A 1G2CB 4C7NA 3KQGA 5AVUB 5AW3B 5AVTB 2R3CA 3TYYA 4JYBA 1T2KC 5AW6B 2XU6A 1MV8A 5AVWB 2WT7A 1H8AA 1GK6A 4GKGA 3B8EB 5AVQB 5AW7B 1H89A 1H88A 1A02J 3A2AA 1GD2E 3WGVB 3O8ZA 1MUUA 2Z5IA 1S9KE 2Q3IA 1SP4A 4EOTA 3HTKA
chains in the Genus database with same CATH superfamily
4Z7QE 1OCWH 1ZWIB 2F53D 4NZRL 2ZX9A 4P2RD 2X2IA 5TDPA 3R7QA 4GRWB 1XVSA 1CUOA 1ZA6B 2BNQB 3I9IA 5B1BB 3HVDA 2MQ3A 4LCWA 4GYBA 4AKPA 4U6VH 5KN5A 1WAAF 4X5QA 5I8KH 1J10A 1PF3A 1REIA 4DQOL 1UEYA 4LCIL 1DJIA 1TXKA 4GI9A 2R39A 4NZJA 4DO6A 5FYLL 5F6IB 2J88L 1P84J 4NN5B 5D7IE 5BRZA 3MRKB 4F7MB 1IRAY 2ORBL 4URTB 3QULB 1SS1A 3D4ZA 3L9BA 2FNWA 2WLNA 4B3EA 3P8CE 1UQSA 2J21A 3CQPA 1NTDA 1MLBA 1ZA3A 4PB0L 4YXKH 2OMUB 4EAEA 3IFMA 3V2PA 1HL5A 2P5WD 2H9GB 5EC1A 1QPKA 4IL6X 3GJFH 5JHLH 3CDGB 1E5BA 5D6CA 1SQXE 4U3FE 2ZSVB 4GUCA 1D2OA 3B8YA 3F7QA 1J1OH 3FQWA 1FWXA 3NCXA 4JFEB 3BSZA 1WS8A 5DURB 5GGTL 4D0BA 3LEXB 3G5VB 1M57D 5I8EB 4KJYB 2R69H 5J1AB 4X9GA 3IXTB 3I02A 1N0XL 5DDHA 2WD0A 1HZHH 4GSQA 2AV7B 2ESVA 3TPUB 2D73A 5HI3D 4B50A 5F0PB 3F58L 3WNNA 1Y8AA 4RLDA 5EUOF 5I1JL 3AXHA 2B2XL 1CLYH 2B3RA 4NUPA 3QZOA 1AD9B 4MJ2A 2WANA 4RMTA 5I1GH 4C4UA 1QLRB 2FFDA 1Z3RA 4G9FD 3VTAA 5KUKA 1DBJL 2FQFA 1DBBH 3B9KB 5IMKB 4P46D 1U8OA 4TKWA 5BVJB 2G2RA 1EANA 1MRCL 1RIUL 4PS8A 3PGFL 1OHQA 1X7TA 2P1YA 5HDWA 1HKLH 3EHBD 1IM3A 1PQZB 2KMWA 3AFLA 1JTTA 4BSWA 5PCYA 3ARGC 4UQBA 3NSCA 2OI9C 4UIKL 4LPYA 2A9MH 4TVSa 4OBSA 3E1IA 1T2QL 3FRPG 5B38B 1WTGT 1V05A 2WBKA 4B41A 4EZKA 3HBGA 3TFKC 1DUYA 4UM9A 2FJFA 2NUTB 2R9HD 4AW7A 3VP8A 3V5DA 1JE6A 4W9KC 2CPCA 4F58H 4V1DD 3T4YB 2XV0A 5IROD 5J3HD 3MUDA 2ICWB 4OFIA 3K2UH 4R4ND 2WQAA 2Q1EA 3W0WA 1K05A 3U1CA 4WZ9A 4YHPA 1DBMH 3BVNB 4N8CH 2QVFB 3ZKSD 4WU5A 1HSBB 4G5ZH 1DN2A 3VYPA 1NFIA 3AG3B 3SD5A 2VDRH 3HMXH 1RZGA 3VTMA 1YJDH 1DO5A 2GM4A 2IWEA 1YMMB 5EUKA 1T0OA 3BW9A 5HJ3A 1N2DC 3ZKXB 3K1KC 3GHEL 5F8QC 2XU9A 3HI1A 1JOCA 1AD9A 4CW1B 3AE2C 4JR9H 1M7IA 3JWOC 4F92B 3WAJA 4WWKA 5E4IA 4HCIA 4PRAA 2J4WH 2NZ9D 1ZT1A 4PB0H 1HWGB 3LXBA 1DVFD 2QGDA 2O01N 1BJ8A 4NS0A 2FLRT 2MHAB 4H13D 4JQXA 2WWKT 5F1SA 3EH4B 5JORB 2GT9A 4LKCA 4NQDE 1NAKH 4Q2ZA 3KPPA 1AKPA 4IGBB 1L7TL 4HZAA 3WNOA 4G7SB 3LPOA 1BVKA 2BFGA 2O5XH 3JTBA 3VQLA 3GSRA 1VB9A 3I3EA 4XX5A 4Z18A 4X4YA 3VDAA 3WKNA 5GSRA 4G1MB 3B2DC 1NPUA 2HR3A 5IW1A 4PLJC 1JY3N 3G6DL 4GBXD 5DLMH 4KBPA 4J3OH 3FHQA 2Z4QA 4IJTA 5GZNA 2YUWA 4ZQKB 4P99A 2H32A 3PP3K 1IFHH 4HJJH 4LSUL 4F2MA 4GQRA 4WNQB 2QHRL 5TE4L 3T6ZA 1OF0A 2P28B 5E24E 2J6EL 4NM4L 1M71A 4KK5C 5T3XH 5CLWA 1S9VB 1PCSA 5CBAB 3U0PA 1OZHA 2YKKA 1UADC 3LH9A 2K3RA 3QPXH 2E76D 4NZDA 4DPBX 2WCPA 4DUVA 4KI5D 2BS9A 5EORH 5IFJA 4POUB 3ZE0E 1CD0A 3GW6A 1CZ8H 3MXVL 4M3HA 1M7LA 3VD0A 3I74A 2CBPA 4GP4B 3T4AC 1KYOD 3KLAA 4NNPL 4HS3B 2WO3B 3MRBA 3BVVA 4HVBA 5IMKA 3KWWA 4YH6A 3OKNA 3VO0A 1RF0C 2AKRB 5ADPL 1QUNA 4QTIH 4JZJA 1Z5HA 4O58H 3WIIH 2VUKA 3K6NA 3BAWA 4NO5B 4NC1C 5F1IB 2H3XC 4MMZC 4Q7DA 4X2UA 1EERB 2BASA 1JXKA 3FFCD 3SBPA 1W0YT 5KOVC 1CLZL 3QQXA 4Y4KD 4DKFH 4WBAA 2CHZA 3IXTA 1Y7VA 3D39E 2WYTA 4PJBE 3VMNA 1L6ZA 3GLDA 5C1MB 3D69A 4DP0X 3QGVA 1KN2H 4TLFA 1N7SC 4Y5YC 3P0VH 1NJ9A 1K8AQ 1EV2E 4YHLH 4QNPE 4UT7L 4PJGE 3TBYB 1ZVYA 5FYJL 3EOBA 1T22B 2OR8A 2YXMA 4IOSD 4UQ2B 3MLPA 4YZFF 5DGRA 4BSVB 1F4XL 3E1F1 3IFNL 4KVNH 3UGXA 3SEPA 4K8RC 3ZMRA 3FT9A 5GTIE 3LHPH 1T1WA 4AMKH 3V9CA 3DX0A 1F86A 4LGPB 5I6LA 3AEFC 4PGBA 4PW9A 5FB8A 3MV01 1QYGL 3OZ9H 3UJIL 2CUMA 5FGRA 2DWYA 3BATA 2EE6A 3R7RA 5IQ9B 3O6LL 2Q87A 1RF0A 2MSPA 4M5YH 5BOZG 3GXMA 4BA8A 3IGKA 4L9LC 2OSXA 2O5XL 1HI6A 5C7XH 4PJBF 4KK9C 3BUIA 1QW9A 5GRUL 2W91A 3H2QA 2K7PA 4I9WD 4LPCA 3TF4A 2APSA 4AL8C 1WUZA 3O4OB 3TN0C 1MHHB 2CJTA 3IDXL 2AGJH 4UM8B 4ALAC 1J18A 3O2WL 3T1WA 4LEBA 3WUWG 4OLWH 4E5XB 4WNQA 5FUOH 5F9OH 3MREB 2VR9A 4CJ1A 3NA9H 5GGRA 3TYGL 3MUY1 4LSUH 2NPSC 3SODB 4MTMA 1T7YA 4FFZL 3ABLB 5I6NA 3CZJA 3S4SG 4WO4A 4F9PA 3WMM0 3L95B 2R8SL 1IL1B 4PM1A 1ML0A 1FZCC 5CGMA 1M90Q 1CBVL 4OLVH 1T0PB 4R26H 3C8KA 4QYAA 5F96H 1EZVX 4NM8L 2JE8A 4YNYA 2W8ZA 1UACL 3QPXL 3TJHC 1D5XA 2BHFA 2HFFB 1A9BB 3II2A 1ZLUK 2IDUA 2NQCA 4Z7NE 1R34A 2YHGA 1XWVA 1BSIA 3FFOA 4M03A 4PLNC 4G6ML 4ABQA 1E8WA 3EXJA 1BGYE 2W60B 4G82A 3ESOA 5DUML 5E8NB 3O3DB 3D25B 2ZYRA 4L1SA 4AQ1A 5KBDA 4KZ0A 3O4OC 2NY0D 1ETB1 1TTFA 1N2RB 2ADGB 4H5SB 1A7NL 2VLKD 3KG5A 3P40A 2FWOB 5F7YC 4ZX6A 2E8ZA 2MJZA 2R2EA 3A6CH 3FYIB 3FUHA 2EIBA 3B3IB 3PAUA 4Y16D 1VJSA 4LHQB 4TNFA 3TEXA 5L88H 3LIDA 1ZP0C 5F7FA 1J11A 3LQZB 3TV3H 1A64A 4YDVB 1M53A 6TAAA 1KN2L 1OPGL 1QZNA 2EEDA 3LCYA 3M45A 1KB9D 2H4EA 4W7YA 1RKRA 3P0VL 2EJ1A 5IMOA 5E56A 5C97A 1PGOA 3WXVL 1JHKL 4LVOB 1MW1A 3TZVC 4AGLA 4JO2H 1FNEA 1TZIA 2X6BA 1XXDC 43C9B 1KPRA 4F9LC 3CCVP 2MPAL 3JWNE 4HCGA 3V5HB 2FYZA 4AIEA 3CU7A 2WBJC 5GGVL 3EGDB 5DRXB 4KVNL 4HISA 3PAYA 4PYGA 5G5DA 3HPJB 4NWTH 2X2UA 5I15L 3LHPL 1GYAA 1A7PH 2B0SL 1FG9C 1YBKA 1G7QA 3GMMB 4WHDA 4R4MA 3RPIB 3U36A 8FABA 1MNNA 1K9TA 3NRPA 4B7IA 2A2QT 5IM7B 1PD6A 3HPLB 4IRSA 3RFZB 3ZZQA 3QORD 4NENB 4KKNA 5H94A 1DLFL 4JO8A 4MCNA 1SXAA 4M5YL 1LTTC 2AEFA 3MV8A 5ANMB 1EZLA 2ZX5A 3LRSB 1ILUA 1KB5H 3SYOA 3AB0B 1PY0A 4P2QD 3IVKB 3GYRA 2GUVA 1IQWH 3WUVA 2BVTA 1EHKB 2MIZA 2WCGA 2Y07H 3ZRFC 4DCKA 1JTPA 1IM3B 2DWTA 1BJMA 4YDIH 2YGOA 4QKXB 3AQYA 3G04A 4NN7B 2XBDA 4OY9A 4HKBA 3MCLL 4DZ8B 5HHOE 4PBDA 3SDDC 4RCAA 4XMXA 4OLWL 5E5LA 2AEPL 2A9NL 2D7QA 3GZOA 3WOVA 4OQTL 4YBQC 4NRZA 2F2HA 1QNZL 3MACL 4ZW6A 2DTMH 3V79C 1RJYA 4JFTA 5J57B 3H9SD 3VTTA 3CHOA 1NMBL 1JFQL 4XXDA 2EDKA 3CIAA 4AQ1C 3A6OA 3TU6A 2ZT9C 3IKCB 4A7UA 2Q0ZX 1UJ3B 2WLKA 3PWUA 5AL8A 4JEGB 1UB6B 3B2MA 3CZSA 3N50A 3MRLB 3M1CA 1U2YA 1NLBH 3KLKA 4MB1A 5FM8A 4C8XA 1PU0A 5FDWA 2OSLB 1JF6A 3AB0C 3PAZA 2WWMC 2DQTH 4PD4E 4D6TD 5DUMH 3HC2A 3MLTA 3CFJA 3H1KD 3QNYA 5BS0D 1FNGB 1NEZA 3FN3A 2FJHA 1MLBB 3M0DA 1G7MB 3CN2A 1BG9A 4PRPD 1OXZA 2R4RL 4Y9FA 2OSLA 2QELA 3SDDB 3T04D 3ES6A 4GEJA 1BWWA 4IKIA 3LRKA 4Z0BH 4Q9RL 2KH2B 3NPZB 1KJ2H 4O9HL 3HVNA 2VLRD 4MDRA 4NQXA 3WS3A 3WDHA 1TF4A 1BGYD 3W9EA 1RH8A 4LL4A 5DFVD 3WY2A 3N0AA 1Z32X 5I76B 1URQD 1HH6A 1P4LA 4WCYL 1ID5I 1JGIA 3MRMB 2VM3A 2LAGB 4POZD 2BRQA 3KE0A 5GJSL 4DGIL 1W0VB 3S88H 5BMFL 4OM1L 3KHOA 1SXZA 2E7CA 3AEDC 1T5KA 4FLRA 4Y2DA 5HYFA 1AOZA 1J8RA 3D34A 3G04B 1RZKL 5KSUA 3DUSB 1V55B 3LPGA 4PJGF 5FV2A 4PJDE 3BRTB 2ZNWA 1HE7A 2ZFCA 3WHE0 4OV6F 4TYUA 3PIQB 4R4NC 3FCSA 4UB6H 1EX0A 5EOTA 4GG6E 3RGVC 2R0WH 1IFDA 4ANUA 2F8OA 1FFRA 1VQPP 4LMQE 4ZPTB 5KJ7E 3KDMA 4GKOA 1FZEA 2IFMA 4I48B 4BUGA 3ARXA 4B9JA 2P8PA 1VADA 2QGEA 4RRPA 5CSBA 1TCRB 5AEAA 3MBXH 5C0NC 1IC2A 2QQLL 1F4WH 1FSKB 1NEPA 1Q0YL 3E7JA 1W6WA 3GMMA 2KPNA 1A5FL 1M1XB 4U1IA 2HTLD 1R24A 5B1JA 4UM8A 2OTUB 1W72L 3FMGH 4DQAA 4TOYL 3B5ND 3BAEH 2DWEB 1JPGA 1DSFH 2F5BH 4MSWA 4DAGH 5DCCA 2M3EA 1HI6B 3GXIA 3F62A 1EDQA 2WK2A 3RDTD 2V5TA 3GNML 2G75A 5IV2A 4H13C 2WVTA 3O6FD 3GIZH 1WT6A 1E9OA 4GODA 4YDKH 3ULVE 1NMBH 1KELH 2LLLA 3C5JA 5GHWL 2PGDA 4IRZH 3RBSA 3GMOB 3M6DA 4RJTA 4ZFZA 4ENEC 5JXAL 2XZAH 4Z3FA 3FO1A 5JYMA 1J1PH 2VXSH 2DQHH 1RERA 2M0BA 3MFGB 4J3OF 3FU7B 5HGAA 3A47A 5JNYB 4ZUTB 5J56B 1GTNA 4Q89A 5CEZD 2XVKA 4GAGL 5JXEC 2X70A 4YBQD 4ZMZA 2QGBA 2CGRL 4PJ8B 3BPCB 4RMUA 2ZKMX 3TO4B 1I1AD 1ZS8A 3LZRA 1XR9B 1SGKA 1KWGA 4F8TA 1A21A 1JTHB 2W60A 4MJIB 3VMYA 1JFHA 5F7EH 5FWQA 4K7FA 2JWAA 3K2IA 1LT9C 2WTYA 5T1MB 1G1OA 3BISA 4ANXA 1ZSDB 3J27A 4FQCH 4O9HH 1JY3P 1C5CH 2YS4A 1ZN5A 4TVPD 4A7SA 1CDUA 5E7BA 4UB6E 3UBXA 2CA4A 1A47A 3P3SA 2V9QA 3F84A 1IO4C 4I48A 1R5IA 2VDKB 3UZVA 4EI0A 3A0BE 4KHXH 5HDQH 4AYFB 2Y1VA 5BPPA 4OCSH 3UBXG 4UQAA 4RESB 3OKLB 3I84A 3QH3B 4RAUA 3IDGB 3LAFA 1ZLSH 3HN8A 3S88L 3H32B 2XVLA 4BSJA 5DQDH 1ERNA 2DEWX 1I1FA 3C12A 5AOIA 3ZT5A 3G7TA 1DBKL 3RWIB 1ZVHA 1JUNA 3AE8C 3ECVA 4NLAA 2PYEA 4FCHA 2KZKA 5CBNA 4P3WA 2GTWA 3BD5A 1ACXA 5EU6D 3EDFA 2WVRA 3AS1A 3L1FA 4OTXL 3N43F 2WVUA 5FLUA 5E08L 1QA9A 3EDJA 5MEPB 4ZUWB 2BS8A 4P9MH 5CIPB 3H1HE 3MGOB 1OW0C 4PWIA 1F4WL 1Q0YH 2F7QA 5FF6A 1XBRA 4JY5H 4AJYV 3RY6C 3UJTL 2E86A 4K3JL 4ELMB 4UOZA 4G6AD 4GLRI 1W72H 3DJ9A 3N1PC 4D2NA 1GW6A 2VM9A 1XF3A 3AS0A 3I3DA 1RXLA 5C0DA 3ENEA 1EPFA 4HJGB 4HHGA 2YKQA 4EYYQ 12E8H 5KSBA 3L75G 1FYTD 4F8NA 1YEIH 4PJCB 5B8CB 2DMHA 3SE9L 4LDLB 4EN3C 1D5RA 5EO0B 4AVIA 3JV5A 1QBMH 1O9ZA 4EOTA 3UXFA 2O1KA 1PJ9A 4FYQA 5KSAB 3V6OA 2YXRB 2NZ2A 1KCUL 2QJPC 1M1XA 3UG3A 4HHAA 4GG8B 4GRLC 1IAOB 3H6PA 3Q3GA 3V4PA 1ZTMA 1FH5H 5SWZD 1NGMB 4F5CE 1TTGA 2FTAA 2H89C 2OYOA 1G7LB 1YECH 2RFXA 2YPLE 5CCGE 4HWBL 1T89C 2EDWA 2PWFA 3Q5SA 2NY4B 3HMXA 3QHFL 4MJ6A 1GJIA 1BM3L 1DDHA 1A22B 1EAJA 4U49A 4U6YA 2WPSA 1H0TB 2QZQA 2HKHH 3E6HA 3DXAB 4QT5B 5EEXA 4JHUA 1EZSA 2PTTB 1UB5A 1C16A 1KCWA 1OARL 4KJPC 1OW0A 3NESA 3EFFB 5DMGC 1QTPA 2NYKA 4NO3B 1IKFL 2VISA 4WUKH 2C4FT 1S9KC 3AEGC 4RETB 3S36X 5A6LA 5CCHE 1VRSA 1CTNA 1Q1JL 1FIGL 3GBNL 5DUPL 1M71B 3TNMA 5DWUH 2ENPA 3OQ3B 2J6WA 2ZX7A 4OZIA 1M1JC 3KXFE 4L74A 2VNCA 1RU9L 5C39A 4M5ZH 6PAZA 2E0PA 2ZUWA 3HRPA 4XNXL 1NGQH 5DMJB 1GL4B 1BX2A 1S7XA 1ZLSL 4WK4B 2ED6A 2R59A 1MAJA 3FN9A 1AXSB 1RK1A 4MA1B 2R9HC 4TTDD 3UC2A 2WMPA 5E1GA 3VMZA 1FDIA 3TGUJ 5M7QA 1MCJA 1LD9A 3ARFC 4L4VE 2EUXA 3BH9A 4HS8L 5E4EB 2HA1A 5IEKB 2WQYC 3BKMH 3KPPB 4FQXD 5D7LE 1BD2E 5KVDL 1GW3A 2HODB 3WU2E 1J87A 2Z7ZA 1ZT7A 2IDTA 3CFMA 4NKDA 4PH8A 4GG6F 1WFIA 4MAUL 4OFYA 2NW3A 3BKJH 3RIKA 1DDHB 4LZKA 2W80C 5LDSA 3AE3C 4FQ2L 1K5NB 3UJTH 2VRKA 4F93B 2HTKD 2DLHA 4MX7A 3V6OC 4WI5A 4A2LA 4FC3E 4RH4A 1IC4L 5J8OA 1HTYA 1JV5A 5IVZA 1FJKA 1NDGA 5JW5B 3AVEA 3GXPA 4UMSA 1I3GH 2ZKHH 1X5GA 2ICWJ 1NC4D 1LO4H 1A1OA 1YY8A 2XBZA 3LEXA 2QEJA 4PJIB 5DT1L 3D18A 1W72A 4I5BA 2K70A 1SQXG 1WHOA 1GY1A 3PCYA 1VCBC 1XGRA 2QL1A 3UEQA 1LNUB 1BYPA 3KHUA 2EIZB 2RCSH 4GUPB 2JI3A 1W5CE 1T1XA 1CVRA 2ZX6A 3HZ3A 1R3IL 1YECL 5E4OA 2NY1D 3QXAA 1KBGH 1HYRC 1DYZA 3IM1A 3TYFB 4JBZA 1G1YA 3L74D 4P2OA 3UYOD 1JWSA 4BK5A 1XD1A 3L71D 3RVVD 4GS7C 2X3CA 4LF3B 4H44D 4F7CB 2BP5M 2ZSWB 2Y7LA 3FRPB 4JFYB 2KI6A 1MCRA 1QA9B 5FA4B 3U36B 5B38G 3G9VA 4N8VB 1NKNA 5MEPA 1BFOA 1JYVA 4UU9A 2XWXA 1SYVA 4APXB 4MA3B 2P1JA 1IC7L 4PV8A 3L4XA 3QUXB 5TDPB 5HYJE 1JPTH 4G7VH 1RFDL 1PQZA 4BSWB 4H20L 3B37A 2QVIA 4HA1A 1A25A 2Q5BA 5T5NF 3B5TA 4O51A 1IM9A 4BGDA 3N5AA 4F37F 1GGBH 2PCYA 1IGCL 3FQYA 4X8GA 3H7LA 4UTAL 1R5SA 1QLRA 4HUMB 5I16A 5E99H 3GFUA 3GMPA 2YGPA 1F2QA 1ZANH 3DO7B 4H8UA 2PWGA 5I0WA 4AH2A 2O61A 1CMOA 5L0QC 1G7HB 4MMZB 1AQKH 1M6UA 3C60D 3CJJA 2GEEA 2AJZB 3VQ1C 1R3KA 4HPYH 1T66D 1FL6A 3IPEA 5D1ZA 5I71B 1FZOB 2WN3A 2N3JA 5I18H 1SQVJ 4LO9A 3DETC 4UDUA 2VDMB 4XN7A 1WS7A 4MNGA 4UTCA 4I0CC 1OCCB 4NQSB 3L2LA 4XI5D 1A7RL 3BKJL 3HE5B 1A6VL 3CWBJ 3ZW3A 4JB9L 4HIEB 4FQ2H 4KK8C 3RY4A 1SDDA 2CPSA 2VXUL 4P23C 1RZFH 5D4IA 4L4VD 4JM0A 2G30A 1NDTA 5KVFE 4JZJB 3L95A 5BZDA 4WO4B 5L4JA 3ELAT 2YRZA 4KKCC 3LKRA 3TZVB 4LAQH 4P2QA 4Y4HC 1JCDA 4ZS7L 3GSNB 1EVUA 5F70A 3KLAB 3PABB 3RY5A 2Q6WB 4LCWB 4YDLC 4Z0XA 3U9PH 3AY4A 2OJZH 4LOVA 3GD1C 4BK5C 2ZXBA 5H35B 4IJ3B 4B9PA 1RZ8A 2EADA 2R69A 2RCSL 1BZ7B 2YK1L 4KK9D 5MERA 5IB2B 1KCLA 2WXRA 4TPRL 4X0KA 2XG5A 1L4AC 4X4ZA 3OZKA 1KBGL 4JDVB 4M8RA 3O3UN 1JERA 4KHTH 4DP1X 4PG2C 2BOCB 3N2JA 2Z4QB 1DQLL 4AUUA 4UB0H 3VWJC 2A9DA 1TQBB 1GGCL 1MWAL 2A45G 5C6TL 5AOLA 4HEPA 3K8KA 3QUMA 1MVFA 5BO1H 2ITDA 2PW2A 1JYWA 5JA9A 3FH8A 4LOFA 1K4DA 1JF5A 1AIZA 5JO5B 3L70J 1K73Q 3X3GH 1H8OA 2IQ9H 3EFDH 4PRNA 4PWJA 3RWEB 5CLZA 2WBWB 3IK2A 3VTPC 1KG0B 4XN9A 4F15C 2ED9A 1X5AA 1QOKA 2CO4A 3OKKB 4X9BA 1KGWA 1NBQA 5K5GB 4WJG3 3RL2A 5EZLB 1FN4A 1GGBL 4UTAH 1EBPA 4MBOA 1RULH 4RGNC 1NINA 2UZXB 2KHAA 3MV7E 3WYRA 2ZAGA 3C09B 4KMTH 4LLQB 2NY6C 4PN6A 4HFUL 4WWKB 4GI6A 1MCWW 5HDLA 2MFNA 2XTJB 3IU4L 3HI1B 2YUVA 2ZYAA 2R7EA 4JN1L 4U7KA 5KVFH 3INUH 4JFHD 1S6NA 1U9KA 3OWRA 2VW4A 4JG9A 4DZOA 5GJTH 2V5RA 2VC2B 4PJBA 4LSDA 2G0KA 5TFSH 5EWIH 3O6QB 1RUQL 3QPQD 3X11A 1J1XH 4R26L 5ESQB 1G7MA 2JKVA 4JFFE 3DTDA 4M5TA 3OR7A 5CEXA 4LEOB 5E6ID 4HXAL 3WN6A 4OCLC 1C7TA 1E65A 2C4FU 4M5SA 1FLRL 4I2XB 3UAJA 3WFHA 1I9RH 1ZGLM 3O45B 5E6SB 4DO5A 4IIQB 1NGZA 3U82B 4PJAE 4LT7A 3U83A 4GKNB 2IF7A 1J8HB 4PSPA 3V5DB 2UWEB 3IJHA 3D3VA 4MHHG 5GGQH 2VITA 4B86A 1ZR2A 4ETYA 4HBCL 3EZJB 4NT6B 1J0KA 1XH3A 5L9DH 4XMZA 3O3EA 3SYQA 5IB4A 2K8MA 5IW1B 4ZX5A 4R8WL 3NUKA 3UAFA 4C47A 3S5LB 1B3JA 4QHUA 4KK8D 4YSOA 5I30H 3U7YH 1A6AB 1JNLL 4AYGA 4N0UA 1XGRB 5F1NA 1TQTA 4YSEA 4U1SA 4XRCB 3TGUG 2R2BA 4LP8A 5LDUA 3FFCB 3TOPA 3TNUB 1A1OB 2Z31C 5BRQA 5IR1A 4WB4A 3F7YB 3HFMH 1BBJA 1A3LL 1IEHA 4JDTL 3OAZK 1MJ8H 4H88H 5LXGH 2XICA 2OMVB 4OIFA 1T80A 5AYTA 1XGTA 4NPYA 2IOIA 2ITAA 4CJ0A 1JXFA 1SBSL 4FQ1L 5T1LD 3L3KA 5H2BA 1PKOA 2GG1A 2ZP9A 2E4TA 3GS0A 3LEVL 2XI9A 35C8L 5FDYA 2K88A 5IJBC 5EUKB 3FQTB 2GJZB 3BWAA 2WC7A 2NDGA 1TU2A 4LQ1A 5MHSE 1FFQA 4DVRL 3REVB 5IGXL 1HXYB 3P9MA 5JOFB 4DETA 4X4ME 5K9JL 2EH7L 2H7WA 4DPAX 1EAPA 3MRIA 3PWVA 1F6LL 2CDFA 2GEQA 5T1DH 1OAQL 4KNUA 4PJEE 4CU7A 3B9EA 1CGSL 2I85A 3Q6FA 4MMXC 3EUUA 4XH2A 3H1IG 3QJFB 3FKUS 1CDYA 2NXZB 2XWJA 3MLXH 4HJTA 4OLXL 3RIFK 1HE8A 5I0VA 2X0WA 4PJ7A 4JQIA 1VF5D 2YD4A 1RUKL 2AXHA 1QATA 4CAGA 3VFOB 2IPTH 4AC4A 1PG7W 4HK3J 4JM4L 1UZGA 2FJGA 1ZV5A 1RZJC 2H0JA 3DURB 3B6SA 4LHJB 3BGFB 1GZLA 2JVUA 4NO3A 2FEEI 2QKIB 5C7ZA 2J8OA 2WOBA 3SQRA 2EDFA 3QEGL 4HUKB 1BZOA 1T21B 2FX8L 2OMNA 4UOW0 5TPWL 1CL7I 3PGDB 2DQFB 1VPOL 2YSSA 3QZMA 1OP5H 1L7IH 4YHKL 4QO1B 1OD9A 4WI0A 3SQOL 5ADOL 2H7HA 5I8KL 3VWJD 1P5VB 4TSBH 2AJUH 3S3BB 4MKTA 4XTRC 1IILE 4G6JL 4IL6H 3NJMA 3HMWH 4OD3H 3ROOB 4PD4I 3AE6C 1UCTA 2ESVB 2DWSA 4LSTH 1F11B 2IBZI 2B77A 3EBIA 1Q94A 2WSCJ 1BYNA 2J5LB 1F02I 1WFNA 1XF2A 2CK3H 3IPFA 3D1MC 4YS4A 3H2PA 1CIUA 3V2AR 2E5EA 3TFBA 5B8CA 1ZW0A 4XCCL 1OV8A 3II1A 4FP8H 1YG9A 3ZTJH 3C6EA 1XF3B 3VDBA 3TBSA 3D2TA 5FEBA 4RQQA 3T97A 3CFBA 2Y9RT 3QR2A 2FSDA 4JPWL 3PJSB 1YNTF 5B7FA 4IBUA 1DJYA 3CMGA 4U6XB 5B1KA 1IZKA 4QRSB 4QWWD 2W27A 1EGJL 1MWAA 2Q8BL 4K5PA 3GKWH 5M95B 3B3BA 2J57A 3V0JA 1HL4A 3GXDA 1AKJD 4MCYB 3U48A 2GPZA 1TTAA 5CJQL 4D0DA 1XAUA 1LTSC 2POHA 1MY5A 4NBXB 4ZTEA 4A7GA 4JANB 1P4BH 5DEFA 4L0ZA 3DXAE 1F8TH 4H44C 1K6QH 2XKMA 3Q8FA 4MD4B 3RY6A 5JPMA 1C5DA 3O8XA 4AEHH 2VMFA 3B2XA 3EJYD 5DA0B 2YN5A 2DL9A 5ILTL 1A1MB 2F58H 2OBGA 1SQQE 2YEQA 3MFFA 1IM3D 1IGYA 1UXWA 3PV6B 1QSFA 1ZTXL 3VXRD 4F7KA 4UBDD 2I9LB 1TJHH 2Y0DA 3RL0g 4WWNA 5F7NC 3IGFA 1GHFH 3H3KA 3KYNA 4G9FA 2ZNXA 3X1GA 4ABUA 4TLTA 5BUPA 5CF3A 3HD7C 1U8QA 4P2QE 4GRLA 1IAMA 2X4QB 2YPKA 3SE3C 3VFUA 3N41F 2UVFA 1AMXA 4EJ1C 2XZZA 3NK4A 2IFFL 3PAVA 3L70G 1KIRB 4HMCA 1OM3L 2N9BA 1JD9A 4LE8A 1LEKA 2H32H 5C0CE 2K3TA 1PJWA 4G7YL 4HZ1A 4KJQD 1YZZA 5GRZA 1WGVA 1CF1A 5ADOH 1SQPE 2J6EA 2X70B 4TSBL 2C9VA 3WBDA 3D4GA 1E6JL 2PABA 4G8IB 1A1NB 5IHUH 3U2SA 4JR9L 1JXDA 3WLBB 1WISA 2VDNL 3EOAA 1OAXH 3M7OA 3MXWL 3MCKA 3DI2B 4GIPD 3MRDA 1AQ5A 4IKLA 4OU3A 3ULVH 3LKOA 2XNDH 2CXKA 4WKZB 4XNUL 3TCXA 2B4CC 2KZWA 3D7PA 4YSUA 2MCMA 5EDSA 5L2JB 4J3OC 3SDAD 5IK3A 5DJAA 4DW2L 4JZOA 4PWFA 2JWYA 1I8AA 5ANME 1IEAA 3N0PB 4I85A 1XSJA 4NJAH 5F2FA 1DANT 1BPLB 3G3ZA 1QKZH 4XOCA 4LSRL 1QMUA 3HD7A 5IBUG 4Z9KB 4OWFA 5KEZA 3HAEH 1ZIBA 3BXNA 5ID0B 2VN7A 2G3ZA 4YLQT 2UVEA 4RDQF 2QJPB 4P23D 3SHSA 2EDRA 4ZOBA 2G60H 3O2DA 5F89A 1CDBA 5C0BE 1P4UA 1S5HA 2DMGA 3W67A 1XR8B 3SKOB 3ROLA 1QUPA 4RNRA 4LLHA 3QDGA 5I19H 2YXVA 3NIGF 5IF0B 5IEHB 1PW3A 4ZO8A 4HD5A 3SJVA 5ESAA 5HYSB 1AGEB 1EJOL 3LZFH 1EQWA 5FECA 1OQXA 5LG1A 4K94L 1WF5A 2DWDB 4WHTB 1F8TL 1K6QL 1M2OA 2R1YB 3TH4T 4O00A 4JRXB 3SPIA 1X22A 3FO2B 2NNXA 2XJKA 4HV8B 5HVHB 2G0LA 4ZYKB 1VKXA 2DI8A 1I8MB 4HU2A 2AMUA 1V7ML 1Q9WB 4B9CA 1OAZH 4M6OL 1UKTA 1XCQA 1CD1A 1S7WA 4JM2C 4AENA 3B5NB 2C3VB 3JYCA 3Q8BA 5CD5C 1ODAA 4EXKA 2R1WA 4K07A 4L3EB 3RX7A 1MVUB 2IH8A 2EDDA 3LN5B 2BY1A 1OTSC 1DUYB 1RHHB 5K69A 1FL3A 3MOBH 4FMKA 1AJ7L 5KYXB 1G7PA 2BEZF 4ZMDA 1L3NA 1U8MA 3JV4A 4NNXB 3DK0A 3ES6B 4S1DD 2HX8A 1ET7A 2BIPA 2TSBA 3NFSL 1JGDA 3ZGHA 2Z34A 3IRZA 5FFLA 3VN0A 1NCCH 3BZDA 2G8YA 5IHZA 1XGUA 4A2GA 1JDCA 1OGAA 1GTFA 1FVDA 1OT2A 3CZKA 4GQ9H 4KC3B 5IVXF 5CBOA 5HPMB 1WV7T 2XCMC 2ZXWB 3PWLB 2AK4B 4WJ5B 2PO6C 2UZIL 3V4UH 3HUJF 4NUGH 5KKZC 1NCAL 4C56A 2V2WB 1I1AB 5H2BB 2WQXA 1KQSO 4M6MH 3VMOA 5EU6A 2E74C 4UQ9A 1CXIA 4QXWA 4ASWA 1B0GA 3D05A 4RWYH 2XNAB 3P9LA 4DOHB 1L9OA 4Y5YB 3DKHA 2YAMA 1ZHKA 3EDKA 3OB8A 3P4NA 2QVAA 2H6OA 1MQ8A 1MFDL 2WCSA 4M8QB 4Z7WA 4DF9A 3D6YA 3NFQA 2DJSA 2NLJB 1IAIM 3BVWA 3QJRB 3HZKA 4L8SA 2K9FB 4CC0A 1T89A 1FAIL 1CXKA 5CHXA 4DZ8A 3MYJA 4NJAL 3QHZL 4HUCA 1QSEE 5EOCL 2CRIA 5I1EH 1SQQK 3Q5PA 1U8CA 2P7TB 1O9VA 4TRPH 2PXYB 5D96B 4LCWE 5CU9A 3FCTB 4OV5B 1CFTA 3S5LA 3LN4A 4QGTA 2YD8A 1C7SA 3FQXA 4TUJB 3BUYB 2ZT9D 2XWTB 1TETL 4I18C 3UERA 2ZKWA 5HHVH 1TMQA 2FIRT 3CTTA 3G5WA 5KYNA 1SY6A 3BUPA 4ZXBB 4ZO9A 3U2IA 4PJ6A 3QWOC 4UILH 1BV8A 4KDVA 4MVBC 4NRXA 4UQ3A 4GS7B 1PZBA 1HC1A 5DHXB 1XH1A 4BD4A 5TQ2H 1JI2A 5D6DA 1LK3H 3HBQA 1JP5A 1ANUA 4HJGH 2KZJA 4MNHB 1IFJA 4NQEA 3LX9A 2V6HA 2JXMB 2UZYA 2A73B 5E1IA 1A9EB 3IMRA 1KJMA 5CEZH 3QK0A 1KIUA 1KN4H 3V7AE 4JRWA 4NSKA 3RDTA 3OXSB 1KOAA 1F4YL 3EJQA 4L4TE 4MDIA 1NFDB 2X88A 4MBRA 2YD0A 5D2LE 5DYOB 2FHCA 2QPFA 1RPKA 1ROCA 1PNDA 2EC8A 3F12A 4G71B 4NO2B 3B7UX 4PJFB 2YKOA 4F7TA 2P8MA 4FHJA 2X3BA 1NGWB 3Q2VA 4KX9A 3HCVA 5AVRB 5CLXA 4HEMA 5I28A 1SLUA 2DQEH 1I9IH 3OSKA 4X6DA 1Z9SA 5LAXB 3RWFB 4NO0B 4Q6IB 1JMXA 3PL6B 4I7ZC 4K23H 4XZUB 4PS4L 5K9OA 3VWJA 1JHLL 2VXQL 1BD2A 4XCYB 3DDFA 4ISVB 2YFNA 3WV0A 5HVGB 3RK2C 3KLSA 3C9NB 3EJTA 4Y1AA 1A7PL 2B0SH 1IK7A 3STLB 3N1FC 1IFRA 1W9XA 3NJVA 1QO3B 1HSAB 3QNZB 3CXFA 3EJSA 5D2LF 1N7ML 4GXUN 4M9PA 4W9ZA 5INDA 4PJAB 1H8LA 5I1AB 2PETA 4Y99B 4F3FB 2WKGA 2P4AB 1N7SB 1DQIA 2IQAA 3GIVB 4DGWC 2R56L 5I17A 4K15A 3CFCH 1S7QA 4AKQA 3CDZB 1GR7A 2G9HB 2WYIA 3IN2A 5LCVA 1N3NB 3KBHE 3NACH 2JWDA 1H15A 4QY8B 4BCXA 3UC0L 4WI3A 3JV6B 3L7EA 3MNDA 1FLTX 4TNGA 2XTLA 2FX9H 1GY2A 3D4YA 1I7ZA 3MLVH 2LT9A 1S7QB 5KBKA 3C09C 4M48H 3L1OL 1P0SE 3FDWA 1DFBL 1VFUA 1R5LA 1DP0A 5J6HB 2ZP0T 3U1SL 1NU1G 2A3TA 3JWNC 3MACH 4JDZA 3S96A 2XQYG 5HYJA 4FMFA 1HKFA 4GKSB 2BVOB 4A2EA 3O2VH 1R8EA 1SQBE 1EDYA 1PZAA 4MHHI 2NNFA 4YUEL 5KLVK 1CTOA 3CCSP 5IZ7A 4WFED 1KGYE 3FCBA 3SBWC 2R69L 3W39B 2FH8A 4EN3D 2E9GA 2AFNA 3QXVA 2NY2B 2R29A 1MW2A 4GH7B 4GY4A 3BHBB 3PL6A 4YO0B 2I7SA 4QRPE 3ZE0F 3DHJA 2VKXA 2B88A 1R3HB 2A0LD 1SY6H 1MVYA 4JRYA 3F7VA 4LRNL 4P05A 3CC2P 1UENA 1BE3E 3MRNA 4GO9A 5C0CA 1DBJH 4LHUD 4JQIL 4Q9RH 4WO0A 1BYOA 2QJDA 5BJTA 1Y0LA 1QP1A 4PRIA 3EYVB 1HKLL 2DJMA 4XO5A 3W1ZA 2WLLB 3VSTA 1KJVA 4P5RA 3T2OA 3BPLC 1KIUB 2F5AL 1IGJB 4FG0A 2W0FB 4YC2C 1F97A 3RBZA 1T2QH 2ZOTA 5D7JA 3CMEP 4H8HA 5I74C 4W9JC 4V33A 3HNSL 4GQZA 4JS7A 4Y0GA 3M8OL 2AMGA 3ZPDA 4E42B 2HLFD 1WH0A 2VH5L 4U0QB 3BASA 3GSXB 3C08L 3QAZB 2KSEA 3WY4A 2CO2A 1ZLWK 4AL8L 4QI3A 1N7MH 2YAFA 3QUXD 3UAJD 2R0WL 3K4AA 3BWUF 4POYA 3DTXA 1X9UA 3MV9A 2CJUL 1DQML 1QSZA 1QFWH 1N67A 4QAWA 3U0WL 1T3FB 1HHGA 1KXVA 3UFIA 4DN4L 4FZEL 4KJQC 5CUSH 4Z77A 4R84A 5DRNB 1VEOA 2PPFA 4MYWB 3WMSA 3DX8B 2VQ1A 4F57L 1YYML 4NI3A 3VG0L 4WFHE 2VR4A 4WDIB 4MXVF 1NVOA 3A5VA 2VO5A 2X4PA 5SWSB 2X53A 1WITA 1JNNL 3MBED 1BVKB 1WT5A 1ZLVH 3U30C 4BGLA 5DZJA 3CX5J 4L1HA 3SGDH 5J13B 5C0ND 1BFTA 5JORA 2JKIS 3SBWA 4FEIA 4GXVH 4X6CE 1AQDB 4W4NA 3UJJL 2HVJB 4QHMB 2ATAA 3GIZL 4FF9A 2PCPA 1Q72H 3VMPA 4U0RB 5CJ4A 2OZ4L 2BVPA 1KTMA 1IZNB 1MDTA 1CGTA 5FYJE 3OHMB 4BM7A 4UNUA 4CVXB 2EDYA 3WKPA 4J8RB 4ONHA 4RMQA 3ZE0B 5MP6H 3T6WA 3CVIL 3TT1L 5E03A 1RZQA 4WF7A 2PR9A 5L2KD 5DRWA 3FAXA 4S2SA 3ZR6A 5C0CD 1Y6NR 3OHXC 3SCMA 5HBBA 3SSUA 1XZWA 4P9HL 3VD2A 3A22A 3QWRD 3AJ7A 5HYSG 2HTLC 4P4RA 1J0HA 5CAYB 3N85L 2DMBA 3U25A 1YJWP 1YO4A 2P47B 4M4RA 4R2GB 5ICZB 1QGKB 5KW9L 2J6EH 1HILB 1M7UA 1NAFA 1S3KH 4DKEL 4YHML 2Z65C 1IFGA 2AQRA 5I1HH 2XN2A 3KPRA 1UM6H 2GHZA 3WSQL 5IHWA 1QHPA 1MFBL 3OKOA 4YHIA 2Y7OA 5CN2A 1HHIA 1U3HB 4LEXL 2B87B 2A0LC 3D2UB 2AEQL 2OX5B 3REWB 5FUZL 2EIJB 2WT7A 3A23A 1MOEA 2XTJC 3HLAA 4IBSA 4PBVC 4UUJA 3M8OH 3BP7B 2XQYK 3FTSA 4PRHE 3Q9PA 3QUYA 3UTQA 2CH8A 1DBKH 2UWJE 3PQYE 2C9AA 3P3YA 3SPHA 4MJ5B 2ZUVA 4L4VA 4UZUA 2NY5C 1C16B 4Y1AD 3TVMC 1FO0B 2CLRB 4M6NH 1YQVL 4XPFH 2CBTA 4JFVA 3MA9L 4Q74A 4QYOA 1JZ3A 3L7FB 2W9LA 1QFWL 2NW2A 1I8LC 1P4IH 1D6VL 3F00A 3NEEA 3GUFA 4TUOA 2DS4A 1JZIA 2HB0A 4V2CB 4FZEH 3UBHA 4ODUA 4GMTH 1G4MA 5EN3A 2XQBL 1MLCB 1MY7A 4DEPC 2WAQA 4YHLL 1DVFA 3WGUB 2E7LC 3C6SA 1RUMH 4UDTA 2C7UB 2GQHA 2YQ3A 1BMWA 4WWKD 3H9HB 5IOKA 4OJYA 4Z1PA 3L4TA 1VFMA 5DJAB 2WWMD 4NHCH 5LAPA 5AZEH 2VN6A 4TVPH 3I9PA 2LXCB 1T7WA 4X6EA 5D5MF 1VGKA 2ICCA 3FQUA 5GTIH 5C0DB 3DRTB 3IDNA 4NWUH 4WFFD 4AYDC 4JFPA 2W65B 2WLHA 3O9WC 3UADA 1VQLP 1ZDQA 4LFHG 1Z5YD 3O6LH 1AR1D 2E6PA 4NOFA 2XWCA 3DYMA 5GGUA 3DVFA 4GAJH 3CVHB 4AV0A 2ZKYA 3W0WD 4FQLL 2CCVA 4HKJA 3V4LA 3TT1H 3D85D 3WKQA 1IX2A 3EBHA 3QHFH 1NFDF 1BCCG 2DIBA 4ZUWA 3AGWA 2UWEF 5T8IA 4BE5A 3IFOB 1ZA6A 5F72S 2Z93A 4YPCA 4YHOH 1KIRA 3OJ2C 3P2TA 4ZZFA 4EDXA 1X5XA 1P7KA 2F8VA 1CFQB 3D51A 4HU8A 3PJNA 4LKXA 4WFFE 3QEQA 1S2EA 3CHRA 1MELA 2GIMA 2OTWB 2EP6A 4XODA 4NQED 4YHZH 3N42B 2XN9E 2VZUA 4K3GA 2CE6A 2HLOA 1UD6A 5HHMD 5LB1A 4S0HA 1ES0A 1CIDA 1S8DB 3FO9A 1QNIA 4G80A 1JPFB 4KZDH 1L6XA 4W68A 1CC3A 1EVTC 4CMMB 5DUBB 4CPGA 2EEFA 3MV7B 5DJZA 4HIXH 4EDWH 2A74C 4TQPA 4FLSA 1VENA 4ZW8A 3NJHA 4Z3EA 2E6JA 4FQJL 3U9WA 1J88A 3RA7H 3TTSA 3VFSA 4AQZA 1KF9B 2J2ZA 1AI1L 4KRMB 5CGYD 1SVZA 1NBVL 2J8UE 3H53A 1J1EB 4PJ5D 1DVFC 3RIFF 1USDA 5J11B 4GKGA 1I1CA 1XR9A 3CLFL 1BECA 5PAZA 3PH0A 3FOMA 3T1FA 2HG5A 1WAAE 3P69A 1MCWM 2ADIA 3CCRP 4J8QA 4K9EH 1SQQG 3SKMA 4DNLA 1OP4A 3UG5A 5EFWB 2K6ZA 1OGAD 2P5WA 3DX7B 3RP1A 4J3BA 2CMRL 2EUWA 1P7QA 1GL2A 1IAKA 1YMME 1RUML 3B1UA 3RFRA 2CHDA 3BQUD 4XCFH 3VVWA 5IBLC 4JHBA 1YN7B 5GGVH 1KCSH 1ZVNA 3LKPA 3QIUD 4DCQB 4AY0A 3CCUP 2A4CA 2LAAA 4NQCD 5DUJA 5ICXB 1I3GL 3NFPB 1FNAA 5AZEL 2IPUG 4X7EC 2YD7A 4X99A 4LARH 4J3OD 3U4KA 3GXNA 4LLYB 3FQNB 2OMZA 1TEYA 4W6XB 4OZHB 4I6MC 2V4LA 2FL5B 2YD6A 5AVZB 3OKDB 2VQUA 4XXWA 1LNQA 3BRFA 2A6IA 4I8DA 4JQXC 5DC0A 5DJDA 3T08A 4FG2A 2CKBB 1TTBA 4ZOEA 1U33A 3EJZC 3CX5K 3S1KA 1PGRB 1X7QA 3IE4A 1W8OA 3IJEA 5CZKA 3ZKQD 4PV9B 3ZDYB 4XP6L 5L8RJ 5T5FH 3FRUB 1QACA 4X8JA 2V2TA 3NSFA 3UPRB 4WFHD 2E59A 4Z7UF 3A21A 3RUGE 2IGLA 2H1PH 4BELD 2VDLB 5B7EA 3DMMA 1GYCA 3DNKA 2FWUA 3ELQA 5C0IB 5J6SA 5KG9B 2DM2A 2OS7A 2QQNL 4P48A 3VGEA 4B9GA 3L6FA 2UZPA 4P59L 3D5OF 3MRPA 4ECNA 4G43A 2IFGA 4ZMLA 2Y3AA 1L5GB 4ODWB 3BCCJ 2R23B 3AXIA 4JFZL 4NQCA 1QL2A 1ZANL 3CWBE 2H6PA 4FQJH 2E75B 1XEDA 4AYBA 1ORSB 3HHSB 1J0JA 4L4TB 2L5GB 2IWFA 1A9VA 3WU1A 3ARRA 4OZFG 1U8LA 1H6UA 4XVSL 4JNXA 2AANA 5ENWB 3VXSB 5D7SL 3EYUH 5DGQA 1CXLA 4Z7AA 2XLLA 1CCZA 1T6VN 4U3FG 2X2HA 4DP6X 1NIEA 5I0YA 3ARFD 1G43A 1S7TA 3LRHA 1RQVA 5DEZA 1PP9G 1KCVL 4Y4KC 4NEHB 4AG4H 2YKLL 1RE4A 2VZSA 4XMLL 3D71A 2CMRH 4GSXA 5KYWA 2C8NA 1LHZA 1MI5A 1YNLL 1XGZA 1U7JA 4L9LA 2E4FA 1N64L 1ZHLB 1KCSL 5E2WL 3U7AA 1AGFA 2MOGA 1T6BX 3WNKA 5I6XC 4HFWA 3T8XB 3ABZA 1M1SA 3FB7A 3U0TA 2NY4C 2IDQA 3OF6D 4MQSB 1B0WA 2HKFL 5HHXH 4Z3HA 2B16A 3FULA 4GSRA 5KJRL 4OJDH 3J8F7 4HCRL 4BRJA 5FLVA 1K2DA 1QSFD 2A6KB 4ONGL 3VXRA 1USZA 1NAMB 2AQQA 2HT3D 5ID1B 2EYSB 4QHKI 4FADA 3G08B 4M62H 3SO3C 1VFAB 4OH8B 2OI9B 3EG9A 4KNSA 3CFDA 5EZOH 4WO4C 1UURA 5DVPA 3S3PA 4F37K 3BEVA 4F9PC 3WEXA 3TJEH 2I9TA 1QW8A 3UBFA 3OBAA 4M8VA 3VM7A 1AHMA 1WZKA 4R4BB 3LB6C 2BCCG 3E9UA 4G7RB 2LU3A 2R5DA 2W0PA 4JFDE 2Y4SA 3S5ZA 1XGYL 1A02F 1AE6L 3GTTA 1Q0EA 4G2AA 4AIZB 5JHDA 5FC9A 2D03L 2X4UA 3FOLA 3LPWA 1TEFA 1DQLH 2FIKB 4PJXB 3IT8D 2X4TA 5C6TH 1MJUH 3FAWA 4ZMYA 2WITA 3F6IA 2JB5L 2VXTH 2DYPD 2ED8A 3C8HA 1U8KA 3L5IA 2VYRE 1J5OH 3WTWA 3EO1A 5JDSA 4ZBJA 4BZ2H 3QISA 1U8HA 1WEJH 4BYHA 1BGYG 2X7LB 2LHAA 1NMCC 2O1JA 3L3HB 5KYUB 1CICC 2OMYA 2X4OA 2X89D 3O8XD 3QCTH 2O72A 1TOXA 2JELL 4X7TA 2Z35A 4AYCA 1K8IB 4CKQA 1TJIL 3WJJC 2QPSA 1MI5B 3QC5X 1JZGA 3WKML 2R2EB 1JZ7A 2IC2A 3FUIA 2JEEA 4Z78B 1YNTB 1FQ9C 1D9KC 4K4KA 5ITBH 5FYJU 2YIUB 1MCDA 1HYSD 4XVSH 1RE4C 2EQDA 2EIKB 1YQ4C 2FNBA 3AGVA 1IBGL 3ZZ1A 3VFTB 2VDMH 5EWIL 5TF0A 4HCRA 4FFYA 2J72A 4WEBH 2WQ8A 3WEOA 1DX7A 4X5XB 4AC2A 3RVUC 3IJYB 3H1LG 2JI2A 4ZG1A 2EDQA 4S1DC 2H6PB 5DK3A 5HDQL 1CJYA 4WK2B 4X4KA 3H25A 4X6FB 2CJSA 3AMLA 3TBTB 4MNQE 3H8NA 4HGMA 4ORGB 1KPVA 1FG2B 5DQDL 1FC1A 4KAQL 1FC2C 2NX5D 2RQ8A 5E8OA 3CMOH 2ZICA 1H9DA 1DN0B 1CI5A 1EO5A 2APVA 5IT2L 1PEZA 4FULA 1BVLB 3QARA 2PR4H 4Y2NA 1G1IA 1BQHG 1IAII 3MREA 3M1OA 2B89A 2FD6H 3BP6B 4J6IA 5EC2B 3H9ZA 5L2KE 5LHDA 5KJRH 2DW5A 2AJ3A 4UQEA 4RAVA 3V6ZA 3RTQD 4OCNC 5GGTA 5MERB 5KAQF 3CXHI 5E08H 1OAYH 2GFBA 3GM0A 3ECBA 2EDEA 3X12B 1Q81Q 1RZ8B 4XMVA 1FZKB 2VLRA 2GAZA 4G42A 4J4PD 4I1LA 1SN2A 2ZJSL 1VL2A 4GSDH 5I0DA 2Y6TE 1XGYH 3OL2A 3Q2NA 2BNRA 4X5WA 3MTXA 5IQMA 4HWEL 1HESA 2VDRB 3ARBA 3ARGB 2NOYA 3QFJD 2OZ4A 1FFNB 3N6YA 1LILA 3A67L 3F89A 2ZCZA 1ZRUA 5D96C 4QXGL 4QRRA 4UOW1 3T3PE 2JB5H 2VXTL 1DJHA 4OCXL 2DQ6A 1X6NA 4JPIA 1FORL 1ONQB 2W9DL 3IDJB 3HE5A 1RZ7H 3L5WB 3LVEA 4MXWL 5F88A 4ZUUA 5DK2A 5E79E 2EXWD 1UIIA 2CRMA 3BAKA 2SEBB 4L75A 4X98B 3VD3A 3QI9C 3C5ZA 5GGRY 1EXUB 2JCWA 3DBXA 5A7BA 4FI6A 2IV9A 4MD5B 2BMKA 1FAVA 2CA3A 2L7QA 4LLAA 4OF8A 3BH8B 3G5ZB 2EDOA 4IDJL 1TJIH 2ZUSA 4IFFA 1OZUA 2QM8A 4DP4X 3D8MA 3HE4A 3AW5A 5D2LA 3PDOB 3D39B 1F2XK 2A9BA 3R8BB 5B39B 3DX7A 9CGTA 3N4XA 2FYVA 1OY3B 5F1IA 3QORC 4LGSB 3QQDB 4X5PA 3GMQB 1PAZA 2YR3A 3HC0A 1LMKA 2VE6A 4WUKL 1S7RA 3RGVD 3VFVB 1HHJA 4B27A 1IFPA 1I7TA 1GYUA 4TSAL 2P52A 1LP1B 3BGMB 3FTGA 3OC5A 4EIUA 1VZHA 2DAVA 4JKPL 4XC3H 1RIHL 2NCMA 3H54A 1KXTB 3HJ0A 4FN0A 4LCUB 1UZ8B 2WY3B 4OF6A 3RKPA 4HJEA 3PLNA 3BFQG 5FCSH 4DTGL 4PJGA 2ZVOB 2VIRB 3BAJA 3UO1L 4IRSD 3QRFM 4NKQB 1Q90D 4JZNA 4P4KB 5HVWA 2DH2A 3GJFA 3MTRA 1BVOA 1ZLLA 4YWGH 1I7UB 2IADB 1FE8H 1BMZA 4LFHD 2AS5M 1WP6A 4OCMC 3FRPA 3P3TA 5C07E 5EU7C 4IHBA 2Z4EA 1X9VA 5D2NB 3TN0B 5ETUB 4YHYB 5B1JC 1ASPA 1L7IL 4O2EA 1FP5A 4BRVA 4GW1A 4NNYB 4U1LA 2YJQA 4LOUD 5AAMC 2FO4B 3IEAA 4R7DB 3OHXA 2B39A 1N0LB 1F90H 1I4FA 3VCLB 4JO4H 3HMWL 3IJ7A 4OD3L 5F6HI 1JXJA 1KDJA 2VUOA 3MA7A 5GSRB 1TCMA 2YAHA 1AZNA 1PD0A 2D3LA 3B8EB 1IT9H 1B2YA 5D1QA 4Y16A 3KWTA 1DVZA 4KO7A 1IBYA 3UZEA 5C08B 2Z5IA 5AG9A 4GSDL 4ETQB 2ZD0A 4HKXA 4WHCA 5EOQL 4YVUA 4BH7A 3C1LA 1SQPK 4KK6D 1KB3A 3OAZH 2C1OA 3OWEA 1ZGLA 4XPBL 4Q56A 3U30B 2KK7A 3VRLE 1MFTA 1KLUB 3E2HB 2P48B 4NQDB 1T5XB 5BRPA 2W92A 5E8DH 1I75A 1KYAA 4E9RA 3P77A 3KXFB 4BA0A 3PL6D 1PPJE 2DKUA 1NL0L 3ZTEA 3ASWA 4H8VA 2FJUB 3G4SP 5E2VL 3DIFA 1E5ZA 2WSFJ 3FQUB 1W91A 3LNDA 1FCGA 2Q7CA 3KCPA 5J12B 4NKDB 4LBEB 5EPMB 3S34H 1TZOA 2CGZA 3NT0A 1PGPA 1PVHA 5CSZA 2TAAA 4PHXA 3QYNA 1GS7A 5JPNA 1SQVK 1WZ1L 1HXKA 4Z1MH 2WPGA 3ALWA 1R3IH 2K4WA 5EFIA 1DBAH 4KKLD 2MKWA 4OD1H 5D4JA 2IALA 1KY7A 1UVQA 3DLQR 1N7SD 4BXLA 1EZVI 5ACLA 3WO4C 1ZEAL 5CLYA 2WIIB 3ZLQC 1M7DA 5DZVA 1FGVH 5D1QC 1OTSD 2FQEA 3VM5A 3X13A 4NQQA 3WE6B 5EUOA 5ILTH 3F8UB 2VZOA 1WBYB 2HP4A 3HIZA 3CZFB 3BP5A 3QT2A 4P5TA 2V9RA 5CS7A 1ED3B 2OXHB 5EA0H 4XBPB 2PCFA 3GHEH 3ZYOA 4DUWA 5I8OL 1RIHH 3ULUH 1N5AA 1SQPJ 3QEHB 2N1TA 2NNRA 3RTQC 4FXGB 2H3NB 1WC7B 5IW6B 1A7OH 3I75B 4WW2B 2Z9TA 1FJ1B 2GIXA 4HUWA 3QFJA 5DFTA 2P10A 3EFOA 2BNUA 2HT3C 2BNRD 2IFFH 4FFYL 1JXGA 3WIFA 2OAAA 5I8CA 4KDWA 2NUPB 3BZFA 4PJAF 3CQQA 2VMEA 1QFWM 1P2CB 2ZUTA 3OR6A 5BZWA 3VSQA 4XBGB 1H0DA 2X2JA 3V4PL 3EDDA 5JQ6H 4Z6AT 3MV9E 3MZWB 3VH8B 1SFHA 3KR3H 1JGUL 3LRLA 1SDYA 4M4RB 3O0RH 5D1ZD 3GF3A 5EEUA 1RF1A 3L48A 3V6FB 1B4JL 5IVNA 2ZJSE 2VMCA 4KTDL 4DGYH 1A6ZA 2R83A 2MCAA 3QW9A 1L9QA 1KSRA 5AVUB 5C8JB 4OZGA 3NJKA 1T4KB 5EOQH 2VXUH 1GYVA 4DOJA 1C12A 1Q9LA 3BD4A 3WL9A 3CZGA 4AVHA 2FQGA 1FZAA 4DW2H 5L4IA 5KSBB 4QHNB 2LU7A 4FE9A 5AW7B 1SYSA 1BEYL 2NY5L 3POCA 1Y07A 1G1JA 3U1QA 4ZO7A 3DECA 3RL0C 2BHUA 2H26B 4M7ZB 1CZ8L 3MXVH 1EEZA 3V9EA 1FBMA 1MCKA 4O2FA 4U1JA 3L9EA 2PCPB 5BRZB 3LIEA 2IAND 1AFVH 4LVOC 1Z5LB 1GS8A 2CO6A 2Z31B 4PJFF 2X12A 3K2MC 3N9GL 1SM3H 2VWEC 1DE4B 1LP9B 1PG7X 3ZKMC 4F2ME 5FO8A 4QTHA 2YK1H 2EVIA 2BVQB 3MPCA 4JBSA 3ZYIA 1SQBK 2E3VA 4PGDA 2UYLA 4DKFL 3ZDYE 4U2ZA 2MCPL 3MUGA 1A6WH 1V3MA 1CBJA 2H8PB 4LBAA 4NAJA 5DJ2A 5BO1L 3P11H 2FT6A 2E7DA 4Z7NB 3IDGA 4ABWA 4J6RL 2Y69B 4N9GB 3LB6D 3CH1A 3QIBA 4QKTA 4KDTA 4CVWA 4L37B 5G4MA 3CFEA 5C2BL 2A6JA 5CR8A 3KJ6H 1GIGL 1Q86Q 4D6TE 5DJ8B 2FT8A 4HG4K 4JW3A 3T3PF 4DWHA 1J5IA 4NN7C 2F54B 1LWRA 3IBOA 2G3NA 1NOAA 3GJFB 4AMWA 4ZX3A 3P8CD 1QBBA 2WVVB 2OMWA 3V2QA 3LDBC 3ATEA 2OSWA 1RP9A 1ZK9A 2PW1A 3JTSB 3WFBH 3D0VA 3QQ4B 4UOJA 3MNZA 2P3YA 1RF1C 2KDGA 1JNHA 3GXUB 5LUMA 5E1AA 4WI7A 3E8UL 1OL0A 4KWUA 3TURA 2MNUA 2YAOA 5ESVA 5HJDA 1PKQA 1PLCA 3HKFA 3KEDA 1YYCA 1WGOA 5F9WC 4KKBC 4IFMA 3G6JB 4R3SA 1JJUA 3VFRB 5ABAA 2EXYD 1SQXK 4L1DA 2XKNB 3EHBB 1R46A 4WSKA 3WLWD 2VDOB 4PUBL 5H4ZA 3FH7A 2BNRE 2G3MA 3MRNB 3CC5B 3Q1SL 5ABDE 4DGYL 3QS2A 1ZRTD 1PTZA 1FZJA 4R90H 5D5MB 2P5ED 4PJDB 4XWGH 1D3CA 3PU7A 5KVGH 2CKNA 2QA4P 4EEEA 1ZT4B 2CDGB 3PUUA 1Y1UA 4PMEA 1D7MA 4HUXB 4UQCA 1I8KB 4MNQD 4NZRH 5DMYA 4AEFA 3F7RA 3D33A 4YLCA 1DUZB 3QI9D 2FX7L 2V17H 3DX9B 3QYMA 3DVGA 4YEEA 1FZFA 1FAIH 3NAAL 5GGQL 5IG7B 2BC4B 4KK5D 2MRYA 3FBQA 3IAQA 1U3HD 5C0GB 1YN6B 1WE5A 2I1KA 4N3UA 4YFLI 1BAGA 3VI3E 5EU5B 1GK6A 4HS6A 3VFPA 5KS9F 4OVVA 3ZXAC 4GKSA 3ZE2B 1R3JB 2X4RB 4EN2A 2HFGL 2BPBA 4JN2A 1TETH 1OEZW 4ZSOA 5H2FE 1SVBA 1IC1A 2ENSA 2OYIB 2GTZA 2JK5B 1UKQA 2EYTB 2WSEH 2H88C 2WIMA 4N2LA 1U8PA 4ZMXA 2FXOA 4KZCA 4Z7QB 4N1HB 5LGJB 2BOBA 4JDTH 5IVXB 3BOVA 1L0ND 4A04A 2BCCD 1J1OL 4D6TJ 4NIYE 3RWJA 4YTPC 3V5KB 1LK3L 2R2HB 3WXVH 1H5BA 1W0VA 3N55A 3P11L 3RU8H 3AG2B 5I66B 3ZMEA 1NEZG 1BA9A 5HY9B 1DJZA 5SWQA 4CC4C 2CNYA 2QADC 3KJ6L 3RWDB 2A6DB 3C5SA 1YQ2A 4J7RA 2HZHA 1GA2A 2ZUXA 4Y5VB 5DF0A 4R5TA 2QR0B 4ODBD 2J5WA 4OJFH 5GTHE 1NBZA 1PYWB 5D1ZC 1CQKA 2VUYA 4N3TA 4AQ8C 2P2UA 5I6XB 4Y19B 3E38A 4ESKA 4LP4A 4GXFA 2HVKA 1ND0B 2ZTBA 1CGVA 1VHPA 3JZ7A 2ARJB 3NDYE 1NICA 4KTEH 2KNCB 3LNGA 4F8OA 1A65A 3V0GA 4X5XA 1HDMB 2NR6A 1TQWA 1MEXH 4KXBA 1QHOA 2DD8H 3VE0A 3BZ4A 3RWGA 2HN7A 1RZIB 3RNQA 2Y1AA 1KB5L 4P23A 1HS6A 4LLVA 1S7VA 3MBEC 4FEMA 4KZEH 3TIEA 2C3HA 3UYPA 4C7RA 4FNLH 2R5BA 4U33A 4JFHE 3BVHA 3HD7D 2Y0SA 4N0CD 3VACA 1NC2B 1G6RB 4YDIL 1UYWL 4N2KA 2WLIA 1RUKH 2X9ZA 3PHAA 4ZMWA 1TPXC 4NO2A 4Z78A 1H6FA 1O5PA 3L72J 3DROA 2E76B 4DK6A 1S4XA 1SOSA 1FYTA 1OVZA 4K71B 4J3OG 4E9QA 3AY4C 3IU3A 4XT1C 2ITCA 2QMJA 4K5NA 4X7TB 1H5BC 1AZUA 1UWYA 4G9FE 4QEGA 1KJMB 1BJ1H 4PY7B 2P7JA 4W80A 3ML9A 3RLSA 5I1DB 1LEIA 3S4RA 2O3JA 2VJ8A 2W9EL 4AV4A 1E6OH 3EYFA 1ZHBA 4ELKB 1JFQH 4NQEB 1P7QD 4TV3A 2A06D 1ZY9A 4PJHA 5IJKC 1KMIZ 1UH4A 3O4LE 2X6CA 3WXWH 4XN5A 1MRDL 5IQ7L 1BFSA 3ZDZB 3LY6A 4AQ8A 4KJWD 1YPZA 5JZ7C 4U1KA 1YEDA 1IGTA 1N73A 2MNWA 3SN6N 5T1KB 4RBPK 5AW8B 2AV1A 3LIZL 4QXUL 1J86A 5CNHA 4ZUVB 3I6GB 4PD4H 2HJFB 3KJ4B 2WSFH 3VWKA 4CSSA 2XWTA 5KLVJ 1D6EB 3BUYA 4PJEA 2JQMA 1FL5B 1GZHA 2OCJA 2ODHA 1FZGA 3CD4A 2BS71 3K6OA 4MQXD 1OKEA 3AAZA 2E46A 3AS3A 1XZ0B 4KY2A 3E6FA 3RZCB 3EDEA 3SWFA 4NQVA 3PWJA 1CI3M 4GO8A 4XR8C 1LE9B 5CJXC 5APQA 4U3CA 5FW6A 2UXFA 4JPWH 3BQUB 5E70A 4GLRH 3QEQD 3I50L 4I18B 5FX3A 1OVUA 1KXQE 3A0OA 3HEIB 5CP7B 3MLZH 4YE4L 4GW5A 2GITB 3I6LE 4BZ1L 1T1ZB 2ITCB 3CUPA 3HI5L 3ZTJG 1QLFA 5HI5D 3ZL2A 1I8IA 1BSNA 1PPJG 1W2EA 2Z0UA 1SOXA 4FQIL 1XCTA 4ODHH 1I1AA 2V0AA 3UOAB 4KTEL 3QQ9C 1DFXA 1KGCE 2VN4A 3FXIC 3VGAB 4NM4H 3HS8A 5T3XL 3UIYA 3V0EA 3TWCL 3N1QC 2EECA 5ANHA 3OMAB 5D7EA 3UYPB 3S9DB 1MAMH 2VAAA 2YO2A 2IANA 1WBZA 5I73B 4ZAKC 3DSNB 4JCWA 4PV1C 5MI0B 1LEGB 4XNYH 2WQSA 2X4NB 1BXXA 3HZYA 3RX9A 1U8JA 3W56A 3V0DA 2D3JA 4HC1A 3H3PL 3DX6B 3HC3L 3PQYA 4EDFA 3KPQB 1FL3B 1A3QA 4FXTA 3A5TA 1KC8Q 3CFKA 2AAAA 3QZBA 3QVAA 3ISWA 1O7VA 3MUJA 3O81A 4IDLA 4Z7OB 1DEDA 5F9AC 1Q8MA 2PO6D 3X14A 1DQMH 5SV4A 4PJ7E 3WXWL 1U8NB 4PP2B 2IAMD 2NNCA 4ZYKA 1EEYB 2VOTA 3VX1A 4RRPM 5E2UL 3IGLA 2DQHL 3MJ8B 4H0GA 4PJ0E 2VLKB 3BLKA 3HZMA 2I7OA 4B96A 1CWVA 2K9JA 3QXDB 2Q76B 1ZHNA 3QH9A 1AFOA 1GCYA 1M1JB 2CBQA 3MRGB 3FWNA 2GCYB 2IGFL 3GM8A 1QI5A 5GXBB 5AW0B 1SNRA 5F7BA 2OGUA 2CR0A 4L4TD 4HW6A 4OKVA 3UH8A 4E36A 4AMKL 3KYKH 4GQPH 1AAJA 3ULVL 4QTFA 1A8ZA 4XVUC 2F1AA 4RISL 5BS0A 1N5YL 3P30L 2BP8B 1CFSA 1KT2A 2PPAA 1BXAA 4F15B 2OYHB 3AMKA 4Z3JA 1C5CL 4KI5F 4N0YL 3ARFB 3T3MF 4APQD 1TLKA 2OMZB 5C0GA 1TMCB 4ZODA 3R4YA 3MZGB 1BZDA 4XNAA 4A7QA 5A1AA 3MRJA 3BO8B 5C7XL 4PJ7F 5D1XB 4X99B 3QFDA 3CCJP 4YMPA 2BY0A 3EOBB 5A2CA 1R19A 4MA1C 2H3KA 4JFDD 1KWKA 3N40F 4H7VA 4UCFA 3H9SA 2OQQA 1JZ4A 2AGJL 2WSKA 4NB7A 3WHXB 5DR5H 5E4EC 5I1GL 3U2SB 3MLSH 5I19L 3QUKA 5C92A 4FFZH 4MAYD 4TL4A 5H4YA 5KS9E 4H26A 3L74J 4AEIH 1PKQE 2KBGA 2AQ1A 3K6DA 1AHWA 2KDYA 3E3QE 5BV7C 3FQRA 4HK3N 3FT2A 4K94H 1PSKL 1MCPH 3CHPA 4KKCD 4S11A 2E27H 4BQ9A 3HW7A 1UM6L 2DKSA 1A02N 1B9KA 4NPKA 5D72L 1NPJA 2CO7A 2NPSA 1XHHA 4Y4HB 3U1PA 2A9ML 2X1OA 4D8PA 4G3YH 5KJ7D 1JB0J 4AZ8B 2KYIA 4FFVD 3QUZA 4NC1E 4Y2OA 4KJWC 4PJ0H 3MO1B 3GBDA 4A7GF 4I13B 4BQ8A 1GKEA 2KS0A 3BP4A 4U3HA 3EZ8A 4JQ0D 2AEJA 2ATPB 3VXPB 3K81A 5LQBL 2K0RA 2WYZA 3B2VL 1AJ7H 5ISZB 4N68A 3P4LA 3NCMA 1YQVH 4JMNA 3M1BB 4XZ4A 1ETA1 1L4AB 1T83A 3NXSA 1E2ZA 4H8WH 3QIBB 1RI8A 1DVSA 4HIIB 3L37A 1QRKA 4JCLA 4LXFA 4E9YA 4PRPB 3RTLA 4G5ZL 1AO7B 3FB6B 4U6HB 3JTTA 2J73A 1PGQA 4G6FD 3HE7B 1GXEA 3V4VL 2BERA 2EE0A 3MV9D 1N70A 1ZPLA 4HAKA 3WENA 3EYSL 5HI4C 3DPBB 4ODVH 3TCLB 5TDNB 5I15H 3QPKA 4P5TC 4E41B 1G6RH 2I5YH 4GT1A 3OKMB 3ILQC 1U36A 2WJ5A 5EBWA 1AQMA 2CO6B 3IJ8A 1MFDH 1OSZA 3SKNB 4L3CB 5E6IA 3T4AB 2MKLC 1IBZA 2WBJA 4PRBA 4N0YH 3ZN6A 5C07B 2Z8RA 1PD1A 1LXMA 4QRRE 1IGIH 5DWUL 1A3RH 3MLWH 2VC2L 3GSOA 4R6UA 2XWDA 2V7NA 3O6FC 3MCG1 4AQEA 1NCTA 5FO9B 1INEL 2AQSA 3DC0A 3MYZA 3BSGA 1BVZA 1RE3A 3K6SA 4EI2A 2NX5B 5JTWA 1SQBD 4P2CG 2OL3A 4JHAH 2VLKA 1BFVL 3BVUA 2WBJD 1JN6B 3SGJC 5KTEL 3QJSB 2GJ6D 2YRBA 4PGZA 1T66C 4GAYA 5DSCA 1WVZA 2VDOH 4N6RB 3FUMA 3T0EE 4AX3A 1RK0A 1TO5A 32C2B 1OCRB 2XFXB 1NUNB 5AUMA 4TS6A 4E9TA 1BJ1J 1G9MH 3NRQA 3DVNA 2YLKA 3C8DA 5CO1A 3SE3A 5D1QD 4WY4C 5DJCB 1PS3A 3PGDA 2FDBP 3BEWB 1NLBL 2GHWB 5C6WH 2NY0C 3MRRA 2DBLL 3DARA 3KNBB 5D71H 2AXTE 3O6FB 3DGGA 4NNPH 1U3HC 4OLYH 1KJ2A 4NIKB 3RK3E 1EK3A 1IC4H 4OZGF 4UUJB 4K7PH 3FTWA 4HZLA 4XVTL 3LKSB 1BDDA 3L4ZA 4QTIL 3MD0A 5HHQA 2WB1A 5J1SC 2V5YA 3GHBH 4O58L 3DGGB 1KENH 2AITA 3FU0A 3Q6GH 3QO1A 5DT1H 4J4PA 4GW4B 1V7NH 2R4SL 2WNWA 1X0TA 4HHWA 5D7LA 3NSJA 5J13C 4H1LA 4KT0J 3SFEC 1ET5A 5HJGA 2C9XA 3O3BA 2XZQL 2IPPA 1KACB 3AY2A 4G70B 1LWJA 2DQEL 4M7JL 4QOKB 2Q86A 4JFQB 5CJOL 3S4SA 1AY1L 2PYFA 3L3GA 2RB8A 2NPSD 1UATA 1JHLH 1NPNA 1BGXL 3ZE1B 2OPCA 4P57B 5J6GA 3TX4A 3DOIA 2FYUK 3KPLA 4IRZA 1F4XH 3IFNH 5FR3A 3POHA 3W9DB 4D0BB 3C9IA 2NZIA 1LK2B 3K6SB 1RMFL 2QJYB 3VOPA 1T0NB 5INCA 3BWAB 4PU2A 4A2HA 2AJSL 1QTSA 4Z23A 2FK9A 3OMNB 4G7QB 1AVYA 3ZDYF 4P5KA 1QYGH 3NP4A 1ZA3B 3E9TA 1LLAA 2YN3A 3FUFA 4O02H 2EO9A 2JQZA 1F4AA 2QQQA 1IGIL 1NGYB 5DHVH 3PP3H 3ZRCC 1SEQL 2ZONA 4OR1A 1XSOA 4JFDA 1USQA 3PRJA 4HUVB 2QQLH 5AD0A 4C83A 3C5ZD 4HIJA 3KPNB 1N8OE 2ZUYA 3CK0L 1GPOL 2XTSA 1CR9L 4HKXB 2DIJA 4YHNA 1XF4A 2R0LH 3AU0A 4QRQB 3WO3B 2AXTH 2YFOA 4YAQB 5BO0D 1UOVA 2D2CD 1OANA 4UF7C 1U3NA 4IS6A 3VFMA 4XOAA 5GRVL 4HZLB 2J20A 5EZIL 1UGKA 4DAGL 3KLLA 1KFNA 3FXEA 1AGBB 1ZWIA 2BZ7A 5C0RL 2YARA 4JO1L 3H1LE 1QVGO 1S7SB 3FB6A 2O6FA 4GBXA 3KPOA 4U6HA 3ARBD 2WP3O 4XWOD 5F9WB 2WXJA 5AW6B 5IJVB 5I1KL 1NIAA 2EYRA 3CGTA 4LCCB 5F96L 1G9ML 3SB3A 2IBBA 3TIDA 1X5FA 5LN8A 1UACH 3QG6A 4S10A 5HP5A 2E56A 4KUCD 2QLVB 2D7NA 2HT2D 4P59H 4GP8B 3LMJH 4X42A 1L0NG 3CC1A 4G8GB 1KLFB 1Y9BA 3P1VA 4XMPL 3KH4A 1F3DH 1RK0B 4ONOA 4FKKA 2IAMA 2N1TE 1PZ5A 4PTUB 1QVFO 1BDCA 1F58H 1KNOB 3MO1A 2PO6A 3GHPA 3RVXC 4UB8E 1JAEA 5CILL 3B5HA 1NTZE 3L73D 1P9MC 1OW6A 3EJCA 1JGVH 1PZCA 2N59A 3ULUD 3L4UA 2EUVA 1UEMA 5APUA 2C34A 2KOGA 2NX5A 2V5MA 3PYCA 4Z7VA 4FQCL 3K71B 2DN7A 1SMDA 2ARJA 2OJZL 2DH3A 4MN4C 3NCBB 2CR6A 4P5MB 4H13B 3U6XA 3TV3L 3RYMA 1MPAH 3KZ8A 4F2EA 5APXA 1S9XB 1U95B 4JLRB 4KKAD 1QLED 3PPSA 3FW6A 4IU3A 2XHNA 4O4YH 2J56A 2OXGA 4UT9A 3OF6A 4LDCA 4R4FL 5DK0A 3HNSH 3NIDF 1R3HA 3GI8L 3PNRB 5HHOB 1QRNA 1S46A 1J8HE 1RP8A 4JAMA 3F85A 1EUTA 2F7PA 2R51A 3K4DA 4B53A 2WPRA 3HAEA 3WFZA 2QE7H 1NH6A 5FWRA 1UT2A 3WY1A 5B3SB 3HLKA 2BIOA 2E5TA 3W39A 1N9PA 4GRWH 3CBKB 3X3GL 4MVBD 4OAWB 1KGIA 1OWWA 4GG6A 3MUZ1 1ADQA 3U46B 3GMNA 5I75C 1DDTA 1LP9E 3AUVA 4PG9B 3TESA 1URIA 3OPZH 3SY0B 3TV8A 2V8MA 4GINA 4GIAA 3ZIYA 1HJ0A 4QCIA 4DKTA 1IBDA 2W6AA 2AZAA 5A3IC 4L3AA 1NMAL 1TENA 4OGXH 1HK6A 3ZO0A 4FQXB 1K85A 1IKNC 2WXLA 4OGQC 1PG7L 1AR1C 3LTVA 4XN8A 4WTZG 3KM1A 12E8L 3K3QA 2EINB 3JV6A 1JK9A 3INUL 3L7EB 4PFEA 4JPKH 5FYLD 1IBBA 1C8PA 1FV1B 4LHUG 2BY3A 4UM9D 5GJTL 1F3DJ 2ADJA 3MNMA 2WWOA 4N5UA 4ZJ9A 4PCYA 3NP3A 1EEYA 1Q72L 1ZV8A 2Y36L 5HGHA 4AYEC 1G2CA 1R0AL 3L70D 5C09E 4EVNB 2BCMA 1TPXB 3USSA 1R4XA 1TU3F 2GI0A 3QWOA 3H55A 1NC4B 1FLRH 3HG0A 2P46B 4ODTH 3CVIH 4NRYA 3RX5A 4HWBH 2YUZA 4PP1C 5HGGS 4JPVH 1Q0XL 3H0TA 2IV8A 3QJZA 4C58B 2YGNA 1KB9K 4RGOL 5FUCE 3TF7C 3IAGC 4N86A 4UT9H 4A7VA 1KEGL 1WBXB 5FYJD 2IBGA 4WK0B 3EJYC 2OYPA 5EEVA 1LO3H 1XL4A 5ITBL 5AYUH 2N56A 4M02A 1QEXA 4HC1L 5BRZD 1KJ2L 2IANB 3MRHB 2E74B 4F7EA 3ZSSA 5KW9H 1J05A 4JFFA 2Y7SA 4R5XA 5K1VA 3TJPA 5ACZA 1HCYA 1SJHB 1E3ZA 2DBJA 5IVXE 5DUPH 5KVGE 3TWYA 3D0LA 3KLDA 1TUPA 2LU4A 1GZHC 3L3GB 3WSQH 1B4TA 4JHZA 4MCZB 1YNTA 4HQQH 4AIOA 2GY5A 1BF2A 4JFSA 4O4YL 5APYA 2AEQH 4KRPB 1X6LA 1ZPUA 1J8SA 1BM7A 3LHAA 2FUQA 3HFML 4B7LA 5H37A 3AWEA 5AB1A 2AEMA 1N59B 3KVQA 1KIPB 1MJ8L 2YLHA 3BIKA 2HCZX 4FXLA 4H88L 5LXGL 1JBJA 3Q8AA 5AWNL 1A4BA 2H2PD 4IMLA 3VD7A 1D5MB 1QR4A 1PX3A 2EILB 4KQ3H 3GGWA 1KV3A 2ARJQ 4FERA 2H0PA 4FQ1H 1T8ZA 1GDTA 1HEZB 4AJWA 3PJLA 3E6FB 1VLXA 5JIIA 1MZZA 1R3LB 3MKKA 1I1AC 3ISYA 4WI2A 5TK2A 2F54D 4XVJL 1UFUA 3VRIB 3SO3B 3WUUA 1K8DA 4HIHA 2W81C 2IMMA 2ZJSH 4PJ5A 1CGUA 1QSFE 3P7KA 1D7CA 1A5FH 1NCWL 2PYED 3PLYA 4WV1C 4I9WE 2ROYA 3DRQB 3PWNB 4OGXL 3OW2O 3FMGL 4JG1L 5KLIB 4F33A 1T5WB 4BV1A 4GKZB 3CFKB 4QXGH 2NXYB 4GRMA 2OK0H 4X5LA 2IBZG 3Q1MA 1DJGA 3VA2C 5F93C 3IJSB 3FX0A 3VXQB 1R5VB 1Z1WA 2MWCA 1KZUB 5MEQA 2MH4A 5HDBB 3RUGF 5D70L 3LQAH 4XCEB 3TZVD 8FABB 1W2BO 3MJWA 2IZ1A 1USEA 3QDJB 1XGPB 5EBMA 4P3DB 3T2QA 1S9WB 2IH9A 3HA0A 2HRGA 2NY7L 3EO9L 3G5XA 5E9DA 4AYMC 4MB3A 4GOSA 4XPTH 3UZQB 3HZVA 3OXRB 1ZOYC 4KKAC 4R7NA 4X6CF 4D9RD 4F8QA 5EBGA 1KEGH 3X1NA 5GS3A 5D7JC 1X5JA 4CNIA 1EXGA 3C6LB 3OKMA 1QWNA 2BRRH 2AK4A 2E6QA 5FA3A 1VQMP 1M6OB 3EGSA 3OJMB 1L0XA 3TIEB 4I18A 3WUWB 3K0YA 1MNUH 5AVQB 5TE6L 1NTMG 4S0SD 1EFQA 5FGBA 4UV7H 1P5UA 4ZAKD 2AJXL 1RCYA 1F45A 3S3JA 3H1HJ 2WMPB 2WNKA 1OGTB 1NDMB 4UBDC 4QAMB 4ODWA 5D6DC 1KPUA 1JNMA 1FE8L 1J0ZA 4HIXL 3DVIA 3SYAA 1DR9A 3QUML 2K8QA 4MA8L 1QX8A 2DLFL 4IMKA 4NQCE 1EIBA 1NFDE 4LAJH 2WIIA 3UTZB 3TNMB 3C2AH 3WS6A 1AGCB 4KQ3L 3LZQA 2JKXA 1KB5B 1FIEA 2VL5B 4JGNA 3FBKA 4KUZH 1NEUA 5T1KA 2DIEA 5HDBE 1TT6A 4D9QE 4E9XA 4ZTOL 3GKWL 3G3LA 3V6OE 5JPNB 5LGJA 1YPZB 5F6IC 2VLLB 3JWDL 3TGUE 5ESAB 4Y19D 5J06A 1ORQB 2FKWB 4X9FA 4JB9H 2IG2H 3ZL1A 1KXVC 4WHYH 4U6YB 4XFJA 2HPTA 1U91B 2WTOA 3VRJB 1AYRA 4GJTB 1M56D 2RIKA 2CUIA 4RFEB 5J0BA 3OM3B 2W07A 5TH2B 1YHPA 3PRZA 1N59A 2C9SA 5E6IB 5DJDB 3T4AA 1EXHA 1EUUA 3DX1A 2ZOKB 3QBTB 5F1KC 1IAOA 3RG1C 4IHOB 4HKZB 3BE1L 4Y9CA 2F58L 4JK0D 1NC2D 1QBML 4MCZA 3ABVC 1YAIA 4C46A 3CZEA 2D2CC 4PWHA 4YXHL 1J8HD 4OVNF 3SGEI 3US9A 4KITB 3GJEB 3D85A 1E27A 1UM4L 3S97C 4PR5B 2YEVB 2W8CA 1MIEL 5E8PB 1GK4A 1UWGL 3PHOA 2X28A 3LH2L 1NAML 3RWGB 4WKZA 4K9JA 1QVOB 5D93C 1URQB 4OSUL 3PREA 4HMDA 4M29A 3U4BL 1P7QB 1WYJA 2FLBT 3CVHL 3LEYH 3SCMD 1UA7A 3QUXC 1SZNA 3JCUH 1WFUA 4BFKA 1AG6A 1FI8C 1FNSL 4LLWA 4HJ0D 2I1JA 4Z7WE 2D31B 4WW1A 3RL1A 3LS5H 3CCEP 3CSTA 3FT3B 4YIQA 4JL1A 4AGOA 4DQOH 1X4YA 4HUUA 2HG5B 3FOMB 3NPSC