4TT3H

The pathway of binding of the intrinsically disordered mitochondrial inhibitor protein to f1-atpase
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
40
structure length
40
Chain Sequence
SAGAVRDAGGAFGKREQAEEERYFRARAAEQLAALKKHHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pathway of binding of the intrinsically disordered mitochondrial inhibitor protein to F1-ATPase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords ATP synthase subunit alpha, mitochondrial
total genus 14
structure length 40
sequence length 40
chains with identical sequence I, J
ec nomenclature
pdb deposition date 2014-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.500 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4tt3H00
2V7QJ 1HF9A 4Z1MH 1GMJA 4TT3H
chains in the Genus database with same CATH superfamily
1IFNA 4PD4I 1M8OB 1X8YA 5M1BA 1IFJA 3RL0B 5APQA 1KORA 1NVOA 2IBZI 1NTKJ 1RHZB 1E5WA 1LTGC 2IDBA 2NPSB 2QJYC 2HODB 2L91A 1YQ3C 2M3EA 2N9BA 3C9IA 3L73D 4L74A 1NTZK 2A45H 2FFDA 1LTIC 1HJ0A 1JMMA 1LNQA 1OVUA 4JPZB 4C7NA 1IFPA 2GUVA 2O1JA 2WTYA 5CCHD 3A5TA 3Q5PA 1JY3O 1N7SA 2HR3A 5B5EH 1XTCC 3VMYA 2P1JA 3B5NB 1K8AQ 1KFMA 1R8EA 3BCCG 5EFWB 3SFDC 2JWAA 1VQNP 4I7ZC 1LWUC 1ZW0A 2E74D 1DEBA 3HD7B 1JCDA 3N4XA 1VQ5P 2LXCB 3CXHI 3CWBJ 4UB8H 4WBAA 1YI2P 2A45G 1EZVI 3K5BA 3GHGA 4ZMDA 1IFIA 1PGJA 1KYOE 3H1JE 2UWJE 2Y0CA 5B66H 2KSEA 4LLHA 4U3FD 2ZVOB 5AVUB 1L0LD 3L71G 1YJNP 3HD7C 3TGUG 1P84I 2NPSA 4NPFX 1PPJG 3OAKA 3M0DA 4D6TE 3MTUE 3NTNA 2FXPA 1RQVA 2Z5IA 4I1LA 3TGUD 1LT9C 2E42A 1JY2N 3L35A 1IK9A 2KYVA 4D6TG 1SVFA 3AEGC 1PP9D 5K5GB 5AW6B 2IYOA 1J1EC 3W67A 3L70J 3P8MC 2C9NY 1IO4A 1MV8A 3P8CE 1PP9G 3AE3C 3B4SA 1T3JA 3IN6A 2K37A 3H1LE 3CX5H 1N73C 3HE4A 4DOJA 1DD3A 3OW2O 1J2JB 3AE4C 4M3LA 3RK3E 2ZT9C 3KDPB 2BCCE 3L75G 1FAVA 1NTZG 3P8CD 2WPQA 4LC1A 3WU2E 1LTBC 1Y9BA 2KNCA 2ZYAA 5AVXB 3RK3C 2CPBA 1KMIZ 1S5LX 2DW3A 4R4MA 3CCEP 1SFCC 1L2PA 2FBWC 2W6AA 3FXEA 5E79E 4JYBA 5AVRB 3U1AA 1M1JA 1QEXA 1DD4A 1JY2O 2FYUE 3VP8A 1ZRTE 3Q3DA 2OTJP 3M0AA 3C8VA 1G2CB 1LT9B 2Q3IA 4RESB 1HBWA 4GDOA 2O01N 4HB1A 1ZOYC 3RBXA 1SQXD 2OARA 3AEEC 3KXDA 5C39A 2RH0A 3H1ID 3VYIA 3T97A 2R5BA 3HE4B 5AVQB 1LJ2A 3H1LG 3CCVP 2WITA 2W8ZA 3PJSK 2FYNB 1JMBA 3E1IA 1NTZD 3G4SP 2ZXXA 4K3AA 2FYUK 1M90Q 2KS1A 3CC4P 2BCCD 4DT0A 5BVZA 3CCMP 3CX5D 5AW9B 5CCHC 1L0NJ 3G9RA 3V2NA 3MHVA 2IYPA 1PGOA 1LTJC 1BCCJ 1OW6A 1URQA 2MKVA 3N7NA 3BRTB 3PRJA 1VQMP 2OYIB 1SQPD 3H1KD 3RK2C 3SWYA 5BU8B 3WU2H 4EOTA 4H44C 2HG5D 2N1TC 5AW2B 1G1IA 1KB9E 4MN4C 3RBZA 5APSA 1JY3N 2WVRA 4C46A 5KJ7A 3G6EP 3CXHE 1YJ9P 3H1HD 1SQVK 1PPJE 3L73E 1EZVE 3H32B 3D71A 3TGUE 3Q5SA 2WSCH 2AEMA 1ZR2A 1CSBA 1ZLLA 2K3RA 1NOHA 1WRGA 3B8EB 1URQB 2M3BA 3A2AA 2J58A 3HD7A 4DCKA 2NPSC 5KKZC 1QVFO 1NTMG 2ZXEB 4PV1D 3AEAC 4Y28J 4ZNCA 4WY4A 2QJPB 1FZCC 3BRVB 3V5BA 1NTKD 1ZN5A 3AE6C 3TNUA 2YO3A 3GHGC 3RK2D 1GTWA 1FE6A 1Q2NA 3PHLA 4H44D 4IL6E 1FJPA 3L74G 1H0TB 3L71D 4XA4A 1K05A 2XU6A 4BXLA 1KQFB 1SQPJ 1PPJD 2HLOA 2P67A 2V4HA 4OGQB 4UB8E 2AEJA 3QH9A 1LTJB 2P10A 1N73A 3H1HG 3H6PA 4WVZA 3KZIE 1VQ8P 1PV3A 3H1KJ 1KB9D 1L4AA 5CMZA 4H0LB 2IFNA 1EDJA 5AW7B 1SQBD 2NRGA 4HH2A 1WMKA 3UIAA 1KV4A 3E7KA 4XFJA 3AEDC 4K35A 1RF1B 2ZVNB 1YYCA 1SS1A 5KLVG 5AW4B 1SQXJ 2Y0EA 3P7KA 1S9KE 1K9MQ 4KJMA 4AQRD 2YKQA 1NTKK 4ZKPA 5BU5A 1USEA 3AE7C 1FU1A 3R2PA 3V2RA 3H1IJ 3V6IA 1AFOA 3CPWO 1RE3A 2PGDA 3LIEA 3MGNA 1YTZT 5APVA 1S5LH 3FXDA 1L0ND 1KILB 1FZEA 5AW1B 1S1CX 3CCQP 3SWKA 1RE3C 5CCGC 3RK3B 3I56P 4NPDA 2KIKA 1SQBK 1J1DB 4L73A 4XE5B 2JEEA 4I6MC 4RKUJ 3CCRP 3V4QA 3VMZA 3BATA 1LTJA 2D2CB 5AVVB 1T2KC 3WUVA 2Q5UA 2QM7A 2QEXP 4UB6E 3AE9C 2CPSA 3A0BE 4RO0A 1NTME 1HJBA 3LW5J 1DX7A 1NJIQ 2N1TD 4D6TJ 1KB9I 1EXJA 4AUWA 1KILC 1GMJA 1GL2A 1CZQA 1NTKG 4PD4H 2Y0DA 2HYNA 2YXQB 5CHXA 1QL1A 4CPGA 2WSSH 1OWAA 1FOSE 2QVAA 1YJWP 5KLIB 1KILA 2O1KA 3O8ZA 4GKGA 4HJGH 1W5CE 4N78D 3SFEC 1A02J 1JO5A 2W90A 3CCJP 1T8ZA 3ITKA 2KLVA 1AVYA 1VQOP 2N1TA 3M06A 4NPEA 2NPSD 2WWWA 3BVHA 3H32A 2R3CA 1LTAC 1NHLA 1L0LG 1LGHB 1K73Q 1FZGA 5AW3B 3RL0C 3FWNA 2MJZA 5GTIE 1L0LE 1HVVA 1IFDA 3L74J 3NFQA 3M0DC 2HODA 3CWBD 1VF5B 1MZ9A 2E74C 3KPEA 2AEFA 2OYHC 2Q6QA 4YPCA 2B89A 2QSIA 1SQVE 3VMXA 2E75C 2A06G 2KZIA 2N9YB 4IFDK 4IL6H 1QGKB 1VQ7P 4PD4E 2FFDB 5KAFE 2FKWB 2W6JH 1AQ5A 1WT6A 1RF0A 1SQBG 2IX7C 2W83C 5B66E 2BEQD 1EDIA 1NYHA 3KHUA 2IBZG 2JKVA 4PJ0H 3VN0A 3RGUA 2K1AA 3IFMA 2KXPB 1N7SD 3NMDA 4H13D 1SQPE 1KFNA 3PH0A 1LTSC 2QJYB 3F5HA 3HE5A 1N8RQ 1G2CA 1SQQE 4WWIA 1EZVG 2A06E 2E5TA 1VPCA 4KT0J 2YNYA 2YXRB 3CX5E 2KP8A 1HTLC 3SSUA 1AA0A 4O9BA 1A02F 1BCCG 3MIWA 2HPCA 2Q7CA 1CI6A 1L0NK 1U7JA 1JB0J 1L4AD 2M5AA 1JM0A 3JSVC 2K88A 3A7OA 1NAFA 4LGDE 1SQXE 3ABVC 1H8AA 2ZT9D 1MFZA 2K9YA 1M57D 3D6ZA 2XDJA 1BE3E 5AVSB 4KHXA 4R4LA 2ZYGA 4PV1C 1AQTA 3GG2A 2R5DA 3L71J 1GL2B 2IPPA 4EYYQ 3Q1MA 2O3JA 3HTKA 2YKPA 2H88C 3CCUP 2YMKA 2KOGA 1BDDA 1KQSO 3TK1A 3CI9A 4YXDC 1NTMJ 3C1LA 3IR9A 4WB4A 1Q90D 3L70G 1VQ4P 2E76B 3II6A 1BCCE 1GK6A 1NU1K 1PGPA 4GOEA 3PLNA 5KJ7C 1SQQG 5APXA 2ZAEB 3BCCJ 3L72J 1VQKP 1FOSF 1L0NG 1S4XA 3F89A 1N86A 1PZQA 5AW8B 1SFCB 4ASVA 1IZNB 3G71P 1Q81Q 1LTTC 3GHGB 3RK2B 1BGYG 1CI6B 3HTKB 2WT7B 5KAIE 1P84H 1KB9H 5CCHA 2JWDA 2HPCB 2Z4EA 3RL0D 4RJTA 1S72P 1GZLA 1OX3A 2FXOA 3GMAA 1BGYJ 1Q82Q 4BRYB 3Q2YA 1GK4A 2E43A 3L73G 4PD4D 2GUSA 1FZAA 2H8PD 1DH3A 3CC2P 2RMZA 2I1KA 1RH5B 1Y47A 1OW7A 2YIUB 3CC7P 1VL2A 5L8RJ 3TGUJ 3W68A 2SPZA 1XTGB 3CXHH 2C0WA 3JC22 1SQQK 3CWBE 2KZJA 3LW5H 1R5SA 4TLFA 1NGMB 3I5CA 5E79H 1QL2A 4IL6X 3V4WA 2V7QH 2I8DA 4IFMA 3L74D 1ZR4A 2E74B 3U1CA 2OYHB 2OQQA 1MFTA 2K9JB 2I1JA 1HF9A 1LP1A 3HRNA 3H1HE 4ASWA 2ZT9B 1H88A 3CXHD 1KILD 3TNUB 5APYA 3TF5A 1N73B 2AXTE 4WY4B 1HUCA 2WSEH 1KN7A 3WMM0 1T6AA 1QX8A 1K04A 2CK3H 1NU1G 2WMMA 1KYOI 2OGUA 2WPRA 2WPVB 3HUSC 5APTA 5AW0B 3V2PA 1OW8A 1Q86Q 2KI7B 3LIDA 1EDLA 1SP4A 1NU1J 2V7QJ 3KZIH 4N6JA 1FZBA 1QLED 1OVVA 1RE4A 2WZ7A 4QMAA 1DIPA 3GLMA 1NTZE 1ZV8A 2R3SA 1W2BO 1VQ9P 4H0LD 3U59A 3VP9A 1VF5C 1KC8Q 2JR8A 1ZMEC 1S5LE 5CJ0A 3D70A 2IZ1A 1JY2P 3CLQA 3MUDA 3H1IE 3IF4A 1NU1E 1PL5A 1H89A 1G1JA 1KZUB 1X0TA 3L75E 2H7HA 3L72E 4EI2A 3L70E 4AYCA 2WSCJ 3MP7B 1SQQJ 3O6QB 3RL0g 3CMAP 3VMAA 1LT1A 5APUA 1NKNA 1JOCA 4I7ZB 3H1KG 2XNDH 4BWNA 5CCGD 2K9JA 2LXBA 1JCCA 4UB6H 1BE3G 3EFGA 3QWOC 5TISH 3P32A 4N3YB 2A06D 1HWTC 1SQXG 2KLUA 1PP9J 1NO4A 1VF5D 2G3AA 3HUSB 3I55P 1SLQA 1M7LA 2L5GB 2RN0A 3H1LD 3PP5A 1JUNA 2AXTH 3H1IG 2J59M 2ITAA 1VQLP 2WSFH 4W7ZA 3A0BH 1URQC 2IBZD 2J5UA 1GL2C 2B9BA 3OJAB 3CMEP 4W7YA 2R32A 1L0LJ 3CL3D 1UIIA 3L74E 3WUTA 2JO1A 1BDCA 1IJDB 2AXCA 3L75D 2ZJSE 1OXZA 2XV5A 3M9HA 1BE3D 1N7SB 3AEBC 4H13B 5CBOA 5GTIH 1BGYE 1FC2C 2KNCB 1AVOA 1ZP0C 3B5NC 3H1HJ 2HFED 4OGQC 2RKLA 3VTPC 1KYOD 3H1JD 5B5EE 3PTZA 3Q5RA 5H2FH 1SQXK 1GW4A 2YIUC 1W2EA 1LP1B 2M0BA 1BE3J 1MKMA 5TJHA 1YHQP 1FZCB 1URQD 1GD2E 1L4AB 2OYHA 2QM8A 2LR2A 1RF1C 1S3JA 5KLVK 2BASA 2E75D 4U3FG 5KJ7D 2XKMA 1S2EA 1KILE 4W80A 4OVNF 4PV1B 1USDA 4U7JA 2QJKB 2IZ0A 2Q1KA 2W27A 3H1KE 2JJLA 2VRSA 4GIFA 2ZFCA 4JBZA 3S9OA 4H44B 4OGQD 2C9LY 1YQ4C 2XZRA 4ZKUA 1N7SC 4H13C 3CD6P 1VQ6P 1BCCD 3CCLP 1YIJP 3EWKA 1SQVD 2G8YA 1GW3A 1Y8AA 3A3YB 1JY3P 4BRYA 2QJKC 1YITP 2QA4P 1PFIA 1P84D 3FGAD 1FS0E 1JTHA 3AE2C 3L36A 5GTHH 1E79H 1Q7YQ 1EDKA 2FYNC 1X9VA 1AV1A 1HGVA 1IC2A 3A0HE 3GW6A 1N7LA 2YKOA 5H2FE 1U57A 2FYUJ 2FYUG 5KLVD 1DEEG 3TSIA 4C7NB 1L4AC 4YXWH 3O6QA 1AJYA 1SFCA 5AVTB 1OVRA 1L0NE 4C7RA 1ZRTD 2PAJA 3FWLA 4B86A 3ZDMA 2IBZE 1J1EB 3H1LJ 1X22A 1JNMA 1JEKA 3WUUA 2OYIA 2OTKE 1LT9A 3RK3D 2JP3A 2KS1B 2PFXA 1SQVG 1M1KQ 1SQQD 4TT3H 5APWA 1GU4A 5DJTB 2Q9IA 1GL2D 2YMYA 2ZYDA 1YTZI 1L0LK 2FY8A 4EIJA 3B71A 3T97B 5KAFH 2JDIH 3G3ZA 2FXMA 5KAIH 2E76D 3AECC 1MUUA 2POHA 2D2CD 1NTMK 3CWBG 2KB7P 3AE1C 4PJ0E 1U7MA 3L70D 1Z56A 5TISE 1EXIA 3MZWB 5KLIC 1VQPP 4JQ0D 1KQGB 3L71E 3V2QA 4D6TD 1NU1D 4DZOA 1NTKE 3H1JG 3S4RA 5CBNA 1P84E 1T3UA 2B87A 2WT7A 5AVWB 5GTHE 1CW5A 4GT1A 3EQ2A 1FDMA 1KTMA 3HE5B 5AVYB 3A0HH 4IFFA 4GOFA 3IAOA 1FDIA 4U3FJ 4IOIH 3EFFK 1EC5A 1OZHA 1SQBJ 1TU3F 2E5YA 2Y9YA 4EDFA 4YTPC 2H43A 3BCCE 1FZFA 1H0TA 3AE8C 3AEFC 1EZVD 4WY4C 1SQPG 1SQVJ 2D2CC 3VOPA 2PP6A 2QIWA 2GA1A 3JCUE 3TDKA 2PRRA 2XNXA 3BASA 2WSFJ 1IFMA 4A7PA 1OMIA 2B87B 2QG4A 5DJUB 1NH4A 1FJKA 2A45I 1SQBE 2BCCG 2OYOA 1KYOH 1J1DC 1LWUA 2H89C 1JTHB 1RF0C 2QE7H 1UIXA 1YBKA 3NXSA 3S1KA 2M8RA 2IFMA 2O01J 2FYZA 4L75A 1RY3A 5KLVJ 4DJGA 3B5NA 2KUBA 2P7JA 3OA7A 1R5LA 3BCCD 3L73J 1OFCX 3M9QA 4HYTB 1X79B 3GF7A 4JYCA 3CX5I 3M9BA 3L37A 2YO2A 1BGYD 1KD1Q 1BSHA 4WY4D 1VDFA 3HUSA 2FFDC 2P2UA 2WQYC 2KK7A 1SQPK 3H1JJ 1FBMA 3KYQA 1RF1A 1PGQA 4GODA 3B5ND 4JF7A 1KQLA 5AW5B 3GF3A 1RE4C 4Y99B 4H0LC 3TYYA 5KTBA 3SWFA 2FYUD 1FDOA 3L72G 1LWUB 2O01H 4OWFA 1FZCA 2QRXA 1GDTA 3HD7D 3R4YA 4HKZH 4I2LC 4OH8B 4L76A 2OTLP 3MUDC 1NAYA 2C0XA 2W6BA 4N78E 2BCCJ 2KSJA 1BSNA 1PIXA 3M91A 3CCSP 1S9KD 1M56D 1NTZJ 2R44A 5AVZB 1NKZB 2GM4A 1M1JB 1QVGO 1ZXGA 1GU5A 2WPSA 3JCUH 2QJPC 3FX0A 3USSA 2E76C 5KKZB 2OYIC 1EQ7A 1NTMD 1RQUA 3L4FA 5CCGA 4Z1MH 1N2DC 3D6YA 1M1JC 3KQGA 2Q3EA 1HH0A 3MD0A 1PP9E 2M5AB 1NWQA 3L72D 2Y9ZA 2B88A 3H25A 2WSEJ 1OIPA 3L75J 2BEZF 2N1TB 2E75B 2P58A 1SFCD 1T2KD 3E1RA 1D7MA 2NZ2A 5KLVE 2LKMA 4Y99C 3AE5C 4U3FE 5CJ4A 2Z5HA 1IK7A 1HGZA
chains in the Genus database with same CATH topology
3AE2C 4H0LB 5M1BA 3GMAA 1WMKA 2FYNC 1KORA 2IDBA 3AEDC 4XFJA 3Q2YA 1U57A 2QJYC 1YQ3C 3O6QA 1AJYA 1HJ0A 1OW7A 3Q5PA 3AE7C 1VL2A 5L8RJ 1R8EA 1NGMB 4IL6X 3SFDC 1S1CX 2JP3A 4I7ZC 2E74D 4TT3H 2E74B 2OQQA 1HF9A 4RKUJ 3B71A 3T97B 2ZT9B 2D2CB 2E76D 3AECC 2D2CD 3AE1C 3AE9C 1K04A 3LW5J 1EXJA 5KLIC 2WPVB 1KQGB 1GMJA 2FXPA 1RQVA 1OW8A 2V7QJ 3AEGC 1DIPA 3GLMA 3SFEC 4H0LD 1VF5C 3IAOA 3AE3C 1FDIA 1ZMEC 3D70A 1TU3F 3IN6A 1PL5A 4YTPC 1DD3A 3AE8C 3AEFC 3AE4C 2D2CC 2QIWA 1IK7A 3RK3E 2ZT9C 2WSCJ 3RL0g 2WSFJ 1OMIA 1Y9BA 4I7ZB 1S5LX 1KMIZ 2E74C 1VF5B 4R4MA 2H89C 2FBWC 2QSIA 3Q3DA 1DD4A 2E75C 1UIXA 1ZRTE 3C8VA 2O01J 4GDOA 1VF5D 1ZOYC 2G3AA 3AEEC 2BEQD 1NYHA 1KTMA 3GF7A 4H13D 2J5UA 2WQYC 4KT0J 2JO1A 3G9RA 2MKVA 3GF3A 1OW6A 4H0LC 1FDOA 4H13B 3AEBC 3R4YA 4H44C 1JB0J 1ZP0C 4OGQC 3ABVC 3Q5RA 1PIXA 2ZT9D 2K9YA 2YIUC 3D6ZA 3D71A 3Q5SA 4R4LA 1MKMA 2QJPC 4PV1C 2E76C 3Q1MA 5KKZC 1RQUA 2H88C 2YMKA 2E75D 4Z1MH 4YXDC 4PV1D 1Q90D 1KILE 3AEAC 2E76B 4Y28J 4PV1B 4U7JA 1EXIA 3AE6C 3S9OA 2WSEJ 4H44D 3H25A 2BEZF 4H44B 2E75B 1K05A 4OGQD 1YQ4C 1KQFB 4H13C 4OGQB 2NZ2A 2P10A 3AE5C 3EWKA 2G8YA 3D6YA 2QJKC 1PV3A 3FGAD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V7Q J;  1HF9 A;  4Z1M H;  1GMJ A;  4TT3 H; 
#chains in the Genus database with same CATH topology
 1IFN A;  4PD4 I;  1M8O B;  1X8Y A;  5M1B A;  1IFJ A;  3RL0 B;  5APQ A;  1KOR A;  1NVO A;  2IBZ I;  1NTK J;  1RHZ B;  1E5W A;  1LTG C;  2IDB A;  2NPS B;  2QJY C;  2HOD B;  2L91 A;  1YQ3 C;  2M3E A;  2N9B A;  3C9I A;  3L73 D;  4L74 A;  1NTZ K;  2A45 H;  2FFD A;  1LTI C;  1HJ0 A;  1JMM A;  1LNQ A;  1OVU A;  4JPZ B;  4C7N A;  1IFP A;  2GUV A;  2O1J A;  2WTY A;  5CCH D;  3A5T A;  3Q5P A;  1JY3 O;  1N7S A;  2HR3 A;  5B5E H;  1XTC C;  3VMY A;  2P1J A;  3B5N B;  1K8A Q;  1KFM A;  1R8E A;  3BCC G;  5EFW B;  3SFD C;  2JWA A;  1VQN P;  4I7Z C;  1LWU C;  1ZW0 A;  2E74 D;  1DEB A;  3HD7 B;  1JCD A;  3N4X A;  1VQ5 P;  2LXC B;  3CXH I;  3CWB J;  4UB8 H;  4WBA A;  1YI2 P;  2A45 G;  1EZV I;  3K5B A;  3GHG A;  4ZMD A;  1IFI A;  1PGJ A;  1KYO E;  3H1J E;  2UWJ E;  2Y0C A;  5B66 H;  2KSE A;  4LLH A;  4U3F D;  2ZVO B;  5AVU B;  1L0L D;  3L71 G;  1YJN P;  3HD7 C;  3TGU G;  1P84 I;  2NPS A;  4NPF X;  1PPJ G;  3OAK A;  3M0D A;  4D6T E;  3MTU E;  3NTN A;  2FXP A;  1RQV A;  2Z5I A;  4I1L A;  3TGU D;  1LT9 C;  2E42 A;  1JY2 N;  3L35 A;  1IK9 A;  2KYV A;  4D6T G;  1SVF A;  3AEG C;  1PP9 D;  5K5G B;  5AW6 B;  2IYO A;  1J1E C;  3W67 A;  3L70 J;  3P8M C;  2C9N Y;  1IO4 A;  1MV8 A;  3P8C E;  1PP9 G;  3AE3 C;  3B4S A;  1T3J A;  3IN6 A;  2K37 A;  3H1L E;  3CX5 H;  1N73 C;  3HE4 A;  4DOJ A;  1DD3 A;  3OW2 O;  1J2J B;  3AE4 C;  4M3L A;  3RK3 E;  2ZT9 C;  3KDP B;  2BCC E;  3L75 G;  1FAV A;  1NTZ G;  3P8C D;  2WPQ A;  4LC1 A;  3WU2 E;  1LTB C;  1Y9B A;  2KNC A;  2ZYA A;  5AVX B;  3RK3 C;  2CPB A;  1KMI Z;  1S5L X;  2DW3 A;  4R4M A;  3CCE P;  1SFC C;  1L2P A;  2FBW C;  2W6A A;  3FXE A;  5E79 E;  4JYB A;  5AVR B;  3U1A A;  1M1J A;  1QEX A;  1DD4 A;  1JY2 O;  2FYU E;  3VP8 A;  1ZRT E;  3Q3D A;  2OTJ P;  3M0A A;  3C8V A;  1G2C B;  1LT9 B;  2Q3I A;  4RES B;  1HBW A;  4GDO A;  2O01 N;  4HB1 A;  1ZOY C;  3RBX A;  1SQX D;  2OAR A;  3AEE C;  3KXD A;  5C39 A;  2RH0 A;  3H1I D;  3VYI A;  3T97 A;  2R5B A;  3HE4 B;  5AVQ B;  1LJ2 A;  3H1L G;  3CCV P;  2WIT A;  2W8Z A;  3PJS K;  2FYN B;  1JMB A;  3E1I A;  1NTZ D;  3G4S P;  2ZXX A;  4K3A A;  2FYU K;  1M90 Q;  2KS1 A;  3CC4 P;  2BCC D;  4DT0 A;  5BVZ A;  3CCM P;  3CX5 D;  5AW9 B;  5CCH C;  1L0N J;  3G9R A;  3V2N A;  3MHV A;  2IYP A;  1PGO A;  1LTJ C;  1BCC J;  1OW6 A;  1URQ A;  2MKV A;  3N7N A;  3BRT B;  3PRJ A;  1VQM P;  2OYI B;  1SQP D;  3H1K D;  3RK2 C;  3SWY A;  5BU8 B;  3WU2 H;  4EOT A;  4H44 C;  2HG5 D;  2N1T C;  5AW2 B;  1G1I A;  1KB9 E;  4MN4 C;  3RBZ A;  5APS A;  1JY3 N;  2WVR A;  4C46 A;  5KJ7 A;  3G6E P;  3CXH E;  1YJ9 P;  3H1H D;  1SQV K;  1PPJ E;  3L73 E;  1EZV E;  3H32 B;  3D71 A;  3TGU E;  3Q5S A;  2WSC H;  2AEM A;  1ZR2 A;  1CSB A;  1ZLL A;  2K3R A;  1NOH A;  1WRG A;  3B8E B;  1URQ B;  2M3B A;  3A2A A;  2J58 A;  3HD7 A;  4DCK A;  2NPS C;  5KKZ C;  1QVF O;  1NTM G;  2ZXE B;  4PV1 D;  3AEA C;  4Y28 J;  4ZNC A;  4WY4 A;  2QJP B;  1FZC C;  3BRV B;  3V5B A;  1NTK D;  1ZN5 A;  3AE6 C;  3TNU A;  2YO3 A;  3GHG C;  3RK2 D;  1GTW A;  1FE6 A;  1Q2N A;  3PHL A;  4H44 D;  4IL6 E;  1FJP A;  3L74 G;  1H0T B;  3L71 D;  4XA4 A;  1K05 A;  2XU6 A;  4BXL A;  1KQF B;  1SQP J;  1PPJ D;  2HLO A;  2P67 A;  2V4H A;  4OGQ B;  4UB8 E;  2AEJ A;  3QH9 A;  1LTJ B;  2P10 A;  1N73 A;  3H1H G;  3H6P A;  4WVZ A;  3KZI E;  1VQ8 P;  1PV3 A;  3H1K J;  1KB9 D;  1L4A A;  5CMZ A;  4H0L B;  2IFN A;  1EDJ A;  5AW7 B;  1SQB D;  2NRG A;  4HH2 A;  1WMK A;  3UIA A;  1KV4 A;  3E7K A;  4XFJ A;  3AED C;  4K35 A;  1RF1 B;  2ZVN B;  1YYC A;  1SS1 A;  5KLV G;  5AW4 B;  1SQX J;  2Y0E A;  3P7K A;  1S9K E;  1K9M Q;  4KJM A;  4AQR D;  2YKQ A;  1NTK K;  4ZKP A;  5BU5 A;  1USE A;  3AE7 C;  1FU1 A;  3R2P A;  3V2R A;  3H1I J;  3V6I A;  1AFO A;  3CPW O;  1RE3 A;  2PGD A;  3LIE A;  3MGN A;  1YTZ T;  5APV A;  1S5L H;  3FXD A;  1L0N D;  1KIL B;  1FZE A;  5AW1 B;  1S1C X;  3CCQ P;  3SWK A;  1RE3 C;  5CCG C;  3RK3 B;  3I56 P;  4NPD A;  2KIK A;  1SQB K;  1J1D B;  4L73 A;  4XE5 B;  2JEE A;  4I6M C;  4RKU J;  3CCR P;  3V4Q A;  3VMZ A;  3BAT A;  1LTJ A;  2D2C B;  5AVV B;  1T2K C;  3WUV A;  2Q5U A;  2QM7 A;  2QEX P;  4UB6 E;  3AE9 C;  2CPS A;  3A0B E;  4RO0 A;  1NTM E;  1HJB A;  3LW5 J;  1DX7 A;  1NJI Q;  2N1T D;  4D6T J;  1KB9 I;  1EXJ A;  4AUW A;  1KIL C;  1GMJ A;  1GL2 A;  1CZQ A;  1NTK G;  4PD4 H;  2Y0D A;  2HYN A;  2YXQ B;  5CHX A;  1QL1 A;  4CPG A;  2WSS H;  1OWA A;  1FOS E;  2QVA A;  1YJW P;  5KLI B;  1KIL A;  2O1K A;  3O8Z A;  4GKG A;  4HJG H;  1W5C E;  4N78 D;  3SFE C;  1A02 J;  1JO5 A;  2W90 A;  3CCJ P;  1T8Z A;  3ITK A;  2KLV A;  1AVY A;  1VQO P;  2N1T A;  3M06 A;  4NPE A;  2NPS D;  2WWW A;  3BVH A;  3H32 A;  2R3C A;  1LTA C;  1NHL A;  1L0L G;  1LGH B;  1K73 Q;  1FZG A;  5AW3 B;  3RL0 C;  3FWN A;  2MJZ A;  5GTI E;  1L0L E;  1HVV A;  1IFD A;  3L74 J;  3NFQ A;  3M0D C;  2HOD A;  3CWB D;  1VF5 B;  1MZ9 A;  2E74 C;  3KPE A;  2AEF A;  2OYH C;  2Q6Q A;  4YPC A;  2B89 A;  2QSI A;  1SQV E;  3VMX A;  2E75 C;  2A06 G;  2KZI A;  2N9Y B;  4IFD K;  4IL6 H;  1QGK B;  1VQ7 P;  4PD4 E;  2FFD B;  5KAF E;  2FKW B;  2W6J H;  1AQ5 A;  1WT6 A;  1RF0 A;  1SQB G;  2IX7 C;  2W83 C;  5B66 E;  2BEQ D;  1EDI A;  1NYH A;  3KHU A;  2IBZ G;  2JKV A;  4PJ0 H;  3VN0 A;  3RGU A;  2K1A A;  3IFM A;  2KXP B;  1N7S D;  3NMD A;  4H13 D;  1SQP E;  1KFN A;  3PH0 A;  1LTS C;  2QJY B;  3F5H A;  3HE5 A;  1N8R Q;  1G2C A;  1SQQ E;  4WWI A;  1EZV G;  2A06 E;  2E5T A;  1VPC A;  4KT0 J;  2YNY A;  2YXR B;  3CX5 E;  2KP8 A;  1HTL C;  3SSU A;  1AA0 A;  4O9B A;  1A02 F;  1BCC G;  3MIW A;  2HPC A;  2Q7C A;  1CI6 A;  1L0N K;  1U7J A;  1JB0 J;  1L4A D;  2M5A A;  1JM0 A;  3JSV C;  2K88 A;  3A7O A;  1NAF A;  4LGD E;  1SQX E;  3ABV C;  1H8A A;  2ZT9 D;  1MFZ A;  2K9Y A;  1M57 D;  3D6Z A;  2XDJ A;  1BE3 E;  5AVS B;  4KHX A;  4R4L A;  2ZYG A;  4PV1 C;  1AQT A;  3GG2 A;  2R5D A;  3L71 J;  1GL2 B;  2IPP A;  4EYY Q;  3Q1M A;  2O3J A;  3HTK A;  2YKP A;  2H88 C;  3CCU P;  2YMK A;  2KOG A;  1BDD A;  1KQS O;  3TK1 A;  3CI9 A;  4YXD C;  1NTM J;  3C1L A;  3IR9 A;  4WB4 A;  1Q90 D;  3L70 G;  1VQ4 P;  2E76 B;  3II6 A;  1BCC E;  1GK6 A;  1NU1 K;  1PGP A;  4GOE A;  3PLN A;  5KJ7 C;  1SQQ G;  5APX A;  2ZAE B;  3BCC J;  3L72 J;  1VQK P;  1FOS F;  1L0N G;  1S4X A;  3F89 A;  1N86 A;  1PZQ A;  5AW8 B;  1SFC B;  4ASV A;  1IZN B;  3G71 P;  1Q81 Q;  1LTT C;  3GHG B;  3RK2 B;  1BGY G;  1CI6 B;  3HTK B;  2WT7 B;  5KAI E;  1P84 H;  1KB9 H;  5CCH A;  2JWD A;  2HPC B;  2Z4E A;  3RL0 D;  4RJT A;  1S72 P;  1GZL A;  1OX3 A;  2FXO A;  3GMA A;  1BGY J;  1Q82 Q;  4BRY B;  3Q2Y A;  1GK4 A;  2E43 A;  3L73 G;  4PD4 D;  2GUS A;  1FZA A;  2H8P D;  1DH3 A;  3CC2 P;  2RMZ A;  2I1K A;  1RH5 B;  1Y47 A;  1OW7 A;  2YIU B;  3CC7 P;  1VL2 A;  5L8R J;  3TGU J;  3W68 A;  2SPZ A;  1XTG B;  3CXH H;  2C0W A;  3JC2 2;  1SQQ K;  3CWB E;  2KZJ A;  3LW5 H;  1R5S A;  4TLF A;  1NGM B;  3I5C A;  5E79 H;  1QL2 A;  4IL6 X;  3V4W A;  2V7Q H;  2I8D A;  4IFM A;  3L74 D;  1ZR4 A;  2E74 B;  3U1C A;  2OYH B;  2OQQ A;  1MFT A;  2K9J B;  2I1J A;  1HF9 A;  1LP1 A;  3HRN A;  3H1H E;  4ASW A;  2ZT9 B;  1H88 A;  3CXH D;  1KIL D;  3TNU B;  5APY A;  3TF5 A;  1N73 B;  2AXT E;  4WY4 B;  1HUC A;  2WSE H;  1KN7 A;  3WMM 0;  1T6A A;  1QX8 A;  1K04 A;  2CK3 H;  1NU1 G;  2WMM A;  1KYO I;  2OGU A;  2WPR A;  2WPV B;  3HUS C;  5APT A;  5AW0 B;  3V2P A;  1OW8 A;  1Q86 Q;  2KI7 B;  3LID A;  1EDL A;  1SP4 A;  1NU1 J;  2V7Q J;  3KZI H;  4N6J A;  1FZB A;  1QLE D;  1OVV A;  1RE4 A;  2WZ7 A;  4QMA A;  1DIP A;  3GLM A;  1NTZ E;  1ZV8 A;  2R3S A;  1W2B O;  1VQ9 P;  4H0L D;  3U59 A;  3VP9 A;  1VF5 C;  1KC8 Q;  2JR8 A;  1ZME C;  1S5L E;  5CJ0 A;  3D70 A;  2IZ1 A;  1JY2 P;  3CLQ A;  3MUD A;  3H1I E;  3IF4 A;  1NU1 E;  1PL5 A;  1H89 A;  1G1J A;  1KZU B;  1X0T A;  3L75 E;  2H7H A;  3L72 E;  4EI2 A;  3L70 E;  4AYC A;  2WSC J;  3MP7 B;  1SQQ J;  3O6Q B;  3RL0 g;  3CMA P;  3VMA A;  1LT1 A;  5APU A;  1NKN A;  1JOC A;  4I7Z B;  3H1K G;  2XND H;  4BWN A;  5CCG D;  2K9J A;  2LXB A;  1JCC A;  4UB6 H;  1BE3 G;  3EFG A;  3QWO C;  5TIS H;  3P32 A;  4N3Y B;  2A06 D;  1HWT C;  1SQX G;  2KLU A;  1PP9 J;  1NO4 A;  1VF5 D;  2G3A A;  3HUS B;  3I55 P;  1SLQ A;  1M7L A;  2L5G B;  2RN0 A;  3H1L D;  3PP5 A;  1JUN A;  2AXT H;  3H1I G;  2J59 M;  2ITA A;  1VQL P;  2WSF H;  4W7Z A;  3A0B H;  1URQ C;  2IBZ D;  2J5U A;  1GL2 C;  2B9B A;  3OJA B;  3CME P;  4W7Y A;  2R32 A;  1L0L J;  3CL3 D;  1UII A;  3L74 E;  3WUT A;  2JO1 A;  1BDC A;  1IJD B;  2AXC A;  3L75 D;  2ZJS E;  1OXZ A;  2XV5 A;  3M9H A;  1BE3 D;  1N7S B;  3AEB C;  4H13 B;  5CBO A;  5GTI H;  1BGY E;  1FC2 C;  2KNC B;  1AVO A;  1ZP0 C;  3B5N C;  3H1H J;  2HFE D;  4OGQ C;  2RKL A;  3VTP C;  1KYO D;  3H1J D;  5B5E E;  3PTZ A;  3Q5R A;  5H2F H;  1SQX K;  1GW4 A;  2YIU C;  1W2E A;  1LP1 B;  2M0B A;  1BE3 J;  1MKM A;  5TJH A;  1YHQ P;  1FZC B;  1URQ D;  1GD2 E;  1L4A B;  2OYH A;  2QM8 A;  2LR2 A;  1RF1 C;  1S3J A;  5KLV K;  2BAS A;  2E75 D;  4U3F G;  5KJ7 D;  2XKM A;  1S2E A;  1KIL E;  4W80 A;  4OVN F;  4PV1 B;  1USD A;  4U7J A;  2QJK B;  2IZ0 A;  2Q1K A;  2W27 A;  3H1K E;  2JJL A;  2VRS A;  4GIF A;  2ZFC A;  4JBZ A;  3S9O A;  4H44 B;  4OGQ D;  2C9L Y;  1YQ4 C;  2XZR A;  4ZKU A;  1N7S C;  4H13 C;  3CD6 P;  1VQ6 P;  1BCC D;  3CCL P;  1YIJ P;  3EWK A;  1SQV D;  2G8Y A;  1GW3 A;  1Y8A A;  3A3Y B;  1JY3 P;  4BRY A;  2QJK C;  1YIT P;  2QA4 P;  1PFI A;  1P84 D;  3FGA D;  1FS0 E;  1JTH A;  3AE2 C;  3L36 A;  5GTH H;  1E79 H;  1Q7Y Q;  1EDK A;  2FYN C;  1X9V A;  1AV1 A;  1HGV A;  1IC2 A;  3A0H E;  3GW6 A;  1N7L A;  2YKO A;  5H2F E;  1U57 A;  2FYU J;  2FYU G;  5KLV D;  1DEE G;  3TSI A;  4C7N B;  1L4A C;  4YXW H;  3O6Q A;  1AJY A;  1SFC A;  5AVT B;  1OVR A;  1L0N E;  4C7R A;  1ZRT D;  2PAJ A;  3FWL A;  4B86 A;  3ZDM A;  2IBZ E;  1J1E B;  3H1L J;  1X22 A;  1JNM A;  1JEK A;  3WUU A;  2OYI A;  2OTK E;  1LT9 A;  3RK3 D;  2JP3 A;  2KS1 B;  2PFX A;  1SQV G;  1M1K Q;  1SQQ D;  4TT3 H;  5APW A;  1GU4 A;  5DJT B;  2Q9I A;  1GL2 D;  2YMY A;  2ZYD A;  1YTZ I;  1L0L K;  2FY8 A;  4EIJ A;  3B71 A;  3T97 B;  5KAF H;  2JDI H;  3G3Z A;  2FXM A;  5KAI H;  2E76 D;  3AEC C;  1MUU A;  2POH A;  2D2C D;  1NTM K;  3CWB G;  2KB7 P;  3AE1 C;  4PJ0 E;  1U7M A;  3L70 D;  1Z56 A;  5TIS E;  1EXI A;  3MZW B;  5KLI C;  1VQP P;  4JQ0 D;  1KQG B;  3L71 E;  3V2Q A;  4D6T D;  1NU1 D;  4DZO A;  1NTK E;  3H1J G;  3S4R A;  5CBN A;  1P84 E;  1T3U A;  2B87 A;  2WT7 A;  5AVW B;  5GTH E;  1CW5 A;  4GT1 A;  3EQ2 A;  1FDM A;  1KTM A;  3HE5 B;  5AVY B;  3A0H H;  4IFF A;  4GOF A;  3IAO A;  1FDI A;  4U3F J;  4IOI H;  3EFF K;  1EC5 A;  1OZH A;  1SQB J;  1TU3 F;  2E5Y A;  2Y9Y A;  4EDF A;  4YTP C;  2H43 A;  3BCC E;  1FZF A;  1H0T A;  3AE8 C;  3AEF C;  1EZV D;  4WY4 C;  1SQP G;  1SQV J;  2D2C C;  3VOP A;  2PP6 A;  2QIW A;  2GA1 A;  3JCU E;  3TDK A;  2PRR A;  2XNX A;  3BAS A;  2WSF J;  1IFM A;  4A7P A;  1OMI A;  2B87 B;  2QG4 A;  5DJU B;  1NH4 A;  1FJK A;  2A45 I;  1SQB E;  2BCC G;  2OYO A;  1KYO H;  1J1D C;  1LWU A;  2H89 C;  1JTH B;  1RF0 C;  2QE7 H;  1UIX A;  1YBK A;  3NXS A;  3S1K A;  2M8R A;  2IFM A;  2O01 J;  2FYZ A;  4L75 A;  1RY3 A;  5KLV J;  4DJG A;  3B5N A;  2KUB A;  2P7J A;  3OA7 A;  1R5L A;  3BCC D;  3L73 J;  1OFC X;  3M9Q A;  4HYT B;  1X79 B;  3GF7 A;  4JYC A;  3CX5 I;  3M9B A;  3L37 A;  2YO2 A;  1BGY D;  1KD1 Q;  1BSH A;  4WY4 D;  1VDF A;  3HUS A;  2FFD C;  2P2U A;  2WQY C;  2KK7 A;  1SQP K;  3H1J J;  1FBM A;  3KYQ A;  1RF1 A;  1PGQ A;  4GOD A;  3B5N D;  4JF7 A;  1KQL A;  5AW5 B;  3GF3 A;  1RE4 C;  4Y99 B;  4H0L C;  3TYY A;  5KTB A;  3SWF A;  2FYU D;  1FDO A;  3L72 G;  1LWU B;  2O01 H;  4OWF A;  1FZC A;  2QRX A;  1GDT A;  3HD7 D;  3R4Y A;  4HKZ H;  4I2L C;  4OH8 B;  4L76 A;  2OTL P;  3MUD C;  1NAY A;  2C0X A;  2W6B A;  4N78 E;  2BCC J;  2KSJ A;  1BSN A;  1PIX A;  3M91 A;  3CCS P;  1S9K D;  1M56 D;  1NTZ J;  2R44 A;  5AVZ B;  1NKZ B;  2GM4 A;  1M1J B;  1QVG O;  1ZXG A;  1GU5 A;  2WPS A;  3JCU H;  2QJP C;  3FX0 A;  3USS A;  2E76 C;  5KKZ B;  2OYI C;  1EQ7 A;  1NTM D;  1RQU A;  3L4F A;  5CCG A;  4Z1M H;  1N2D C;  3D6Y A;  1M1J C;  3KQG A;  2Q3E A;  1HH0 A;  3MD0 A;  1PP9 E;  2M5A B;  1NWQ A;  3L72 D;  2Y9Z A;  2B88 A;  3H25 A;  2WSE J;  1OIP A;  3L75 J;  2BEZ F;  2N1T B;  2E75 B;  2P58 A;  1SFC D;  1T2K D;  3E1R A;  1D7M A;  2NZ2 A;  5KLV E;  2LKM A;  4Y99 C;  3AE5 C;  4U3F E;  5CJ4 A;  2Z5H A;  1IK7 A;  1HGZ A; 
#chains in the Genus database with same CATH homology
 3AE2 C;  4H0L B;  5M1B A;  3GMA A;  1WMK A;  2FYN C;  1KOR A;  2IDB A;  3AED C;  4XFJ A;  3Q2Y A;  1U57 A;  2QJY C;  1YQ3 C;  3O6Q A;  1AJY A;  1HJ0 A;  1OW7 A;  3Q5P A;  3AE7 C;  1VL2 A;  5L8R J;  1R8E A;  1NGM B;  4IL6 X;  3SFD C;  1S1C X;  2JP3 A;  4I7Z C;  2E74 D;  4TT3 H;  2E74 B;  2OQQ A;  1HF9 A;  4RKU J;  3B71 A;  3T97 B;  2ZT9 B;  2D2C B;  2E76 D;  3AEC C;  2D2C D;  3AE1 C;  3AE9 C;  1K04 A;  3LW5 J;  1EXJ A;  5KLI C;  2WPV B;  1KQG B;  1GMJ A;  2FXP A;  1RQV A;  1OW8 A;  2V7Q J;  3AEG C;  1DIP A;  3GLM A;  3SFE C;  4H0L D;  1VF5 C;  3IAO A;  3AE3 C;  1FDI A;  1ZME C;  3D70 A;  1TU3 F;  3IN6 A;  1PL5 A;  4YTP C;  1DD3 A;  3AE8 C;  3AEF C;  3AE4 C;  2D2C C;  2QIW A;  1IK7 A;  3RK3 E;  2ZT9 C;  2WSC J;  3RL0 g;  2WSF J;  1OMI A;  1Y9B A;  4I7Z B;  1S5L X;  1KMI Z;  2E74 C;  1VF5 B;  4R4M A;  2H89 C;  2FBW C;  2QSI A;  3Q3D A;  1DD4 A;  2E75 C;  1UIX A;  1ZRT E;  3C8V A;  2O01 J;  4GDO A;  1VF5 D;  1ZOY C;  2G3A A;  3AEE C;  2BEQ D;  1NYH A;  1KTM A;  3GF7 A;  4H13 D;  2J5U A;  2WQY C;  4KT0 J;  2JO1 A;  3G9R A;  2MKV A;  3GF3 A;  1OW6 A;  4H0L C;  1FDO A;  4H13 B;  3AEB C;  3R4Y A;  4H44 C;  1JB0 J;  1ZP0 C;  4OGQ C;  3ABV C;  3Q5R A;  1PIX A;  2ZT9 D;  2K9Y A;  2YIU C;  3D6Z A;  3D71 A;  3Q5S A;  4R4L A;  1MKM A;  2QJP C;  4PV1 C;  2E76 C;  3Q1M A;  5KKZ C;  1RQU A;  2H88 C;  2YMK A;  2E75 D;  4Z1M H;  4YXD C;  4PV1 D;  1Q90 D;  1KIL E;  3AEA C;  2E76 B;  4Y28 J;  4PV1 B;  4U7J A;  1EXI A;  3AE6 C;  3S9O A;  2WSE J;  4H44 D;  3H25 A;  2BEZ F;  4H44 B;  2E75 B;  1K05 A;  4OGQ D;  1YQ4 C;  1KQF B;  4H13 C;  4OGQ B;  2NZ2 A;  2P10 A;  3AE5 C;  3EWK A;  2G8Y A;  3D6Y A;  2QJK C;  1PV3 A;  3FGA D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...