4TT3H

The pathway of binding of the intrinsically disordered mitochondrial inhibitor protein to f1-atpase
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
40
structure length
40
Chain Sequence
SAGAVRDAGGAFGKREQAEEERYFRARAAEQLAALKKHHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP synthase subunit alpha, mitochondrial
publication title Pathway of binding of the intrinsically disordered mitochondrial inhibitor protein to F1-ATPase.
pubmed doi rcsb
source organism Bos taurus
total genus 14
structure length 40
sequence length 40
chains with identical sequence I, J
ec nomenclature
pdb deposition date 2014-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.500 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4tt3H00
2V7QJ 1GMJA 4TT3H 4Z1MH 1HF9A
chains in the Genus database with same CATH superfamily
3AE2C 4GDOA 2N9YB 2CPBA 4OVNF 1FC2C 3BRVB 1LP1A 3HD7C 3MGNA 1K8AQ 2IPPA 2J5UA 1M1KQ 2OYIB 5KAFH 4RO0A 2JEEA 3RK2C 5KLVK 3Q5SA 2PRRA 1SQQD 5AW3B 1EZVD 5AVTB 1VQKP 1JEKA 1CW5A 3CC4P 3P8CD 1GW3A 2OTJP 2YMKA 2IDBA 1JY2O 5BVZA 1CI6B 3HE4A 4UB6E 2JWAA 2ZVOB 2K88A 2W83C 2O1JA 3EFGA 2LXCB 1KC8Q 3IFMA 4PD4D 1VQ9P 3I56P 4ZMDA 2CPSA 1KTMA 1YJ9P 1SQQE 4ASWA 5KLIB 4H13D 2Q5UA 2UWJE 1EZVE 4PJ0H 3VMZA 2OTKE 2E42A 1NH4A 1JY2N 2KLUA 4IOIH 1SQXG 2E75D 3SFDC 3CLQA 3WU2H 2W8ZA 3P8CE 3MD0A 3JSVC 1FS0E 1M56D 2FXMA 1QGKB 1FU1A 1U57A 4H13B 1GTWA 5GTHE 2GUSA 2FBWC 2E75B 3H1KD 3CX5H 3PH0A 4PD4E 4WBAA 1FOSF 3H1LG 3PJSK 1SQVG 4W7YA 2R5BA 1TU3F 1SQVK 5B5EH 1RF1C 1Z56A 4R4MA 1KV4A 2P2UA 3FWNA 1HWTC 3F89A 3H32B 4I7ZB 3D70A 1OXZA 1RF0C 1LWUC 4OH8B 2R3SA 2E43A 3MP7B 3N4XA 2MJZA 1H8AA 4KHXA 1JTHA 1N2DC 3H1KE 5APTA 2WTYA 2LXBA 1S3JA 3G6EP 1NOHA 1H89A 1KFMA 3KQGA 3CMEP 2D2CD 2O3JA 1NU1G 3B71A 3KPEA 2OARA 1U7MA 5KAFE 1AA0A 1NTMD 1VQOP 3Q1MA 2LR2A 2XU6A 1T8ZA 3H1JG 1G2CB 2M5AA 2PFXA 1SLQA 2M3EA 5CMZA 2ZT9C 1QLED 2D2CB 5B66H 1RE4A 1S72P 1EDKA 1OFCX 1SS1A 3LW5H 5TJHA 4N78D 4OGQD 2N1TA 1KB9H 5CCHD 1PPJD 1SQQJ 1E79H 1ZN5A 2B89A 2GM4A 3RK3D 2JDIH 3GG2A 1PGJA 2ZYDA 2ZXXA 4OGQB 1N7SD 1BCCG 3U59A 1URQC 2Q3EA 2KOGA 4N78E 3T97B 3H1IG 3RK3B 3L70G 1PPJE 1DD4A 2Q7CA 3O8ZA 1X8YA 3SWKA 1N7SB 1H0TB 1N73A 1MV8A 5GTIH 2A06G 1BDDA 2R5DA 3PHLA 3RK3E 2B88A 2V7QH 1M90Q 3O6QB 4AQRD 2QIWA 2GA1A 3G9RA 2P7JA 2A45G 2ZAEB 5B5EE 3FXDA 1LP1B 1VDFA 2M3BA 3MIWA 2LKMA 1W2BO 1NTMK 3G3ZA 3H1KJ 4MN4C 1K05A 3FX0A 5BU5A 2R44A 4EI2A 4JYCA 2Z4EA 1PGPA 2B9BA 3OW2O 1NKZB 1NTZG 1OMIA 2OYIC 4JYBA 5AVUB 1GL2A 2IYPA 4H44D 1A02F 1KB9D 3VYIA 2QJYB 3U1AA 5E79H 3GHGA 3AE8C 3B5ND 4YTPC 3CXHI 3TK1A 3AEGC 3FGAD 1N86A 2XNXA 3HRNA 3VP8A 1H88A 2G8YA 1LTIC 2YMYA 3CCRP 2ZJSE 3ITKA 3TGUG 2PP6A 5B66E 1XTCC 3B5NB 3H25A 5KKZB 2W6JH 5KAIE 2I8DA 2WSCH 3AEDC 1HJ0A 1RE3C 1NTMJ 5KLIC 1KB9E 3L71D 3CCLP 2WZ7A 4Y28J 3A0BE 1Y8AA 4BXLA 1WRGA 1S9KD 2KSJA 4I6MC 2XKMA 1PIXA 2Y9ZA 3AE4C 5CCGD 1T3UA 2YXQB 4H13C 2K37A 4U3FD 4L74A 3VTPC 1JM0A 2BEQD 3TSIA 3GF7A 2E75C 1GZLA 3OJAB 1L0ND 1GDTA 3M0AA 3L72D 2NPSA 2BEZF 2FYNB 3V2PA 3L71E 2KSEA 1LTJA 3V2QA 4WVZA 5CBOA 1L0LD 1FJKA 3PTZA 1S9KE 1FOSE 4I7ZC 2Z5HA 1YI2P 5APSA 2JR8A 1JTHB 5TISE 4U3FE 1Y9BA 2IX7C 1SVFA 4I1LA 3PLNA 3CCQP 3K5BA 2XV5A 3L72E 2PAJA 4DZOA 1L0LE 3HE5A 2AEMA 3QWOC 2P1JA 1KQGB 3GW6A 3L74E 2WSFH 2IZ0A 4DCKA 3A2AA 3G4SP 3USSA 3A3YB 4RESB 2D2CC 3P8MC 1NAFA 1EDLA 5KJ7A 2QEXP 3M0DA 3QH9A 3LW5J 2I1JA 2QE7H 1IC2A 4EIJA 2WPQA 3BCCG 4PV1D 1KYOI 3CWBG 3V6IA 3BRTB 1LTSC 1L0NK 4WY4A 4IL6X 1RY3A 2ITAA 3TYYA 1BGYG 4UB8H 4OGQC 2FYZA 3EWKA 5CCHC 3CD6P 3RGUA 4PV1B 2HYNA 4KJMA 2AXCA 2XDJA 3LIEA 4GOEA 4O9BA 4A7PA 3RK3C 1LTBC 2C9NY 1DEEG 1R5SA 2YKQA 1N73B 3L71J 2E5TA 2AXTH 4HH2A 1N7SC 1GD2E 4L75A 3VMYA 1VF5D 1MKMA 3CMAP 2C0WA 3SWYA 2WSSH 1MFTA 1SQXD 1SFCA 1FZGA 1BSHA 2QJPB 4U3FJ 1IZNB 3PRJA 4NPDA 1G1IA 1VF5B 1L0NJ 4ASVA 2HPCB 2G3AA 2E76D 1M8OB 3L72J 3WUUA 1NTKD 1OZHA 1T2KC 1EDJA 1NO4A 1DH3A 5KLVG 2KIKA 1YTZI 3A0HH 1IK9A 2KS1B 2OYHA 2IZ1A 1JCCA 4W80A 3CL3D 3HD7A 3GHGB 2YKPA 3AE1C 1VQ8P 2QJYC 1HTLC 1M57D 1SQXE 2YKOA 2E76B 1P84D 3M06A 5AVQB 4IFDK 2WPRA 2QVAA 1HF9A 2ZXEB 1KORA 4JF7A 1NTKE 1CSBA 4H44C 1Y47A 1LJ2A 3ABVC 3B5NC 1EDIA 5AVSB 4BRYA 3V2RA 2N9BA 1ZV8A 2WSCJ 1VQMP 1KILD 1FZFA 1KN7A 2A45H 2H89C 1NU1D 1P84E 1KZUB 1FBMA 2XZRA 3CI9A 3G71P 2W90A 1JMMA 3H1JD 1IFNA 1JMBA 3BATA 1KILB 2ZYGA 2IBZD 1NAYA 2Z5IA 5DJTB 1LTTC 2YO2A 2JJLA 2E74C 5CBNA 1DIPA 2B87A 3L75G 5EFWB 2FYNC 2NZ2A 2HODB 1KILE 1BDCA 1BSNA 5CCGC 1IFDA 1NU1E 1LNQA 1AQTA 4C7NA 1SQQG 4LLHA 3C9IA 1SQQK 2FFDB 3BASA 4B86A 3H1JE 3Q2YA 4TT3H 1EC5A 1USEA 2IBZE 1RF1A 1RQVA 2YO3A 1SQBD 5APXA 1PGQA 3A7OA 3H1ID 3HTKA 3PP5A 3HE5B 1FZEA 1RF0A 1LWUA 1JO5A 5CJ4A 1PV3A 3CCJP 1FDMA 2QM8A 1YHQP 1YQ3C 1SQXJ 3A0HE 3Q3DA 1YBKA 3HUSA 1EZVI 3C1LA 1IFIA 4WY4D 1A02J 3V5BA 1SQBE 1NTKJ 2W6BA 3L73D 4XA4A 3H1IE 2OQQA 3IAOA 3IF4A 3OAKA 1NKNA 2WSEH 3H1KG 2QA4P 4C7RA 2BCCD 1NTZD 4WY4B 4PD4I 3CX5D 2GUVA 1PL5A 2MKVA 2WVRA 4PJ0E 1J1EC 3VMXA 1ZR4A 5AW5B 3WU2E 3NXSA 4IL6H 3U1CA 3NMDA 4PV1C 1K9MQ 3L73E 1PFIA 3MHVA 5KTBA 1IFPA 1SFCD 3L37A 1DD3A 3ZDMA 4ZNCA 3A5TA 2YNYA 1X79B 3AE3C 1URQA 2BCCE 1NTZE 3CX5E 3EFFK 5APUA 4DJGA 1NU1J 1G1JA 1QEXA 3CPWO 1SFCB 2C9LY 3VMAA 1NYHA 2HG5D 3H1JJ 1X0TA 1NTMG 2W27A 1S2EA 1VQ7P 3HD7D 2WQYC 2FY8A 3D6YA 3WMM0 2QRXA 3RL0D 4RJTA 4U7JA 2KLVA 1U7JA 4HJGH 1FDIA 1LTGC 2OYHB 3S9OA 3HD7B 3CCUP 3AE5C 1K04A 2AEJA 3F5HA 1AFOA 3GHGC 3RL0B 3H6PA 2P10A 3I55P 2FXOA 2E76C 2C0XA 3M9HA 4DOJA 1UIIA 4K35A 1PP9D 3HE4B 4YXDC 2WT7A 1SQBJ 1R5LA 4AYCA 2E5YA 4I2LC 2W6AA 3RBXA 1FAVA 3H1IJ 2Y0DA 1SQPD 3EQ2A 5AVVB 3IR9A 4CPGA 5DJUB 4YXWH 2Q3IA 3AE9C 2H7HA 3M91A 2FYUD 1L4AA 2H43A 1Q90D 1YIJP 1CI6A 1YTZT 1BE3G 4D6TG 4GODA 4JBZA 1Q7YQ 1NGMB 1PP9E 2YXRB 5AW7B 1GW4A 2WMMA 4ZKUA 1IO4A 1M1JA 3GMAA 3L73J 1QVGO 1VQ6P 1RE3A 3JCUH 2O01N 1SQPE 1KILC 2AEFA 2B87B 1YQ4C 2BCCJ 1NTZJ 2Y9YA 2FYUE 3AE7C 3P7KA 2RMZA 3VP9A 5AW1B 3FWLA 3NFQA 3BCCD 1YYCA 4C7NB 2K9JA 5GTIE 3CWBD 3L74D 1FZBA 3AE6C 5AW0B 3H1HD 4M3LA 4L73A 2FFDC 1BGYD 3JC22 5CJ0A 4H0LD 1ZW0A 1FZCA 1OW8A 1IFJA 1LTAC 2WWWA 2O01H 3H32A 2ZFCA 3BCCE 2O1KA 2WPSA 2N1TD 1S4XA 4H0LB 3KYQA 1UIXA 3MUDC 1PGOA 5CHXA 5AVXB 1GU4A 3CWBE 1OIPA 1KQSO 3HUSB 2KI7B 4Z1MH 3M9QA 1AQ5A 2M5AB 3FXEA 1MFZA 1QL1A 3H1HE 3L71G 4C46A 1KB9I 4XFJA 2XNDH 1BGYE 4WB4A 1W5CE 5E79E 2M0BA 4XE5B 1LT9A 3M0DC 2N1TB 2WPVB 5AW2B 4EYYQ 1NVOA 2JKVA 3OA7A 1HGVA 2L5GB 4UB6H 2QSIA 4ZKPA 1VQNP 1G2CA 3MTUE 2KUBA 1KQLA 1L0NG 4IFMA 4WY4C 5KLVD 1ZR2A 2WSEJ 1PP9J 1URQD 2ZYAA 3SSUA 1N8RQ 5AW6B 3AEFC 1L0LK 1E5WA 1L2PA 1SP4A 1SQPJ 1HGZA 1LGHB 2FYUJ 1URQB 3GF3A 3JCUE 2KP8A 1JCDA 2HR3A 3E1IA 5CCHA 3R2PA 4PD4H 4HYTB 5KLVE 4L76A 4LC1A 2YIUB 3T97A 1JY3P 2JO1A 2V4HA 2QM7A 2V7QJ 1SFCC 2CK3H 1GL2D 5APYA 2ZVNB 2J59M 2P58A 1N7SA 3WUVA 3KZIH 1NJIQ 2IFMA 4AUWA 1ZLLA 1QL2A 2IFNA 1KD1Q 1VQ4P 1GK6A 3BCCJ 2OYHC 1L0LJ 1GL2B 2DW3A 2OGUA 3CWBJ 3L74J 3H1LD 1SQVD 1YJWP 3L75D 1JNMA 1IK7A 3H1HJ 3RL0C 1L4AD 1BGYJ 2WT7B 3R4YA 1AV1A 3Q5RA 4N3YB 1S1CX 1L4AB 2JWDA 5KKZC 2QJKB 3C8VA 3H1LE 1SQVE 4OWFA 1IFMA 1KQFB 2OYOA 3L75E 1HVVA 3TDKA 2NPSD 3GLMA 5H2FH 3CCMP 3CXHH 1JUNA 3IN6A 1M1JB 3CCEP 4BWNA 3MZWB 3B5NA 1S5LX 3S4RA 1WMKA 4UB8E 1MZ9A 1WT6A 2H8PD 3AECC 5AW8B 1PZQA 2KNCA 1SQXK 3TF5A 1ZRTD 2NPSB 3V2NA 5KLVJ 1LTJB 3KHUA 5AVZB 1NTKG 2K9JB 1NTKK 2I1KA 2AXTE 2KK7A 1XTGB 5L8RJ 2HLOA 1EZVG 1AVYA 4Y99B 1FZCB 1BCCD 3II6A 5CCGA 3L36A 1ZRTE 2RH0A 2RN0A 3KZIE 2R3CA 3L70D 5KJ7D 5BU8B 2O01J 1T6AA 4GKGA 4H0LC 3SWFA 1OVRA 3D71A 2A06D 3HUSC 3TNUA 3B8EB 1K73Q 1FDOA 2WSFJ 4W7ZA 5AVYB 1KMIZ 2KB7P 1LT9B 1RE4C 1BCCE 1P84I 1M7LA 1NU1K 1OW7A 3CXHD 1GK4A 2N1TC 1FE6A 3L70E 3H1LJ 1SQVJ 2IBZG 1EXJA 2L91A 3L75J 5KAIH 2A06E 1JY2P 4JQ0D 3D6ZA 1HJBA 1OVVA 4GIFA 3S1KA 1ZXGA 3P32A 3A0BH 5H2FE 1W2EA 3CXHE 5AVRB 1NTME 2Y0EA 2OTLP 5K5GB 3BVHA 1X22A 1N73C 2IBZI 1KYOH 1SQBG 3TGUD 1HUCA 5AVWB 2P67A 1SQBK 3CCSP 1X9VA 2YIUC 2FXPA 1J1DB 4TLFA 1VL2A 2J58A 4KT0J 2H88C 1BE3D 4D6TD 2KYVA 2QJPC 3AEAC 1VQPP 1VF5C 5APVA 1Q2NA 1USDA 3UIAA 1T2KD 3V4WA 1R8EA 5TISH 4RKUJ 4DT0A 3SFEC 1GMJA 3RK2D 3TGUE 2RKLA 3B4SA 3L73G 1GL2C 1NHLA 1VQLP 1CZQA 1PPJG 1FZAA 1ZOYC 1FJPA 2BCCG 2HPCA 2KZIA 1BE3E 3VOPA 4GT1A 4D6TE 2Y0CA 3M9BA 1NTZK 1BCCJ 3RK2B 2OYIA 2IYOA 5APQA 5C39A 2KS1A 1JOCA 1VQ5P 2K9YA 2A45I 3L70J 2SPZA 4GOFA 1OWAA 1OW6A 1L4AC 4BRYB 1DEBA 2QG4A 3CC2P 2QJKC 1VPCA 1HH0A 1ZP0C 4H44B 1KYOD 3CX5I 1M1JC 1Q86Q 2KZJA 2R32A 3W68A 1ZMEC 1MUUA 2KNCB 3KXDA 3VN0A 3Q5PA 3KDPB 1GU5A 1S5LH 4IL6E 2E74D 2NPSC 3L35A 3LIDA 4K3AA 2Q9IA 1T3JA 1LTJC 4QMAA 2VRSA 2JP3A 2POHA 1JY3O 1RH5B 4EDFA 3RL0g 1KFNA 1KYOE 2Q1KA 1KILA 5M1BA 2E74B 4NPFX 1YITP 2M8RA 4Y99C 3WUTA 1RF1B 1FZCC 2HODA 1DX7A 1JY3N 1PP9G 4JPZB 3HTKB 1EXIA 3TGUJ 1RQUA 1LWUB 3CC7P 1Q82Q 1OVUA 1SQPG 2FFDA 3CCVP 1NWQA 4IFFA 1SQPK 5APWA 3TNUB 1L0NE 4HB1A 1J2JB 2FYUG 1BE3J 3V4QA 4D6TJ 2FKWB 4LGDE 2ZT9D 2FYUK 2HFED 3AEEC 2K1AA 1LT9C 1IJDB 5KJ7C 4WWIA 3W67A 3MUDA 3NTNA 2PGDA 3I5CA 1QX8A 4U3FG 3N7NA 2ZT9B 1QVFO 1Q81Q 1EQ7A 2KXPB 3L72G 5AW9B 1N7LA 2BASA 2Q6QA 1OX3A 1D7MA 1L0LG 2K3RA 1P84H 4YPCA 3L74G 1YJNP 5AW4B 3H1HG 1LT1A 1RHZB 4HKZH 3E7KA 3AEBC 3RBZA 1J1EB 5GTHH 3L4FA 1AVOA 1S5LE 4EOTA 1HBWA 1AJYA 3E1RA 1J1DC 2WITA 1H0TA 1JB0J 2NRGA 4R4LA 3O6QA 4N6JA 4NPEA
chains in the Genus database with same CATH topology
1YQ4C 3D6YA 1ZRTE 3AE7C 2FBWC 3AE2C 2WSCJ 2E75B 3R4YA 1Y9BA 3AE8C 4U7JA 4YTPC 4GDOA 2H89C 2YIUC 3AEGC 3FGAD 3Q5RA 1ZMEC 1FDIA 1VF5D 3AEFC 2FXPA 2G8YA 2O01J 1TU3F 1MKMA 2ZT9B 3S9OA 1VL2A 4OGQB 4KT0J 3Q5PA 3AE6C 2H88C 4H0LC 1S1CX 2QJPC 3D71A 2J5UA 2OQQA 3AE5C 3IAOA 4R4MA 1K04A 5KKZC 2E74D 3AEAC 3C8VA 1VF5C 3Q5SA 1FDOA 1KQGB 2P10A 2WSFJ 4H0LD 2WSEJ 1KQFB 3H25A 3T97B 1KMIZ 4I7ZB 3GF3A 3D70A 2E76C 1R8EA 2JP3A 3AEDC 1HJ0A 1OW8A 1PL5A 4RKUJ 3RL0g 2MKVA 3GLMA 1VF5B 3SFEC 5KLIC 1DD4A 1GMJA 2E74C 3IN6A 4YXDC 1DIPA 1OW7A 2FYNC 2NZ2A 2G3AA 2E76D 1KILE 1S5LX 5M1BA 2D2CC 1WMKA 2E74B 2YMKA 4Y28J 2JO1A 2V7QJ 2IDBA 3RK3E 3AEBC 1ZOYC 4H0LB 3AECC 1UIXA 4PV1C 1EXJA 1PIXA 3AE4C 3LW5J 2QIWA 3AE9C 2D2CD 3G9RA 4Z1MH 3B71A 1DD3A 4H13C 3AE1C 2QJYC 1Q90D 2BEQD 3Q2YA 4XFJA 4PV1D 4TT3H 1EXIA 3GF7A 1RQUA 2E76B 2E75C 3D6ZA 1KTMA 1RQVA 3Q1MA 3AE3C 4H13D 1AJYA 2K9YA 1K05A 1HF9A 1NGMB 4IL6X 2BEZF 2WPVB 2E75D 3SFDC 2ZT9C 1KORA 4OGQC 5L8RJ 1OW6A 2D2CB 3GMAA 3EWKA 1OMIA 4H44C 1JB0J 2QSIA 1NYHA 2QJKC 1PV3A 1IK7A 4PV1B 3ABVC 2ZT9D 4R4LA 4OGQD 1YQ3C 1ZP0C 4H44B 3AEEC 3O6QA 4I7ZC 4H44D 1U57A 4H13B 3Q3DA 2WQYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V7Q J;  1GMJ A;  4TT3 H;  4Z1M H;  1HF9 A; 
#chains in the Genus database with same CATH topology
 3AE2 C;  4GDO A;  2N9Y B;  2CPB A;  4OVN F;  1FC2 C;  3BRV B;  1LP1 A;  3HD7 C;  3MGN A;  1K8A Q;  2IPP A;  2J5U A;  1M1K Q;  2OYI B;  5KAF H;  4RO0 A;  2JEE A;  3RK2 C;  5KLV K;  3Q5S A;  2PRR A;  1SQQ D;  5AW3 B;  1EZV D;  5AVT B;  1VQK P;  1JEK A;  1CW5 A;  3CC4 P;  3P8C D;  1GW3 A;  2OTJ P;  2YMK A;  2IDB A;  1JY2 O;  5BVZ A;  1CI6 B;  3HE4 A;  4UB6 E;  2JWA A;  2ZVO B;  2K88 A;  2W83 C;  2O1J A;  3EFG A;  2LXC B;  1KC8 Q;  3IFM A;  4PD4 D;  1VQ9 P;  3I56 P;  4ZMD A;  2CPS A;  1KTM A;  1YJ9 P;  1SQQ E;  4ASW A;  5KLI B;  4H13 D;  2Q5U A;  2UWJ E;  1EZV E;  4PJ0 H;  3VMZ A;  2OTK E;  2E42 A;  1NH4 A;  1JY2 N;  2KLU A;  4IOI H;  1SQX G;  2E75 D;  3SFD C;  3CLQ A;  3WU2 H;  2W8Z A;  3P8C E;  3MD0 A;  3JSV C;  1FS0 E;  1M56 D;  2FXM A;  1QGK B;  1FU1 A;  1U57 A;  4H13 B;  1GTW A;  5GTH E;  2GUS A;  2FBW C;  2E75 B;  3H1K D;  3CX5 H;  3PH0 A;  4PD4 E;  4WBA A;  1FOS F;  3H1L G;  3PJS K;  1SQV G;  4W7Y A;  2R5B A;  1TU3 F;  1SQV K;  5B5E H;  1RF1 C;  1Z56 A;  4R4M A;  1KV4 A;  2P2U A;  3FWN A;  1HWT C;  3F89 A;  3H32 B;  4I7Z B;  3D70 A;  1OXZ A;  1RF0 C;  1LWU C;  4OH8 B;  2R3S A;  2E43 A;  3MP7 B;  3N4X A;  2MJZ A;  1H8A A;  4KHX A;  1JTH A;  1N2D C;  3H1K E;  5APT A;  2WTY A;  2LXB A;  1S3J A;  3G6E P;  1NOH A;  1H89 A;  1KFM A;  3KQG A;  3CME P;  2D2C D;  2O3J A;  1NU1 G;  3B71 A;  3KPE A;  2OAR A;  1U7M A;  5KAF E;  1AA0 A;  1NTM D;  1VQO P;  3Q1M A;  2LR2 A;  2XU6 A;  1T8Z A;  3H1J G;  1G2C B;  2M5A A;  2PFX A;  1SLQ A;  2M3E A;  5CMZ A;  2ZT9 C;  1QLE D;  2D2C B;  5B66 H;  1RE4 A;  1S72 P;  1EDK A;  1OFC X;  1SS1 A;  3LW5 H;  5TJH A;  4N78 D;  4OGQ D;  2N1T A;  1KB9 H;  5CCH D;  1PPJ D;  1SQQ J;  1E79 H;  1ZN5 A;  2B89 A;  2GM4 A;  3RK3 D;  2JDI H;  3GG2 A;  1PGJ A;  2ZYD A;  2ZXX A;  4OGQ B;  1N7S D;  1BCC G;  3U59 A;  1URQ C;  2Q3E A;  2KOG A;  4N78 E;  3T97 B;  3H1I G;  3RK3 B;  3L70 G;  1PPJ E;  1DD4 A;  2Q7C A;  3O8Z A;  1X8Y A;  3SWK A;  1N7S B;  1H0T B;  1N73 A;  1MV8 A;  5GTI H;  2A06 G;  1BDD A;  2R5D A;  3PHL A;  3RK3 E;  2B88 A;  2V7Q H;  1M90 Q;  3O6Q B;  4AQR D;  2QIW A;  2GA1 A;  3G9R A;  2P7J A;  2A45 G;  2ZAE B;  5B5E E;  3FXD A;  1LP1 B;  1VDF A;  2M3B A;  3MIW A;  2LKM A;  1W2B O;  1NTM K;  3G3Z A;  3H1K J;  4MN4 C;  1K05 A;  3FX0 A;  5BU5 A;  2R44 A;  4EI2 A;  4JYC A;  2Z4E A;  1PGP A;  2B9B A;  3OW2 O;  1NKZ B;  1NTZ G;  1OMI A;  2OYI C;  4JYB A;  5AVU B;  1GL2 A;  2IYP A;  4H44 D;  1A02 F;  1KB9 D;  3VYI A;  2QJY B;  3U1A A;  5E79 H;  3GHG A;  3AE8 C;  3B5N D;  4YTP C;  3CXH I;  3TK1 A;  3AEG C;  3FGA D;  1N86 A;  2XNX A;  3HRN A;  3VP8 A;  1H88 A;  2G8Y A;  1LTI C;  2YMY A;  3CCR P;  2ZJS E;  3ITK A;  3TGU G;  2PP6 A;  5B66 E;  1XTC C;  3B5N B;  3H25 A;  5KKZ B;  2W6J H;  5KAI E;  2I8D A;  2WSC H;  3AED C;  1HJ0 A;  1RE3 C;  1NTM J;  5KLI C;  1KB9 E;  3L71 D;  3CCL P;  2WZ7 A;  4Y28 J;  3A0B E;  1Y8A A;  4BXL A;  1WRG A;  1S9K D;  2KSJ A;  4I6M C;  2XKM A;  1PIX A;  2Y9Z A;  3AE4 C;  5CCG D;  1T3U A;  2YXQ B;  4H13 C;  2K37 A;  4U3F D;  4L74 A;  3VTP C;  1JM0 A;  2BEQ D;  3TSI A;  3GF7 A;  2E75 C;  1GZL A;  3OJA B;  1L0N D;  1GDT A;  3M0A A;  3L72 D;  2NPS A;  2BEZ F;  2FYN B;  3V2P A;  3L71 E;  2KSE A;  1LTJ A;  3V2Q A;  4WVZ A;  5CBO A;  1L0L D;  1FJK A;  3PTZ A;  1S9K E;  1FOS E;  4I7Z C;  2Z5H A;  1YI2 P;  5APS A;  2JR8 A;  1JTH B;  5TIS E;  4U3F E;  1Y9B A;  2IX7 C;  1SVF A;  4I1L A;  3PLN A;  3CCQ P;  3K5B A;  2XV5 A;  3L72 E;  2PAJ A;  4DZO A;  1L0L E;  3HE5 A;  2AEM A;  3QWO C;  2P1J A;  1KQG B;  3GW6 A;  3L74 E;  2WSF H;  2IZ0 A;  4DCK A;  3A2A A;  3G4S P;  3USS A;  3A3Y B;  4RES B;  2D2C C;  3P8M C;  1NAF A;  1EDL A;  5KJ7 A;  2QEX P;  3M0D A;  3QH9 A;  3LW5 J;  2I1J A;  2QE7 H;  1IC2 A;  4EIJ A;  2WPQ A;  3BCC G;  4PV1 D;  1KYO I;  3CWB G;  3V6I A;  3BRT B;  1LTS C;  1L0N K;  4WY4 A;  4IL6 X;  1RY3 A;  2ITA A;  3TYY A;  1BGY G;  4UB8 H;  4OGQ C;  2FYZ A;  3EWK A;  5CCH C;  3CD6 P;  3RGU A;  4PV1 B;  2HYN A;  4KJM A;  2AXC A;  2XDJ A;  3LIE A;  4GOE A;  4O9B A;  4A7P A;  3RK3 C;  1LTB C;  2C9N Y;  1DEE G;  1R5S A;  2YKQ A;  1N73 B;  3L71 J;  2E5T A;  2AXT H;  4HH2 A;  1N7S C;  1GD2 E;  4L75 A;  3VMY A;  1VF5 D;  1MKM A;  3CMA P;  2C0W A;  3SWY A;  2WSS H;  1MFT A;  1SQX D;  1SFC A;  1FZG A;  1BSH A;  2QJP B;  4U3F J;  1IZN B;  3PRJ A;  4NPD A;  1G1I A;  1VF5 B;  1L0N J;  4ASV A;  2HPC B;  2G3A A;  2E76 D;  1M8O B;  3L72 J;  3WUU A;  1NTK D;  1OZH A;  1T2K C;  1EDJ A;  1NO4 A;  1DH3 A;  5KLV G;  2KIK A;  1YTZ I;  3A0H H;  1IK9 A;  2KS1 B;  2OYH A;  2IZ1 A;  1JCC A;  4W80 A;  3CL3 D;  3HD7 A;  3GHG B;  2YKP A;  3AE1 C;  1VQ8 P;  2QJY C;  1HTL C;  1M57 D;  1SQX E;  2YKO A;  2E76 B;  1P84 D;  3M06 A;  5AVQ B;  4IFD K;  2WPR A;  2QVA A;  1HF9 A;  2ZXE B;  1KOR A;  4JF7 A;  1NTK E;  1CSB A;  4H44 C;  1Y47 A;  1LJ2 A;  3ABV C;  3B5N C;  1EDI A;  5AVS B;  4BRY A;  3V2R A;  2N9B A;  1ZV8 A;  2WSC J;  1VQM P;  1KIL D;  1FZF A;  1KN7 A;  2A45 H;  2H89 C;  1NU1 D;  1P84 E;  1KZU B;  1FBM A;  2XZR A;  3CI9 A;  3G71 P;  2W90 A;  1JMM A;  3H1J D;  1IFN A;  1JMB A;  3BAT A;  1KIL B;  2ZYG A;  2IBZ D;  1NAY A;  2Z5I A;  5DJT B;  1LTT C;  2YO2 A;  2JJL A;  2E74 C;  5CBN A;  1DIP A;  2B87 A;  3L75 G;  5EFW B;  2FYN C;  2NZ2 A;  2HOD B;  1KIL E;  1BDC A;  1BSN A;  5CCG C;  1IFD A;  1NU1 E;  1LNQ A;  1AQT A;  4C7N A;  1SQQ G;  4LLH A;  3C9I A;  1SQQ K;  2FFD B;  3BAS A;  4B86 A;  3H1J E;  3Q2Y A;  4TT3 H;  1EC5 A;  1USE A;  2IBZ E;  1RF1 A;  1RQV A;  2YO3 A;  1SQB D;  5APX A;  1PGQ A;  3A7O A;  3H1I D;  3HTK A;  3PP5 A;  3HE5 B;  1FZE A;  1RF0 A;  1LWU A;  1JO5 A;  5CJ4 A;  1PV3 A;  3CCJ P;  1FDM A;  2QM8 A;  1YHQ P;  1YQ3 C;  1SQX J;  3A0H E;  3Q3D A;  1YBK A;  3HUS A;  1EZV I;  3C1L A;  1IFI A;  4WY4 D;  1A02 J;  3V5B A;  1SQB E;  1NTK J;  2W6B A;  3L73 D;  4XA4 A;  3H1I E;  2OQQ A;  3IAO A;  3IF4 A;  3OAK A;  1NKN A;  2WSE H;  3H1K G;  2QA4 P;  4C7R A;  2BCC D;  1NTZ D;  4WY4 B;  4PD4 I;  3CX5 D;  2GUV A;  1PL5 A;  2MKV A;  2WVR A;  4PJ0 E;  1J1E C;  3VMX A;  1ZR4 A;  5AW5 B;  3WU2 E;  3NXS A;  4IL6 H;  3U1C A;  3NMD A;  4PV1 C;  1K9M Q;  3L73 E;  1PFI A;  3MHV A;  5KTB A;  1IFP A;  1SFC D;  3L37 A;  1DD3 A;  3ZDM A;  4ZNC A;  3A5T A;  2YNY A;  1X79 B;  3AE3 C;  1URQ A;  2BCC E;  1NTZ E;  3CX5 E;  3EFF K;  5APU A;  4DJG A;  1NU1 J;  1G1J A;  1QEX A;  3CPW O;  1SFC B;  2C9L Y;  3VMA A;  1NYH A;  2HG5 D;  3H1J J;  1X0T A;  1NTM G;  2W27 A;  1S2E A;  1VQ7 P;  3HD7 D;  2WQY C;  2FY8 A;  3D6Y A;  3WMM 0;  2QRX A;  3RL0 D;  4RJT A;  4U7J A;  2KLV A;  1U7J A;  4HJG H;  1FDI A;  1LTG C;  2OYH B;  3S9O A;  3HD7 B;  3CCU P;  3AE5 C;  1K04 A;  2AEJ A;  3F5H A;  1AFO A;  3GHG C;  3RL0 B;  3H6P A;  2P10 A;  3I55 P;  2FXO A;  2E76 C;  2C0X A;  3M9H A;  4DOJ A;  1UII A;  4K35 A;  1PP9 D;  3HE4 B;  4YXD C;  2WT7 A;  1SQB J;  1R5L A;  4AYC A;  2E5Y A;  4I2L C;  2W6A A;  3RBX A;  1FAV A;  3H1I J;  2Y0D A;  1SQP D;  3EQ2 A;  5AVV B;  3IR9 A;  4CPG A;  5DJU B;  4YXW H;  2Q3I A;  3AE9 C;  2H7H A;  3M91 A;  2FYU D;  1L4A A;  2H43 A;  1Q90 D;  1YIJ P;  1CI6 A;  1YTZ T;  1BE3 G;  4D6T G;  4GOD A;  4JBZ A;  1Q7Y Q;  1NGM B;  1PP9 E;  2YXR B;  5AW7 B;  1GW4 A;  2WMM A;  4ZKU A;  1IO4 A;  1M1J A;  3GMA A;  3L73 J;  1QVG O;  1VQ6 P;  1RE3 A;  3JCU H;  2O01 N;  1SQP E;  1KIL C;  2AEF A;  2B87 B;  1YQ4 C;  2BCC J;  1NTZ J;  2Y9Y A;  2FYU E;  3AE7 C;  3P7K A;  2RMZ A;  3VP9 A;  5AW1 B;  3FWL A;  3NFQ A;  3BCC D;  1YYC A;  4C7N B;  2K9J A;  5GTI E;  3CWB D;  3L74 D;  1FZB A;  3AE6 C;  5AW0 B;  3H1H D;  4M3L A;  4L73 A;  2FFD C;  1BGY D;  3JC2 2;  5CJ0 A;  4H0L D;  1ZW0 A;  1FZC A;  1OW8 A;  1IFJ A;  1LTA C;  2WWW A;  2O01 H;  3H32 A;  2ZFC A;  3BCC E;  2O1K A;  2WPS A;  2N1T D;  1S4X A;  4H0L B;  3KYQ A;  1UIX A;  3MUD C;  1PGO A;  5CHX A;  5AVX B;  1GU4 A;  3CWB E;  1OIP A;  1KQS O;  3HUS B;  2KI7 B;  4Z1M H;  3M9Q A;  1AQ5 A;  2M5A B;  3FXE A;  1MFZ A;  1QL1 A;  3H1H E;  3L71 G;  4C46 A;  1KB9 I;  4XFJ A;  2XND H;  1BGY E;  4WB4 A;  1W5C E;  5E79 E;  2M0B A;  4XE5 B;  1LT9 A;  3M0D C;  2N1T B;  2WPV B;  5AW2 B;  4EYY Q;  1NVO A;  2JKV A;  3OA7 A;  1HGV A;  2L5G B;  4UB6 H;  2QSI A;  4ZKP A;  1VQN P;  1G2C A;  3MTU E;  2KUB A;  1KQL A;  1L0N G;  4IFM A;  4WY4 C;  5KLV D;  1ZR2 A;  2WSE J;  1PP9 J;  1URQ D;  2ZYA A;  3SSU A;  1N8R Q;  5AW6 B;  3AEF C;  1L0L K;  1E5W A;  1L2P A;  1SP4 A;  1SQP J;  1HGZ A;  1LGH B;  2FYU J;  1URQ B;  3GF3 A;  3JCU E;  2KP8 A;  1JCD A;  2HR3 A;  3E1I A;  5CCH A;  3R2P A;  4PD4 H;  4HYT B;  5KLV E;  4L76 A;  4LC1 A;  2YIU B;  3T97 A;  1JY3 P;  2JO1 A;  2V4H A;  2QM7 A;  2V7Q J;  1SFC C;  2CK3 H;  1GL2 D;  5APY A;  2ZVN B;  2J59 M;  2P58 A;  1N7S A;  3WUV A;  3KZI H;  1NJI Q;  2IFM A;  4AUW A;  1ZLL A;  1QL2 A;  2IFN A;  1KD1 Q;  1VQ4 P;  1GK6 A;  3BCC J;  2OYH C;  1L0L J;  1GL2 B;  2DW3 A;  2OGU A;  3CWB J;  3L74 J;  3H1L D;  1SQV D;  1YJW P;  3L75 D;  1JNM A;  1IK7 A;  3H1H J;  3RL0 C;  1L4A D;  1BGY J;  2WT7 B;  3R4Y A;  1AV1 A;  3Q5R A;  4N3Y B;  1S1C X;  1L4A B;  2JWD A;  5KKZ C;  2QJK B;  3C8V A;  3H1L E;  1SQV E;  4OWF A;  1IFM A;  1KQF B;  2OYO A;  3L75 E;  1HVV A;  3TDK A;  2NPS D;  3GLM A;  5H2F H;  3CCM P;  3CXH H;  1JUN A;  3IN6 A;  1M1J B;  3CCE P;  4BWN A;  3MZW B;  3B5N A;  1S5L X;  3S4R A;  1WMK A;  4UB8 E;  1MZ9 A;  1WT6 A;  2H8P D;  3AEC C;  5AW8 B;  1PZQ A;  2KNC A;  1SQX K;  3TF5 A;  1ZRT D;  2NPS B;  3V2N A;  5KLV J;  1LTJ B;  3KHU A;  5AVZ B;  1NTK G;  2K9J B;  1NTK K;  2I1K A;  2AXT E;  2KK7 A;  1XTG B;  5L8R J;  2HLO A;  1EZV G;  1AVY A;  4Y99 B;  1FZC B;  1BCC D;  3II6 A;  5CCG A;  3L36 A;  1ZRT E;  2RH0 A;  2RN0 A;  3KZI E;  2R3C A;  3L70 D;  5KJ7 D;  5BU8 B;  2O01 J;  1T6A A;  4GKG A;  4H0L C;  3SWF A;  1OVR A;  3D71 A;  2A06 D;  3HUS C;  3TNU A;  3B8E B;  1K73 Q;  1FDO A;  2WSF J;  4W7Z A;  5AVY B;  1KMI Z;  2KB7 P;  1LT9 B;  1RE4 C;  1BCC E;  1P84 I;  1M7L A;  1NU1 K;  1OW7 A;  3CXH D;  1GK4 A;  2N1T C;  1FE6 A;  3L70 E;  3H1L J;  1SQV J;  2IBZ G;  1EXJ A;  2L91 A;  3L75 J;  5KAI H;  2A06 E;  1JY2 P;  4JQ0 D;  3D6Z A;  1HJB A;  1OVV A;  4GIF A;  3S1K A;  1ZXG A;  3P32 A;  3A0B H;  5H2F E;  1W2E A;  3CXH E;  5AVR B;  1NTM E;  2Y0E A;  2OTL P;  5K5G B;  3BVH A;  1X22 A;  1N73 C;  2IBZ I;  1KYO H;  1SQB G;  3TGU D;  1HUC A;  5AVW B;  2P67 A;  1SQB K;  3CCS P;  1X9V A;  2YIU C;  2FXP A;  1J1D B;  4TLF A;  1VL2 A;  2J58 A;  4KT0 J;  2H88 C;  1BE3 D;  4D6T D;  2KYV A;  2QJP C;  3AEA C;  1VQP P;  1VF5 C;  5APV A;  1Q2N A;  1USD A;  3UIA A;  1T2K D;  3V4W A;  1R8E A;  5TIS H;  4RKU J;  4DT0 A;  3SFE C;  1GMJ A;  3RK2 D;  3TGU E;  2RKL A;  3B4S A;  3L73 G;  1GL2 C;  1NHL A;  1VQL P;  1CZQ A;  1PPJ G;  1FZA A;  1ZOY C;  1FJP A;  2BCC G;  2HPC A;  2KZI A;  1BE3 E;  3VOP A;  4GT1 A;  4D6T E;  2Y0C A;  3M9B A;  1NTZ K;  1BCC J;  3RK2 B;  2OYI A;  2IYO A;  5APQ A;  5C39 A;  2KS1 A;  1JOC A;  1VQ5 P;  2K9Y A;  2A45 I;  3L70 J;  2SPZ A;  4GOF A;  1OWA A;  1OW6 A;  1L4A C;  4BRY B;  1DEB A;  2QG4 A;  3CC2 P;  2QJK C;  1VPC A;  1HH0 A;  1ZP0 C;  4H44 B;  1KYO D;  3CX5 I;  1M1J C;  1Q86 Q;  2KZJ A;  2R32 A;  3W68 A;  1ZME C;  1MUU A;  2KNC B;  3KXD A;  3VN0 A;  3Q5P A;  3KDP B;  1GU5 A;  1S5L H;  4IL6 E;  2E74 D;  2NPS C;  3L35 A;  3LID A;  4K3A A;  2Q9I A;  1T3J A;  1LTJ C;  4QMA A;  2VRS A;  2JP3 A;  2POH A;  1JY3 O;  1RH5 B;  4EDF A;  3RL0 g;  1KFN A;  1KYO E;  2Q1K A;  1KIL A;  5M1B A;  2E74 B;  4NPF X;  1YIT P;  2M8R A;  4Y99 C;  3WUT A;  1RF1 B;  1FZC C;  2HOD A;  1DX7 A;  1JY3 N;  1PP9 G;  4JPZ B;  3HTK B;  1EXI A;  3TGU J;  1RQU A;  1LWU B;  3CC7 P;  1Q82 Q;  1OVU A;  1SQP G;  2FFD A;  3CCV P;  1NWQ A;  4IFF A;  1SQP K;  5APW A;  3TNU B;  1L0N E;  4HB1 A;  1J2J B;  2FYU G;  1BE3 J;  3V4Q A;  4D6T J;  2FKW B;  4LGD E;  2ZT9 D;  2FYU K;  2HFE D;  3AEE C;  2K1A A;  1LT9 C;  1IJD B;  5KJ7 C;  4WWI A;  3W67 A;  3MUD A;  3NTN A;  2PGD A;  3I5C A;  1QX8 A;  4U3F G;  3N7N A;  2ZT9 B;  1QVF O;  1Q81 Q;  1EQ7 A;  2KXP B;  3L72 G;  5AW9 B;  1N7L A;  2BAS A;  2Q6Q A;  1OX3 A;  1D7M A;  1L0L G;  2K3R A;  1P84 H;  4YPC A;  3L74 G;  1YJN P;  5AW4 B;  3H1H G;  1LT1 A;  1RHZ B;  4HKZ H;  3E7K A;  3AEB C;  3RBZ A;  1J1E B;  5GTH H;  3L4F A;  1AVO A;  1S5L E;  4EOT A;  1HBW A;  1AJY A;  3E1R A;  1J1D C;  2WIT A;  1H0T A;  1JB0 J;  2NRG A;  4R4L A;  3O6Q A;  4N6J A;  4NPE A; 
#chains in the Genus database with same CATH homology
 1YQ4 C;  3D6Y A;  1ZRT E;  3AE7 C;  2FBW C;  3AE2 C;  2WSC J;  2E75 B;  3R4Y A;  1Y9B A;  3AE8 C;  4U7J A;  4YTP C;  4GDO A;  2H89 C;  2YIU C;  3AEG C;  3FGA D;  3Q5R A;  1ZME C;  1FDI A;  1VF5 D;  3AEF C;  2FXP A;  2G8Y A;  2O01 J;  1TU3 F;  1MKM A;  2ZT9 B;  3S9O A;  1VL2 A;  4OGQ B;  4KT0 J;  3Q5P A;  3AE6 C;  2H88 C;  4H0L C;  1S1C X;  2QJP C;  3D71 A;  2J5U A;  2OQQ A;  3AE5 C;  3IAO A;  4R4M A;  1K04 A;  5KKZ C;  2E74 D;  3AEA C;  3C8V A;  1VF5 C;  3Q5S A;  1FDO A;  1KQG B;  2P10 A;  2WSF J;  4H0L D;  2WSE J;  1KQF B;  3H25 A;  3T97 B;  1KMI Z;  4I7Z B;  3GF3 A;  3D70 A;  2E76 C;  1R8E A;  2JP3 A;  3AED C;  1HJ0 A;  1OW8 A;  1PL5 A;  4RKU J;  3RL0 g;  2MKV A;  3GLM A;  1VF5 B;  3SFE C;  5KLI C;  1DD4 A;  1GMJ A;  2E74 C;  3IN6 A;  4YXD C;  1DIP A;  1OW7 A;  2FYN C;  2NZ2 A;  2G3A A;  2E76 D;  1KIL E;  1S5L X;  5M1B A;  2D2C C;  1WMK A;  2E74 B;  2YMK A;  4Y28 J;  2JO1 A;  2V7Q J;  2IDB A;  3RK3 E;  3AEB C;  1ZOY C;  4H0L B;  3AEC C;  1UIX A;  4PV1 C;  1EXJ A;  1PIX A;  3AE4 C;  3LW5 J;  2QIW A;  3AE9 C;  2D2C D;  3G9R A;  4Z1M H;  3B71 A;  1DD3 A;  4H13 C;  3AE1 C;  2QJY C;  1Q90 D;  2BEQ D;  3Q2Y A;  4XFJ A;  4PV1 D;  4TT3 H;  1EXI A;  3GF7 A;  1RQU A;  2E76 B;  2E75 C;  3D6Z A;  1KTM A;  1RQV A;  3Q1M A;  3AE3 C;  4H13 D;  1AJY A;  2K9Y A;  1K05 A;  1HF9 A;  1NGM B;  4IL6 X;  2BEZ F;  2WPV B;  2E75 D;  3SFD C;  2ZT9 C;  1KOR A;  4OGQ C;  5L8R J;  1OW6 A;  2D2C B;  3GMA A;  3EWK A;  1OMI A;  4H44 C;  1JB0 J;  2QSI A;  1NYH A;  2QJK C;  1PV3 A;  1IK7 A;  4PV1 B;  3ABV C;  2ZT9 D;  4R4L A;  4OGQ D;  1YQ3 C;  1ZP0 C;  4H44 B;  3AEE C;  3O6Q A;  4I7Z C;  4H44 D;  1U57 A;  4H13 B;  3Q3D A;  2WQY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...