4TT3H

The pathway of binding of the intrinsically disordered mitochondrial inhibitor protein to f1-atpase
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
40
structure length
40
Chain Sequence
b'SAGAVRDAGGAFGKREQAEEERYFRARAAEQLAALKKHHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase subunit alpha, mitochondrial
publication title Pathway of binding of the intrinsically disordered mitochondrial inhibitor protein to F1-ATPase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 14
structure length 40
sequence length 40
chains with identical sequence I, J
ec nomenclature
pdb deposition date 2014-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.500 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4tt3H00
4TT3H 2V7QJ 4Z1MH 1HF9A 1GMJA
chains in the Genus database with same CATH superfamily
1K73Q 3AEGC 1BDDA 3FWLA 1FOSF 3S1KA 3D6ZA 2N1TC 3CCSP 1NJIQ 3SWYA 3VN0A 1N86A 4W7YA 3RBZA 1FDOA 1YTZT 2B87A 1HWTC 2FBWC 2YO2A 2NPSC 3H1IJ 2B87B 3H1JJ 3TYYA 4I7ZC 3CCEP 1FZFA 2CPSA 3MIWA 1DEEG 1NH4A 3KZIE 3WMM0 3G6EP 1LNQA 1XTGB 3P8CD 1PV3A 4C7NB 1EZVE 3TF5A 1GD2E 2O1JA 4AQRD 1VQ9P 1ZP0C 3TGUD 2XV5A 5AVTB 2P67A 5AVVB 1JMMA 3G9RA 1PGJA 2H8PD 1KQLA 4XE5B 3H1LJ 3T97A 1USDA 1BDCA 1W2BO 3AEFC 3RK2C 2DW3A 3TNUA 2B9BA 2KLUA 3K5BA 4ASWA 4WBAA 3SFDC 2FFDB 5KAIH 2AXTH 1Y9BA 1VQ7P 1QVFO 1URQA 3TSIA 3GW6A 1NTKJ 5KLVJ 1DD4A 4NPEA 2Q7CA 1PFIA 1URQB 4N78D 1VQ8P 2FYNC 3CC7P 1E5WA 1HBWA 1Q7YQ 1GDTA 1K9MQ 4U7JA 3ZDMA 1J1EB 1FBMA 2KOGA 2YKOA 1L0NK 1EZVI 2YIUB 1PP9J 4AYCA 1MFTA 4OH8B 3KPEA 4ZMDA 1QEXA 3USSA 1JMBA 1ZXGA 1KILC 1RHZB 1J2JB 3AE5C 2KK7A 1JNMA 2WPQA 2BEQD 4WWIA 1P84H 3V5BA 1H88A 3AEDC 2YNYA 2A06G 2QJPB 4L73A 3L71D 2HPCA 3BRTB 2JWDA 3U59A 2M3BA 4PD4H 1AA0A 2JEEA 2I1JA 3CCMP 1IZNB 3CCVP 1NGMB 1PIXA 2HPCB 3HE4A 4D6TD 5AVQB 1FZEA 4N3YB 3I56P 3HRNA 3VMXA 3L73E 2YMYA 4TLFA 1ZRTD 3CC4P 3OJAB 2WMMA 1PPJG 2GA1A 2QM8A 5DJUB 1L0LG 5KAFE 2ITAA 3P32A 2XU6A 2D2CD 4ZKPA 1LGHB 2IZ0A 2RN0A 4K35A 1NAYA 1VQKP 2FFDC 1VPCA 1NU1J 2O01J 2P1JA 1QGKB 2W27A 2C9NY 1NYHA 1URQC 4U3FE 2M5AA 1PPJE 1OX3A 2CK3H 1L0LE 2M5AB 1GTWA 2RH0A 1J1EC 1SFCA 5TISE 1IJDB 1VQPP 1JCDA 1VQLP 1SFCB 5GTIE 3HE5A 3L74D 1XTCC 3B71A 2BCCD 4NPFX 1T6AA 3HE5B 3CWBG 2IBZD 3G71P 3L70D 2POHA 4N6JA 4XFJA 4R4LA 1SQBG 1S5LH 2AXCA 1NTME 3GLMA 3CX5E 3Q3DA 1SQQE 2QJPC 2ZJSE 1ZV8A 1RF1A 4AUWA 3JSVC 3R4YA 1GL2B 3Q1MA 1RF1B 4H44B 1Z56A 4MN4C 2AEMA 2H7HA 1S4XA 2ZT9D 3H1IG 3H1JG 1KD1Q 1SQVE 1N7SA 1SQPJ 2A06D 3L75J 1KYOD 3S9OA 3C8VA 3CWBE 2E76B 1KILE 1N7SB 1PL5A 2JKVA 4PD4D 3RGUA 2HFED 1LJ2A 5H2FH 2H89C 1SQBE 1T3JA 1BCCJ 3BCCE 3G3ZA 1N8RQ 5AW7B 1BE3J 2V7QJ 3L37A 1RQVA 1AVOA 3H1LG 1G2CA 4GDOA 1VQ5P 1FC2C 2R3SA 2UWJE 2XNXA 1G2CB 1GZLA 3CX5I 3H1IE 4U3FJ 3H1JE 5E79E 5B66E 2NZ2A 4GOFA 1ZR2A 5AW8B 3AE7C 2E43A 3VOPA 4YXDC 1NTKG 1YTZI 3L72D 5KLVG 1S5LX 3MP7B 1KORA 2E74D 1KB9E 1JO5A 3VMAA 4ZKUA 5B5EH 4PV1D 2OYHA 3D70A 1SFCC 2K37A 4L74A 2OYHB 1HJBA 1E79H 2WSEH 3H1LE 1SQBK 1GW4A 4IFMA 2LR2A 2OGUA 2H88C 3CCJP 1JCCA 1PP9G 3H1HE 1KZUB 2Y9YA 4PJ0H 1JOCA 1S3JA 3HD7D 1KC8Q 1KTMA 1NTMJ 1BGYD 3N7NA 1SP4A 1SQQJ 1LTJA 5AW2B 3WU2H 3PTZA 5BU5A 4DOJA 2E75D 1KN7A 1NTKE 1LTJB 4PV1B 1GMJA 2XZRA 2R32A 4WVZA 1GL2C 1RF1C 1SQVJ 4H44C 5KLIB 5APWA 4C46A 3CCQP 3HD7A 2P58A 3GF3A 3KZIH 3CMEP 2OQQA 1EDIA 3HD7B 1PP9E 1H0TA 1KB9I 1UIXA 5CBOA 2E76C 1N7SC 1AV1A 1JY3P 1QL2A 2E42A 1OW8A 3BCCJ 1H0TB 4N78E 1JY3N 2QJKB 2C0XA 2E75B 1NVOA 1QX8A 5CCHD 2Z5HA 2R5BA 1LWUA 1NTZD 2C9LY 3IR9A 1RY3A 1LWUB 1L2PA 2WQYC 4EDFA 4TT3H 4I1LA 4IL6X 2JDIH 3AE6C 4ZNCA 1H8AA 2K3RA 5KLVK 1LTAC 3M0AA 3IF4A 2P7JA 2L5GB 1FZAA 4DJGA 4W7ZA 2R3CA 4EI2A 5CCHA 1RH5B 1VQMP 4EIJA 1OVRA 1NU1G 3E1IA 5APYA 1HVVA 2RKLA 1U57A 4UB6H 5K5GB 1MZ9A 1SQXK 3M0DA 1JY2P 2IPPA 3RK3D 2M3EA 1JY2N 1OWAA 4WB4A 3CI9A 1MUUA 3AEEC 1FDIA 3H1HJ 1VQNP 2OYHC 2JP3A 2GUSA 1S2EA 3T97B 5KLVD 1ZRTE 1YJWP 3IAOA 3TNUB 1MFZA 3TGUJ 3MHVA 1HGZA 2J58A 2K9JA 4B86A 1HTLC 2V4HA 2WZ7A 2H43A 1N7LA 3FX0A 1JTHA 5CMZA 1YJ9P 2K9JB 1NU1E 1T8ZA 3V2NA 1JTHB 2IDBA 1LTJC 1SQXD 3VMYA 5L8RJ 4PV1C 3V6IA 1R8EA 3VP8A 5EFWB 3HUSA 1VQ6P 2QM7A 1FZCA 5KLIC 5AVUB 3AE2C 1IFPA 5AVSB 3HUSB 2R5DA 1ZN5A 3L73G 2FYUE 1FZCB 2WITA 1FOSE 2WT7A 3HD7C 3A0HH 1DD3A 2N9YB 3GMAA 1KQGB 2WSCH 2Q1KA 1SQPG 2KIKA 3L75G 2QJKC 3EWKA 3MTUE 2E75C 3QH9A 1FE6A 2QVAA 2WVRA 1VQOP 3BRVB 1IFIA 1KYOH 1T2KD 1S9KE 1LWUC 5KAIE 2AXTE 1BCCG 3AECC 2W90A 3B8EB 3A0BH 1EZVD 3PHLA 1LP1A 1L0ND 5CCGD 1GW3A 3RBXA 3SFEC 1K05A 1LTGC 1BE3G 2OARA 3KQGA 1K04A 1LP1B 3CL3D 4BRYA 3HE4B 2KZIA 2M0BA 3S4RA 4BRYB 3IFMA 1KQFB 2LXBA 1FJKA 3H1KE 2Y0DA 4U3FG 1SQPE 3L75E 2AEFA 2OTKE 3MUDA 1OXZA 4D6TJ 1OVUA 5CCGA 3CLQA 2QE7H 3M0DC 2FXPA 5AW9B 1BCCE 4Y99B 4OGQD 1A02F 3V4QA 2XDJA 5AW5B 1M56D 3JCUH 3F5HA 1YQ4C 1BE3E 1P84E 2KLVA 4GODA 3OAKA 2YKPA 1Q86Q 2E5TA 3KXDA 1YIJP 2A45H 3UIAA 1OW7A 1X9VA 1IFJA 2K9YA 2PFXA 3PH0A 3RL0g 3GHGA 1DX7A 1QL1A 3VTPC 1NTMG 3LW5H 2HODA 1SQQG 2QJYB 2IFMA 1YHQP 4LLHA 2HODB 1FZGA 5APXA 1LT9A 2FYUJ 2KXPB 5AVRB 1KMIZ 2D2CB 5GTHH 1SQPK 4WY4D 3HUSC 4H0LD 1FZCC 1X79B 3MZWB 1SQVG 3Q5SA 1YI2P 3M9QA 4H13D 1RF0A 4DT0A 1Q81Q 1NAFA 1GK4A 5APQA 2YO3A 2QEXP 3BCCG 3L73D 3I55P 1G1IA 2ZYAA 2AEJA 3E7KA 4WY4A 1P84I 3L74J 3AE1C 5AVZB 2BCCJ 1IO4A 3U1AA 4WY4B 3RL0D 4LGDE 4PD4I 5AVYB 3CXHE 3VYIA 3L70J 3M9BA 2N1TD 3H1KJ 1L0LK 2W8ZA 5KTBA 4H13B 1PGPA 4K3AA 3EFFK 3Q5PA 1VQ4P 3AE4C 1MKMA 1HJ0A 1OZHA 4JPZB 2B88A 1RE3A 2VRSA 1DEBA 2WSCJ 4LC1A 1AQTA 1QLED 3NTNA 2WTYA 2HLOA 1U7JA 3MUDC 2OYOA 3C9IA 2Y9ZA 1FS0E 1IK9A 4Y99C 2NRGA 5CCGC 1NHLA 4HKZH 4U3FD 1EXIA 1PPJD 3TK1A 2B89A 1ZLLA 1YBKA 1S5LE 1NTMK 2ZT9B 3H1HG 1YQ3C 1L0LD 5APTA 1SQQK 2KB7P 1Y47A 1J1DC 1BSHA 2FXOA 4L75A 2JWAA 3TGUG 3RK2D 3OW2O 1IFNA 3AEBC 3F89A 3L36A 2QJYC 3GHGC 3B5ND 2ZXEB 3CXHI 1SS1A 1SQVK 4DCKA 1CZQA 4UB8H 2O1KA 1OIPA 3AE9C 2W83C 1AQ5A 3W68A 2D2CC 3B4SA 2WPSA 1D7MA 2C0WA 4IFFA 3CX5D 5H2FE 1KFMA 2Q5UA 1SQQD 1EDLA 3L72J 3P8CE 1M57D 5AVXB 3B5NA 3A7OA 5AW6B 1NWQA 4A7PA 4IOIH 3TGUE 1RF0C 3EFGA 3B5NB 2YMKA 2E74B 1HF9A 1LTSC 1SQVD 2IYOA 1JUNA 1EDJA 2Q9IA 2WSFH 1BSNA 4XA4A 2FY8A 3CWBD 3LW5J 3A5TA 1KILD 2MJZA 4KJMA 4WY4C 2KSJA 2Q6QA 1Q82Q 1BGYJ 1SQBD 1PZQA 1LTIC 3EQ2A 3NXSA 3BCCD 4YTPC 4H13C 1Q90D 3I5CA 1A02J 2ZVOB 4IL6E 5CBNA 2Q3IA 3NMDA 2Q3EA 1ZW0A 2R44A 1GU5A 4L76A 3H1ID 2WWWA 2KS1A 3H1JD 3U1CA 2K88A 1RE3C 4PJ0E 3Q2YA 1WRGA 2BEZF 4D6TG 2KS1B 3WU2E 1OFCX 2ZT9C 4HB1A 1UIIA 4BXLA 2JJLA 1NTKK 3A2AA 1WMKA 1KB9D 3CD6P 1AJYA 4I6MC 4M3LA 2J5UA 3D71A 3KYQA 3CMAP 3CCRP 3Q5RA 1NTZJ 4GKGA 4I2LC 2O01H 1N73A 1U7MA 2YXRB 3H1LD 4YPCA 5AVWB 4C7NA 3H1HD 1N73B 5APSA 3VMZA 5CJ4A 3L71E 5TJHA 2QSIA 1W5CE 1VDFA 1EDKA 1L0NE 4D6TE 1URQD 2FYUG 1YITP 2P10A 5CJ0A 2Y0EA 3BATA 3M91A 3E1RA 1NTKD 3O6QA 2ZAEB 2LKMA 3FXDA 3P8MC 2W6BA 3O6QB 3PLNA 2KYVA 1MV8A 1NKZB 5KJ7D 4Y28J 2FFDA 3FWNA 1RE4A 3B5NC 1YJNP 2E74C 4R4MA 2I8DA 3M9HA 1W2EA 3V4WA 3RK3B 3C1LA 1KQSO 1PP9D 2PAJA 2QIWA 3V2RA 2FYZA 3L74G 2BCCG 2IYPA 1FJPA 1USEA 2JR8A 2ZFCA 4UB6E 2MKVA 3V2QA 5KJ7A 1EXJA 1EQ7A 2IBZG 1JY3O 3L70G 3CCUP 3H1KG 1SQXJ 2WT7B 2WSEJ 4RO0A 2XNDH 1CW5A 1FAVA 1OW6A 5KAFH 1IK7A 1M90Q 4HYTB 1Y8AA 4KHXA 4JYCA 1JM0A 1ZMEC 5CHXA 1JB0J 1NKNA 4Z1MH 4GOEA 2WSFJ 1NU1K 2ZXXA 3L74E 2V7QH 2BCCE 2KI7B 1YYCA 1KFNA 1M1JA 3R2PA 2O3JA 2IBZE 2O01N 1WT6A 3L70E 1M1JB 5AW4B 3MD0A 1LTTC 1OMIA 4EOTA 1N2DC 2LXCB 3HTKA 1H89A 5CCHC 2PP6A 1JY2O 3L71J 4OVNF 1DH3A 1FZBA 1GU4A 2FYUK 4RJTA 1N73C 5KKZB 3HTKB 2QA4P 1L0NJ 3L4FA 4GT1A 5TISH 3A0HE 1SLQA 1FDMA 1HUCA 2W6JH 1L4AD 5GTIH 2G3AA 2OYIA 1R5LA 2FKWB 1NU1D 1LT1A 1ZR4A 4OWFA 3V2PA 3IN6A 2OYIB 2ZVNB 2K1AA 4JQ0D 2A06E 2QG4A 1KYOE 1J1DB 3L35A 3LIDA 2J59M 3A0BE 3FGAD 4DZOA 1X8YA 3ABVC 3L72G 3KHUA 4PD4E 1SFCD 2JO1A 3WUUA 1M1KQ 3CX5H 2E5YA 3N4XA 2FYUD 3GF7A 1IC2A 3GHGB 1L4AA 1RE4C 3RK3C 3AEAC 2A45G 1AFOA 3MGNA 1L4AB 4IFDK 4CPGA 3M06A 3CPWO 4KT0J 2IBZI 1NOHA 4OGQB 3CXHH 1LT9B 3ITKA 1PGOA 3H32A 3QWOC 1PGQA 1BGYG 1TU3F 1S9KD 3SSUA 3JC22 1OVVA 2L91A 2KZJA 3OA7A 4HJGH 5KJ7C 2GUVA 3H32B 3NFQA 3P7KA 1VF5D 2YIUC 1QVGO 1GL2D 3H6PA 4H44D 3WUVA 2Z4EA 3L72E 1T3UA 5APUA 3JCUE 4C7RA 1K8AQ 2Y0CA 1KYOI 2E76D 1N7SD 3H1KD 1X22A 3W67A 4JBZA 3SWFA 1M7LA 1LTBC 1SQPD 3L75D 4H0LB 5DJTB 2SPZA 3WUTA 5E79H 3A3YB 5B66H 2PRRA 1M8OB 1GL2A 2ZYGA 5AW3B 1BGYE 1VF5B 1M1JC 3L73J 1BCCD 1CI6A 2NPSD 2HG5D 3LIEA 1IFMA 3AE8C 5GTHE 4BWNA 1SVFA 3FXEA 2HYNA 1CI6B 1NTZG 1KB9H 1BE3D 5KKZC 2I1KA 1P84D 1VL2A 1T2KC 2PGDA 2WPRA 2N1TA 4O9BA 3RL0B 1HGVA 3TDKA 1X0TA 3II6A 2N1TB 2M8RA 2OYIC 1S72P 4RKUJ 4JF7A 5APVA 1RQUA 2NPSA 2YXQB 2NPSB 5AW1B 3H25A 3AE3C 5AW0B 2A45I 2WSSH 3CC2P 1JEKA 4I7ZB 1GK6A 1NO4A 1NTZE 2YKQA 4EYYQ 1L4AC 1L0LJ 4OGQC 1Q2NA 2W6AA 1LT9C 1G1JA 5C39A 1NTMD 4NPDA 2IX7C 1S1CX 3SWKA 1CSBA 3BVHA 2WPVB 3CCLP 4IL6H 2N9BA 1ZOYC 3RK2B 1SQXG 3CXHD 4W80A 4ASVA 2ZYDA 3BASA 3RK3E 4YXWH 2Z5IA 1EC5A 2HR3A 5M1BA 1DIPA 1R5SA 2OTLP 1FU1A 3O8ZA 4H0LC 2OTJP 2FYNB 2GM4A 2KNCA 5KLVE 2IZ1A 1KV4A 1NTZK 1IFDA 4RESB 3VP9A 1AVYA 4JYBA 2KNCB 4UB8E 1VF5C 5B5EE 3G4SP 4QMAA 2KSEA 2FXMA 3CWBJ 2G8YA 2KP8A 2P2UA 1SQXE 2KUBA 1KILA 3KDPB 2CPBA 3GG2A 5BVZA 3L71G 3PRJA 2XKMA 1EZVG 3PP5A 2RMZA 1SQBJ 1KILB 3PJSK 4GIFA 2QRXA 2IFNA 1L0NG 1HH0A 3D6YA 2BASA 5BU8B 4HH2A 3RL0C
chains in the Genus database with same CATH topology
2WSEJ 2YMKA 3AEGC 1S1CX 2E74B 2JP3A 1HF9A 3GF3A 3D6ZA 2FYNC 2OQQA 3T97B 3FGAD 1VF5B 1KMIZ 2D2CB 3ABVC 1OW6A 2WPVB 3SFEC 1K05A 2JO1A 1ZRTE 4XFJA 3IAOA 1IK7A 2NZ2A 4R4LA 1FDOA 1UIXA 1ZOYC 1K04A 4H0LD 3GF7A 3AE7C 3LW5J 2E76C 3AE8C 2FBWC 4U7JA 2QSIA 1EXIA 3GLMA 4YXDC 3Q5SA 1OW8A 3Q3DA 2ZT9B 2QJPC 1S5LX 5KKZC 3AEAC 1ZMEC 1KORA 1YQ3C 1VL2A 1JB0J 2E75B 2E74D 1KQFB 4I7ZC 4H13D 4KT0J 2P10A 4Z1MH 2D2CD 2WSFJ 3RK3E 4YTPC 3O6QA 4OGQB 2IDBA 3R4YA 4H13C 4PV1D 3Q1MA 1Q90D 4H44B 5M1BA 1DIPA 3D70A 5L8RJ 2WQYC 4PV1C 1R8EA 4TT3H 1PV3A 3AEBC 4H0LC 2ZT9D 4IL6X 1ZP0C 2QJYC 4RKUJ 1TU3F 4Y28J 3AE6C 1RQUA 2O01J 5KLIC 2H88C 3AE5C 3AE1C 2FXPA 3AE2C 3S9OA 3AE9C 3C8VA 1OMIA 1VF5D 4OGQD 2E74C 2E76B 1NYHA 2YIUC 1KILE 3G9RA 4R4MA 2BEQD 1PL5A 4H44D 1KTMA 3Q2YA 2BEZF 1VF5C 2D2CC 3AEDC 3H25A 1YQ4C 2QIWA 3AE3C 2H89C 1DD3A 3GMAA 4I7ZB 1KQGB 3AEFC 2E75D 2G8YA 2QJKC 2ZT9C 1OW7A 4H13B 1NGMB 1PIXA 1U57A 3EWKA 2G3AA 3Q5PA 2E75C 2K9YA 2E76D 3RL0g 1WMKA 3AE4C 1AJYA 4PV1B 2V7QJ 3SFDC 2MKVA 1MKMA 1HJ0A 4H0LB 1GMJA 1RQVA 4OGQC 1Y9BA 3IN6A 2J5UA 1EXJA 3B71A 3D71A 4H44C 4GDOA 3D6YA 1DD4A 3AEEC 3Q5RA 1FDIA 3AECC 2WSCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TT3 H;  2V7Q J;  4Z1M H;  1HF9 A;  1GMJ A; 
#chains in the Genus database with same CATH topology
 1K73 Q;  3AEG C;  1BDD A;  3FWL A;  1FOS F;  3S1K A;  3D6Z A;  2N1T C;  3CCS P;  1NJI Q;  3SWY A;  3VN0 A;  1N86 A;  4W7Y A;  3RBZ A;  1FDO A;  1YTZ T;  2B87 A;  1HWT C;  2FBW C;  2YO2 A;  2NPS C;  3H1I J;  2B87 B;  3H1J J;  3TYY A;  4I7Z C;  3CCE P;  1FZF A;  2CPS A;  3MIW A;  1DEE G;  1NH4 A;  3KZI E;  3WMM 0;  3G6E P;  1LNQ A;  1XTG B;  3P8C D;  1PV3 A;  4C7N B;  1EZV E;  3TF5 A;  1GD2 E;  2O1J A;  4AQR D;  1VQ9 P;  1ZP0 C;  3TGU D;  2XV5 A;  5AVT B;  2P67 A;  5AVV B;  1JMM A;  3G9R A;  1PGJ A;  2H8P D;  1KQL A;  4XE5 B;  3H1L J;  3T97 A;  1USD A;  1BDC A;  1W2B O;  3AEF C;  3RK2 C;  2DW3 A;  3TNU A;  2B9B A;  2KLU A;  3K5B A;  4ASW A;  4WBA A;  3SFD C;  2FFD B;  5KAI H;  2AXT H;  1Y9B A;  1VQ7 P;  1QVF O;  1URQ A;  3TSI A;  3GW6 A;  1NTK J;  5KLV J;  1DD4 A;  4NPE A;  2Q7C A;  1PFI A;  1URQ B;  4N78 D;  1VQ8 P;  2FYN C;  3CC7 P;  1E5W A;  1HBW A;  1Q7Y Q;  1GDT A;  1K9M Q;  4U7J A;  3ZDM A;  1J1E B;  1FBM A;  2KOG A;  2YKO A;  1L0N K;  1EZV I;  2YIU B;  1PP9 J;  4AYC A;  1MFT A;  4OH8 B;  3KPE A;  4ZMD A;  1QEX A;  3USS A;  1JMB A;  1ZXG A;  1KIL C;  1RHZ B;  1J2J B;  3AE5 C;  2KK7 A;  1JNM A;  2WPQ A;  2BEQ D;  4WWI A;  1P84 H;  3V5B A;  1H88 A;  3AED C;  2YNY A;  2A06 G;  2QJP B;  4L73 A;  3L71 D;  2HPC A;  3BRT B;  2JWD A;  3U59 A;  2M3B A;  4PD4 H;  1AA0 A;  2JEE A;  2I1J A;  3CCM P;  1IZN B;  3CCV P;  1NGM B;  1PIX A;  2HPC B;  3HE4 A;  4D6T D;  5AVQ B;  1FZE A;  4N3Y B;  3I56 P;  3HRN A;  3VMX A;  3L73 E;  2YMY A;  4TLF A;  1ZRT D;  3CC4 P;  3OJA B;  2WMM A;  1PPJ G;  2GA1 A;  2QM8 A;  5DJU B;  1L0L G;  5KAF E;  2ITA A;  3P32 A;  2XU6 A;  2D2C D;  4ZKP A;  1LGH B;  2IZ0 A;  2RN0 A;  4K35 A;  1NAY A;  1VQK P;  2FFD C;  1VPC A;  1NU1 J;  2O01 J;  2P1J A;  1QGK B;  2W27 A;  2C9N Y;  1NYH A;  1URQ C;  4U3F E;  2M5A A;  1PPJ E;  1OX3 A;  2CK3 H;  1L0L E;  2M5A B;  1GTW A;  2RH0 A;  1J1E C;  1SFC A;  5TIS E;  1IJD B;  1VQP P;  1JCD A;  1VQL P;  1SFC B;  5GTI E;  3HE5 A;  3L74 D;  1XTC C;  3B71 A;  2BCC D;  4NPF X;  1T6A A;  3HE5 B;  3CWB G;  2IBZ D;  3G71 P;  3L70 D;  2POH A;  4N6J A;  4XFJ A;  4R4L A;  1SQB G;  1S5L H;  2AXC A;  1NTM E;  3GLM A;  3CX5 E;  3Q3D A;  1SQQ E;  2QJP C;  2ZJS E;  1ZV8 A;  1RF1 A;  4AUW A;  3JSV C;  3R4Y A;  1GL2 B;  3Q1M A;  1RF1 B;  4H44 B;  1Z56 A;  4MN4 C;  2AEM A;  2H7H A;  1S4X A;  2ZT9 D;  3H1I G;  3H1J G;  1KD1 Q;  1SQV E;  1N7S A;  1SQP J;  2A06 D;  3L75 J;  1KYO D;  3S9O A;  3C8V A;  3CWB E;  2E76 B;  1KIL E;  1N7S B;  1PL5 A;  2JKV A;  4PD4 D;  3RGU A;  2HFE D;  1LJ2 A;  5H2F H;  2H89 C;  1SQB E;  1T3J A;  1BCC J;  3BCC E;  3G3Z A;  1N8R Q;  5AW7 B;  1BE3 J;  2V7Q J;  3L37 A;  1RQV A;  1AVO A;  3H1L G;  1G2C A;  4GDO A;  1VQ5 P;  1FC2 C;  2R3S A;  2UWJ E;  2XNX A;  1G2C B;  1GZL A;  3CX5 I;  3H1I E;  4U3F J;  3H1J E;  5E79 E;  5B66 E;  2NZ2 A;  4GOF A;  1ZR2 A;  5AW8 B;  3AE7 C;  2E43 A;  3VOP A;  4YXD C;  1NTK G;  1YTZ I;  3L72 D;  5KLV G;  1S5L X;  3MP7 B;  1KOR A;  2E74 D;  1KB9 E;  1JO5 A;  3VMA A;  4ZKU A;  5B5E H;  4PV1 D;  2OYH A;  3D70 A;  1SFC C;  2K37 A;  4L74 A;  2OYH B;  1HJB A;  1E79 H;  2WSE H;  3H1L E;  1SQB K;  1GW4 A;  4IFM A;  2LR2 A;  2OGU A;  2H88 C;  3CCJ P;  1JCC A;  1PP9 G;  3H1H E;  1KZU B;  2Y9Y A;  4PJ0 H;  1JOC A;  1S3J A;  3HD7 D;  1KC8 Q;  1KTM A;  1NTM J;  1BGY D;  3N7N A;  1SP4 A;  1SQQ J;  1LTJ A;  5AW2 B;  3WU2 H;  3PTZ A;  5BU5 A;  4DOJ A;  2E75 D;  1KN7 A;  1NTK E;  1LTJ B;  4PV1 B;  1GMJ A;  2XZR A;  2R32 A;  4WVZ A;  1GL2 C;  1RF1 C;  1SQV J;  4H44 C;  5KLI B;  5APW A;  4C46 A;  3CCQ P;  3HD7 A;  2P58 A;  3GF3 A;  3KZI H;  3CME P;  2OQQ A;  1EDI A;  3HD7 B;  1PP9 E;  1H0T A;  1KB9 I;  1UIX A;  5CBO A;  2E76 C;  1N7S C;  1AV1 A;  1JY3 P;  1QL2 A;  2E42 A;  1OW8 A;  3BCC J;  1H0T B;  4N78 E;  1JY3 N;  2QJK B;  2C0X A;  2E75 B;  1NVO A;  1QX8 A;  5CCH D;  2Z5H A;  2R5B A;  1LWU A;  1NTZ D;  2C9L Y;  3IR9 A;  1RY3 A;  1LWU B;  1L2P A;  2WQY C;  4EDF A;  4TT3 H;  4I1L A;  4IL6 X;  2JDI H;  3AE6 C;  4ZNC A;  1H8A A;  2K3R A;  5KLV K;  1LTA C;  3M0A A;  3IF4 A;  2P7J A;  2L5G B;  1FZA A;  4DJG A;  4W7Z A;  2R3C A;  4EI2 A;  5CCH A;  1RH5 B;  1VQM P;  4EIJ A;  1OVR A;  1NU1 G;  3E1I A;  5APY A;  1HVV A;  2RKL A;  1U57 A;  4UB6 H;  5K5G B;  1MZ9 A;  1SQX K;  3M0D A;  1JY2 P;  2IPP A;  3RK3 D;  2M3E A;  1JY2 N;  1OWA A;  4WB4 A;  3CI9 A;  1MUU A;  3AEE C;  1FDI A;  3H1H J;  1VQN P;  2OYH C;  2JP3 A;  2GUS A;  1S2E A;  3T97 B;  5KLV D;  1ZRT E;  1YJW P;  3IAO A;  3TNU B;  1MFZ A;  3TGU J;  3MHV A;  1HGZ A;  2J58 A;  2K9J A;  4B86 A;  1HTL C;  2V4H A;  2WZ7 A;  2H43 A;  1N7L A;  3FX0 A;  1JTH A;  5CMZ A;  1YJ9 P;  2K9J B;  1NU1 E;  1T8Z A;  3V2N A;  1JTH B;  2IDB A;  1LTJ C;  1SQX D;  3VMY A;  5L8R J;  4PV1 C;  3V6I A;  1R8E A;  3VP8 A;  5EFW B;  3HUS A;  1VQ6 P;  2QM7 A;  1FZC A;  5KLI C;  5AVU B;  3AE2 C;  1IFP A;  5AVS B;  3HUS B;  2R5D A;  1ZN5 A;  3L73 G;  2FYU E;  1FZC B;  2WIT A;  1FOS E;  2WT7 A;  3HD7 C;  3A0H H;  1DD3 A;  2N9Y B;  3GMA A;  1KQG B;  2WSC H;  2Q1K A;  1SQP G;  2KIK A;  3L75 G;  2QJK C;  3EWK A;  3MTU E;  2E75 C;  3QH9 A;  1FE6 A;  2QVA A;  2WVR A;  1VQO P;  3BRV B;  1IFI A;  1KYO H;  1T2K D;  1S9K E;  1LWU C;  5KAI E;  2AXT E;  1BCC G;  3AEC C;  2W90 A;  3B8E B;  3A0B H;  1EZV D;  3PHL A;  1LP1 A;  1L0N D;  5CCG D;  1GW3 A;  3RBX A;  3SFE C;  1K05 A;  1LTG C;  1BE3 G;  2OAR A;  3KQG A;  1K04 A;  1LP1 B;  3CL3 D;  4BRY A;  3HE4 B;  2KZI A;  2M0B A;  3S4R A;  4BRY B;  3IFM A;  1KQF B;  2LXB A;  1FJK A;  3H1K E;  2Y0D A;  4U3F G;  1SQP E;  3L75 E;  2AEF A;  2OTK E;  3MUD A;  1OXZ A;  4D6T J;  1OVU A;  5CCG A;  3CLQ A;  2QE7 H;  3M0D C;  2FXP A;  5AW9 B;  1BCC E;  4Y99 B;  4OGQ D;  1A02 F;  3V4Q A;  2XDJ A;  5AW5 B;  1M56 D;  3JCU H;  3F5H A;  1YQ4 C;  1BE3 E;  1P84 E;  2KLV A;  4GOD A;  3OAK A;  2YKP A;  1Q86 Q;  2E5T A;  3KXD A;  1YIJ P;  2A45 H;  3UIA A;  1OW7 A;  1X9V A;  1IFJ A;  2K9Y A;  2PFX A;  3PH0 A;  3RL0 g;  3GHG A;  1DX7 A;  1QL1 A;  3VTP C;  1NTM G;  3LW5 H;  2HOD A;  1SQQ G;  2QJY B;  2IFM A;  1YHQ P;  4LLH A;  2HOD B;  1FZG A;  5APX A;  1LT9 A;  2FYU J;  2KXP B;  5AVR B;  1KMI Z;  2D2C B;  5GTH H;  1SQP K;  4WY4 D;  3HUS C;  4H0L D;  1FZC C;  1X79 B;  3MZW B;  1SQV G;  3Q5S A;  1YI2 P;  3M9Q A;  4H13 D;  1RF0 A;  4DT0 A;  1Q81 Q;  1NAF A;  1GK4 A;  5APQ A;  2YO3 A;  2QEX P;  3BCC G;  3L73 D;  3I55 P;  1G1I A;  2ZYA A;  2AEJ A;  3E7K A;  4WY4 A;  1P84 I;  3L74 J;  3AE1 C;  5AVZ B;  2BCC J;  1IO4 A;  3U1A A;  4WY4 B;  3RL0 D;  4LGD E;  4PD4 I;  5AVY B;  3CXH E;  3VYI A;  3L70 J;  3M9B A;  2N1T D;  3H1K J;  1L0L K;  2W8Z A;  5KTB A;  4H13 B;  1PGP A;  4K3A A;  3EFF K;  3Q5P A;  1VQ4 P;  3AE4 C;  1MKM A;  1HJ0 A;  1OZH A;  4JPZ B;  2B88 A;  1RE3 A;  2VRS A;  1DEB A;  2WSC J;  4LC1 A;  1AQT A;  1QLE D;  3NTN A;  2WTY A;  2HLO A;  1U7J A;  3MUD C;  2OYO A;  3C9I A;  2Y9Z A;  1FS0 E;  1IK9 A;  4Y99 C;  2NRG A;  5CCG C;  1NHL A;  4HKZ H;  4U3F D;  1EXI A;  1PPJ D;  3TK1 A;  2B89 A;  1ZLL A;  1YBK A;  1S5L E;  1NTM K;  2ZT9 B;  3H1H G;  1YQ3 C;  1L0L D;  5APT A;  1SQQ K;  2KB7 P;  1Y47 A;  1J1D C;  1BSH A;  2FXO A;  4L75 A;  2JWA A;  3TGU G;  3RK2 D;  3OW2 O;  1IFN A;  3AEB C;  3F89 A;  3L36 A;  2QJY C;  3GHG C;  3B5N D;  2ZXE B;  3CXH I;  1SS1 A;  1SQV K;  4DCK A;  1CZQ A;  4UB8 H;  2O1K A;  1OIP A;  3AE9 C;  2W83 C;  1AQ5 A;  3W68 A;  2D2C C;  3B4S A;  2WPS A;  1D7M A;  2C0W A;  4IFF A;  3CX5 D;  5H2F E;  1KFM A;  2Q5U A;  1SQQ D;  1EDL A;  3L72 J;  3P8C E;  1M57 D;  5AVX B;  3B5N A;  3A7O A;  5AW6 B;  1NWQ A;  4A7P A;  4IOI H;  3TGU E;  1RF0 C;  3EFG A;  3B5N B;  2YMK A;  2E74 B;  1HF9 A;  1LTS C;  1SQV D;  2IYO A;  1JUN A;  1EDJ A;  2Q9I A;  2WSF H;  1BSN A;  4XA4 A;  2FY8 A;  3CWB D;  3LW5 J;  3A5T A;  1KIL D;  2MJZ A;  4KJM A;  4WY4 C;  2KSJ A;  2Q6Q A;  1Q82 Q;  1BGY J;  1SQB D;  1PZQ A;  1LTI C;  3EQ2 A;  3NXS A;  3BCC D;  4YTP C;  4H13 C;  1Q90 D;  3I5C A;  1A02 J;  2ZVO B;  4IL6 E;  5CBN A;  2Q3I A;  3NMD A;  2Q3E A;  1ZW0 A;  2R44 A;  1GU5 A;  4L76 A;  3H1I D;  2WWW A;  2KS1 A;  3H1J D;  3U1C A;  2K88 A;  1RE3 C;  4PJ0 E;  3Q2Y A;  1WRG A;  2BEZ F;  4D6T G;  2KS1 B;  3WU2 E;  1OFC X;  2ZT9 C;  4HB1 A;  1UII A;  4BXL A;  2JJL A;  1NTK K;  3A2A A;  1WMK A;  1KB9 D;  3CD6 P;  1AJY A;  4I6M C;  4M3L A;  2J5U A;  3D71 A;  3KYQ A;  3CMA P;  3CCR P;  3Q5R A;  1NTZ J;  4GKG A;  4I2L C;  2O01 H;  1N73 A;  1U7M A;  2YXR B;  3H1L D;  4YPC A;  5AVW B;  4C7N A;  3H1H D;  1N73 B;  5APS A;  3VMZ A;  5CJ4 A;  3L71 E;  5TJH A;  2QSI A;  1W5C E;  1VDF A;  1EDK A;  1L0N E;  4D6T E;  1URQ D;  2FYU G;  1YIT P;  2P10 A;  5CJ0 A;  2Y0E A;  3BAT A;  3M91 A;  3E1R A;  1NTK D;  3O6Q A;  2ZAE B;  2LKM A;  3FXD A;  3P8M C;  2W6B A;  3O6Q B;  3PLN A;  2KYV A;  1MV8 A;  1NKZ B;  5KJ7 D;  4Y28 J;  2FFD A;  3FWN A;  1RE4 A;  3B5N C;  1YJN P;  2E74 C;  4R4M A;  2I8D A;  3M9H A;  1W2E A;  3V4W A;  3RK3 B;  3C1L A;  1KQS O;  1PP9 D;  2PAJ A;  2QIW A;  3V2R A;  2FYZ A;  3L74 G;  2BCC G;  2IYP A;  1FJP A;  1USE A;  2JR8 A;  2ZFC A;  4UB6 E;  2MKV A;  3V2Q A;  5KJ7 A;  1EXJ A;  1EQ7 A;  2IBZ G;  1JY3 O;  3L70 G;  3CCU P;  3H1K G;  1SQX J;  2WT7 B;  2WSE J;  4RO0 A;  2XND H;  1CW5 A;  1FAV A;  1OW6 A;  5KAF H;  1IK7 A;  1M90 Q;  4HYT B;  1Y8A A;  4KHX A;  4JYC A;  1JM0 A;  1ZME C;  5CHX A;  1JB0 J;  1NKN A;  4Z1M H;  4GOE A;  2WSF J;  1NU1 K;  2ZXX A;  3L74 E;  2V7Q H;  2BCC E;  2KI7 B;  1YYC A;  1KFN A;  1M1J A;  3R2P A;  2O3J A;  2IBZ E;  2O01 N;  1WT6 A;  3L70 E;  1M1J B;  5AW4 B;  3MD0 A;  1LTT C;  1OMI A;  4EOT A;  1N2D C;  2LXC B;  3HTK A;  1H89 A;  5CCH C;  2PP6 A;  1JY2 O;  3L71 J;  4OVN F;  1DH3 A;  1FZB A;  1GU4 A;  2FYU K;  4RJT A;  1N73 C;  5KKZ B;  3HTK B;  2QA4 P;  1L0N J;  3L4F A;  4GT1 A;  5TIS H;  3A0H E;  1SLQ A;  1FDM A;  1HUC A;  2W6J H;  1L4A D;  5GTI H;  2G3A A;  2OYI A;  1R5L A;  2FKW B;  1NU1 D;  1LT1 A;  1ZR4 A;  4OWF A;  3V2P A;  3IN6 A;  2OYI B;  2ZVN B;  2K1A A;  4JQ0 D;  2A06 E;  2QG4 A;  1KYO E;  1J1D B;  3L35 A;  3LID A;  2J59 M;  3A0B E;  3FGA D;  4DZO A;  1X8Y A;  3ABV C;  3L72 G;  3KHU A;  4PD4 E;  1SFC D;  2JO1 A;  3WUU A;  1M1K Q;  3CX5 H;  2E5Y A;  3N4X A;  2FYU D;  3GF7 A;  1IC2 A;  3GHG B;  1L4A A;  1RE4 C;  3RK3 C;  3AEA C;  2A45 G;  1AFO A;  3MGN A;  1L4A B;  4IFD K;  4CPG A;  3M06 A;  3CPW O;  4KT0 J;  2IBZ I;  1NOH A;  4OGQ B;  3CXH H;  1LT9 B;  3ITK A;  1PGO A;  3H32 A;  3QWO C;  1PGQ A;  1BGY G;  1TU3 F;  1S9K D;  3SSU A;  3JC2 2;  1OVV A;  2L91 A;  2KZJ A;  3OA7 A;  4HJG H;  5KJ7 C;  2GUV A;  3H32 B;  3NFQ A;  3P7K A;  1VF5 D;  2YIU C;  1QVG O;  1GL2 D;  3H6P A;  4H44 D;  3WUV A;  2Z4E A;  3L72 E;  1T3U A;  5APU A;  3JCU E;  4C7R A;  1K8A Q;  2Y0C A;  1KYO I;  2E76 D;  1N7S D;  3H1K D;  1X22 A;  3W67 A;  4JBZ A;  3SWF A;  1M7L A;  1LTB C;  1SQP D;  3L75 D;  4H0L B;  5DJT B;  2SPZ A;  3WUT A;  5E79 H;  3A3Y B;  5B66 H;  2PRR A;  1M8O B;  1GL2 A;  2ZYG A;  5AW3 B;  1BGY E;  1VF5 B;  1M1J C;  3L73 J;  1BCC D;  1CI6 A;  2NPS D;  2HG5 D;  3LIE A;  1IFM A;  3AE8 C;  5GTH E;  4BWN A;  1SVF A;  3FXE A;  2HYN A;  1CI6 B;  1NTZ G;  1KB9 H;  1BE3 D;  5KKZ C;  2I1K A;  1P84 D;  1VL2 A;  1T2K C;  2PGD A;  2WPR A;  2N1T A;  4O9B A;  3RL0 B;  1HGV A;  3TDK A;  1X0T A;  3II6 A;  2N1T B;  2M8R A;  2OYI C;  1S72 P;  4RKU J;  4JF7 A;  5APV A;  1RQU A;  2NPS A;  2YXQ B;  2NPS B;  5AW1 B;  3H25 A;  3AE3 C;  5AW0 B;  2A45 I;  2WSS H;  3CC2 P;  1JEK A;  4I7Z B;  1GK6 A;  1NO4 A;  1NTZ E;  2YKQ A;  4EYY Q;  1L4A C;  1L0L J;  4OGQ C;  1Q2N A;  2W6A A;  1LT9 C;  1G1J A;  5C39 A;  1NTM D;  4NPD A;  2IX7 C;  1S1C X;  3SWK A;  1CSB A;  3BVH A;  2WPV B;  3CCL P;  4IL6 H;  2N9B A;  1ZOY C;  3RK2 B;  1SQX G;  3CXH D;  4W80 A;  4ASV A;  2ZYD A;  3BAS A;  3RK3 E;  4YXW H;  2Z5I A;  1EC5 A;  2HR3 A;  5M1B A;  1DIP A;  1R5S A;  2OTL P;  1FU1 A;  3O8Z A;  4H0L C;  2OTJ P;  2FYN B;  2GM4 A;  2KNC A;  5KLV E;  2IZ1 A;  1KV4 A;  1NTZ K;  1IFD A;  4RES B;  3VP9 A;  1AVY A;  4JYB A;  2KNC B;  4UB8 E;  1VF5 C;  5B5E E;  3G4S P;  4QMA A;  2KSE A;  2FXM A;  3CWB J;  2G8Y A;  2KP8 A;  2P2U A;  1SQX E;  2KUB A;  1KIL A;  3KDP B;  2CPB A;  3GG2 A;  5BVZ A;  3L71 G;  3PRJ A;  2XKM A;  1EZV G;  3PP5 A;  2RMZ A;  1SQB J;  1KIL B;  3PJS K;  4GIF A;  2QRX A;  2IFN A;  1L0N G;  1HH0 A;  3D6Y A;  2BAS A;  5BU8 B;  4HH2 A;  3RL0 C; 
#chains in the Genus database with same CATH homology
 2WSE J;  2YMK A;  3AEG C;  1S1C X;  2E74 B;  2JP3 A;  1HF9 A;  3GF3 A;  3D6Z A;  2FYN C;  2OQQ A;  3T97 B;  3FGA D;  1VF5 B;  1KMI Z;  2D2C B;  3ABV C;  1OW6 A;  2WPV B;  3SFE C;  1K05 A;  2JO1 A;  1ZRT E;  4XFJ A;  3IAO A;  1IK7 A;  2NZ2 A;  4R4L A;  1FDO A;  1UIX A;  1ZOY C;  1K04 A;  4H0L D;  3GF7 A;  3AE7 C;  3LW5 J;  2E76 C;  3AE8 C;  2FBW C;  4U7J A;  2QSI A;  1EXI A;  3GLM A;  4YXD C;  3Q5S A;  1OW8 A;  3Q3D A;  2ZT9 B;  2QJP C;  1S5L X;  5KKZ C;  3AEA C;  1ZME C;  1KOR A;  1YQ3 C;  1VL2 A;  1JB0 J;  2E75 B;  2E74 D;  1KQF B;  4I7Z C;  4H13 D;  4KT0 J;  2P10 A;  4Z1M H;  2D2C D;  2WSF J;  3RK3 E;  4YTP C;  3O6Q A;  4OGQ B;  2IDB A;  3R4Y A;  4H13 C;  4PV1 D;  3Q1M A;  1Q90 D;  4H44 B;  5M1B A;  1DIP A;  3D70 A;  5L8R J;  2WQY C;  4PV1 C;  1R8E A;  4TT3 H;  1PV3 A;  3AEB C;  4H0L C;  2ZT9 D;  4IL6 X;  1ZP0 C;  2QJY C;  4RKU J;  1TU3 F;  4Y28 J;  3AE6 C;  1RQU A;  2O01 J;  5KLI C;  2H88 C;  3AE5 C;  3AE1 C;  2FXP A;  3AE2 C;  3S9O A;  3AE9 C;  3C8V A;  1OMI A;  1VF5 D;  4OGQ D;  2E74 C;  2E76 B;  1NYH A;  2YIU C;  1KIL E;  3G9R A;  4R4M A;  2BEQ D;  1PL5 A;  4H44 D;  1KTM A;  3Q2Y A;  2BEZ F;  1VF5 C;  2D2C C;  3AED C;  3H25 A;  1YQ4 C;  2QIW A;  3AE3 C;  2H89 C;  1DD3 A;  3GMA A;  4I7Z B;  1KQG B;  3AEF C;  2E75 D;  2G8Y A;  2QJK C;  2ZT9 C;  1OW7 A;  4H13 B;  1NGM B;  1PIX A;  1U57 A;  3EWK A;  2G3A A;  3Q5P A;  2E75 C;  2K9Y A;  2E76 D;  3RL0 g;  1WMK A;  3AE4 C;  1AJY A;  4PV1 B;  2V7Q J;  3SFD C;  2MKV A;  1MKM A;  1HJ0 A;  4H0L B;  1GMJ A;  1RQV A;  4OGQ C;  1Y9B A;  3IN6 A;  2J5U A;  1EXJ A;  3B71 A;  3D71 A;  4H44 C;  4GDO A;  3D6Y A;  1DD4 A;  3AEE C;  3Q5R A;  1FDI A;  3AEC C;  2WSC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...