5AW5B

Kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 2.2 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw5B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw5B02
5AW0B 1H89A 3IR9A 1GK4A 2Q5UA 4I6MC 3B8EB 3NFQA 2WT7A 5AW9B 4GT1A 3V4QA 2WWWA 3WGVB 5AVRB 3HE5B 1OWAA 3HE4A 1SP4A 4RESB 5APXA 5AW1B 4AYCA 1A02F 1NWQA 2ZFCA 3OAKA 3T97A 3V4WA 3MD0A 5AW5B 1CZQA 3A3YB 3MGNA 1X8YA 3TYYA 3VTPC 3A7OA 2Z5IA 5AVXB 1T2KC 3HE4B 2QM8A 3M06A 5APUA 3NXSA 3L37A 3M9BA 2W6AA 5APVA 2WPQA 2ZXEB 3SWFA 3KQGA 4LC1A 3L36A 1J2JB 2JJLA 2YO2A 2WPSA 2N9BA 1S9KE 1DH3A 1FOSF 4GKGA 5AW6B 3TK1A 3L35A 4EOTA 3P32A 2Z5HA 4I2LC 5AW7B 4XE5B 3LIEA 1KQLA 2KP8A 5AVYB 1H8AA 3VMXA 5APYA 1MUUA 4DZOA 5APWA 3VMZA 1JUNA 4M3LA 3VMYA 2C9LY 5AW3B 3HTKA 4JYBA 3WGUB 1GTWA 4JYCA 1GZLA 2P7JA 1FOSE 5AVTB 3M0DA 5AVUB 1SLQA 1MFZA 3TNUA 2VRSA 1YYCA 2P67A 1GD2E 2C9NY 4C7NB 3VYIA 2WTYA 4HYTB 5AW8B 1HUCA 3VN0A 4AUWA 2R5DA 4KHXA 1CSBA 3M0AA 1FAVA 3M9HA 3P8MC 5AVWB 3TNUB 1GU4A 2BASA 5CMZA 5AVVB 3O8ZA 2XV5A 1S9KD 3I5CA 2E42A 3A5TA 2XZRA 1A02J 2YNYA 3NMDA 1GK6A 1MV8A 3NTNA 4C7NA 1HJBA 5APTA 1NAFA 4AQRD 3LIDA 1CI6A 3A2AA 2R5BA 1G2CB 5APSA 3M91A 3V5BA 2P2UA 1H88A 3P7KA 5APQA 1GU5A 2W27A 1HWTC 4C46A 3KDPB 2Q7CA 1IO4A 5AVQB 5AW2B 5AW4B 1CI6B 2XU6A 2R32A 2H7HA 2WT7B 1HBWA 3UIAA 5AVSB 5AVZB 2E43A 2R3CA 2YO3A 2QM7A 1JNMA 2Q3IA 2IPPA 1T2KD 2WPRA 1OXZA 4RETB 3HE5A 4B86A
chains in the Genus database with same CATH superfamily
5BZWA 4CDGC 1BAFH 5HHMB 5C6TL 2GHWB 1DLHB 4KK8C 1BVKA 2CXGA 5K9OB 4V11A 4M7LT 3MJ7A 1ORSB 4A2MA 3DPBB 2LOEA 3IMSA 1ET8A 1H0DA 4GI6A 4HJIA 4H8UA 2JWAA 3MJWA 5B8CA 3NTCH 3B9EA 3D2TA 1BVOA 4JGJA 4FLSA 4QJ3B 4B0MM 3PREA 1DP0A 2W8ZA 4KHXL 3UMTA 5EZPA 1S5IL 2ATKB 3WS6A 4M9OA 4XN1A 5KWYC 3A4EA 1R19A 5EBWA 4BH7B 4K7PY 3UTPD 4FA6A 1G6RL 4CILA 4MZ2A 5DZJA 1QEWA 8CGTA 2E8ZA 1T1YB 1W80A 2K6YA 2PCYA 2KYIA 3A0BE 2GAZA 1WUNT 1J1OH 1MKFA 1UWYA 2Z7YA 1K3IA 3HHMA 3F5WB 3LKQA 4JDZB 2E3VA 2WPSA 1DQML 5EU6E 1RUPH 3JC22 1EUUA 4IGBD 3WIHL 5KJRL 1II4E 3CN2A 1PBYA 4HCGA 1UOKA 5KSBF 1YVLA 5F1NB 3GRWL 3PAUA 3OAYK 1CICB 3LHPL 3PXJA 3ZQWA 3LNGA 2AABH 4PY7A 3KXFA 3SBWA 4PGDA 5HYFA 1SN0A 3US1A 3OZKA 5MEPA 3OTTA 2ZSVA 4WIQA 4JYCA 2GITA 3CFUA 5AVTB 4GMSL 1ZHNB 4PRNA 5I30L 5IMLA 2R69L 1JMMA 1AS7A 4ODSH 3RWIB 1XHHA 4A6YH 1TENA 2O1AA 4ZODA 1CFBA 3D12B 1S7XA 5I1LA 4PJ9A 1LO2H 2OMUA 4WEUD 1FZBA 5BJTB 4CVUA 2NPSB 4XFJA 1S7UA 3BZEB 2QV2A 1B6UA 2N0MA 3BP5A 4NCC2 2NW3A 3C8VA 1F8TH 3O9WA 1XTLA 1BGYJ 2YXVA 4ELMA 1AYOA 1UWXK 2VR3A 1KPUB 1PMYA 1DEEB 1MW0A 2O26U 4FXKB 4MDJA 4FNQA 4G6KL 4F9LA 5J7CC 2JB6B 2FK9A 5AUMB 3SDYL 3MRKA 5KAQG 3P3RA 2XQYG 3B5ND 5BZXA 2KSJA 3BPCA 5I24A 5MP6L 2ARJA 3RAJL 4R2GC 1T0OA 4BKTC 3MRIA 4Z7UF 1SHMA 3OR7A 4UDTB 2FYZA 2Y0CA 1KCLA 4XMZA 5C0EA 4IIQA 4E9LA 1QNZL 4HXAH 3S6CA 4BBWA 1M57B 5CJXC 2VM4A 1RPUA 3MRJB 1FSKC 3WFHA 3A0HE 3ATFA 4X98A 3HG5A 1J1EB 1MCEA 4P4KB 3GUFA 1E5ZA 4W70A 3KW7A 5JPMC 4D7BA 5CILH 3WO3B 2MOVA 3IDGB 3E8UH 3H1HE 1I9RH 4BUQA 2LE9A 3CMGA 2VUYA 2WQSA 4GUQA 4UI2A 4XC1L 4NQVB 2K3TA 4A1RA 3MACL 3DXAB 3W68A 1R3KA 3KL3A 4LPXA 4PGCB 4UM9D 3F01A 5DD6B 5AWNH 2A6KA 2NR6A 2NNXA 4P2CG 1ZJBA 3GSNL 4RGNC 4N5EC 3TNMA 4YDKL 4G6JL 4UQAA 1ACYL 1ZCRA 1KYFA 4KJPC 4BIKA 5JQ6H 4OIFA 3VXRD 1Q9OA 4W9ZA 1JGLL 1MIEL 4AC2A 4XNMA 3MXVH 4DZBA 2J8HA 2PAJA 3V6ZB 1U95A 4HGKC 4DKFH 1O6SB 3J2PA 4ZMNA 4AH2A 1BSHA 2QLYA 1M7XA 4XHJD 2OYIA 2YO2A 3K5SA 4L9LC 4AYFB 4R4ND 4TVUA 3VG0H 1OVUA 1NFIA 3ZUNC 3S88H 1H8OA 4RMTA 2AXTH 4MXVE 5HGBB 4M4PA 5C86A 3KHUA 3FQ1A 1JPFA 1T0NB 3OAWA 4FFZL 2VDOL 2DYPA 4AITA 3HTKA 3ZL4H 4JDEB 3HFML 4I85A 1VQ7P 2WUCH 4HKXB 5IMKB 1OW7A 1FNHA 4I1LA 1NFAA 2BFVH 1GZLA 1OCWL 4NJ9H 4UBDD 5ACMA 43C9A 1LK3H 1YYCA 2WZPD 3UBXA 4DNLA 2KLRA 3QFJE 1N6VA 1J10A 3QZPA 4DKAA 3SCMB 2AJXH 3O6QA 3VJ6B 1YMHA 1LT1A 1DUZB 3IAQA 3KYOB 3NA4A 5DI8A 4X7CC 1UADC 4XCCH 1HT6A 3ZSSA 3N9GH 4A7VA 4BQ8A 1LO5B 1NO4A 2WCSA 4MAUL 3VWKD 1SYSA 5CEZE 1XGPB 4HIJB 2LLNA 2V2TB 1I4FB 2FJSA 2NXZC 1S9XA 2G2RA 4JW3A 2XWBA 2GJJA 1B4JL 3U9PH 4WCYL 3MLZH 4KDVA 4RQQA 3DO7A 1A6ZB 3MQIA 3ULVL 2DS4A 1VF5D 1TTFA 5T33H 1MFBH 3PWPE 4MD0B 3HMWH 1BPVA 4AMKL 2H8PA 2WVUA 5IROA 4FQXC 1FC2C 4HWZA 5DVOA 4JHAL 5EU5A 2QFRA 4HUKB 4K7PH 5C08D 4KV5F 1K8DA 3HZMB 1XGTA 1A3ZA 1XD1A 3E6FB 3MXWL 1HDMB 3VCLB 3ILPB 3KPQA 4X6CF 1Z9PA 3HN3A 3K2KA 3L70J 2XXCB 1NC4B 3AXLB 4K7FB 5EZIH 5JHDE 1KELL 2XN9B 2B8OT 2WYTA 1AHKA 1WK0A 4K3GA 2HX8A 1F2XK 2VKWA 3GXMA 3H9HB 3HC0B 2VLJE 2BRRH 3OMZA 4PRAB 4AGNA 1J5IA 3QXVA 1SYVA 1B88A 1KBGH 2EO7A 3WHXB 4RESB 3LV3B 4Y7MA 1VQOP 4GW1A 1BECA 4NEHB 3WL9A 1J86A 2WGXA 1CI5A 2ZE0A 5IHUL 1G7IA 3WKML 1MCPL 3V4VH 4NC2B 1U3NA 1S7TA 1CYWA 3ML9A 2XG5A 4GUPB 5JHBA 2BVPA 5E79E 1NIFA 3MMEA 2O61A 2OTUA 3U4KA 3E7KA 2IFGA 4QHPA 1XX9C 3SO3C 2ZCLL 2DYSB 2HT4D 4XAWL 2VLRA 3MRQB 1QLEL 4L37B 4CW1A 4UT9H 5C0AB 1NEPA 1SQVG 2W88A 4OLVH 3SWYA 3CFKA 1XZ0A 1OP4A 1KXQE 1DFBL 1URQD 2YD7A 4JY4B 2G5BA 2KERA 4NFDA 3MBEA 3QPQD 3PY9A 4GAJH 4Q9RL 4EDFA 2FD6H 4PJGA 1BZOA 3VMPA 5FW7A 5FV2A 5I1CH 2OP4H 1G7HB 1KYOH 1MWAH 1N64H 2FHBA 2WXLA 3MC0A 2ZT9D 4DP9X 4ZMVA 1INEL 1ETZA 3G5XA 4PVMA 4Q6YA 4BE6A 2YPLE 1AXSA 1U3ZA 3WAJA 3T9WA 4F3FA 3BEWA 1UZ8B 1TO4A 5ABDE 2K9JA 4B5ZA 4NQUA 3OGCA 3Q2CA 5J0BA 2HJFA 2VDNB 1D5XA 3NSCA 4JQIH 2UVFA 4V1DE 5EC1B 2MCPL 2BHFA 1YI2P 3ASNB 2VYRE 4PRPE 3P3SA 3ZT7A 2F7PA 4IRZA 1I9JL 3H6PA 1RZKH 3DUUA 5DVNA 4BFKA 3WNJA 4EKJA 3C60A 4LVHC 1QFWL 1N7SC 4TF4A 1HVVA 3RK3E 1HXKA 3ECBB 4EZLA 3ULUE 3MJ8B 4MZRA 2JCCE 3STZA 4CAGA 3DX8A 3FOMB 2XTJB 2HN7B 32C2A 4PCYA 4Y19A 2OYHA 1GGIH 5A2LH 5EIIB 2N3JA 3P0YH 1Y47A 4KKRA 5J4MA 4RX4A 1ZVSB 3GO1L 5EO9B 3D51A 2DEWX 4B53A 2Z4QA 4XPHL 1MLCB 1PPJE 5D1ZD 3II6A 3X1NA 3Q3DA 4AYGA 3N44F 4HZLA 1JUFA 4OLXH 1S5LE 3HLAB 5APQA 4ZW8A 2ODHA 4KX7A 1GTFA 4U7JA 2E74B 2EIEA 3F7QA 1XV8A 3L71D 3HC3L 4OFDA 5BUAA 4K8RH 5FYJU 2KUTA 5FGBA 4HQQH 4NCDA 5FK9B 5HDLA 1CGXA 1DQTA 1NGMB 2YUWA 3FUEA 3N5AA 4JFDA 1FAIH 2I1JA 1NCCH 1T6VN 1UUNA 1ZY9A 2A74A 2I32A 2ZKYA 1N18A 3ALWA 4H88L 4O9HH 5HVHC 5GGTA 1MJUH 2AK4E 5GZOA 3ZDYE 1J1PH 5IQ7L 4ALAC 2VZVA 4I6MC 2V2WB 4LL4A 2K1AA 3ZT6A 4HSCX 4YO0A 2WXNA 1DDTA 3BUIA 3A23A 4PJ5E 4B9FA 4XO5A 1SQQE 4LARL 2CUMA 1EFXA 3IS0X 4JM4L 3Q1SL 2IGFH 4JFPB 1EJOH 3A0OA 1WBZA 1CL7H 1CVRA 4AG4L 4LL1A 4NENB 1HHHB 4OFIA 5LCVH 1HH0A 4GIOA 2KZWA 1U91B 2JKWA 3L3GA 1VACB 1KF9B 3MTRA 4DKTA 1RIVL 2AVGA 2YXFA 2BY2A 3BVWA 2L3BA 3EFOB 4IBZA 5FO7B 1HE8A 3WLWD 1AANA 1LE9A 1SQXE 3PP4H 4QR7A 1WA1X 2VABB 4HPHA 2FEEI 4DGIL 2TSBA 5LXGL 3CC4P 2G60L 3EGXA 1IL1A 4KXAA 4RMQA 2MFNA 3QARA 3GHGA 5E8PA 3M46A 1YYML 5KSBB 4XT1C 2Z34A 1UTDA 1KILE 3VMZA 3MOBL 3WSQL 2DD8H 4MA7L 1J9SA 4UQ9A 3SQBA 2PTTA 4W1TA 2XQ0A 2DOCA 3F7VB 3H1ID 2IWGA 1KG0A 3WU2E 3M0DA 2D0FA 2DBJA 4YDNA 4QHKJ 3ARFA 3GHEL 4NNXB 1M4KA 1FGNL 5E2VL 5ISZB 5KVEE 5LHDA 1YHPA 2CIIA 4FHJA 3LRSA 1EEYA 2I5YL 5CS7A 5EULV 5IBTL 4FNTA 2DLFH 1JXKA 3IFOB 5DD5L 4HULB 2WO2B 4EI2A 3CK0H 1E0OB 4DH2A 1WFNA 2A83A 2J58A 4E36A 4HD5A 4LEOA 1GC1H 4OF6A 1OT4A 5D2NA 4YWGL 1JY2O 3OJ2C 5DJDA 3QUZA 1NC2A 1OD9A 1ADQH 4M7ZB 4R7VA 4WO4D 4Y19E 5FUOL 5CSGA 1MG3C 1YMMA 4P23B 1ZAGA 3ISRA 2WXQA 2VDMH 2MKVA 4U6TA 4WTWA 1I8KB 4F7TB 1NYHA 1H15A 1BLIA 3G6JF 4X99A 4KI5E 3RGVD 3UROR 4HKBB 4LPWA 5C7XH 1JYNA 1FV1A 5D1QD 4O02H 5D72L 3OAYH 4FXGB 3S3SA 4D8OA 1T2XA 3N85L 1D7MA 2OXHB 3WUVA 3V0VA 4LCIH 2QM7A 2ZKWA 4NN6C 1T89C 5AOKA 4NQDD 3K72A 3BP6B 1F4AA 4J27A 1S9YA 3HS0C 3RURA 3QUKA 2HPOA 3BH8B 5F88B 5IVXE 2ZKHH 1WC7A 3RTQD 2NUPB 3OKLA 4XI5D 3MX0B 1UT2A 1FZCC 1A4KB 1ZSDA 1FZOA 2VL5A 3WNMA 2EZ0C 2ZOKA 2HAZA 5CGTA 2VLKB 2OW7A 5D7EA 4ZD3L 3HOGA 3SEPA 1QMUA 3QIBB 2Y6SD 5H4ZA 4NQXA 5AOZA 2NY6C 2EKSB 1GGBH 2W91A 2FBJL 1KQSO 4UYPA 1EZVI 3TT1H 4HEPG 2NZ9D 1OXYA 1YUHB 3U7WL 5ILTH 3AM8C 2YRBA 2CO6B 1XR8A 5HDOA 5HHVL 1FJKA 4HPYH 4NCC1 1FH2A 2PMZA 2EO1A 4AIOA 5A6MA 1FO0B 4F7PA 2XBZA 2AXWA 1U4FA 4KC3B 1QG3A 4R0LB 3BCCE 5BZZA 1RZPA 1EMTH 4A2EA 4KDTC 5M1BA 4EI5D 1SQPD 5GGVY 1NTZE 4WW1A 2VSCA 4K2UL 1UGNA 1UD4A 3BGFC 2VQUA 4ADJA 1I7UB 3VM7A 2DLGA 3HPJA 1KMGA 1KB9D 1MRDL 2EDFA 2X1PA 4LGPB 2FX8L 4M61A 4NC1C 3CLFL 3CBKB 4H7VA 1ORQB 1WBXA 3L73E 3V2NA 4WGVB 1FZKB 1PP9D 2VC2B 4UOJA 1OAZH 1UFUA 3EFFA 1LGHB 5DSCA 3OG4B 1CD9B 1NGWA 1ZK5A 1OF2B 5EOCH 2YD1A 1MH5A 4XC3L 2PW2A 4ZMXA 3PHOA 3LN5B 3RPIB 1E4XH 5BPPA 4APXA 3TEYA 2CLVB 3L74G 4FTVA 1NKNA 2X2UA 3SBQA 1F11A 2DF3A 4PWEA 4QRQA 2O5YL 4U1LA 1PCXA 4TVSa 5LGHL 3U1AA 2ESVA 5EZLB 4G8GB 2IGLA 4OZFG 5D7JD 1HZKA 1XF2A 3SQRA 5L6YL 5C09E 3IF1A 3G04B 3B2MA 4L4TD 1GK6A 4FL4B 4NB7A 3NIFB 1ZD6A 4A7UA 4H8PA 2HMID 3DTXA 4RMUA 1AQKH 5T3ZH 1F42A 5LBVA 2SEBA 4Z0XA 3HBQA 4CSPA 4PTTB 3VI4B 4RNRB 3QA3B 4WI0A 4GT0A 1JPSH 5IF0B 3TASA 4AXWA 3K2IA 3NCJH 4HWEH 1XCTB 1UB6A 5FC9A 2C9XA 1HZHL 1VRSA 2VM9A 4NO3B 5E9DD 1KIUA 1P9MA 3DKHA 4JB9H 3L5HA 3QEQB 2X3AA 2XJLA 2XVLA 1KTKE 5I6OA 2A9DA 2W94A 1KCSH 4XBGA 4D0BA 1G7LB 3UEZA 4KZ0A 2FCBA 1OSEA 4N90E 2FWOB 1WD8A 2Z31B 3HE6D 4WFGE 5DZPA 4YJZL 1FVEB 5KLVD 2CG9X 3W67A 2BOLA 2PUQT 2X41A 5F7KC 4KROC 2O01J 1RLWA 1U8HA 1H89A 2YPKA 2N7AA 4J3OH 1KACB 1Q72L 3ESPA 4P2QD 4UT7H 3U36A 1PL3A 3VO0A 1GZPB 2NQ3A 2KBGA 3RB5A 4IU2B 3NCXA 5IBLD 3EJSA 4QOKB 3QNXB 4Z7WE 4LLUB 4TOYH 4PJDE 1I3GL 2R51A 4FZ8H 4LCYA 1PQZA 1LMKA 3QEHB 1JE6A 5DRZA 3S4SA 4FG6D 1JWSA 3ZTCC 3MGNA 5EUOE 3TYYA 1CBVL 2B87A 1UA6L 3LZNA 4OW6A 1FHGA 5IHLB 5KKZB 3I85A 1QRND 3E2HB 4UOQA 4Y4KC 5DFAA 4AY0A 2P4AB 4HH9A 1EV2E 1M3JA 4FFYH 1L5GB 1INQB 4GIPD 3ULUC 2ZCZA 5K9KB 4GW4A 4J3XA 1B2WL 5GJTH 4BV1A 2OYMA 1QKZH 3CN4A 2IBZD 2NY5H 2RCSH 3QYCA 5IB1A 1LP1B 1MAMH 3J8F7 3CVDA 2QJKC 1A9EA 3H0TB 1SJHA 4M7KH 5AW6B 4GRMB 5D96B 2E5YA 5KVGE 1BOGA 1AZBA 2BJMH 2DRUA 4NUJB 2EIZB 2JQZA 3BC9A 3P0GB 2VSMB 4ABUA 1OT2A 5GRUL 3HR6A 1GZHA 2LAAA 3BMWA 4Y9FA 5IG7B 2ZXXA 5HYJA 3L71G 12E8L 4YLBA 2BCCD 1OAXL 1IQWH 2P24B 4WI6A 1AGFA 3DMMA 1TPXB 5FFLA 4IM8A 4LAQH 2DQTL 3MV8E 4DN4H 3M17A 4F9PA 2BXZA 3DIFB 1W15A 5GRJL 5DA0B 3ZHDA 5F7EL 4YR6B 1R8EA 2L7JA 1KZYA 1HKLL 5MHSE 3T3ME 1FAKT 1TDQA 2GK0A 4J3UA 4ZI8A 3FQRA 4JRYA 4HJTA 2J6EL 2WN2A 5FW8A 1NAMA 2K9FB 3DJRA 3ABGA 3HS8A 2JO1A 1QABA 5FGCB 3KBFA 1ZTXL 3CHXA 2W38A 2X09A 3EF4A 1FJ1B 2FBOJ 1O7SA 1LK2B 1U4EA 3BKML 2WAHA 4XP4L 3TFKC 4CNIB 2OR9L 3NN8B 1LE5A 4DK6A 1L0LJ 3I84A 3H9SA 4PJ7A 2ED8A 4WW2A 4PTUA 1VZHA 4OVNF 1A14L 3QHFH 3LZOA 3AEGC 4NHUA 4RWYH 4ZUUA 3EOYG 4AQ8A 2WCGA 4N8VB 3N44B 4MJIE 3MOAH 2CLZA 4ZZKA 5K9QG 3MLUH 5J57B 3GSXA 3WFDH 5A7BA 1BGYD 1YY8B 5E5UB 4GRLC 3QFGA 2KNCA 4P9HH 4PLKD 5FKPB 1MNUL 3TEWA 2N4IA 2Z1PA 3V4LA 4HIEA 3VQMA 3JWNG 4OAWA 3S2CA 2WXJA 2OMWB 2W07B 3VI3A 3GMNA 4QTHA 1Z56A 2BIHA 4Y4FA 5DO8A 3M1CA 1LTAC 1IBDA 2YAMA 3VGGA 2CJUL 2YD8A 1KILC 5IB5A 3PJSA 5DVMA 4FQIL 2EC8A 3H1IG 1OZTG 2E6PA 3EUDA 4M93B 1MI5A 2NLJA 5J5EA 4LHUB 3C6EA 1N2RB 3IPFA 4GFXA 1A4AA 3TX4A 4AV4A 2QSCH 2IAMD 4FKKA 1T5XB 1JF1B 3IMUA 4WUKL 2Q86B 4OLYH 4KQ4H 2B1OA 1HSBB 5HYQA 4Z95L 4LL9A 1DJIA 4B9JA 3GMRA 3V9FA 2IPUK 1IAIM 1MVYA 5HHOD 1DDHB 3GKZA 5BS0D 2FJFB 3V4UL 2KZIA 4UOW1 3K5BA 5D2LA 3QAQA 3F04A 1HHKB 2QJDA 4S1DC 3CXHJ 4LPUA 4TNVF 1ES0A 1I9IL 2D3NA 2FUQA 1B0WA 1RUKH 2YN3A 3BZDA 4TSAH 5E70A 4U1NA 3J07A 4CGUB 3Q9QA 3L45A 1FDIA 2R23A 1P4LA 3AUVA 5AEAA 4KO6A 3V5HB 2OI9C 2OTKE 1OGAD 1JGUH 3CQQA 2GJ6D 4DESA 3OKNB 4WKZB 1NGPH 4LK4A 1IK9A 4RKUJ 3GSUB 4KRLB 4TLSA 3OLDA 4MASA 3IFLH 1DL7H 1XF5A 3LAFA 2OJZL 3OGOE 4KQ3L 4B60A 5HPOA 2ATAA 4N0UE 3LSOB 4YLCA 2WXHA 4YK4C 5JHLA 1UM4L 1FOSE 4I18C 4B9IA 2BOBB 3AXHA 4PB0H 4DN3H 1GOHA 2EP6A 4NZUL 4B41A 3PHQB 2XKUA 1I8IA 3MRDB 2X0WA 1NDGA 4IK7A 4S1QL 1MHCB 1NSNL 1BSIA 4LNRA 1FAVA 3X13A 4N25A 3UJIL 5DJ8B 5T5FL 1T04A 3KPNB 3RGBA 1FIEA 3TBWB 2YXMA 2P9RA 5F0JB 2H3KA 4E5XA 2BVYA 4M1DH 1QHOA 1RZKC 2NNFA 3VI4A 1C1EL 3MNZA 4PWFA 5APSA 4RNRA 4U0RB 4WWPA 1A22B 2DQJL 4AM0A 5D1XB 1RU9L 3VGBA 5SV4A 3RK2D 2UXGA 3O2WH 4QKTA 4PRIE 3U6XS 3VXUB 1HWTC 5A2CA 2PYEA 1ACXA 4C46A 3NJMA 1F4WH 4YSUA 1X5GA 2Y5TB 1E6JH 1JEKA 1SQPG 1ZVNA 3SE9L 1FNAA 2BIOA 1HBWA 1QGKB 3MUUA 2D31B 1MFAL 3MJ9A 1K6QL 3CCVP 2Y69B 2WLKA 3I9PA 5K1VA 1RCYA 5TH2B 5E8DL 4FADA 2F2HA 2BK8A 1A4BA 3L3HA 4PG2A 3D3VE 4L3CA 4GS7C 4LSTH 2ZAHA 4OB5H 3ALXA 3TA3B 2QQNH 4KTEL 2V7NA 2HCZX 1CK0L 1LHZA 1PP9G 1KNOB 1L9PA 4XCEB 1CXKA 4QRPE 2E86A 1NOFA 5C0DA 3CWBE 4Y99C 1TQTA 4N2EA 1T5KA 5CLTA 2W9DL 3TURA 5D5ME 3VFWB 1IGFL 3CSYB 1BG1A 2VQ4A 3N50A 2CHDA 4EBQH 1X7SA 2OR7A 1FQ9C 4KUCF 4M3HA 3L70D 5F1KC 3PWNB 1CXFA 1CJYA 5FYJE 1LWHA 1I1AB 2GT9B 3WD5H 1EEUA 4D94A 4J4PD 5F1IB 7PAZA 2YSSA 4OQTA 4C57C 3OXRB 1DE4B 1NIBA 1M6OA 2EO9A 1AKJD 1T22B 2MTAA 5DLMH 1ZHLB 4LIQL 2G2PA 2BY3A 4W9DC 1SQQJ 1FG2B 3BCFA 3VAEA 2JXMB 5IEKA 2X4TA 3D39E 5KN5B 3MRMA 2BS9A 1U57A 4C54A 3MGOA 3RX7A 2QTEA 2Y06H 3ZE0F 5D7IE 1NAKH 3I2CH 4HT1L 1FLRL 5IP4A 2HLFC 4PLJC 1KD1Q 5JW3L 3RL0B 2V8LA 2JIXA 5J11B 2QQLL 2XTSA 3MA9H 1WFOA 3LN9A 4PGBB 2IQAB 3SBRA 2BSDA 1FZMB 4QRRE 2Z65C 3MZGB 2DICA 3PG2A 1EK3A 4NI3A 3CX5J 5KLVG 4OVVA 1SMDA 1KGWA 3UZVB 3T77B 1V3KA 3U6RA 1CLCA 4O9BA 1SDDB 4PV1D 1SOQA 2UWEF 2VDNH 5CIPA 3ZUCA 4G5ZH 1SBBA 3LKPA 4R2GD 3PQYB 5DFTA 2B15A 1D5IH 1SY6L 1ZA3B 3D4YA 1YEDB 4GINA 5E7BA 2R8SL 1BFOB 4M1CD 1WHOA 4WGWB 2GHZA 2W0FA 3ARPA 4XVTL 2ADFH 4JHBA 3TO4B 2RMNA 2EE6A 1K8IA 1TCRA 1SJMA 4GKSB 1C5DA 4L48A 1IAKA 1S72P 5CEXB 3JTBA 3CI9A 3PF2A 5B39A 1V3LA 4IFFA 1GL2B 1RURL 4LLQA 5D7SH 1ZT1A 4KKBD 3HUJF 2AEMA 1H88A 1OCOB 1T4KA 2XOTA 4DJGA 4EOWL 4M5SA 1DR9A 3CDGA 2ZX7A 3QPXL 3GM8A 4G8AC 4H8HA 2WQAA 3QUXC 1TT6A 4H20L 4O5LL 4FA7B 1N67A 4MCYA 2IBZG 1C8PA 3KLKA 3GQFA 3L1OL 3LH8A 3V52L 4RGND 4JJ5B 1X5JA 2CCVA 3GMPB 1F3RB 4X5RA 3OZ9H 3LPFA 4P05A 4YHLL 3NFPB 1E30A 5LBSL 1WZ1L 3O41A 4EAEA 4IBWA 5CGBA 3ES6A 1CDYA 4P57B 2NX5D 3H1JE 3CGTA 3D06A 4P46B 2BCCG 1MUJB 3JVGC 4OF5A 2NZ2A 4DQOH 2QKIC 1AIZA 4JM2D 1YEFH 3FB8B 5T3XE 5HHNA 5SWZB 4L5FH 4WY4B 2YPVH 2Z0UA 3ARGB 4OWFA 3VXMB 1SOSA 2AV7B 3I6SA 4N26A 3O6FD 3L7FA 4TULH 5AW5B 4AT6B 4R5XA 2VH5H 3BSZH 4B9CA 3D33A 1NKGA 3B71A 3LW5J 1AE6H 4P5KA 4XMVA 3CFJA 4X0NA 1IFHL 1UWEL 3PHAA 3C6LA 4I1NB 1LEIA 4OCWH 3C5ZD 3TM6A 1HKFA 3BQUB 2HB0A 4NQCD 4QXWA 3BJLA 3HG1D 4WRLA 3T0EC 5I19L 1PG7X 4RFNC 2LLGA 1FNEB 1PIFA 4UQ3A 4JUTA 4WWOA 3SDCD 1NEZG 1R33A 2GPZA 2X70B 4HBCL 3WEBA 1UWFA 2ARJQ 3UOAB 3ATEA 2KH2B 3D18A 3UIZA 4EPSA 4GKNA 3BUYA 2I7OA 3QJHA 1OCRB 1FNGB 4KY1L 1BGYG 1RF1B 2D7NA 4ESKA 5DEFB 1L6ZA 1P7QB 1LVEA 3BCCJ 3KXFE 3QXTA 4HWBA 4YSSA 4NQSA 1AGBA 1JPTH 2MHAB 1JK9B 1C5BL 1KFNA 1IC7L 1OM3L 4KAQH 4XPBL 4CC4A 3DX3A 3MFFA 1RMFH 2OA9A 1HEZB 2VDQB 3AS1A 3WIFA 5BQ7A 2VIRB 1V27A 1TNNA 4FQXD 4ZFOL 1NCAL 2IZ0A 3FUKA 2HX9A 3G7TA 4DP4X 5DMKB 3ZGIA 2XIIA 5ADPH 5DK0A 4UB8H 1MXGA 4EVNB 1ZLDA 4X0KB 1A9BA 1S7QB 3VGHA 3BZFB 3K80A 5DTFA 2BDNH 1P6WA 3QCUL 4AGPA 4ELME 3AAZB 3CV5A 4K55A 4HS8L 4UT6A 4XCFL 4WWID 3ZIYA 3MRBA 1F6FB 1L0NJ 1LP9F 1N86A 4V33A 3LS4L 4AW7A 1R5LA 3TBSA 5GHWH 4F8LA 1UJ3A 1G84A 1PEWA 2AEOA 2IQ9H 2NY1B 5I75B 5HHPA 1DHKA 1ZLSL 1KIRB 1EO8L 1KCVL 2XY2A 4DGWC 3K1DA 1HL8A 3FNKA 3FKUS 2SODB 4L1HA 3MUJA 3GIVA 3IDJA 4WU5B 2XPZA 4CU8A 5BMFL 1SXNA 4KZCA 5GRWA 3L5JA 2PO6D 4F57H 4YSAA 3X3FH 1F4XL 5F8QC 3CXFA 4KJWD 4X8JA 5EU3A 3QNYA 5BU8B 2C9UA 3B37A 1DVFC 3P9MB 1G7PB 5D7LD 3VXTB 3T2NH 5EIVA 2QJPC 3CIAA 4HIHA 4S10A 2R29A 4XP1H 4BQ6A 1NGXA 4NPYA 4PY8J 1UQSA 3LHAA 3PWVB 1L9TA 4GW5B 4WWKB 3ZL1A 1P84E 4K3JL 3U25A 2P5WD 5CJOL 4ZUVA 1PVHA 2F9BT 5A40E 1M1JC 5E99L 2FKWB 5M95B 2Z8SA 4HUNB 2GIXA 1IO4C 1L9SA 3SKJL 3L3OB 5IQLA 3X12A 5D71H 1KSRA 4G11A 1ORSA 2WAQA 3L37A 4L9DA 5DRXB 2OK0L 3HAEG 1XGQA 4RRPA 4YHKH 4H13C 2DWYA 1U93B 2HXAA 4OU3A 1JO5A 1FO0H 5L9DH 1V7MH 3VM5A 3WE1A 1J1DB 1EVTC 1JZDC 4U1GC 3DUSB 2XDJA 1N7SD 4Z8FH 2ENYA 1NBYB 1QSVA 4BH7A 1UH3A 3L95A 5TISE 5DHVB 1CCZA 4JHVA 1M2OA 5BV7C 4ETYA 1OVVA 4M03A 5H94B 1CFNB 3TF5A 4XCNA 4JDZA 1LTJC 3DNKA 3O4LB 4HA1A 2G3AA 3MGTB 2TSAA 3L9RB 3NJIA 3OR6A 2CLRB 4OH8B 2VC2H 3JVFC 4Z0BH 3SDAA 1R3JA 2ZWYA 3MLXH 2KDGA 2OSYA 4UUJB 4UWQB 3TT3H 5F1NA 4ENZA 5BRPA 1L4AB 1ED3B 3AADB 2IFFL 3MRCB 4BZ1H 2M3EA 1CICA 4JF7A 1CFQA 3NJVA 3ALPA 5GS0H 2X4NB 1EBPA 5KJ4A 3DLQR 5DJ2A 5DRWA 5KVFL 4Q2ZB 5AVWB 1KXHA 4QY8A 3I3BA 4P5TC 4DKDC 4HKZH 4IBUA 4ANXA 4FJ6A 3ARDC 5EU6D 5A16B 1OW8A 1ID5I 1ZHNA 1FZFA 4H8QA 4HV8A 2PP9A 5T1LB 2PP7A 3TGUE 1JGVL 3L70G 3BKJH 2VDKH 3VD3A 1BCCE 1YY9C 3M45A 4K9EC 2C0XA 4UV4H 3S5LA 2AEJA 2VDOB 3GBLA 1UACL 4MD5A 5B1JC 3U4EB 1EZVY 5GZNC 2X2HA 2HJLA 4N78E 1QSZA 4FHKA 2Q6WB 4AUYA 5BJTA 1EAJA 5GTIH 2NPSA 1RIUL 2WLZA 4HHWA 2ERJC 5ACZB 1XTMA 2IWKA 1Q1JL 4UIMB 1OSPL 2F53B 5L2KB 3KDPB 4P59H 2D3JA 2VZTA 3V0EA 2AMUA 3IDXL 5EC2A 3FSVA 1KPUA 2KXPB 1DEEA 2PKDA 3N3EA 4FXKA 4HD9A 1N12A 5PCYA 5CCJA 3RZCC 1ZV5A 3OKMB 5AUMA 4G9FB 3EJPA 5DUJA 4TQIA 3OKOB 2Q3XA 2AQRA 3BWUF 1XH1A 5IB2A 1CDBA 3D4CA 1YPZA 4XODA 4OIIL 2UY7A 3HE5A 2ZYIA 2QBWA 2EE3A 2MQCA 5GGQL 4AIZB 1FCCA 5IFHL 4UDTA 2Y2YA 3H3PH 4YEFA 2WLIB 4H1LB 1MCJA 1AP2A 2BP3A 1GGUA 3IE4A 4LOUC 2PXYD 4AYDC 3BWSA 4KRPC 1YEJL 1U21A 3NCFB 4IKKA 1WGOA 1VZGA 2C3WA 4IRSC 4LSVL 4P3WA 2IAAC 3IDGA 1SDAB 2BEQD 4N6JA 1J0HA 3T8MA 4NQVA 4X9YA 3VQ2C 1MCOH 4PD4E 3O8XD 2VLRE 3P3YA 3FO9B 3RB7A 2Y25A 2H9GA 4LVOB 5DD6A 3WJMB 1WG3A 2I25N 1HK6A 2X6UA 4ILDA 3AB0B 1U6AL 2M1KA 3OZLA 4FQLH 2P8LB 2OMTA 3LH2H 1A0QL 5F9OL 5I8OH 2BVEA 3MRRB 4I87A 1ZS8B 4KVCH 5JZ7C 3H1HD 2AZUA 3P73B 4WV1A 4PJGE 3AUWB 4MS8C 1VQKP 1MUUA 4AQ1B 2X1XR 1TQBB 3V6ZA 2FO4A 1R5WB 5DZ9A 1O6SA 4HBQA 2JV6A 4HK0B 4JRXD 2LR4A 3MV7A 4I13B 5DJYB 1KT2A 1HEHC 4Y9GA 2MOGA 3FU9A 3B3IB 4DO5A 4DUXA 1ZMEC 4OZIF 4GP8B 3FFOA 3IBOA 3ME0B 5GSVA 4AYFA 2R2CA 1ZE3H 1XXFC 4NLHA 5F3HB 1OV8A 3MNWB 4Y16B 5INCA 3MUGB 1A02N 3F7YA 3U9UB 4ZYKA 5HGBA 1QLEB 1SFCD 2AVFA 4HK3J 2XQYK 2UWEB 4HCRA 4LKXB 1THAA 1NUGA 2MSPA 3UABA 3L13A 4X4XB 4PJIB 4WF7A 4HKXA 2GI7A 3NZHL 5CR8A 5IMKA 3RRQA 5HGDB 3I5CA 2GABA 1IBHA 2YAFA 2APTA 3AT0A 3DETC 3MLTB 4NN7C 4PJXA 4PJ8D 1X5FA 1UXWB 4I5BB 4YBLB 3VFUA 4F2MB 1MV8A 4KUZH 1GPOH 3DWTA 3FH7A 4H25B 1PX3A 1QR1A 4WDIB 3SCMA 2L7UA 5ANMA 4HIIB 2PF6A 2PWEA 4TKWA 3WS6C 1DUZA 2EXSA 3KHOA 3KWUA 4BRVA 1IE5A 2EZ0D 4BDVB 2ZCHL 5J6GA 1TU2B 3A24A 1WS7A 4TUJB 4BQ9A 4Z7OF 1LO5A 2UVEA 5CHNA 5I1HH 4HIJA 3HRZA 2H6PB 1I4FA 2NY6D 4XNXL 4ZPVA 3IN2A 4MMZC 2XZCL 2DTSA 3QFJD 1AVYA 3UG5A 2J44A 4LCVA 2JLLA 1HNGA 4FN0A 3Q5RA 2XU9A 2FSEB 2YAHA 4WI9A 5CSZB 4MD0A 3WS3A 2MH4A 1EZLA 2JQMA 3IVKA 1RV6X 3NIGF 2XDHA 4AK2A 4OLWL 2ZX5A 3ZDZF 2QPUA 5CEZD 3E6FA 1HDMA 3MRHA 1AXTL 3UG4A 3VG9C 2ITDB 1O9VA 3IF4A 2XA8H 3AWEA 4PV8B 1A7NH 1PU0A 3C2SA 4ZQKB 5F6HI 5IV2B 1BF5A 1U8JB 3ZDXE 5LWYL 5IQNA 4XNZC 3ZRFC 1NFDB 5DQJA 5SWSB 3ARBA 3PWPD 2XN9A 1CE1H 1DVYA 3QXAB 3IAGC 4HSAC 1M56D 5ICZA 1NH4A 5DZOA 1RHHB 4KPHL 3WHXA 1FL6A 3AGVA 3LIZL 5IQ9B 3O9WC 4AKPA 1IFNA 4R90H 4LEBA 4OCYH 4KTDL 2NNAA 2H0FA 3AEAC 4KO7A 4ZDHA 4GIAA 1RJYB 3E1F1 4KITB 5JHDD 4GSDL 4EOTA 4KXZH 1U8IB 4GUPA 4PFEA 5D1ZI 3NFSL 1BVNT 1XH3B 5DK2A 2VLJD 3L7EB 2VXTL 3QEGH 4FQQB 4L37A 4OGYL 5JXED 1H3XA 3OB0K 1KXVA 3Q0HA 2B4CC 2A9AA 3HG3A 5C0AA 3I9IA 4I4WA 3IDMB 2W59A 3IJEB 5K93A 2DQCL 4YX2L 4P9ML 3PAVA 3UDWC 1URIA 4NC0B 4AENB 1C5CH 3D0VB 3B5NB 3BE1L 8PAZA 5E5LA 4C83A 4GMTL 1NUNB 1RY3A 1VGKB 4I0PA 1G7HA 1CN4A 5I18H 2J1ZA 4JPSA 2CHZA 1JHKH 1YEGL 1OW0C 1V5JA 2IGTA 5ETUB 3ABLB 1A1NB 1QWUA 1VHPA 3CCMP 5E03A 3CCHA 1UZ8A 4TSBL 2DBLH 3UAFA 2BP8A 5EO0A 3BD5A 1G2CA 2M5AB 4OTXL 5D2NE 1MHHB 2A3TA 3MNDA 4I77H 2K0RA 4KGJA 2HR3A 3G9RA 4UTBL 4XXDB 5AYUL 3WLBB 4G8FB 2OARA 5CCGC 1OB0A 1QYGH 3I50L 4NQEA 3QG6B 3QO0A 5CSBA 1T20B 1OAJA 1YMME 2WINA 2KZKA 2RJMA 4I88A 4TLFA 3ECBA 2RIKA 1KB5L 4ANKA 3T6VA 3GXDA 4UILL 5IVZB 2HSIA 3FOMA 4K94H 2K9UA 5K9QI 3Q8AA 2Y0EA 4UM9B 5EIIA 4Z7VF 1QLRB 3E9TA 1BJ1H 1JB0J 3FO1A 3FTGB 4V1DD 1ZVSA 1FIGL 5EO9A 9PCYA 2XTJC 2XWJB 4PRPD 1WISA 3VUAA 1PZDA 4WBAA 2YBRA 1JZ4A 4NDMB 3VXRB 3ARXA 4Y4KD 1BVLB 3IMBA 4MHHG 3RK3D 1R34A 2EYTB 3ULUD 3HLAA 1GW4A 3V5DA 4M7JL 2Z64C 4X7SH 3UO8B 4DP2X 4MKMA 5I76B 4U3XA 4WI3A 3U83A 4BZ2H 4CBZA 5I6MA 3VD7A 2X2JA 4M43L 4OUUB 5DJ6B 2VCOA 1X4ZA 1SQVK 1HINH 4B9YA 1RJZA 5KSAC 4G42B 3NA9L 3SKOA 1FL3B 1NANI 4ZSOB 1FYTA 1AR1D 4Y5VB 3SE4C 2GBAA 4WJKB 2OX5A 5IZ7A 3WXWH 2JKTM 4AV5A 1SPDA 2WTPA 3A7OA 4PV9B 2V2WA 3F8UB 1NMBL 4TQEH 3CFDB 3OB8A 3P4MA 5TDPA 4LLAA 1ZEAL 1CLYH 3LKNB 3WOVA 1OF0A 1TJHL 2IPKB 2XIBA 5EZJB 1LO3L 4MQ7A 3P1VA 1PNCA 3BXNB 1QO3B 3V4PA 4APQC 4IL6H 3BFWA 3FQTB 4OZHF 3CSPA 3VXOA 2AK4D 3VU2A 3MODH 4NJAL 4OGQB 1CD1B 1DJYA 5DHYB 1R4XA 1U91A 2QSTA 3WKPA 4XH2A 5JDSB 1VACA 1W0VB 3S1KA 4NZFA 2IC2A 3RWDA 5FO7A 4J28A 1E8WA 3EFOA 4GXVH 3LQMA 1TQVA 3VWKB 2GY5A 4RZKA 2ZKXA 4Z5RB 2HJKB 1KPRA 3L4ZA 3OX8B 4PJ5D 4ZPTA 3BW9B 2WUBL 1XIWC 2FTAA 15C8L 4ZOCA 3ILQD 5LGKA 4LGDE 4XP6H 1N6QL 1VF5B 3MRFB 3QGVA 3NJKA 5KJ7C 4S2SB 4EKXA 5KSBA 5H2BA 1SVCP 3KPMB 3G5VA 3Q9PA 4JFSA 4FTVE 3QWOA 2YD4A 4ISVB 1RE3C 2WVVA 5C08B 2G4GA 4EI6A 3RKDC 1T83A 3L3JA 3QORD 5JQHC 3F7VA 3O3AB 5DUMH 2ESVE 4LDEB 1SQXD 1IFGA 1OVZA 3FN9A 4OGXL 5B22A 2RBLA 3I6LE 3HI5H 3KJ6L 4NNXA 5FUZH 1AD9A 3UZQB 1G0XA 3RA7L 5CLYA 4RSYA 1J1XL 3X1BA 5ISZA 1FC1A 2ADGB 2FO8A 1L0LK 1OAUL 4ODUB 5HDWA 5T1MA 2K8QA 2VE6B 1KILD 3GDCA 3L2LA 4KZEL 1NU1J 2V2XB 4D3CL 5IOKA 2PR9A 3WUZA 2Z92B 4P48A 4MXQC 5E2WL 2R2HB 3WN5A 4Z7IA 3V55A 3IFNL 2DM7A 3GHPA 4F8OA 1ESOA 4YSPA 3QH9A 1AYRA 2Q87A 3UIAA 2B1HH 2OL3A 2FFDC 3G9AB 1AGEA 5TF1L 1HXMB 3HD7D 1JSYA 5JW4N 3H1HG 3RY4A 2KZBA 3AREC 2WP3O 3H9YA 1KC5L 1KB9I 1CF1A 4W7ZA 3LXCA 2IOOA 3POHA 5D70L 3NG5A 5JXAL 1IX2A 2OTPA 4K71B 1HC1A 1HOEA 4S1DD 2YJQA 4FXGA 2XX1A 3FQ4A 4JFOA 5IJVA 4Z7UA 1KENH 3QHZL 3SQOL 4TM9A 1DSYA 2AW2A 5LGYA 4EXKA 1CIUA 2QEJA 3T4YB 2VQ1A 2WWKO 2ADIB 3CFIC 1BX2A 1S3RA 3FF7A 3TIEB 5FM5O 1OE1A 3HUSC 5DD3H 4JNXA 4FNLH 2EH8L 5AVXB 1F00I 3VFTB 2BOCB 1Q9KB 4KI5D 3C60C 1IGCL 1A4KA 5D9SB 3JTTA 1W0YT 4OJAA 2DM3A 3GF8A 3WMM0 1KIQB 4JFFA 3BVNA 3QIBA 4ERSL 5JORB 4GI8A 2WLLA 5ERWB 3VRJB 1BF2A 1DD3A 1DBML 3RL1B 2AJYH 3OKEA 4C56A 1YUHA 35C8L 4M3KB 3STLB 2VITB 3AXIA 4L18A 4R5TA 5C6TH 4R96B 4UOZA 3DROA 3E80A 3MYJA 1FBMA 3BIKA 1A3QA 1LNUA 4Y5XB 5HYJE 4R0LA 2GUOA 1BLNA 2Z6FA 3WEMA 5GGSB 2FWLB 4OZIB 3FXEA 1IEAB 3AROA 2VMFA 2BIIA 1HF9A 5B66E 3G08B 5CEZL 1PZSA 4WHTB 4Y2DA 4KHXH 1I7UA 4P2YA 3CN0A 5D1ZB 3W57A 1S5IH 5KBLA 3ZKXC 3RPBA 1FLTX 2A74C 1IM9D 5C9KA 4UM8B 4JRYE 1G6RH 1FZKA 1V55B 1UD8A 3FT4B 4UV7L 1AFVL 5DZVA 3WEXA 4BHUA 3HJ0A 2BHZA 5EUKB 1QSFA 4HOMA 3JCUE 3CSGA 3LRLA 3S5ZA 4EZKA 2V9TA 1NTZD 3QULA 5CMAA 2ZP9A 2EIDA 1JV5A 4HMCA 1DQMH 3FCTB 3W0WA 3IETA 4LLVB 5KJRH 2QIWA 4R7DB 4XCYA 1DX7A 1QA9A 2D73A 4PLNC 2AQ3A 3W5NA 3K8LA 3H9SE 1HJBA 4PJ7E 1NTKE 2EYRB 3GRWH 3L73D 3LHPH 1KQGB 2NUTB 5GS0C 4RMVA 4X80L 1H3GA 3QDJB 2IBBA 4FNPA 1I53A 3AE5C 5EZLA 4FAAB 1W72L 4OLZL 4CN4A 4BINA 2A9BA 3TGUJ 2IBZI 4GMSH 2XU6A 3S36L 5I30H 1VPOL 1BCCJ 1HESA 3VFNB 1LJ2A 3OMNB 5A6LA 2R3CA 3TFBA 2YGQA 3N40F 4MAYC 1MRFL 2VT0A 3QA3A 5IF0A 2Q9IA 3VI3E 5DT1L 5IBUG 1XCTA 1X5HA 2GUVA 2CU9A 3WUWB 2F8IA 3NIGB 4ANWA 1JHLL 1M9WA 1U3HA 4HUXA 1MI5E 5C09D 3B4SA 1KJMB 3R8BB 5A2FA 3ZDZB 2P28B 4GY4A 1I3RB 1G7LA 4G6KH 1WFUA 1CZ8L 3SDYH 1BDYA 4X6CA 1KBBA 2Z31A 3M0DC 3F2LA 1AJ7L 4NP4H 3ARFC 3RBZA 2F1EA 5EZOL 4PLJD 1QLFA 3DX2A 4JL1A 5MP6H 2CHWA 4IDJL 1XXDC 3HE4B 2X5PA 5FAAA 2HP4A 4L74A 2VLLB 4LCWB 4M5ZL 1E7UA 2F74B 2HVKB 3QUHA 2ZCKL 4QOKA 5D2LE 4ZTPL 2GSIB 1ET7A 4BRYB 1KJ2A 1YQ4C 4D9QE 4ZMOA 3C2AL 1QNZH 3QEHA 5L7XL 2EKJA 4N90D 4YN3A 5D2NC 1SVFA 4N1EA 5KANG 4AM0Q 3WFCL 2P8MA 3KGRA 1WH0A 4WKXA 1E40A 5AD0A 2MCAA 3GG2A 1J88A 4LF3A 5IHZB 1HTYA 1L5GA 1INQA 3F58L 4X8XA 3RLSA 1MDTA 1UD3A 2BSBA 4XC1H 1YNKL 4K15A 1DJSA 7TAAA 3ULUL 5DHVH 3QDHA 3KGSA 2P80A 4HLEA 4G8EB 2NXYC 4WU7B 4Y5YB 1ROWA 5C92A 1SMAA 3GSNH 4GRMA 4WO4B 3VD1A 4NUJA 4G6JH 1ASOA 1KYOE 5C0BB 1ACYH 4YDKH 1W5CE 5HYSA 2W9LA 5DZNA 5BRZD 1JGLH 1MIEH 1IGJB 4PREB 1UXSB 5D96C 3BP4B 4ELKB 4FFTA 1TFPA 3RGVB 1TZGL 4JMNA 2X9WA 3VXPB 1HQRA 3HMXL 1SOXA 1TEYA 1DEDA 1CE6A 3B2UC 4OCNC 5EV7A 3QT2A 4YR6A 1PPJG 3BGMB 4NQDB 4XRCB 4XR8C 3V0HA 4D0CB 3WJJA 2DQUL 1F5WA 4KMQA 3PV6B 3U2SB 5ECGA 4ZG1A 4LXFA 3RTQB 4LVNB 4C4KT 2YA0A 3NDYE 4KMLB 6PCYA 4FFZH 1B90A 2VDOH 3H9ZA 2RAMA 1U92B 2GUYA 3HFMH 1FJ1A 3VXNA 5CLWA 1LK2A 1YAIA 3AQXA 3MJGX 2PYEE 3MV8D 5E6ID 1QPXA 3M6DA 4FMVA 5F9DC 1IC4L 4CNIA 1ZV2A 3TCXA 4U4BA 1OCWH 4QHMB 4Q52A 3OB0H 4FNRA 1MY5A 4PVNA 3TNNB 5MHSD 2FX9L 2H3XC 5F2FA 3UTSB 2ICWI 1H6UA 1A7PL 4GQ9L 2LKMA 4ZS7L 1EAQA 4PAZA 3VTAA 2QL1A 2HG0A 4G6ML 3T0ED 1MOEA 1PFIA 3QWRA 2ED9A 3CHSA 5KS9A 4D0DA 4PH8A 1YY8A 4MAUH 4IIZA 4WJ5A 1SQQG 4EI5B 4MNGA 1T1XB 4X6DF 4CU6A 2LW3A 1B4JH 4WCYH 2OMWA 3QWNA 4DEUA 2W07A 3DI2B 2CUAA 5B38B 3ULVH 3UPRB 2M26A 5TQ2H 4MJID 4AMKH 1IQDA 3HPLB 3O6ML 1TJIL 2CH8A 2Y7SA 4JHAH 3R18A 1SQXG 3MNVB 5ENWB 2A06E 3K2MC 2XFGB 2EDRA 2FYNC 4LHUA 3FL7A 4K7PL 5EEWA 4PMEA 4PB9L 2RH0A 3DGGB 1RFDL 3MXWH 4XO4A 5T5NG 1T5XA 1JF1A 3QSKB 1YQ2A 1PGQA 1Z5YD 3K8MA 5CD5D 2KLSA 3VGDA 3DOIA 3ETBJ 3B9VA 1CGTA 5MI0B 4KGLA 4HU8A 5K1NA 1N7ML 1N4XL 5KVEL 2VN5A 1ECZA 1SEQL 1DDHA 1LDPL 2FJFA 3CVHL 2DI7A 3COOA 3EJZD 5D7JB 5TDOA 1QX1A 1D9KA 3IFMA 3MTUE 2IOIA 3BN9C 3EH3B 3UC0L 4CVZB 2F8VA 1LGVA 1DJHA 3WFZA 1P9MC 1NCWL 1IGIL 3TBYB 3MLRL 5IHUH 2Z8RA 3HKZA 4P5RA 3WKMH 4PJ0H 1MCPH 1N68A 1V3JA 4IU3A 3NCEB 2HKFL 3ECUA 3OKNA 4QPEA 3GMLA 1KCRL 2X28A 5GTHH 3GSUA 2JQAA 2CMRL 2ZCLH 4L2LA 5F7DB 4XAWH 1N5AB 1QLEH 4BFIA 3LQZB 4XVUC 5E6RB 3LSOA 2RMZA 1A21A 2Y7NA 4QNPF 2F1BA 4JPZB 4DHLA 5C0CA 2L7EA 1OKEA 3DX6B 3M86A 4G72B 2BOBA 3ZZ1A 1DFBH 3P11L 3QZOA 4YNYA 3HE6B 3FUHA 3PHQA 4G3YL 1TKWB 2B5IC 4I2XB 3V0FA 1RUQL 2Y3NA 2HVBA 1J0IA 4JY6B 2ZXBA 3NOIA 4B96A 1AHMA 1DQQB 4IOIB 4P2QB 3RIFK 1MHCA 1RP8A 2JB5L 4URKA 4JZJB 3F7KA 1INEH 1T2QL 2W27A 2BSSB 3Q43A 3KPNA 2XICA 1XTGB 1JIBA 1SXAA 4GIFA 3TBWA 2WMPB 2XQBL 5EORL 2MCPH 4YEEA 3RY5A 1I9JH 1YBKA 1QRNB 1TQUA 1CTOA 3KPRA 1QFWH 1R5IB 2A77L 5ID1B 1WO2A 4OCMC 1GZHC 4H13D 2XV6B 2Y5TA 3G6JA 4HS3B 4KRMB 2EEBA 2H1PH 5D1XC 3R19A 2D31A 2IOMA 5L0QC 1GGIL 1XT5A 2BHYA 4TUKL 3QRFM 2HG5A 4KI1A 5AVRB 3GO1H 3MBWA 5C0IB 2WD0A 4H44B 2WWMD 4XPHH 5HJDA 4ZOEA 2CRIA 2AZAA 2N1TB 2C1PB 2Y6TE 2H0JA 4BZ2A 3TA3A 3UCRA 4I9XA 2V7QH 1KNOA 2XZZA 2YFNA 3CFNA 4PRID 3BCCG 2BMKA 1Y0LB 4W9FC 4TL5A 1BSNA 3ZSTA 4ETQA 1NTZG 3M9BA 1EHKB 1ZDQA 3QDMA 4NZTL 1MHPL 3T2LA 4LSSL 3HN5A 4FRWA 3PUUA 4MA1B 2IALB 4P06A 2X2YA 4LKCB 1YITP 4NERA 1UGKA 3WJLA 3T04D 3C1LA 1KYDA 1HI6B 3D3VD 4H88H 4PP2B 4RDQF 2WXIA 3L73G 3GS7A 2E76C 2AFNA 2DIEA 1FWXA 2BNQA 3L35A 2GT9A 1I1AA 4QRSB 1ZT7B 5EOTB 3V2AR 5IQ7H 1MJUL 1F86A 1IAII 4ONFL 2NY0D 5F1IA 1MW2A 2FVNA 4QRPD 1EDLA 4F7EB 3K6NA 3CWBD 2BCKB 2GSGB 1TCMA 1T22A 3ARDD 2EDWA 3EYFB 3IWUA 1OB1B 5CINL 1RJCA 4NT6B 1U36A 2G9HB 1FG2A 1ZDSA 5DJZB 1U3JA 1XWVA 2BNUA 3O3EB 2L7QA 4ZXBD 3RDTD 1M71A 5EU7C 1IGYB 4LARH 3WY3A 4JM4H 3Q1SH 4NAJA 4JO2L 5FYJD 1N59B 2VDRB 2V33A 2KI6A 2ZYHA 1WGVA 4AG4H 1ZV8A 2I24N 3EYQC 3FF8A 3FH8A 1XL6A 4PRBA 3CZSA 1PZCA 1RIVH 3Q06A 4YDLB 3GSOB 1NEUA 1O6VA 2JJTA 3SE8L 3RZCD 1I1YA 4P3DB 4X6FB 3C9NB 2IX7C 3D39D 1O7DE 4DGIH 5LXGH 1LEKB 3T77A 3FONA 2G60H 1KTDB 5DU7A 1KB9K 1NQBA 3WO4C 1D7CA 4AYBA 2IH3B 4K23L 1GKEA 4Q14A 3MOBH 1ZA3A 3GNML 2WLHA 3WSQH 3Q2NA 1QEXA 2PN5A 2FIRT 3ARYA 4MA7H 4N9OB 4P2OC 3F05A 3EOAB 2SPZA 3VYOA 3TO4A 4HJEA 3BUPA 4QRRD 1CG9B 3D08A 2AQNA 3HNTL 4JRWA 3MRPB 2GCYB 4GKSA 2IAMB 4LOUD 3HZYB 4NRYB 2VWEC 4E41A 5T3ZE 5CEXA 3B9KA 3GHEH 4NZDA 4ZFOB 4GUOA 1FGNH 3JZ7A 5E2VH 2E5EA 3TPKA 4IRSD 4X7FC 3THML 3UERA 2I5YH 2ZAGA 5IBTH 5HHOB 2R0ZL 2WPRA 1OXZA 1WEJL 3U1SL 3TWCL 1ET5A 3B2PA 5BS0B 1TETL 1GL2C 5DD5H 2B3RA 3IXAB 4JPIB 2NT0A 3CZFA 1JD9A 4W68A 1ML0A 3PJNA 2J2ZB 2LFGA 1TQCB 4YWGH 3GMPA 1E2VA 4WHYG 5L4IA 3SKNA 2GFBB 2OMVB 3TZVD 4NO2B 2WZ6A 5FUOH 3WEAA 5JZ7D 1OGAB 2CBMA 1G9MH 1CTNA 4MS8D 2GJ6B 4A7GF 5KVGL 4P46A 3S34H 5HHME 1S8DB 2XV2A 3FTVA 1NBZA 1EC5A 3BFQG 2VR4A 1JL8A 2D03L 3BPLB 3C6SB 3OKDB 2BRQA 4EF3A 4AEEA 1RAMA 1MZZA 1AQ8A 5D72H 1IKFL 5DJAB 5C7XL 1T1ZA 3N85H 3TJHC 1NOLA 4JZNA 5I5JA 4GNKB 2EDJA 1GW0A 3VFSB 1CFTA 4AT6A 1NTME 1L7IL 4GAYB 2FB4L 3HLKA 3RFZB 3R06B 4LFHD 5KLVK 4ZNEA 3H1JD 3SDXF 2ZUSA 1NBVL 1ZN5A 1QVOA 4M5TA 1I1FA 4UB6E 3AEBC 3G9VA 3K81A 5T3XD 1U8NB 4BZYA 2C9RA 4EUPB 2Y9YA 2W65A 2X4OB 1FNEA 3DETD 2FYUJ 3HAEB 2J8UF 4ZD3H 1ECYA 2X2IA 3IGAB 3BQUC 4K4KA 2DEXX 3WTUA 3WUUA 1FUNA 5LNEA 2FBJH 1N8ZB 3ZW3A 1MREH 3GF7A 3HI1A 2K1MA 1ZR2A 3U7WH 2MNWA 4W9KC 5HHVH 4WUUB 5CBAA 1VQNP 1GCFA 2WV3A 5C6WH 4HJGA 2MHAA 2V3EA 1JK9A 2X4PA 1YTZT 4KHXA 3SKMB 5IESL 5EEVA 1JMBA 3H85A 3PRZA 4QWWC 5AOIA 1OP5K 1FFOB 3ETBF 4K2UH 4A63A 3QC5X 1HEZA 3A5VA 3FT0A 4UQ2B 3T8VA 1E5YA 3LD8C 1MRDH 1KQFB 4WFHE 3CLFH 3DK2A 3UBFA 3WIHA 3ZQXA 1LL1A 3KXFD 3PWUB 1Y07A 3KE0A 4ONGL 1HNFA 3PL6A 4EVNA 1NVOA 4X0KA 1JV2A 2ED6A 2H0PA 3ZKND 5I8CA 1AZCA 4JQXC 1S7QA 3S3JA 3BZFA 3RL2A 4PJAF 3EJJX 3AAZA 3DTUB 4XC3H 4NKDB 2CNYA 3S9OA 3VX0A 1F02I 1JGIA 3UAAA 4HOXA 2ZQKA 2FH6A 3CLWA 2PRRA 1A25A 4HDIB 4X8CA 3LRMA 4PJ9D 2UXFA 4YZFE 1YPZE 1Y8AA 1CC3A 2J5UA 5A2BA 2VRAA 1MCQA 2P5EA 1TTRA 4MHHI 2RFXA 2O5YH 1QQDB 2R69A 2W0KA 5LGHH 2WOBA 1IGTB 3TIDB 3O9WD 4W9LC 2OFQA 3B8EB 3NFQA 3EYVA 3HW7A 4PBXA 1XSIA 2APFA 5L6YH 4DSYA 3CD6P 3B9DA 4EN3A 4Q97A 3BKYL 4M8VA 4Y9BA 4X6DB 1BMGA 2LU7A 5EFWB 3QR1A 2YA1A 1XSJA 2NY7L 4ZFZB 1JM0A 1KN2L 1LWUA 5IHHA 1ZT4B 4GG6F 2NT1A 3L81A 4IKIA 3P9MA 1G7PA 3U46B 2WZ7A 5FDWA 1HZHH 1FNSL 3RWJA 2WJ7A 4FI8A 5JNYB 5I17A 2F15A 4L1SA 3AY4A 2RD0A 3C08L 3WDIA 2X3CA 2E6QA 3AU1B 3VH8G 1RXLA 3KR3L 4Y2OB 1WCQA 4R2GB 4PIBA 3L3OA 4WJG3 1Q72H 1H9DA 1H5BC 2EC9T 4W4NA 5FA4B 4QT5B 3ULSB 4U6HB 4L8CB 3Q2WA 3MV7E 4H2CA 3HJEA 2VN7A 1FSKB 1P84D 2NR6D 4DGYL 5JIPA 5JPMB 1ZTMA 2D0GA 2R1XA 4XMPL 2J4WL 1CBVH 1UA6H 5AVUB 1NBYA 5G4MA 5I66A 1NLBL 2ZUQB 4TLKA 4MA3B 4YH6A 5I1JL 4EI0A 1N0LB 4QD2E 1CFNA 1B2WH 4ODHL 5BV7L 4Z7QE 3S3DB 4ODVL 3P8MC 3O4LA 3QIUC 3US0A 3I6KB 4RGNB 3MGTA 2Q8BL 3LZFL 1KY6A 4NZJA 3R1GL 2MQ3A 4LSPL 3UGXA 4PJXE 1KYOJ 3CN1A 1A7QL 1XSKA 1VCAA 1XBDA 4UUJA 4XTRC 3MHZA 3T3PB 1OWRM 4IEFB 2B9BA 1L4AA 1ED3A 3MRCA 3UJJL 1ITBB 4MTMA 2NX5B 1BYNA 4R83A 4N2MA 3AE2C 4KVNH 5AKSA 5GRUH 5ANME 5DJUB 12E8H 1GAFL 2B14A 3NH7L 1OAXH 4Q2ZA 5DC9B 2DYPD 3L2NA 1FFNA 3CBJB 2H0EA 5ELIA 4GXUM 1QX8A 2A38A 5IJKC 4HS6B 3GK8L 3B7YA 4J3TA 2DQTH 5KSAD 5A16A 4L9LB 5T1LA 2A45G 5G5DB 1JWMB 2QADD 1QTYT 3ITKA 1AHWB 5T8IA 5GRJH 5DFWH 3O6FB 5F7EH 5D8JL 3VP9A 1CQYA 4FFZA 1HKLH 2GIMA 2EYSB 3TPUB 3U4EA 5C0FA 2ZUVA 4M7LL 4K9EL 2J6EH 2R1YB 2OYPA 3ZO9A 3CWBG 3C5ZB 4UTAA 5F7AA 3JV6B 4JVPA 2Y7QB 4NQCB 3HG1B 1ZTXH 2G75A 3ESUF 1WAEA 4HCIA 4F27A 4QYOA 3RL0g 4JFVA 5L2KA 3BKMH 4OV5A 1R24B 1Z5LB 4L4JA 3SDCB 3TGUD 1JWUB 2OR9H 3IK2A 5CJ8A 1FS0E 5HD8C 4G9FA 3WHE1 3SGDI 1JMXA 3OKOA 2LHAA 1DBAL 1A14H 5HI3D 4CC4C 4N78D 3MD0A 4X6BA 4K73A 3W37A 4TNWF 3AITA 1OANA 2LABA 3TS8A 1DUYA 1E9PB 2XN9E 1SQBK 1I8AA 2H8PD 5CBOA 1GVIA 1ZJAA 1MRCL 3HB3C 4TN9A 2DN7A 3UAJC 2NXZB 4H1LA 3WFDL 2CDGB 3KHQA 5FECA 4AKOA 3BYTA 5AL0A 3S37X 1GY2A 1WAAF 1PZ2A 2OR8A 3ZTJG 1M7IB 3MAWA 4PJBB 3D69B 1AIFB 5GGVL 3ULVC 1QBAA 1NANH 1OZUA 1Z9MA 4FQXB 1P7HL 1F0LA 5B3JF 2CJUH 3V6BR 1RLBA 4HHAA 3QR0A 1CBJA 4FQIH 4NN5C 3FO9A 2MMXA 2GG1A 4ZMAT 4NPFX 5IHWA 5C0AE 3QRGL 4Z77B 1IUZA 2BSCA 1BQHA 1FP5A 4YSRA 4LQFL 5LN8A 2UX7A 3V2PA 2P8LA 5DQ9B 4WUKH 4H5SB 3SSUA 3F3HA 3OKYA 2PNDA 5ESVB 4XWGL 4Z95H 3P73A 4ZT1A 1G1CA 5C0GA 5JOPE 3HA0A 2NPLX 1P1ZB 2QSQA 1KB3A 2CO1A 3QUML 4R7NA 4AQ1A 1XBRA 4MXQD 3V4UH 4PD4D 2FQGA 2VLRD 4HK0A 1UH4A 5DJYA 4OI7A 4Z9KB 3P69A 2QPFA 4AW4A 2HFEA 3B3IA 3F12B 5C3IA 3D71A 1I9IH 5E4EC 5KBMA 3RI5K 3BIAX 2H32A 1DQJB 4GRWH 2VNCA 3R7RA 3MNWA 4Y16A 3MUGA 3MBED 1G1OA 1Y18A 5HI5D 3SO3B 2OQJA 1I85A 1BIIA 2VDLL 2ZWSA 3BKCL 4PJCF 4F2FA 4NQEE 1JGUL 3SYQA 3KPLB 2OJZH 4KQ3H 4MZ3A 1WIUA 2HPCA 4NO5A 1Y1DA 1U3YA 5DYOB 3O2DA 5HGDA 3FQWB 3KPTA 3D4ZA 1UM4H 4JFEA 1SJEB 3VA2C 1AACA 2NW2B 4I5BA 5T3XL 4BA8A 2E6JA 2YKPA 4LFHG 4D9LL 5KZCD 3H1JG 4H25A 4NZUH 5IJDC 4YE0A 4WDIA 3GSVB 4L8SA 3ZZQA 3H7LA 4HIIA 1EXJA 2CO3A 3C60D 3DO4A 4S1QH 3HUJA 2RN0A 2Y07L 1IRAY 1NSNH 3RWEB 5KSVB 4TUJA 4DCQB 3TC9A 2ZSWB 3UJIH 5T5FH 3VYPA 4Y19D 2XPGB 4U6YA 3KYAA 5I0ZA 2IADB 4G5AA 4H8WL 4PWGA 5DUBB 1VFBB 4LLYA 4RX4D 3OVUB 2AJZB 3OSVA 3CZJA 3IBEA 1ZOXA 1NWQA 4LVHB 1FYTE 3QRBA 1N7SB 3QWQB 3SDAC 3DV4B 3VGFA 2FSEA 4X6EB 1C1EH 4U6XB 3A4DA 5CD3A 3H1LE 1U8CA 2DQJH 4JG1L 5A6IA 3EO9L 1RU9H 1T6AA 3TA4D 1MF2L 1T0PB 1KB9H 3II1A 3KWVA 3UL4A 2XWRA 3NCMA 4HKJA 1E3ZA 3N43F 1EQWA 3BVUA 3L4CA 3SE9H 2HH0L 5HP5A 1BE3D 4NO0B 4R3SB 1TZIA 1VJSA 4XB8A 1MFAH 3RBSA 1K6QH 3V95A 3KH3A 3TVMA 5IV2A 5E8DH 5FO9A 4S11A 3PPEA 5EEUA 4JFDD 2E7LA 3U0PA 4IGBC 2CPCA 5SWSA 2ID5A 2Y0SA 1S9KE 1OSZB 4LLMB 5KANI 4K3HA 5GZOD 1ASQA 1GCYA 1E2WA 3SDXB 1LDSA 4Z7NF 1OE3A 4BD4A 1PZAA 2JKSA 4OSUL 3JWOC 3LZLA 5IW3A 3AE8C 4X7EC 1BZ7B 1NKOA 3QIWA 2W9DH 4MBOA 1JGDA 2OSLB 4UZSA 1IGFH 2J8UB 3BIBX 2XV3A 2CKBB 4HJUA 5HVHB 2OSXA 1CF8L 1EFXD 5CBEB 1UZ6F 3MR9A 5FO8B 3F6IA 5DJCA 1NCOA 2PR4L 4Q0XL 1NU1G 4WI2A 4ODWA 1NDMB 3L7EA 3VFPB 4FQQA 3ZLQC 5KSBE 5IEHB 1F58L 3BDXA 5BQDA 1YZZA 1IEHA 3M07A 3BAYA 1WZMA 3BZ4A 3IDMA 2FRGP 3K4ZA 2WK2A 2B4CL 3EGDA 4R7XA 3D30A 4LIQH 1MXDA 5IB3B 4YHML 1IAOA 3MBXL 4XX5A 4AYEC 4FMFA 3F00A 1G5AA 1JN6B 4YXHL 3MREB 1DLFL 3MHVA 1KLFB 3CC5A 5K1JA 5ISZE 1IKNA 5D4QA 2QR0A 4HIXL 5EA0L 4UB8E 4ODTL 2YOAA 3H1KE 1D5BA 3QNFA 4HT1H 1FLRH 5CJ5A 3EO0B 1OIOA 3B8YA 4QUOA 4D2NA 5JW3H 1TF4A 5ETUA 5EOCJ 5ACLA 2YLHA 4NUGL 1HHJB 2P2UA 2AQTA 2QQLH 3W82A 5DYFA 4IOIH 1U8KA 2BXYA 3CUPB 1J05A 2M5AA 1LQBC 2V4LA 4YBHA 5K39B 1MHHA 4PJAB 4ZK8A 3WLBA 3ARFD 4XXDA 4RISL 3O6KL 2ZYSA 3I75B 1DANT 4LRIA 3ENEA 1P5VB 4IS6B 3FU7B 5DFVD 4BKLB 1F1DA 3QUYA 1LP9A 5GS3A 4RVBA 3ERXA 4J7RA 5IVZA 1W2BO 3KW8A 1SS1A 2W81C 1SY6H 4J8QA 2YQGA 3SGEI 4M8UA 3CDZA 3R4DA 4LBEB 4XVTH 4GQQA 3K6SB 4WNQA 5DQDL 4Z7UE 5F9JA 2VN4A 2XWJA 1NC2D 4JLRB 2WWWA 1F13A 3DO3A 3T09A 4QRTB 4JO4L 1RURH 2JEEA 1AXIB 2GBTA 1OP5H 2OTWA 3V6FB 4EOWH 3HVDA 1HCZA 4CMMA 4ZFFB 2RHEA 3QPXH 4G80B 4JRXB 2XUWA 1T2KC 4O5LH 4H20H 43CAA 3IDIB 5APUA 2C3GA 2G3MA 2O1JA 5CP3A 3FYIB 3L1OH 4FJYA 2NXYD 2XACC 1A3LL 4G42A 4O2FB 3V52H 4HUUB 1FL3A 1HL4A 4JFFE 1IU1A 4F7KA 4YHLH 2EDTA 3VSQA 3NJFA 4JM0A 1WZ1H 1SFCB 1G9MC 4N2AA 1XCWA 4R4NC 4L2YA 3FT3A 1DVSA 4J6RL 3HHSA 4C56E 2WSCH 1IBGL 1F90L 4F20A 2YXRB 2JJWA 4UDUB 2GEEA 1H8AA 2B7DT 4HIQA 4WFEE 3BAJA 5I6LA 4IJ3C 2IPKA 4A39A 2FQDA 1RPQA 3B2UD 5EZJA 4O58L 2ZONA 4KFMA 3KCPB 4PJ8B 4N5UA 2IH9A 5F9AC 3BXNA 1QO3A 3SE3A 2A6IB 3HS0B 2O30A 3FQTA 3HRZC 3UBXG 2JKIS 3DRQA 4J1UB 4LOEA 3MNMA 5L8LB 1CD1A 1UWEH 1XF3B 4JKNA 4ZO7A 5DHYA 1JTTA 2J5LC 3C8HA 3VOPA 1W0VA 4EZMA 4IMKA 3FSZA 3CDCA 1IFJA 4XGZB 5FHBL 5D6DA 1S9VA 5I19H 3TGUG 4A38A 5KYXB 1TLMA 1QSFE 1WFIA 4Z5RA 1BCCG 4WY7L 3M9HA 1QPPA 2RB8A 2OYLA 4JG5A 4K07A 1J7VR 2CPUA 2NY6B 3BW9A 3INUL 4IRJA 5INDA 4M00A 3CMEP 4HBCH 3W0WE 3QFJB 1X5ZA 2YR3A 1A02J 2YGOA 1MCIA 3CH8A 1EUTA 2P43B 3EDFA 3HIZA 5L2JA 1V10A 2WTRB 4P2RB 1SF3A 1AGCB 2DWDB 2E56A 1ZR4A 3NUKA 4M62L 4KY1H 5I71C 4Z1MH 1BZDA 3W2DL 4LPYA 1AQDB 2DV6A 2R2EA 1C5BH 4G43A 5FA3B 1OM3H 3BGFB 1BQUA 4XPBH 3V79C 5HHXL 2R32A 2ADGA 5IW6B 4ODUA 4BFEA 3EG9B 2VE6A 3PWPB 2AP2A 2ZG2A 4F8TA 2FLBT 5DXWA 4R8WL 1AO7A 1OIPA 1NCAH 1Z66A 2V2XA 4HGWB 5E8OB 2OMZB 2Z92A 3EADA 3FB6B 1BEXA 4ACPA 4KKAD 2R2HA 3QI9A 5CP7A 3QCVL 2IDFA 3I6LD 5JUEL 1RULL 2R2BB 2VZSA 1R0AL 3QCUH 4KV5E 4ZO9A 3RY6C 5B7FA 4HS8H 4XCFH 3WGVB 1SP4A 5JHDB 3CZLA 4JFQA 4X6CE 3BD4A 3BP7B 4PRDA 3LS4H 1W72B 3A3YB 2H2PC 5CKGA 5FYKU 2ZVOB 3GS0A 2GSMB 1QR4A 2BSRB 2F5AL 3RZWA 3GMAA 3SSGA 4XMWA 1FNLA 3PIQB 4AYID 4N1HB 1KTCA 4OF7A 1BM7A 1HQ4B 2IQ9L 4JE0A 3TTYA 3CU7A 4QOKE 1ZLSH 2MWCA 4G7VL 4BM7A 1T03L 3CCSP 1EO8H 5APVA 1KCVH 1U33A 4RBPK 1CDIA 3T4YA 2B2XL 1RZ8A 5E1IA 4JR9L 5D93C 2G3NA 1VL2A 3T4AA 2BVQB 3SWKA 5BMFH 1URQC 4M5YL 2EE2A 3NIDF 1EZVD 1JFQL 4XB3A 4ZAKA 5CUSL 2E46A 3VFTA 2BOCA 1F4XH 1Q9KA 1R3HB 2WY3B 1FL5A 1QASA 4XVUD 5F3BB 4HWNA 4IRZL 3SDDA 5D9SA 5DRNA 4QMAA 3DVNB 4Y0GA 2ZT9C 2O6FA 3T2NL 1FZEA 2FJUB 5JORA 2L91A 1SHWA 5HY9B 2E4TA 3T8XB 5DDHB 2WHVA 1SDYA 4K3JH 5D6CA 5F6IB 3N1GC 5CJOH 2UZYA 3HAEH 4MRCA 4YQXH 2J1XA 3STLA 5E99H 2VITA 3OAZK 2BWIA 2C7FA 5ICYA 3TONA 3M8OL 4RAUB 4YHNA 2Z8WC 4Y5XA 4GEIA 4HMDA 5A2IH 2OK0H 3H32B 1JZ7A 2WO4A 3PLYA 3FT2A 5LGJB 1D5MA 4I0KA 5IVOA 3JZYA 5GGSA 4OZIA 1GU4A 1IEAA 2C1OB 2XXMB 4NS0A 4PRPB 5JYMA 4U05A 2W6JH 2EIBA 2DWEA 4QXTB 4AV0A 1A47A 4LESA 2IWFA 3VDBA 2MOQA 2E75D 3ARZA 1ZPLA 1X5MA 4Y4KB 5A43C 4L4VA 3V6OC 3RK3B 2JCCB 1FH5L 3IMWA 3MV11 4UM8A 3CZEA 1USDA 4WVRA 3IKCA 1AMXA 1CUOA 2XNAA 5EUKA 2EEFA 4DPBX 5HYJD 1SXZA 2FYYA 5FF6B 5FGCE 1X9QA 2QJKB 4HMEA 5TGBB 4ECNA 4BQCA 4LLVA 4R7DA 4YHIB 5GISL 3EFDL 3WKNA 2ED7A 2OZNA 2N7BA 2DIBA 4OV6F 2WANA 1USQA 3HCVA 5IHBA 3B9AA 2IFFH 5ALCL 2IPPA 1ASPA 1G1JA 3QDJA 3FOLB 3TH2T 3RHWK 4OJEH 2RTTA 5KVFH 2DYRB 3EGSA 3L1GA 2ZAEB 3B83A 1QI4A 5IMMB 2WNGA 5KS9E 4NKQB 4MYPA 3VB8A 3T2PA 1JGVH 4RFEA 4MNGE 4EMZA 3ASOB 2Z9TA 4LPTA 2X9XA 3H9SD 4CVXB 2E76D 1E4JA 1NTKD 4WEBL 2PPDA 2AK4B 1D2OA 1UACH 3HG0A 5C0ND 1ICTA 3OC8A 5HJ3B 2DQGL 1RIUH 4PYHA 1K9TA 4M8QB 1Q1JH 5D7KE 3WUWA 2YWZA 4HJ1A 1A8ZA 2EXTA 4DQAA 1BJMA 3NGBC 1WBYA 1T83C 2CXKA 1KJMA 1IM3A 3IDXH 4N0FA 2YKQA 2BC4B 1EEQA 3N43B 2N9YB 3QW9A 4LSQL 3B6SB 4R26L 1BA9A 4H4NA 1AGDB 1J9RA 3WLWC 3RVVD 4NKOA 2XA3A 3IDNA 4JKKA 3CPWO 2OMYB 1EGJA 1P7KB 2CO7B 4OIIH 3EYQD 4Y4FD 3DBXB 2C26A 5F97E 3JWNC 4LCWA 2F74A 1ZWIB 2HVKA 5GGQH 4ZNCA 2EXYD 4GRLB 3BJ91 5IFHH 2YK1L 1HHGA 4Z7NB 3TBBA 1MI5D 2P1YA 1BMZA 2RA1A 5KG9A 4E42A 3IN0A 3WN5C 3RAJH 4ZQTA 4OI8A 1TXKA 2OV0A 1YEJH 4WK2B 5DEZA 5A7EA 2J73A 5DVPA 1JY2P 5F8RC 5DJ0A 1D6EB 3UTTD 5I0YA 1KLUB 4LSVH 1KILB 1BQSA 4O2CA 4YHOL 5IHZA 4W4OA 1TZHB 5KUKA 3IMVA 4UMGA 1G4MA 2F7IA 1UASA 3BDYL 3L75D 2GKIA 2HUHA 3JUZA 2IBZX 1MCOL 4K9JA 5AOMA 4D9QD 2Z3FA 4H0HB 4F7CB 4MFHA 4Y5YA 4OFYA 1RZIA 1U6AH 1H19A 2YKKA 4RAVB 5C0CE 4DVRL 4J3OF 2ENSA 1GMIA 2D8KA 5C0BA 3PLNA 1A0QH 3MO1A 2V5YA 5F9OH 2UYLA 3CVHB 4LLDA 1PW3A 5FOBA 4ZUSA 4KXDA 4KJQD 4PREA 1GZQB 1X3DA 1UZGA 2XVGA 3BP4A 4KVCL 4ELKA 5AAWA 1FORH 3FB5B 3HNVL 4E9YA 3UFIA 3PGCB 3PHSA 3LZQA 1ODUA 1DJWA 1DN2A 1VQ4P 1E5UI 3T1WA 2R7EA 3KPEA 4H2AA 3RGVC 1DZ0A 1P6FA 5D1QC 1IVTA 3BGMA 3REVB 2BZ7A 2OI9B 2VISB 2HLEB 4D0CA 1LJMA 1T5WA 2GYSA 1D5ZB 2KIKA 5DO2D 5IKCA 2EDQA 1PSKL 1KXTB 1JK8B 3KYMB 3RTQA 5B21A 2P58A 4NSKA 3KPRE 1U92A 2RQ8A 4YK4B 3CLEL 2YQ2A 2NYZA 3TJHD 1EHLH 3NZHH 4MDIA 5DMIH 4XI5C 2Q5UA 1ZLEA 3G6JE 4G6FD 4I18B 3KD4A 1G1KA 5C6PB 4QHMA 5D4IA 4Z7VA 3TNNA 4XNDA 4FFWD 3G6AB 5AW9B 4KNUA 1QUPA 5HXMA 3UTSA 2F1AA 3BEVB 4CDHA 3O3DB 1A02F 3VYNA 3FFCD 2RQEA 2Y6SC 1VQLP 2KDYA 1V54B 3IGKA 3JXAA 4YDIL 2NZ9C 1T21A 3L3IB 2ZCHH 5DMGD 2PYED 2XYBA 4Y1AA 3EDJA 2QJYC 1BAGA 1T1XA 5ITBL 3QDME 3QJFA 4XO9A 4ZJ9A 4XNXH 5I1HL 3B7RL 5DS8B 5I1DB 5F3FA 1BIHA 2YSTA 1VA9A 2M8XA 1W0WB 4LCUB 1BD2A 4DVBA 3UPRA 4GUCA 1OAKL 3H1LJ 1IM9B 1U8PA 2ALWA 3KDMB 2BNQE 3HPLA 4A2DA 3T71A 2ALAA 5E0QA 1EXUA 5ENWA 1RE4C 5SV3A 1HZLA 3BX7C 4OLWH 1F6AA 2W60B 2KI7B 1E5WA 4X9BA 5APWA 4ICXA 4X5WA 5GSRA 4U7KA 3WGUB 5LWYH 1XMWA 1GYCA 4OZHA 3GD1C 2EUXA 4XN7A 2RGSA 5FKAB 1BQLL 2WSPA 2H3NB 4UU9A 1JCKA 2VRSA 4Y99B 4N2FA 4C7NB 1Q9WB 2A06D 4H26B 1KY7A 3GI8L 5DEGB 4KPHH 3NZ8B 3VN0A 3JV5A 3LIZH 3KMDA 5T1JA 5FIEA 5E1AB 2C9VA 1K04A 3TBYA 4JPWL 1J8SA 4KTDH 4YFLF 1YEKL 2DI8A 4GP4B 4GSDH 2H2SD 5EFIA 3RVXD 2HMIC 4OF0A 4YBQC 3DX7B 4RLDA 4CUCA 1CGSL 5F7DA 4OGYH 2VXTH 1N5AA 3H4HA 1NTDA 2LTQB 3MGAA 2JIXD 3AZUA 4L0ZA 3S5YA 1IGML 3FSOA 2AJ3B 2DQCH 1TU3F 3DX6A 1S78C 3WY1A 4YX2H 4P9MH 3IJ7A 3FO2B 4U1MB 3WELA 4E41E 1RZFL 3PTZA 5JW5B 1K5NB 3OLIA 4FKHA 2FIKA 3BE1H 2K8MA 1G7QB 4I2XA 1AZVA 4GMTH 3CVBA 4JY6A 4AZUA 2R44A 4P2QA 5E6UB 1SLXA 1M90Q 2V7HA 1Q1PA 1OQXA 2HTLC 3ML8A 1WT6A 2ZX8A 4JZJA 3B2XA 1A7OL 4ONHB 1GJWA 1N70A 2BSSA 2VW7A 5JYLA 1KTMA 3HS9A 1SQXK 2ICEA 4TSBH 1AS8A 3FULA 1MCHA 2FT8A 1XGRB 4OTXH 5I16B 3S4SG 4Z3IA 5KYYB 4I8DA 5AYUH 1RIHL 1YLBB 4UTBH 1CPUA 1RK0A 2VR7A 4U1HB 3I50H 5E94B 5HVFB 3OAKA 3SN6N 2YD9A 1UM6L 2IXQB 2XI9A 3L16A 1KB5H 2AV1B 3EJYC 5A2KH 3LRHA 4UILH 4Z7WB 3MZWB 4QTIL 1P5UC 3MRGB 2CE6A 3EAKA 2EDDA 4PJDB 1YEHL 4LU5L 1H0TB 1BF8A 2ADYA 1IJDB 1P4IL 1R6VA 5D4HA 1OO2A 1FIGH 1YC8A 4EDXB 2Z93A 5EUOB 5IMOB 4OZGF 2QLVB 1FJPA 1K8AQ 2LQRA 1JTHA 1J18A 2N1TA 3WJJC 3KEHA 5BRZB 2DQFB 4ZNEE 3P30L 5DF0A 1UB5B 2V9QA 3KS0H 3EHBD 1E9OB 1OHZA 3LMJL 3NIDB 3QUXB 4I2LC 4M7JH 1J0JA 4DOHE 1N6UA 1BVZA 2XN0A 4TPRL 3CFEB 5LBSA 1JZFA 1NAML 4J2QA 4M43H 1L3NA 5MEQA 4I3SH 2IALA 4JO8A 3P77B 4XMKL 3CNKA 3NA9H 4LKCA 5CCHA 3A0BH 5AW3B 1EDYA 4XTRD 3UYOD 1Z9NA 1DFXA 1F41A 1HI6A 4PP2A 3BQVA 5J13C 2VDMB 1W2KT 4MA1C 4JHUA 4NRZA 2FBWC 5AAMA 1H3UA 1ZT7A 2QKIB 1OY3B 4G1EB 4X5XA 4FD0A 1U8MA 4N8CL 1NMBH 2GSGA 1NWPA 3EH1A 4LHQB 4TLTA 1QWNA 2HRHA 3MV8B 1ZEAH 3KNBA 5LQBL 2YKLL 1TJHH 2FUTA <