2QM7A

Meab, a bacterial homolog of mmaa, bound to gdp
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
323
structure length
314
Chain Sequence
LPDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPGAGDELQGIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase/ATPase
publication title Crystal structure and mutagenesis of the metallochaperone MeaB: insight into the causes of methylmalonic aciduria.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Chaperone
total genus 121
structure length 314
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2qm7A03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2qm7A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qm7A02
4US1R 4TTPA 1JOYA 2J3EA 3OE7D 2O0HA 2CHQA 2VH5R 3PQCA 3Q5DA 4Q9HA 5L3SA 1KK1A 4R71A 4LGMA 1W44A 2F3TA 1KMQA 4B48A 4N0DA 3TVTA 3UATA 2RKOA 5A4JA 5AW3B 1MO5A 2PZEA 3HU2A 1CKEA 1DAMA 2V1UA 3VNUA 4FWTA 2FJUA 2OM2A 4OHYA 2QQ0A 2A5GA 4I1VA 5AW8B 4DSTA 5EE0A 1FMJA 3MWYW 3R7WB 2GXUA 3B78A 1G18A 3EIQA 4KYUA 3X1YA 4P32A 2ZREA 3I61A 1ZM4A 1KI4A 2UKDA 1GRQA 1OXUA 3KQUA 1VYTA 2Q21A 3B85A 4FINA 3M0EA 3PUVA 3HE4B 1JR3D 3BAFA 4A9AA 1G19A 1FX0A 2KSQA 2WWYA 2R5DA 3UPUA 4E5UA 2FPLA 3CB4A 1XFAA 5D3MA 4WA7A 1XMIA 4BIUA 1JAIA 3ASZA 4I1OA 3NDBB 2W6JA 5JMTA 1EX6A 2I3BA 1MO6A 4L9WA 1KK3A 1E94E 1II9A 2WWIA 4XTRA 4KFTA 4M1WA 2QE7D 2C95A 4I99A 3TLXA 4MKHA 1QHYA 5EXTA 2FWRA 5IDJA 2HCBA 4JVSB 3TE6A 1E0KA 4BEJA 4K81B 4HDOB 3AUYA 4S2EA 1DAGA 4L4UA 4XWAA 3L35A 2YO3A 1TF5A 3CWQA 2JLWA 2VO1A 3GLGB 2ZEJA 2PEYA 3I73A 2QORA 1T3LA 4DDVA 3W8NA 1FUKA 1E2PA 5AJZA 2ZSFA 3A3YB 4CYMA 5CB6A 3LX5A 1MRSA 1CJVC 2REBA 3R8FA 4Q01A 1MV8A 2Z4RA 2Z43A 1DS6A 2GESA 4US0R 3LIDA 1KSJA 4C0HA 2ZXUA 3GLFB 3MWKA 1E3MA 2VP2A 2F1IA 2IYWA 2VHTA 2V55B 3EWSA 5IHPA 4ASUD 1UJ2A 1A02F 4NTZA 3OEED 3N5CA 4AURA 5K8UA 1T2KC 2IUUA 2MSEB 4TLBA 1II0A 4DJTA 5JS8A 4K46A 1CSBA 3B7GA 1JBKA 4AY2A 4OL0A 2FSHA 3K0EA 3R20A 4FPPA 3K0SA 1GUAA 2AX4A 2GDJA 3P8MC 4H1VA 4KJZA 4Q21A 3KB1A 4BRWA 4L5BA 1BO6A 4RD1A 2OCBA 2OZEA 3B1VA 4U02A 2ZRIA 1U81A 5FBRB 1Z6TA 4A0RA 1IXRC 4IOKA 4DXAA 1Q1QA 2AK3A 2HF8A 3CZPA 3SQXA 3W6NA 1WE2A 3VU9B 2IYXA 1I2DA 1ZNYA 1IY1A 2VL7A 3CNNA 4FXPA 4FMCF 1P60A 3PEWA 1ELOA 5FUXA 3U6BA 3MG9A 3PJRA 3WHLA 5AW6B 3DPUA 4WIAA 2HLDD 1T5LA 1RYHA 3FFBA 2D06A 2V8OA 4NU0A 2RGXA 4BLPA 4KSCA 3VHXA 2X2FA 3T1VA 3CO5A 4KODA 3KFXA 3S1AB 4AKEA 4V03A 4NMMA 4E09A 3CH5A 2N9BA 2J46A 4ERNA 3A4MA 2JLQA 4N1AA 1GNQA 4BPBA 1GKYA 2LFRA 3G0HA 3U3MA 3K70B 3T5GA 1DVRA 1HE1C 3TR0A 2ZS7A 2CBZA 1E2KA 3JVVA 2EVWX 1TQDA 2HXSA 2WIAA 3D31A 1X8YA 3CX7A 2LWIA 2CLDX 4JYBA 3Q7PA 2JLRA 1X1SA 3TUIC 4JMPA 1VIAA 3L2OB 1I4DD 2GZHA 2P6RA 3SJBA 3VN0A 1ESMA 1G8HA 4DB4A 4XSGA 3LW7A 4AYCA 4B3XA 2F9LA 3DMDA 1XTKA 4GFDA 3OZXA 4C0QC 3CH4B 2ZRAA 3RLFA 3IUYA 4C3ZA 3RYTC 4P4UA 1ZAKA 4Q1CA 1CR2A 4N3NA 2JDIA 1I4LD 1J2JA 1E9DA 2JASA 3THYA 4I2LC 4JBYA 4B74A 4DSOA 4ZV4A 1GSIA 5E3HA 2RGNA 1QG2A 1CIPA 2XNSA 4WXRA 4Q19A 2OAQ1 1EWRA 3PCRB 4TYQA 4CT4B 2HV8A 4JLJA 4CEIB 2JLZA 1NBMD 1E2IA 1NVVQ 5A0FA 3O8CA 1MR3F 5FOWA 1GAJA 4DLYA 4JLKA 1XRJA 5C2JB 1WBBA 4MRRA 1UPTA 2ANBA 2KI5A 5FBQB 1UBFA 2GJSA 3IO5A 3K8YA 5HKKA 4PHHA 1D5CA 2L0XA 2VIIA 3LY5A 3TQCA 1M7GA 4RD4A 4TL6A 2ZSAA 221PA 1V5WA 5AJVB 1T3HA 4B44A 4D81A 4WW0A 4JAVA 4MGKR 1KJYA 1WA5A 2ZSDA 2P65A 4OI2A 4Q18A 3X2SA 3NEJA 3KUCA 2XGJA 4U7NA 4MKGA 1YR6A 1A2KC 3QPUA 4RFSB 3KQNA 1PV4A 2RGNC 2A5JA 3WMFA 3IEUA 1WB9A 2Q6TA 1KIMA 1ZM3A 4U7DA 2ZE8A 2GF9A 3O47A 2OFOA 3FB4A 1VPLA 3MUFA 4X8OA 3A0RA 2FX3A 2OLKA 2QL6A 1UKVY 3ZS8A 3OF5A 4XTCS 4C0KA 1GL6A 3N2IA 1VECA 4HZUA 1MABA 5DN6D 5APVA 3ADBA 3W6OA 3NBXX 2KP8A 1M8PA 5J40A 1K6MA 1C4OA 3QXCA 3RSOA 1N5LA 4V0NA 4LV8B 1SKYB 5HTKA 2NZ8A 4DLRA 2HJGA 4J0QA 1ZD1A 4BLOA 3Q72A 3CUEF 4MDFA 4YMUA 4NH0A 3DHWC 1IN8A 1P9RA 5P21A 4Q9LA 1ZIOA 5E7MA 4DT1A 2VSXA 5B2ZA 1YZNA 5LPNA 1S4QA 2ZUDA 3RVBA 1D6JA 1DAFA 2P5SA 4C7OA 1S8FA 1SP4A 4DDUA 4Q5IA 3RANA 1P73A 3VMFA 3CF2A 4A1FA 4BZPA 4DUGA 4LDJA 2EFCB 5JCZA 4DLVA 4GZLA 3ZIAD 3JZMA 3K09A 3QKTA 2QI9C 4GPTA 1G291 3RWOA 1R2QA 1YR8A 4ZDWA 3T12A 2QY9A 3KQLA 3QXXA 5EUQB 4GOJA 4IDNA 2FEOA 4PAMA 5J4HA 4F92B 2IHBA 4ZKDA 1A4RA 4O2RA 2P6NA 2WM9B 5HCNA 2O52A 5SZHB 1XEXA 4HSEA 1W5SA 4G3XA 4HB3A 4WAUA 1EFRA 1KAGA 3AGQA 1KDRA 1GK6A 1H8HA 1NF3A 2F6RA 4C0SA 3KJIA 2FZ4A 1KZ7B 1S96A 1ZVQA 1KYIA 1YVDA 5EP3A 3TNUB 4B43A 3P20A 1QHXA 4OQMA 4Q1FA 1FTNA 3SFZA 3TJZA 3WBJA 1HBWA 3GCGA 4JLDA 2V7QA 4TT3A 4AYTA 3UWKA 2R6AA 1Z0JA 5FUVA 2PBRA 4P3YA 3ZGXA 2R32A 1QBKC 1R0ZA 1XD9A 1Z5ZA 2PH1A 2YWFA 4P4SA 3K09C 4PSAA 5L3SB 2NPIA 3K9NA 2PX0A 4GOXA 1Z29A 4DHEA 4M3LA 1NY5A 4LHYA 1JXMA 2YINC 1AGPA 1N2CE 4I1UA 4NCIA 2W6IA 4OJKA 3WYFA 3OIYA 5JJLA 4WZAE 2QAGC 1OE0A 1DE0A 2F1HA 3C5HA 4QM7A 3D8BA 1ZUHA 2GZDA 2V54A 1IY2A 1F2UA 1Z6XA 2J0VA 3PUYA 4NHOA 2CLCX 2QPTA 3QXHA 4ACBA 4XWOA 2ZM5A 4DLSA 1VG0B 2FPKA 2GJAA 1M2OB 3DZDA 4F91B 4FWIB 4NE2A 4PTLA 5F3WB 1IXSB 4OI0A 3P26A 5KTYA 1FX0B 1T0JB 4MYHA 5B1NA 2OCPA 1OIWA 2OCYC 3GJ4A 4O2LA 4PQYA 1W36D 5D3MB 1AQUA 4L8GA 3BH7A 2VHJA 5AJXA 1OHHD 1HURA 3FHCB 1W4AA 2W2XA 4IFEA 3I72A 1IN6A 4L9SA 2PJRA 4OI4A 4DZZA 2ZRLA 2QP4A 1F6BA 4NONA 3VR5A 1XEWY 4U00A 4YDHB 3JVUA 2QA5A 5AW5B 4TMWA 2OBMA 1E2NA 2J45A 1E1QA 2A5DA 1AM4D 3AVOA 4E22A 4KHXA 2D4HA 3C4JA 3B60A 1A2BA 1G8FA 5C18A 2GWHA 3AKYA 3Q85A 1KY3A 1NN0A 3VYIA 1NJFA 4M2LA 1G7SA 2OG2A 1E79D 1RIFA 2QQEA 3I5XA 2WJVA 2IXFA 1COWD 2PMDA 3U7GA 4ZDJA 2NMVA 1Q3HA 3GD7A 3M0DA 2ZI4A 4QBHA 4B32A 1N0VC 4Q9KA 4JLPA 2VEDA 2GA8A 2Z6VA 2GZAA 1EX7A 1E9BA 1E2HA 3PITA 4URYR 3CX8A 1D2NA 4EOTA 4KVGA 3LRPA 4DCNA 5UKDA 5A5GA 5G3ZA 2SHKA 1Z0FA 1GNPA 4Z54A 5EXSA 3SU8A 5GVSA 1KSFX 1NNEA 1OFTA 1TAGA 5KNDA 2P6UA 4LX0A 4JKYA 5AUOB 3L82B 2OV2A 3CR7A 1XD8A 3U7FB 4KP4A 2Q5UA 1NAFA 3ZS9A 1OB5A 2PMKA 1N6KA 4RZ3A 1ZBDA 3VR6A 3ZQJA 2YV5A 3EZ2A 5APUA 3VR2A 4MGZR 2BWJA 4ESHA 4Q4HA 3R9WA 1P2SA 2GBLA 3PENA 3ZZTA 2GXSA 1GDDA 3ONWA 3QI2A 5JCPA 3U61B 3X1DA 2AR7A 1Z3IX 4NKRA 4GP7A 4AKIA 1IO4A 4MYTA 4WXPA 5EZ5A 3ZVLA 5C4MA 3OAKA 3LFUA 4HB2A 3RAPR 5G41A 4M8NE 3T97A 4JVMA 3LBNA 3DZ8A 621PA 2IEYA 1C9KA 1GL7A 1G3IA 1IONA 2VHUA 2N1BA 1NVXQ 3FDIA 3FKSD 4BFYA 1IJEA 2DYKA 2JLVA 1PVOA 4LBWA 5DIFA 5AJYA 1RZ3A 1FFHA 2Z5FA 2IPPA 1KY2A 1U0JA 2BOVA 1DH3A 3VKWA 5FPTA 2BM1A 2G88A 4X8LA 4BUJA 5JWRA 4BECA 1JR6A 1X1RA 1HV8A 4C9BA 2YC2C 1E1RA 1X8KA 2FNAA 3E70C 3FMOB 3N2EA 2DFNA 2AD1A 2Q0HA 3IHLA 4PC1A 5CYPA 5TXGA 3UANA 4YMVA 1O3YA 1UEJA 2GF0A 3CRW1 4XIGS 5H68A 2ZAOA 5HE9A 2QAJA 2W2TA 3WNCA 1G8PA 1YHNA 2QT0A 3VKGA 4W9MC 3SQWA 2I1QA 2WWHA 2GJKA 4M53A 1W2GA 3SI7A 4EIWA 1TUEA 4HAXA 4QGAA 1N6LA 1U99A 1J2JB 2C96A 3AP3A 3KDSE 3THYB 1N25A 1IN7A 1P4SA 4KBGA 3AVVA 5FFMA 1YU9A 3ZQ6A 4GCZA 3W6PA 2BC9A 3I92A 3OEHD 3WHKA 1L4YA 5DNYB 1OFHA 1XJCA 5C46F 1W49A 3RRNA 3U7EB 4KYIB 1WRBA 2NO7A 4LHXA 4MT8A 3W5IA 5FPHA 4LYFA 2GVZC 521PA 4PAOA 5F9FA 3W8RA 1VYUA 2HUPA 2XOKA 4A4DA 1AIPA 1N6OA 4IXNA 3UG7A 2QTVB 5F9HA 1HT2E 4V0MA 1E69A 2UVQA 2IC5A 1WF3A 3GEIA 2WJIA 4A6PA 4EPTA 2C9CA 1KO7A 3KQKA 4IOLA 1U94A 4EDHA 5B58C 1JPJA 2A2ZA 2ERXA 2ZSEA 3B8HA 4V0ME 2DB3A 3U3JA 1NG1A 3BRWD 5FL7D 2WPDD 2ZJAA 2F1JA 1Z28A 3K9GA 3IHWA 3VR3A 1Z6AA 1D2MA 4Z1MA 1GOTA 1VCOA 2CL0X 2DFLA 3B6EA 4TWZA 3K53A 5SZKB 5KYKA 2QNRA 3REFA 1U8AA 4TLDA 5HZKA 3D6TB 1IOZA 4Q4LA 1XX6A 1ZP6A 3UMFA 3K70C 4AKGA 4Z8YA 5FL3A 2BDTA 3SNHA 3ZVRA 4AD8A 2C78A 5J4KA 5E4FA 1OH8A 3CRMA 2KJQA 3LNCA 1YKSA 2ZANA 1OV4A 4NCHA 4DLWA 2X1VA 1NN5A 3MJHA 4AUWA 2QUZA 4OHWA 5AW4B 1FQJA 1GD2E 1LW7A 3QKRA 4HZUB 1A02J 4LYJA 1MABB 2N42A 1Q44A 1W0JA 2EFEB 3BH0A 1G3UA 1OWAA 1U0HC 1RC8A 2G1JA 1GITA 2EWWA 3LV8A 4JSYA 3OIVA 2BIFA 1RRGA 5EXPA 4RKFA 5J4LA 2XNDD 4PC7A 4B3BA 2VP6A 4C0AC 1RJ9A 1QHGA 4EPWA 2NO1A 1E9AA 2IL1A 4DT1B 3KUDA 4PO1A 1FUUA 4RFSA 5FOVA 1HY3A 1R10A 4A2PA 4C7OB 3DGEA 2AFHE 4HAVA 5GJWC 3DEFA 5CM9C 1FOSF 3ZZ0A 1YZQA 3EC1A 1AS2A 2WJGA 1N3BA 4XVRA 5CDFA 1FMLA 2KBFA 3QKSA 3TGPA 2XB2A 1YRAA 2DWPA 5C93A 1JAHA 3AUXA 4URUR 2V1XA 3FOZA 3HYTA 5L3VA 1NMXA 3NH6A 5CDFE 1Q1ZA 1E6CA 3GFTA 1OKKA 2ZJ5A 3CF0A 3HPRA 4PC3A 2ZR7A 2VRSA 1VIYA 1XEXB 2RHDA 3KQGA 1JQJC 1P75A 4GP6A 3U3RA 5BWMA 5JBQA 3WP1B 1K5GA 4POAA 1J70A 4QNMA 3H1TA 4DDWA 3RABA 3IEVA 1UBGA 3BGWA 5CB8A 2XX3A 3GJ5A 2R65A 2OBNA 2XSZA 3DKVA 4FMDB 4TMTA 6Q21A 1PUJA 4PC6A 3MSXA 2WT7A 3IIMA 1SULA 1XMSA 2JJ2A 1XEFA 1OLOA 2JAQA 1HEIA 2QTFA 1ZM7A 3VMZA 4QRHA 3V5BA 1BS1A 1SZPA 3RC3A 4DSNA 1KTVA 4BFSA 4TQUS 5FR2A 3PUWA 3SWFA 1GRRA 2HDNB 2WKQA 4P4SB 1Z47A 4RZUA 4MGYR 3LO5A 1SQ5A 1QF9A 4QL3A 3EX7C 2XTMA 3VMXA 2ZS8A 1RRPA 1GWNA 2C2AA 1WP9A 5AUQA 4DCVA 5AW9B 2F9MA 2LKCA 1MO4A 3GEEA 2J5XA 4WVFA 3IDQA 1AQYA 3RS2A 5KSPA 2WSSA 2JJLA 4BLTA 2HXYA 2KBEA 3QF7A 4BFVA 4BWYA 2R6DA 4CW7A 4B3DA 2CNWA 3QE0A 2D74A 1E2DA 2Y8EA 4D26A 3O8RA 4QFMA 2HJVA 4O3MA 2GK7A 2W0MA 2Q3FA 3L0SA 4RJLA 3AF3A 4AG6A 1NVUQ 1CF4A 1CTQA 1LY1A 3ZH9B 4BFTA 3U4QA 4Y0AA 1C1YA 1NN3A 2G3YA 2ZIAA 4WOPA 3I5YA 4IOJA 4PO9A 1SHKA 2B7CA 2BJVA 3TRFA 2NG1A 1U9IA 1LF0A 1Q22A 3CLVA 2YJTD 1Z2CA 1XF9A 3TSWA 1E2JA 4WBSA 4BIZA 1YZTA 4ZIRA 5JLJA 4HAWA 3LLMA 4JLAA 3K70D 2CCGA 4QM6A 4MGIR 1TEXA 2BMEA 3ECCA 4KFUA 3SS8A 5HR5A 3IPXA 3SJCA 3CNOA 4B35A 4FD2A 1SVLA 2FEMA 3CWZA 4PQRA 1P9NA 4MH0R 1OXVA 2F1RA 3GJ8A 4RVCA 2NPFA 2VQSA 4QGFA 2GAAA 1CJMA 1W4CA 3IPYA 2BKUA 2VA8A 4M1SA 3HDTA 2ZI9A 5APWA 2ZITA 3QEJA 2P67A 1DO2A 5EQTA 2XU6A 4M9QA 1NG9A 3PIRA 2FMXA 1N5IA 1NVWQ 2R44A 1DOAA 1QG4A 2XZRA 5KNBA 1NP6A 4QG7A 1RRFA 1U9IC 4I81A 2ZRHA 1P61B 4PSVA 2WMNB 3A36A 1CEEA 2WTYA 1SVKA 4TQAA 5DYIA 5AW2B 5AK0A 2IYUA 2EFGA 4NL4H 4PX9A 3UXMA 2PLFA 4LHZA 1XD2A 3F5FA 4HAYA 1GU5A 3CPEA 3NH9A 1HH4A 3X1ZA 4I6MC 1HTWA 1PJRA 2V6JA 3A4LA 2QP9X 4LJ5A 3Q9LA 3AVTA 1FP7A 5H70A 2Z83A 4ABYA 2QSZA 3WRXC 5K8TA 2C03A 2RB4A 1JNMA 3QG1A 4Q4HB 3PEUA 3AV0B 5LD2B 2QENA 3I8XA 4HYYA 4C30A 3M1IA 2DCUA 1T8UA 3LIEA 4LJ6A 1SVIA 1OYYA 1X6VA 1SGWA 3KB2A 3ND8A 1MKYA 1TU3A 4A15A 4TZ0A 2IS1A 3I3SR 1YE8A 4DC9A 3U44A 1EESA 2OHFA 3E2IA 1HUQA 1G2CB 3Q7QA 4UXHA 3Q5EA 3NXSA 1KQLA 1X8JA 3NVAA 4XD7D 2VTKA 5AJWA 1CJUC 2VSFA 1E98A 3KTAA 1A7JA 4B34A 3A37A 2H7HA 4X8HA 1F3OA 1NN1A 2ZE6A 1QHHA 1G8YA 1G41A 1MH1A 2P5TB 3GMTA 3VAAA 4BFZA 4BFUA 1E9CA 5G3YA 3SOPA 1P2TA 2ZS9A 2O8BA 2R5BA 3FMFA 1BMFA 3V4WA 4Q4JA 2IS2A 4CIDA 5ELXA 2QP3A 4U5XA 1YZKA 2FA9A 3PR1A 2AL7A 3RRZA 3T35A 3KJGA 1W0KA 2IS4A 2QN6A 3QIAA 1OYWA 2JLYA 1G3RA 2J7PA 3D3QA 3MGCA 2YOGA 1M7HA 1U90A 1YJ5A 5DH9A 2WWGA 4TL9A 2R6GA 1S9KD 3CZQA 4QXAA 4JLBA 1GU4A 2C5LA 1U2RA 4OQNA 2VYFA 3LXRA 1JQLB 3WNBA 4A2WA 3SYNA 3P1JA 2Q3HA 1RFLA 2IYYA 2C9YA 1OXZA 3A6PC 3DM5A 1FW6A 1XBTA 1SVSA 2CHGA 3VTKA 3TK1A 1JJVA 1XTRA 4V0OA 4OI1A 3PEVA 4LHVA 3QBTA 3LXXA 1G7TA 2HEIA 2R62A 4ZPXA 1KKLA 3UK6A 2R6FA 1R4AA 3H84A 4HATA 4UXJA 2ZVQX 4URVR 2FH5B 5FOTA 5TDHA 1MRNA 1W47A 1SLQA 3WMGA 4C7NA 1K5DA 1JB1A 1TL7C 1MV5A 1NVVR 1TQ2A 4TYNA 2PJZA 1Y63A 4LPSA 2NQ2C 3GJ3A 3OAAA 1AKEA 4YDSA 1Q57A 2Q7CA 5TMPA 3RC8A 3GEHA 2WPSA 1DADA 2BJWA 1KDOA 1VG9B 3SZRA 1XTQA 3X1XA 4HLDA 2PX3A 2QTHA 4F93B 1E0AA 1QVAA 2YWHA 3EZ9A 5JSZA 3H2YA 4G0NA 2G6BA 5KOYA 2RCNA 1TNDA 3HWSA 2E42A 1OW3B 5B64A 1Z0IA 2GK6A 2RAPA 1N5JA 3HU1A 4QC2A 1D9ZA 4NCKA 1T0HB 1K8RA 1JECA 1ZYUA 4EUNA 3EXAA 2GEVA 4LK2A 5FH9A 3F3YA 4NYIR 3IIKA 1OH7A 2QPOA 1XU4A 3K0AA 3NBYC 3QKRB 5GJVC 4B3FX 2DY1A 4D80A 4JS0A 3NBZC 2DWQA 1XPRA 2ZXEB 4YMSA 4LYHA 2EYUA 2AXPA 3WYGA 2CK3A 2QROA 2V3CC 2C99A 3U60B 1AK2A 1FOEB 5FBVB 3HE5A 5CJPA 3CIOA 1XPUA 1RJ9B 3GLIA 2WVJA 2JLSA 2VP9A 3G82C 4F38A 1VCNA 4FMDF 2JLXA 3CX6A 4DIDA 4A0GA 3O8ZA 4Q02A 3FKQA 2H16A 4EFLA 4AQRD 1BYIA 3NFQA 2ZTSA 2ZJOA 1Q12A 3GLIE 1NMYA 1NKTA 1EK0A 2GJ9A 3FPAA 3QKSB 1T2KD 2H92A 2W6JD 1IXZA 2BMDA 2W6AA 2YYZA 4LSGA 2BKEA 3L43A 4ILEA 1UAAA 4IVRA 4NYJR 1F2TA 4LUCA 2YOFA 4ACAA 5FUWA 4KFRA 2ZR0A 5BN4A 1EWQA 4MUAA 2OSBA 2GRJA 3NHAA 1UKZA 2QPAA 2ZAMA 3CR8A 4PR0A 4HDQB 3GP8A 1XWIA 1W5TA 2ZRNA 3K0FA 1RRCA 3L0PA 2EQBA 1E0SA 2ZJYA 4LBYA 2O8EA 4A8JA 4XWKA 2WT7B 1AA9A 2NZJA 1T8TA 3BERA 4EPRA 3KKOA 4IDOA 3FMIA 3R9IA 2NTYC 1XXHA 1IN4A 1DELA 2MSCB 1OIXA 1EFUA 1TEVA 5LDDC 3TW4A 1KK0A 3BXZA 1FZQA 2CDNA 4OK5A 1XXHE 4PAQA 1M74A 2FFBA 1KKMA 3A7OA 1UM8A 1EFCA 1F51A 1PLKA 1GFIA 1AKYA 4EPYA 2FFAA 1VTKA 3A1TA 2BHRA 4QPKA 2YWEA 1FAVA 4QHTA 5JS7A 3PFIA 4IXMA 2IF2A 3TR5A 1KGDA 1KHTA 4PZZA 3VX3A 4JBXA 2AKYA 1G1MA 3C14C 2CXXA 4HAZA 4HB4A 1GKIA 4YC7A 4D0NA 4LZZA 5FI0B 4EKDA 3SFVA 4A8JC 1U0LA 2REXB 5GADl 1X86B 4MTXA 2FGJA 1JPNA 3U4QB 3KJHA 3THWA 4I5SA 1KI2A 1UEIA 4PFSA 1KMHA 1UKYA 4LCBA 3DOFA 2PCLA 2VP5A 1SXJA 3L37A 3FVQA 5CM8B 3EIHA 3TUJC 4D6PA 3FGNA 1B23P 3UMSA 3NDPA 1EGAA 1G5TA 2HT1A 4BFXA 5KPJA 1XNJA 3T1QA 4ZIRB 1VKJA 1SXJE 5KO2A 3U3OA 1IBRA 3ADDA 3SBEA 1VHLA 4RD3A 1ZD8A 5DE3A 4IW3B 4F4CA 2F7SA 2OXRA 4JT4A 3NEYA 4OK6A 4MYUA 5F2EA 1GNRA 2X2EA 3EA5A 2FE4A 1Z8FA 3TIFA 1NL3A 2JIZA 2C2HA 4M1MA 1OPXA 2D62A 3HU3A 1CI6A 1GL9B 1L7VC 1ZC4A 4V0LA 3ICEA 4FIDA 2IWHA 4EQ6A 5SZJA 2WTUA 1N6RA 4OKSA 4UNQA 5CJ2A 3KQHA 3SEAA 2Q3IA 3OAAD 1HYQA 3EARA 4C0LA 1XMVA 4IVPA 4KV9A 4A0HA 3O8BA 1UF9A 4HUQA 4IEEA 4TTRA 2JDID 1E9RA 4Q47A 5IT5A 1S2MA 4W7SA 5FOXA 1R0WA 5DI3B 4NDZA 2ZE7A 3HP1A 4Q20A 1G8GA 4YXWA 1YRBA 1AZTA 3K0CA 2QRZA 2Z0MA 4LJAA 3I8SA 1NY6A 2NO0A 1XD2B 3SE0A 1U98A 4KI0A 4C2TA 2GETA 4GRAA 1D2EA 1KO4A 2ODWA 4LJ7A 1CLUA 3SJAA 1ZU4A 1RVDA 5BW8A 4CEHA 1MUUA 1DAEA 1OXSC 1JJ7A 4PZLA 3BB1A 4BQSA 5HKKD 5J47A 5E7IA 4DEYA 2QGNA 5AW7B 3GLHA 5LB4A 4MRNA 2ERYA 4D0LB 4OQFA 1CR0A 1P5ZB 3L8ZA 4ZI3A 2XEXA 4RCZA 1F60A 1I2MA 4MITA 4B6EA 1G6OA 1R5BA 1QRAA 2ZVPX 5AVRB 3GLHE 4B86A 3SHFA 3EPKA 3U44B 3GJXC 4NPHA 4C0BA 2E9SA 3BFVA 4GMDA 3WBKA 2G83A 2P0EA 3KTAB 2W83A 2B6HA 1AJEA 5M04A 2OILA 1OT3A 3K0CC 1QHHB 4XE5B 1UFQA 4IKEA 1T6NA 1YR9A 5G53C 2O8BB 4Q4JB 1UDXA 3TW8B 3U2QA 3ZDQA 4KLZA 4RCYA 1N6HA 4DWJA 3NMDA 1PUIA 3F8TA 3N70A 3GJ7A 3CW2A 4HZIA 4JVNA 4GL2A 4B73A 1Z0AA 3TMKA 1IHUA 3B9QA 1CJTC 3HR8A 2YNMA 3MLEA 4ZDIA 2DFTA 2O0KA 4W5WA 3QJYA 3BC1A 1S0UA 1ZUNB 4CZ2A 5AUNB 3TUZC 4LBVA 1T3SA 2CEAA 3P7KA 5E7JA 1X8LA 4LC1A 2FSFA 2Q9BA 3B5JA 3E5HA 4AK9A 4TYPA 1II8A 3IO3A 4JLOA 2RH5A 4RFVA 4PHTA 3ASYA 3B1ZA 3QF4B 4DUGD 4QKQA 3P32A 3HYRA 2OXCA 2XXAA 1H8EA 2QRNA 3A1UA 2WKPA 1DG1G 2ZQ5A 4TSFA 2CE2X 2FFHA 4G1UC 5GJBA 4C7NB 2BVNA 3KKNA 2WIBA 4DLZA 4Q1BA 2CJWA 5IK2A 4DBLC 3KKMA 4B2LA 3QPVA 1WCV1 2GBLC 5FTNA 5LD2C 2B7BA 2B92A 1YZLA 1EFRD 2MMCA 2PLRA 4G5GA 2J59A 5TV2A 2OLJA 1Z2AA 1H8HD 1E96A 3B1WA 2Z5IA 1P62B 4ZCMA 2HT6A 3BJIC 3RNLA 1BH2A 2H17A 5L8VA 4PPGA 1DAIA 4F4IA 4HUTA 4PQFA 4DIEA 5JSZB 1S9DA 1LS1A 5GVRA 2V7QD 1R5NA 3H86A 4IDPA 4TT3D 4Q9JA 4A6XA 3A1WA 2WBLC 1US8A 2ECKA 3AH8A 4PPFA 4XVUA 1E2MA 2VHQA 1GTVA 2F43A 3BOSA 3OE7A 4Q7KA 3FHOA 4FCWA 4H9GA 4DB2A 2BEJA 1GIAA 3UWOA 2ZI7A 4C2UA 5TB5A 5L3QA 3FWYA 1KI7A 2A5FA 1P72A 2W6ID 2WICA 3K0AB 3LD9A 2OFXA 1IQPA 4L15A 3W9YA 2DWOA 1W48A 3IILA 1MOZA 5KSZA 2WPRA 5EZ6B 1G3MA 4DCTA 3VTPC 3WRYC 1Z63A 4YONB 4Q1EA 3DVLA 1E9SA 4CT5A 5JRZA 3HE5B 2HYIC 3RHFA 5APYA 1M6NA 4L16A 5AUPB 3DO6A 4US2R 4Q4AA 3GLIB 2XJ4A 4JL5A 4LRWA 2N46A 4Q7LA 4D4KA 5KU1A 4JJKA 1KNQA 4FMCB 3TSZA 3BFXA 4GSYA 1JR3A 1JEEA 4M1KA 1KDTA 2W2VA 4IVQA 1G4UR 5KDDA 1ZC3A 2J9RA 3EZ7A 1NKSA 1H8AA 1DARA 1Z07A 1P7CA 2NOAA 1JR3E 2HF9A 1OXXK 2VBCA 5EP1A 1F2TB 4NYMR 1XPOA 3LVQE 2V6IA 4QNRA 4IRUB 3VMYA 1ZMXA 5C1BA 4CEJA 2ZU6A 4PHFA 4JASA 3E1SA 1P9WA 3NWJA 3AVYA 4EPVA 1E1QD 1CRQA 1YR7A 3K0FB 2XTNA 4AI6A 2ATVA 2IXGA 4PSKA 4AKHA 1V43A 3U6KA 2O8EB 1E2FA 4A8JB 2R3CA 4NCJA 4C0JA 3M0AA 4G5QA 2A3RA 4P4TA 5LB2A 1G20E 1XCMA 2EFHB 2WJHA 1WMSA 3L0IB 1XXHB 3U3KA 1XB2A 2QBYA 4MRPA 3DM9B 2IA5A 1SVOA 3VHLB 4TLEA 4RKEA 3PG5A 2ATXA 1T4GA 2BV3A 1TPZA 3CKLA 1FTSA 2Q9CA 4HLQB 2BMJA 3DOEA 5EJEA 2P3SA 3B1XA 3EPLA 4ASUA 1GZSA 5JEEA 3OEEA 3IGFA 2O8DA 2C9LY 2IUTA 3I4LA 2AXNA 3CPJB 2CMKA 4GOKA 4TMXA 3T1OA 4TMKA 3V4QA 4LJ8A 2ZUCA 3M4YA 1G5RA 2IEZA 4OBEA 3UKDA 4QBIA 1S1CA 2WAYA 4XOIA 4C4PA 3AF0A 2IX3A 4JLVA 2ODEA 3AF1A 4QHSA 3G5UA 1I4TD 4JLMA 1VHTA 3NKVA 5J5CA 4URXR 3MWJA 3LBHA 2LFSA 5HZHA 1KAOA 2DBYA 2WOJA 1KSGA 1G7CA 4C46A 2ZSBA 2PEZA 4YMWA 3OFNA 2P2LA 5AVUB 5KPDA 3THWB 2PZFA 2ORIA 5L3RA 1KMHB 1P3JA 1TTTA 2HLDA 2FU5C 1SXJB 2TMKA 5BYKA 1E32A 3QVVA 5HE8A 1B0UA 2QSYA 2REOA 2B21A 2J0UA 4G01B 3B8EB 4IHQA 2O8CA 5EE3A 4LV6A 2RMKA 4JIMA 5FBWB 4LJ4A 1XEWX 2ZYWX 4BLQA 2A78A 1TUIA 3LBIA 3W3AA 4KITB 4TL8A 1FNNA 5AW0B 3TH5A 5JHGB 2O8FA 1ZCBA 4V0KA 1E1RD 3P4YA 3QY0A 1FP6A 2RGBA 5EP2A 1NMZA 1M7BA 5IF9A 4MKIA 4D4JA 3C16C 3NC1C 4X8MA 1OH5A 3EWAA 2YO2A 1OSNA 2GCNA 1CI6B 3CONA 5H8WA 3R9XA 2A30A 3NTUA 3MJRA 4GT1A 1ZD9A 1ZUIA 4ZKEA 5EE9A 4E07A 3A1SA 4EQ6B 1VCIA 3NTNA 3FHTA 1RW4A 1TQ6A 2AN9A 2Z4SA 3EC2A 1BIFA 1DBSA 1Y3AA 3I32A 3IIJA 5SZIA 4ZDKA 1G16A 1Z06A 2WWXA 4M9SA 5FI1B 4HUQB 4CVNA 5H1YA 1XTJA 2JATA 2OBLA 2G77B 1D9XA 4OHZA 5KUTA 4RD0A 1DEKA 4D2IA 2P2UA 3WY9A 1ESNA 3D7MA 5K8IA 1Z08A 1IN5A 1Z83A 2XITA 2IYLD 4G5SA 1NLYA 4KXFB 4IFBA 5BYJA 2AKAB 1NBMA 5D3QA 1FL9A 1QDEA 1FOSE 2XOKD 4TMZA 3LA6A 5AR1A 4N0EA 4CEHB 4AC9A 1VCMA 1BKDR 3EASA 2EYQA 4MQBA 5BN3A 3BIFA 2J0QA 5FUYA 1J90A 2OEPA 3THXA 1NBME 5CYOA 4UNPA 1ONBA 3GLHB 3ZD6A 4RD2A 4URZR 2WOOA 1M34E 4JVLA 1TX4B 3LLUA 3ZRVA 2MMGA 5CLQA 3CBQA 2ORWA 2ZYUX 4Q03A 4RZ2A 1AS3A 1GILA 1IAQA 5DI3A 4PO8A 5CIWA 4Z1MD 4LJYA 3Q8XB 1N0WA 3TAHA 3QBVA 3FMPB 2F3RA 1LS6A 2IWRA 3ZVMA 1KO1A 5FTKA 3RWMB 3AVXA 4Q1AA 1CXZA 2QZ4A 4RESB 3EW9A 1G17A 4QJ3A 1UKEA 1G3QA 3U7HB 5JJKA 2D2EA 4EAQA 2RGAA 2QM7A 3U5ZB 2CCJA 2ZRDA 1OFUX 4II7A 2FDCA 4HLCA 5FPKA 3FFAA 4PPQA 1NJGA 4M1YA 1DAKA 3T15A 1VYVA 2B8WA 2H57A 5JJIA 1W0JD 1CS4C 4KCGA 4G5OA 1OJLA 1EG7A 2WPQA 5DN6A 4Q00A 2J7KA 4HDCA 4ESVA 1KO5A 4NBSA 2YOHA 4EFMA 1T91A 2GHIA 2ZRCA 4PANA 1OF1A 1W4BA 3EG5A 4URWR 2H18A 4TMVA 3QXJA 5TY0A 4LI0A 1II8B 1KI9A 1NIPA 1KI8A 2QMEA 3AGPA 2J87A 5FBLB 1HA3A 1TF7A 1MO3A 2NIPA 2WMOB 1A1VA 1P2UA 5KHOC 3MGNA 5JFGA 2XXAB 1QHNA 3HR7A 5FOSA 2BCJQ 4TLAA 1OIVA 1W46A 2QEQA 2PL3A 2HYDA 2G1KA 4UJ3A 3ZIAA 1CULC 5EE5B 1G6HA 2LKDA 4PXAA 1R8SA 3MD0A 1GVNB 4TLCA 2CE7A 1OKKD 2CJWB 1ETUA 3AP2A 2GCOA 4Q1DA 1JUNA 4KU4A 1DO0A 5FPSA 2EFDB 3SN6A 5APTA 1NLZA 5AVYB 3NIBA 3J81k 5CITA 1RE0A 2FSIA 3A4NA 1P2VA 5C4GB 2BEKA 2ZROA 4OHVA 4D4LA 2XSZD 4JL8A 4B3CA 1WBDA 1R6BX 2GKSA 4NZYA 3TAUA 4ZI2A 1SKQA 1E2QA 1L2TA 2FGKA 3DMNA 3QF4A 2JJ2D 1AN0A 2FTKA 1NSTA 4OYHA 3HJNA 5GJCA 1IXMA 5TARA 2ORVA 4AG5A 4KSBA 5CK5A 1U8YA 1US8B 3OFND 4TQ9A 4JL6A 4ZCLA 1EFTA 2JLUA 2DHRA 1XZPA 3B1YA 2F43B 3ZJYA 1LFDB 2PT7A 2H1LA 2OFWA 421PA 4LPKA 5L3QB 1JNYA 4BRUA 4EFNA 2D7DA 3A58B 1TADA 4U7OA 3ADCA 1GTWA 1N6IA 1X3SA 4PPNA 4AWXA 3A5TA 4AYXA 1PLJA 2WSSD 3ZRWA 3PV0A 2CNWD 3GJ0A 4KAXA 5DO9A 3X1WA 2W58A 1XDBA 1YQTA 4UNRA 4RZXA 1LV7A 3NHBA 3BWDD 3IKJA 4Q4AB 1J8YF 4MDEA 5DLQC 3KX2A 1RPZA 2D2FA 1DG3A 2JCSA 3A2AA 4TYWA 2P7JA 4K8OA 5AVQB 3AKEA 2VP0A 4TYYA 2ODNA 3RRMA 2RGEA 2GNOA 3ZYCA 1EXMA 1WDTA 4AYWA 5J4YA 4P33A 1BOFA 1E0JA 4A36A 1FPMA 4D25A 5BXQC 2YKGA 4IOMA 4LHWA 4CF7A 2RGDA 1YYCA 1OHHA 4QJ5A 1LTQA 3ZVNA 4S35A 1TMKA 1CP2A 2JEOA 3FYHA 4LC0A 4BZXA 3I1FA 5G40A 4CEJB 4I1SA 1P6XA 2FFQA 3CRQA 2ZRFA 4MUBA 2IBMA 2QM8A 2JA1A 5JHHB 3VX4A 4Q48A 4O25A 2WZQA 1GKUB 3SYLA 1Z6YA 2QMUA 4GMXA 4W5JA 1NRJB 2VF8A 1CBUA 3VR1A 4A2QA 5AVZB 4UNNA 3AVWA 3C15C 3I5CA 2EU8A 5KDOA 3M06A 3M6AA 1E79A 2FV8A 3MRSA 2GXAA 5AVTB 2QBYB 2EW1A 1COWA 4LY6A 2AHOA 2ASEA 3KJEA 4FCTA 4TTQA 2CCKA 4PHGA 1N0UA 4ZKIA 3OIWA 1W36C 3K9LA 3EAQA 4A92A 1ODFA 2NO9A 4D4MA 2E1RA 4Q7JB 5FTJA 1G21E 4WZBE 1HUCA 1XP8A 4R2HA 5APSA 1Q1EA 2VRWA 4XJXA 2GEDA 5K8LA 2O8DB 1XJQA 3EA0A 2BBOA 3H0KA 1HQYE 4RY2A 3JZAA 1Q1BA 1DAHA 4R2IA 1VMAA 3V4FA 4ARZA 2ZI3A 4LJ9A 4F4JA 3AF2A 4NYIQ 2XZLA 1AS0A 2CL7X 2IYQA 4B2IA 3SJZA 2IYVA 2IS6A 2ZRMA 1ZNXA 4QPJA 4HAUA 3AVQA 3WXMA 4YMTA 3HPQA 3W5JA 2ZFCA 1W2HA 4UQOA 8OHMA 1VG8A 2F55A 3K9HA 4UNSA 4KFSA 3VFDA 4NCNA 2CHVA 2VP4A 3BB3A 3L0OA 1NWQA 2A9KA 4R7ZA 5B30A 2IYZA 1UBCA 2B8TA 1T9HA 2NO6A 4I4LA 4QBGB 1Q20A 4ZCIA 5CMZA 1L4UA 5FTLA 1HQCA 4EJSA 4CRWB 2BBTA 4EPXA 3K1JA 4FW9A 2Q9AA 1KI6A 1SVMA 2XB4A 3FKSA 2J0UB 2YZ2A 4JBWA 2WWWA 3QPWA 2O8CB 5CIQA 3DL0A 1GK4A 3ZLJA 2ZJ8A 1LNZA 2H5EA 4HI0E 1AZSC 1PLLA 4KVAA 2QMOA 2O8FB 4M1OA 3M9BA 5JECA 5DISB 5AVSB 3LWNA 4XSHA 3CPHA 1BMFD 1YZGA 4B71A 3ZD7A 4AIIA 4NYJQ 4JZKA 2FZLA 4BASA 2X77A 4M21A 1YZUA 1W0KD 2Z5HA 1T5IA 4DSUA 2OO7A 2NGRA 2RHMA 3VKHA 2J7PD 4PZYA 1XMJA 1XTSA 2QAGA 5EUMA 4IJMA 3W90A 3V9PA 1ZJ6A 1G7RA 1E99A 2ANCA 1E2LA 2D7CA 3GFOA 2BBWA 2R8RA 2WJYA 1HE8B 2E43A 1XJ0A 1CR1A 4EJSC 4LV5B 1DTSA 4WZ6A 5AVWB 4XVQA 3QQ5A 3OEHA 2ZJ2A 4H1UA 4BEBA 1CRPA 4MKFA 3RSLA 1UADA 1NI3A 1DPFA 1XCGB 1O87A 1L8QA 1R0YA 3NG1A 4ZO4A 1MT0A 3T1TA 2I1VB 5BN5A 4M0LA 3SR0A 4GI7A 4GNKA 3MAAC 3R8CA 5IRCD 1M1YE 2ZRKA 1TQ4A 3SYKA 5AW1B 2XAUA 1ZRHA 3THXB 2ZJBA 3SDZA 2GEUA 2QU8A 3KL4A 4O0MA 2C8VA 1JXOA 4HEJA 4P31A 1E4VA 2G0TA 5EXXA 2GTPA 3QOFA 3WNDA 3AVPA 3BBPA 1LF5A 3VR4A 1UBEA 2CLSA 1SXJC 2ZU0C 5FL7A 2LCFA 4KHZA 3TYYA 2WPDA 3MMPA 2IHYA 2FPMA 1N6PA 5DHFA 1IM2A 1G4AE 4B76A 3VNVA 2IK8A 2RGGA 2WJJA 2O5VA 2MSDB 3W3ZB 4YLGA 4B75A 5JZVA 3HTKA 3C5CA 2VF7A 4DDTA 5APQA 3IR9A 4OK3A 4BLRA 821PA 4JJZA 3I62A 3A1VA 2CVFA 5KDLA 1RYFA 4D82A 5AVXB 4JSTA 4JT2A 1E9FA 3KDPB 1E2EA 2GILA 2XZPA 4LWZA 4FI3C 5AWFC 2Q3MA 5JI2E 4A82A 3FTQA 2CK3D 2H7VA 3UG6A 2W0SA 2PCJA 3R7WA 1J8MF 1QHSA 5HPYB 5J4VA 1GM5A 5AVVB 3B9PA 1W4RA 2YVUA 3RS0A 3WMEA 5DHAA 1W1WA 2G0NA 2YNYA 4D0GA 1ZINA 2HCJB 5HCIA 4F7WA 2XNDA 3KXIA 1KSHA 3A8TA 2UZIR 2I4IA 2ZYVX 3BK7A 1R5OA 1S1MA 2H8KA 2ZI6A 3V00A 3SC3A 1EFHA 1OB2A 3HE4A 4KLNA 1LVGA 5LBIA 3L36A 3LQRA 4DRZA 1ZNZA 3KKQA 4QGGA 2C77A 2GAOA 2DPXA 1GP2A 2UZ3A 3SHWA 1N5KA 1ANKA 2KB0A 2WV9A 4CDGA 3AP1A 2R6CA 3QKUA 3NC0C 3B82A 1KJWA 4DLUA 3T34A 1UDWA 3TQFA 2ZETA 3RS4A 3LQQA 2GCOB 2YWGA 2KE5A 2VPPA 3ICQB 4A0FA 3PUZA 3PUXA 2OT3B 1N6NA 3THOA 4KO8A 4GKGA 3UIEA 1E9EA 1S3SA 1Z22A 2AWOA 2CVHA 3TBKA 3LX8A 1KNXA 5CLLA 3KXLA 1QVRA 1XTIA 2BM0A 1Q3TA 2IYSA 3EZFA 1NSFA 3GLGA 3C8UA 2PT5A 3IQXA 1ZU5A 5B1OA 4DZOA 2FOLA 4Z8XA 5IDVA 4RSGA 1Z0KA 1E4YA 4M4SA 2OUKA 2JJ1A 4OHXA 4OQLA 3Q3JB 3CRRA 4UXIA 4DVGA 3GLGE 1SHZA 3GPLA 3KZ1E 2A5YB 4V02A 3PXGA 1KK2A 1MFZA 3GLFA 4HLUA 4TL7A 1KJZA 3DKPA 4Y0VA 1R7RA 3REGA 4P0TA 1G5PA 4B47A 3C7KA 4NP6A 3DDCA 4DLTA 3OHMA 3TKLA 2QMHA 4QBFA 3GLFE 2FG5A 3FE2A 2YC4C 5FPYA 1AGRA 2C9OA 3ZRWB 3AKDA 3EZ6A 4G5RA 2XTZA 2V9PA 2W27A 3F0TA 3CM0A 3P27A 4BZQA 4E03A 5KNCA 4JAUA 2WHXA 4IDHA 4LBZA 2VHCA 1QZXA 3GJ6A 1RKBA 2ZYTX 1Q0UA 2IT1A 3MCAA 2EWVA 2FN4A 2FSGA 3VU9A 3QXSA 2WKRA 1R8QA 5JEDA 2DFKB 3OESA 3QVUA 5ANRB 2RGCA 3EPJA 3CF6R 5DGXA 4QGHA 2PZGA 2ZE5A 4HYTB 1FNMA 2D3WA 1VG1A 1W36B 2BASA 1KOFA 1SXJD 2A7QA 5DI9A 4HLUC 4KBFA 3S1AA 3C41J 2CL6X 4Q7MB 3AQ4A 4FCVA 4FN5A 1H65A 3AB3A 3V4RA 3CNLA 2X19A 3GQBA 2BBSA 1KI3A 4DLXA 3VQTA 3H4MA 4DKXA 1H88A 1XZQA 4MRSA 3QEOA 3LVRE 3PEYA 2C9NY 2JIZD 3QSYA 2VSOA 2ZUBA 3RS5A 3QNUA 3WYAA 4YQFA 5E95A 5B57C 2ZRGA 3BORA 1NLFA 3IBYA 2XJ9A 1S9HA 3LH5A 1JI0A 2X8AA 3TVDA 4TZ6A 1S3GA 4R98A 3D36A 2YHSA 3GFPA 2ZRJA 4ON9A 4DEXA 5KSYA 1WXQA 4JLNA 4B6FA 2WWFA 2IYTA 1OFIA 2IF0A 4IDQA 4YXWD 4UKDA 5FTMA 1HT1E 1BYUA 3BFKA 3ZCCA 121PA 3M91A 1QHIA 3EIEA 2ZJZA 4BGDA 5JWOA 2QE7A 4B2PA 1IJFA 2OESA 2IW3A 2QT1A 2R9VA 3ADKA 3AEZA 3OIUA 4ARZB 2ONKA 3LDAA 4BE7B 4CEIA 5EE1A 2ZI5A 5APXA 1KZGB 2FF7A 3RS7A 4BFWA 4B3GA 2GXQA 2QG6A 3TNFA 2GVDC 2O0JA 2WSMA 2AFIE 1A82A 3KXKA 3RDPA 1OH6A 721PA 3ETLA 3BE4A 4W5HA 2QGZA 4LYAA 2ONJA 4M1TA 2GCPA 4OQXA 1FQKA 2JJ8A 4GBMA 3RS3A 1ZM9A 3LAWA 3MWLA 3UIAA 1TU4A 2IXEA 5FR1A 1J7KA 2VLIA 2OAP1 4EJSB 5JWHA 1HWTC 1E2GA 1ZIPA 3AM1A 1CJKC 1KI6B 1OXTA 2C98A 3BD9A 3BH6A 3KFVA 2J0SA 4XD7A 1GZLA 4MA4A 2AD5A 2C04A 4UJ5A 1GRNA 5BQ5A 1XCPA 1R0XA 4FMTA 1H89A 4QOSA 2OCAA 1U8ZA 1KO8A 1G9XA 2R2AA 4M22A 4MRVA 2BCGY 3QG5A 3IQWA 4NYMQ 1F48A 3B13B 4GDFA 3W34A 2J41A 1CR4A 1Q21A 1KDPA 5DSZA 3B2EA 2AWNA 4HB0A 1VDZA 3QENA 3IBGA 3ZZUA 1ZCAA 2K5UA 5TVKA 2E87A 1IY0A 3L8YA 3ND9A 2ZPTX 4M9ZA 1SVWA 2QAGB 4JKIA 3AKCA 4RD6A 4XH9B 5CK4A 1ZNWA 1GG2A 3PVSA 3KKPA 2JGNA 5KSOA 1ZW6A 2ZRBA 3O8DA 1TF2A 1ZM2A 1G64A 3UMRA 4QJ4A 2J1LA 2AK2A 3SBDA 3CRVA 4TN1A 3MFYA 3BB4A 2W00A 1KI1A 2IUSA 2OE2A 1D8TA 1S9KE 4DCSA 3P4XA 4DCUA 4FMBB 3EPHA 2GJ8A 4CGZA 3M9HA 1SKYE 2DR3A 2XZOA 5F98A 3AVUA 3NBFA 2JJ1D 1CZQA 2ZRPA 1H8ED 4GZMA 2G9NA 3AF4A 5JRJA 4Z51A 3RRYA 2KWIA 2XV5A 4TSFD 4M9XA 2WAXA 4BLSA 2ODBA 4OJQA 3T06B 1JEDA 5IK2D 4JYCA 2V4ZA 1A5TA 3QUSA 4ITRC 4MYCA 4B33A 5EP4A 3LW8A 1PZNA 4Q9IA 4PC2A 4R9UC 1F5NA 4Q66C 5JI3E 4QHYA 2ZR9A 1Z0DA 1CU1A 4LOAA 4IEIA 1F2UB 5FOUA 3ZRXA 1HJBA 3TSOA 2BMFA 3T5DA 1JALA 1WQ1R 2IYRA 3BS4A 1LB1B 1Z6GA 1J99A 3WP0A 1W7AA 5DYGA 3TNUA 3T61A 1NIJA
chains in the Genus database with same CATH superfamily
3RAJA 3HTKB 2H1HA 3TPZA 1FP1D 5DGTA 2QTWB 4R71A 1PNRA 3ER8A 3T4EA 2RKOA 1QX8A 4JFAA 2A5GA 2QX6A 5K8VA 1C29B 4DSTA 1NXTA 5F1PA 3R7WB 3STLC 3EMVA 2CSUA 1KERA 2XUDA 3TJTA 3VKVA 2Q21A 4DMHA 1XFAA 3EXIA 3NDBB 1B1AA 1YGPA 3DV0A 3CNEA 4WFEA 1OU0A 5LZ8A 4ID9A 4JELA 4HRXA 3PRHA 4FIPC 1I5OA 5FEUA 2QORA 3RVRA 4ZT5A 4E1AA 4MB2A 2REQA 2V55B 4L87A 4Q82A 5AM5A 3QV2A 1XDDA 3F1LA 3RGWS 5IJ0A 1WV1A 2VRNA 4WVZA 4WKBA 4A0RA 4IOKA 5EKSA 1Q1QA 2HF8A 2P8JA 3M8KA 2O1WA 5K3SA 2IYXA 4FXPA 4LYYA 1ZISA 5BQOA 2GM9A 4G0OA 4S3MA 4BNFA 4B17A 4IZOA 3T1VA 3CO5A 3CH5A 4N1AA 1IG0A 3KYDB 3VPCA 2CLDX 5J5AA 1VJRA 4M1EA 3BGDA 3TUIC 3BWBA 3ZWVA 4B3XA 4CHTA 4N76A 4H37A 3D4PA 1QBZA 2AJTA 5C35A 2B8NA 1EWRA 4IYJA 1P2GA 3G5LA 1KMIY 1QZZA 4DLYA 1FDWA 3R4CA 4HJRA 4IH1A 3TQCA 2DECA 1O95D 5EJIA 4ZJZA 2NAPA 2GAIA 3P2YA 2BCCG 4ENPA 4NK4A 9ABPA 1ZNQO 5BXYA 2I7DA 1YR6A 4GWLA 4H77A 3KQNA 2PZSA 1AHNA 3RYHB 4RDIA 5KX5A 4FGJA 4D4KA 1RQNA 2OLKA 3EVKA 3F7OA 2JJ1G 5C34B 1JF8A 2PUTA 1MABA 1V54C 1SC6A 2BI4A 3QP9A 1U1EA 1MQ9A 3V2PA 2C4MA 1SXIA 2WM8A 1ZJYA 4YCNA 2HJGA 4YEDA 4RV9A 1O57A 3S5UA 2CDRA 4UVCA 1M56B 2OIGA 2B8JA 3CLQA 4HNAA 3H1HJ 1F9AA 4KOAA 1HSOA 3RSZA 3T12A 4E31A 2QY9A 4XB2A 4LI3X 2XAJA 2P6NA 4Q15A 2JCGA 3ZHTA 3MUOA 1N7SC 3PHHA 1EFRA 3C39A 2IZ6A 5DLDA 3CV3A 2Z95A 3IP9A 5J1TB 4BFLA 4PONA 2JFBA 2FSUA 1K6JA 4JLDA 1LPOA 4B85A 3HUSC 1FVOA 4P3YA 2O2EA 4ONEA 1IUKA 4O4HB 1MAVA 2Q27A 1AGPA 3OIYA 1Q91A 2ZYIA 4FKZA 3AO0B 2G8YA 3D8BA 3AR4A 1PNQA 2I9PA 1R66A 4U7TB 1EXDA 3LK6A 2VUUA 1JG6A 1YRQA 4JXJA 1GGHA 4L8GA 5DWQA 3R7DA 2JHCA 2ORED 5ICSA 2R25B 3X1KA 1EBOA 4OHMA 1DV2A 5BW6B 4NB5A 2X14A 1WY5A 3F5WC 5B3KA 3ESXA 3Q2IA 3T3OA 1RIFA 1COWD 1WV0A 1EU1A 2ZI4A 4G4SO 4LOHA 3T1YO 1UBHS 3CX8A 3UYKA 2SHKA 2VNIA 4HWOA 3ACBA 5JT1A 3D71A 4KP4A 4PZCA 3BDVA 1GDDA 3WRVA 5EZ5A 3SNKA 1XZBA 2G82A 2GPAA 2FZVA 5TQJA 621PA 4BFYA 1G2CA 1JSCA 3PK0A 3EHDA 2P9CA 1U0JA 3I9NA 1B76A 2DEUA 3EVDA 1KYOD 1ORTA 3Q10A 4PC1A 3UANA 3OMXA 1MT3A 4ZEWA 1Z5GA 1BCCH 2EATA 1HFEL 1CFZA 5DSXA 1U3TA 2A92A 2I22A 2WTBA 1WZNA 2XWPA 2VTEA 4KBGA 1WZIA 3AY0A 4XYMA 3V6IA 1UIMA 5FA8A 1XDCA 1M2VB 2GVZC 1Y89A 4XR4A 3R4VA 3FDFA 1MRZA 2Z1DA 2VXBA 3WJ2A 4UTVA 2W6JG 3ZDCA 4O5OA 3PE3A 3D6TB 1IOZA 3G89A 5DTEA 1KA9H 1EAYA 4KQMA 3ZMSA 4UUOA 3ET4A 1CIJA 5IVHA 4ER7A 3HMQA 4FFPA 3CLTD 2QLTA 1U31A 2BIFA 1NC3A 4PC7A 5EIBC 1C7ZA 2VP6A 3H8JA 4G4SP 1YT5A 4C7OB 4OY3A 3SYOA 2O7NA 2WJGA 4XVRA 3IHTA 3WWZA 5LLSA 3DL7A 3AUXA 4X00A 5DYTA 3V8EA 3LF1A 3OE5A 1TMOA 1Q2NA 5TC4A 3LK7A 4UPDA 1UBTS 2PUEA 5JBQA 1U7TA 1R3KC 1DIGA 4RWUA 1CY2A 3K5LA 4PLGA 1OTHA 1XMSA 3KZOA 3URKA 3DGEC 5HIJA 5ADWA 4OB7A 1PYGA 1CUYA 4DYVA 4U9HS 5ESRA 2VAPA 2J5XA 3KOWA 2A94A 5KSPA 4UXNA 5KNCD 2QIPA 4CW7A 4QFMA 2ZSJA 2XXJA 2HJVA 3L74H 4AG6A 4IMJB 1X3LA 3I5YA 1QPZA 1JA0A 2H1OA 1X7HA 4L2IA 4U2EA 5HQJA 5EA2A 1KRWA 3IPXA 1RE3A 2FFDB 1K9VF 4QGFA 4YQYA 4YV0A 3HB3B 4WI1A 5JDCA 3RTEA 1N9KA 1AN9A 4XW2A 4QPNA 3E8HA 1X4TA 4I81A 4DQUA 2WMNB 3CPEA 4TN5A 3NH9A 4MUIA 3V6MA 1JG3A 1Z4OA 3AW8A 4IGFA 2C03A 4M98A 1QTQA 3CP1A 1MX3A 1PBNA 1PN3A 2IS1A 4DC9A 5K0TA 4BVHA 2LJ2A 5DKFA 2V5AA 4JENA 3HCNA 4U8GA 3L8FA 1G41A 2ZATA 4RPGA 4BWAA 3MLBA 4C1BA 4U5XA 4UDOA 4B0OA 4GP9A 1P7WA 3MTQA 3KBBA 4QXAA 1REQA 3L04A 3ZLUA 1I2BA 3A6EA 1QP0A 3CGGA 2Q3EA 4ZO9A 3A3PA 1XBTA 4AULA 5ALDA 2ETXA 2H07A 2DOSA 5LZ9A 2QI9F 3M6LA 5FOTA 1DMRA 1CZUA 1S1CX 4QOHA 4XDHA 5EIXA 1TQ2A 1Y63A 3UENA 4KQKA 3D1JA 4JROA 4HLDA 4F93B 5JSZA 2AGAA 1E1QG 4N78D 1Z0IA 3HU1A 1K8RA 3KAJA 5I01A 5J23A 3CCSV 4LK2A 1X7ZA 1Q17A 3F9IA 3WK6A 4MRMA 2QPOA 3NBYC 5JQGB 4W7YA 2WD7B 3U60B 4UBIA 4RTLA 2AFHB 3V2IA 1MW8X 4NMWA 1H2NA 2C2YA 3R2PA 2E4UA 2P5YA 3GFFA 3QKSB 1OC4A 3GR6A 4Q9NA 2LGWA 2GASA 2ZRNA 3E4CA 4RVGA 1CPYA 5JPCA 3NM6B 4TQFA 2VJMB 3DXYA 5U9CA 4F5ZA 1CUIA 1TA0A 1SKMA 4OK5A 1NZFA 3S70A 4YRJA 3CURA 2FFAA 1VTKA 4Z1VA 2X4IA 2Z1NA 3VQVA 2RGUA 3ISVA 2KX7A 1PL8A 1OWOA 5J9FA 1NTZH 1DAOA 3DOFA 2FB9A 1B23P 4MVJH 1VKJA 3HUFA 1MOSA 3O9VA 2FE4A 3GHGC 2I4TA 1CI6A 1M72A 4V0LA 1H38A 1A5BB 4V0QA 2VXCA 2C2WA 2Q3IA 3D81A 2Z8XA 4NG4A 1ARZA 4FFNA 4DS3A 5IT5A 4BU1A 4I3FA 3FPGA 5DW0A 3KYCA 2JIBA 2NSHA 3R3JA 3I5DA 1RVDA 4EGFA 2XE6A 4PZLA 4H6WA 5F12A 2HPVA 1BE3E 3B89A 4CLHA 4ZI3A 4ID3A 1I2MA 5LFAA 1J9GA 2IW5A 4NPHA 2BGIA 4GMDA 1RS0A 3W2IA 4DGQA 4HNHA 2VDPB 1S7GA 3SXPA 1HDIA 4RX1A 2XYQA 2PZKA 4B7EA 2GPTA 3PHLA 4G0ZA 4H6VA 3D8RA 4WY8A 3R75A 3CEAA 5KQGA 1EHYA 2O0KA 4QVKA 4L28A 4L7VA 3HD7A 4GVXA 4AK9A 1WPXA 3R3ZA 4WH0A 1NTME 3OCXA 2RHCA 3ORQA 2WKPA 4TSFA 1UFKA 2FFHA 1NVFA 3L0BA 1Z35A 2JZOA 4NOJA 1YJNP 5HJ5A 3QE4A 1BC5A 5EHQA 3FTCA 3SM9A 2GN4A 4K03A 1GZ4A 1YXBA 3RNLA 3FNRA 3NASA 1DCFA 2APJA 4PPGA 4X20B 2V7QD 3KVNA 4KTVE 2F48A 1ZL8B 2BDUA 1X79B 3NOQA 1DT3A 3GC6A 3FWYA 2M3EA 2OFXA 4XCQA 4BBPA 4FQ5A 1C9YA 4RO0A 3PX7A 1WXIA 1T8WA 5AKLA 4ZU1X 3D7SA 2VHYA 3T5CA 2RCVA 3ZJ5A 1HDXA 4ZVLA 3FKJA 3NW9A 4JQOA 3NGMA 3DEZA 3ICCA 5CNKA 3EZ7A 3OOJA 3W2EA 1T4DA 1L4MA 2YDXA 2J9XB 3OJCA 1NUUA 2X9LA 3VV3A 2LQTA 3UC9A 1G6UA 5BN4B 5ALRA 4PHFA 1P9WA 3ZN2A 3GJTA 3TBHA 2WK1A 5TJHA 2ZB4A 4AKHA 1LI7A 2VDVE 3P0JA 4PBRA 3E9QA 2HN9A 2BFBA 2RAFA 1WMSA 5AVTA 4GKAA 1BMFG 4OXXA 4DMCA 4RSRA 3H1HE 3SG0A 2Q9CA 2P3SA 3VDMA 4YY3O 4HXEB 4WTOA 4JBNA 3NTVA 3L74J 2PM8A 2CB9A 4TVOA 1LSOA 3HRKA 2CYBA 1W2WB 2QWPB 4DR5B 5I7OA 2R4QA 3UUEA 1SK8A 1ZJ4A 2YJ6A 3KSDO 2P68A 2HLDA 5A5FA 3NYWA 2TMKA 1OJ7A 1FYDA 1NPYA 2RMKA 3U4IA 4NK5A 3PJSK 5F52A 2O8FA 4V0KA 1E1RD 3NC1C 3EWAA 1RHJA 3GNSA 2NVUB 3THRA 4GT1A 1Y3AA 1QGZA 1XROA 1BX1A 2J3MA 5BR8O 3A6ZA 4X1YB 4HUQB 3G0OA 4B5KA 5G02A 1IZ0A 1OVMA 3S4RA 5BYJA 5K3BA 1V45E 4K9NA 3R6DA 2R7LA 1M34A 3KAPA 3BVPA 5JSHA 3HK2A 2P10A 1ZLYA 1ONBA 4JVLA 5LHGA 5A9TA 1V6CA 4ENUA 1QO0D 1AS3A 4MK4A 2FYUG 3FBWA 1YMVA 1N0WA 3QBVA 1F5SA 4Z0HO 3RWMB 4RESB 4G37A 2ZRDA 4LKOA 1OW8A 5TGTA 4DUPA 4U6QA 1A4IA 1Y48E 3KE9A 2WPQA 4EFMA 3S8YA 2BEUA 4PANA 2NNUA 5DT2A 3VPGA 1II8B 3AGPA 3HTXA 1TF7A 4PA6A 3Q5RA 2BCJQ 1L5VA 4DR4B 4GLOA 3BPZA 1PFWA 4P38A 4UJ3A 2ON6A 3VC3A 3GRVA 4EB3A 3AP2A 4KQEA 4Q1DA 1EWVA 2DT5A 1I6MA 1NWCA 4C3VA 1WP8A 2G71A 3VR0A 2B78A 3QFFA 3LSSA 4IYHA 2JJ2D 3B7WA 2ZBEA 4OAOA 1EFTA 3W7TA 2JFGA 3FSGA 2WD8A 4GPEA 4Z7OB 4LPKA 3T0GA 2FW6A 2RJZA 3ORFA 2D7DA 1O5OA 3BMNA 1BRTA 3EW7A 3ABSB 1Q6UA 1QJ4A 1XO1A 2BGLA 3KB6A 3RAFC 3OOHA 4F85A 4BWNA 1KB9E 3DVQX 3NHBA 3BWDD 2QN7A 2A5LA 3I12A 1G2QA 1TFUA 1PQPA 4IIFA 4JYYA 4H7FA 4IFTA 4WT7A 4LMRA 1BEEA 1QQCA 2ZPUA 4D25A 2AN5A 3IF4A 3K1ZA 5EZYA 2N9YB 4BZXA 3GAAA 2GN9A 5CJ4A 2AFVA 3NANA 1JHAA 4MUBA 2P2DA 5AK6A 1O6FA 4WFBV 1ZICA 5JHHB 5CAEB 3D6YA 4QAQA 2SICE 3WRWA 2CXTA 1EWKA 2VF8A 4O2BB 2VWQA 1VHDA 3C15C 1E79A 1QYDA 2QYHA 1RZRA 3EAQA 2NO9A 5KNBD 5FTJA 4P3PA 3V2QA 3VYWA 4Z2WA 4RA9A 1DAHA 3PYMA 1PT9A 2BFMA 3AKZA 3IPAA 1NTZJ 1CC1S 3AVQA 1J09A 2WSIA 1E3WA 2PRKA 3PQ4A 5CBOA 1Q7CA 3FBTA 1E64A 4KFSA 4GPAA 1EM8B 3BB3A 1D4ZA 4EW3A 4WY4D 5L3BA 3K1JA 5EKUA 5CIQA 3ZLJA 4O3FA 4V38A 5JJJB 4IDAA 1PZHA 1R27A 1W0KD 5BT8A 4GM1A 2OO7A 3A7EA 5DHTA 2B5VA 3AR7A 1BFKA 1TO6A 3JCUE 2OQQA 1E2LA 5HK9A 2QD2A 2AYZA 4RZIA 4RVUA 3BA6A 4RIFA 3IQIX 1SZTA 2QXTA 1SQBE 4S2UA 5ARBA 3TXQA 2NNLD 4HNSA 3OU7A 1F38A 3LDEA 1K7EB 2HF2A 1IVYA 5CB0A 1I8TA 4JUDX 3BBPA 2E5YA 2VUIB 3DBVO 4BYMA 1QQ5A 2RGGA 3ESAA 1ICEA 4DMGA 1JDBB 1P80A 3EQ7A 3F3KA 4BCBA 1Z7YA 1O5IA 3I01M 3CW8X 1ZUWA 3HCFA 3UG6A 1J8MF 2G0NA 3MINB 2E4YA 1KSHA 3IA7A 1W1UA 1CY6A 2PGLA 5AD1A 3R23A 1VPDA 4IDFA 4ZV7A 1K0UA 4DRZA 1ANKA 3IALA 1FMCA 3LFTA 5D6NA 2PD4A 4JR2A 1V9PA 2PI5A 4F3RA 1N6NA 1OX4B 4ZARA 4MROA 4UTNA 1LNQA 1UPFA 3AEIA 2XUHA 4RSGA 2WTAA 4DVJA 4B79A 5H02A 3EIWA 1MFZA 1DRJA 5T4EA 2YV2A 3F7YC 4O1IA 2GEJA 2C9OA 3DBOB 2XTZA 2V0CA 2W27A 4RIHA 3UZUA 2E74B 4LNAA 3FUUA 5DGXA 2NV0A 2NUAB 3VV2A 1YJ8A 4CIYA 1JMKC 4UU8A 1H65A 3K32A 4HDAA 5C1PA 2X42A 1J25A 4DV5O 5KWSA 4D02A 1FRZA 1EZZA 1BCCG 3IVCA 4LAFA 4OFWA 3IBYA 8ADHA 1S9HA 1WB6A 2JEZA 4NPAA 3ZEAA 3ZYZA 3D36A 2YHSA 1UBUS 1UP6A 1QMPA 3L7NA 2IYTA 3EFOB 5DM60 4CIXA 2C94A 3SHVA 4OAQA 4TM7A 1RLJA 3AI7A 4R3WA 5MGNA 2UDPA 4ZOAA 3NAQA 3K6SA 2FF7A 2GXQA 3C8DA 1JIUA 1PU2A 2ONJA 3QPDA 3LAWA 3HL0A 5JNVA 3O0TA 2VLIA 4AO7A 2PU5A 2L19A 3GHYA 1DL5A 3SBOA 3WXBA 5JAPA 2JLBA 4UJ5A 1U8UA 4MUYA 4YMHA 2Q8VA 1GGEA 1ZUQA 1OAKA 3URMA 3PPWA 1GGJA 1EP9A 3B2EA 1L7QA 2ID4A 1ISMA 2PUGA 2V65A 3EIUA 1ZW6A 1BWSA 3CBGA 4DUYO 1KI1A 3WYEA 2ILVA 1QGOA 2GJ8A 3HO8A 3UVEA 3ENNA 1AO0A 3T4PA 1WETA 4YJ3A 3HBAA 3PC3A 3JC22 2ODBA 1DKOA 4AQYB 4L0MA 1VE1A 2A9FA 4MYCA 1ZZEA 1B8PA 2XNCA 1T15A 2GZSA 4C7UA 3EUWA 2P1RA 1CU1A 2XQVA 1KILD 3GWZA 2QQ5A 1LT9B 1ADGA 3HNOA 3B6MA 5B3JC 1USUA 1N3YA 2CH7B 4I50B 1LBHA 2Y4OA 3NP7A 1SQVD 1DX7A 3UATA 1GYRA 4OHYA 2NN4A 3UHFA 2M6YA 1H2YA 3TECE 1H2EA 3DOHA 2O3UA 3V1KA 3EC7A 3L74G 1KL7A 1B6TA 1OI2A 2FUKA 1YA6A 4J6EA 4MVJI 4BMNA 3U3XA 4N18A 2VC2B 2BTQB 1W5AA 3IERA 3BPSA 1IURA 2GSWA 3T5BA 1RF1A 5EI5A 4YJDA 5JMTA 4L9WA 5ALTA 4KFTA 3L1HA 2HCBA 4HDOB 3AUYA 2VAMA 2GTSA 1TF5A 1FXVA 5KYYB 3GPIA 3NBKA 3R8FA 3MWKA 2Y0PA 3MBIA 3DBLA 2NW6A 2IUUA 1M6YA 5B53A 1XL0A 4K9RA 5IAEA 1AX9A 1UPBA 4X94A 2FDXA 4HDSA 2DBZA 4BRWA 1ECBA 2OCBA 4IMPA 2AK3A 4F6RB 1GTMA 3VU9B 4HJXA 3KOZA 3C3TA 1ORRA 1ELOA 3HLTA 3U6BA 4OREX 4TWAA 5FPQA 3SWWA 1AB6A 1WNSA 4RHXA 4UBKA 2I2BA 2Q2NA 3MTBA 4BPBA 3FYUC 2YY7A 3BCCG 3TI7A 2EVWX 4MPRA 2Q50A 1JSZA 2B34A 4TTAA 2FWMX 3H2GA 2JLRA 1S5LX 1GCUA 4K6OA 3SYCA 5LQRA 2BR5A 1OV9A 1ADFA 4MHOA 3RN4A 4LFAB 2PGOA 2AW9A 1J2JA 4B74A 1NZDA 3D3JA 1BZKA 2AFIB 5C53B 2C8KA 1WBBA 4EJ6A 1UPTA 5IC5A 3TD6A 2L0XA 4RQTA 1NQXA 2IPLA 1M7GA 3PRJA 5IXYA 2I6XA 3NFRA 5AJVB 3FAKA 4IV0A 3QPCA 4OI2A 4FVMA 3LIIA 1AB3A 5KU7A 2R4TA 3ROMA 3ZQUA 1C9DB 2BKAA 1V7PC 3E22B 1KIMA 5JSQA 3AUKA 2ZE8A 2G4CA 5BV0A 2FOXA 3SZMA 3APQA 2DLDA 3WGZA 5L4SA 1TCCA 1O94A 4FI3F 1VJGA 3CCEP 1RAAA 1DJQA 1C4OA 3RSOA 4HADA 3JQ9A 5HTKA 2NZ8A 1N2HA 4NH0A 4QEDA 5E7MA 4FS8A 1T9GS 4FE4A 1N2EA 3TQTA 1LTJA 3ASOC 4BP8A 3AILA 1DJPA 3PQDA 4PAMA 4ZKDA 4V3BA 3B8MA 4UB6E 5DCLA 4C4ZA 4G3XA 2WUVA 1K7CA 4EABA 3DSRA 4DDHA 3GVIA 3PFNA 4WE3A 4MWEA 4AP9A 2M6KA 5JSYA 4Q1FA 2P35A 3GWGA 4Z49A 4AYTA 4EZEA 1YDFA 3PE4A 4HO1X 1N2CA 3DMTA 2FMFA 4R84A 1HZJA 1VJTA 3WGTA 3A9UA 4TZKA 5ABPA 2F1HA 3C5HA 2BSAA 2J0VA 2V45A 1NGSA 2CLCX 3G2PA 3JQDA 2XUQA 2ZVNB 1W0CA 3PBKA 1R4MA 1E6KA 1NTZG 4HMPA 4D0SA 3HUEA 4GI5A 1KETA 4MVJG 5DJTB 1QV6A 1HURA 2DKNA 1TMYA 3OP1A 4P83A 3WLSA 2P4VA 2QA5A 2RE8A 2A0WA 2OBMA 4HDKB 1PP9H 1Z0ZA 1KY3A 3OMNB 1JG1A 3W8FA 1U4OA 1V1JA 2SNIE 2XMCA 4RMNA 4COKA 3M0DA 1LGYA 1JRLA 2ZBGA 1S8OA 4PAWA 2ZDQA 5CVVA 1PL0A 3UWSA 4URYR 4EOTA 4N9WA 2BTOA 1LQUA 4BDSA 3FHJA 1XCJA 1N6KA 3VR6A 4MV7A 2I2DA 2XASA 2IIVA 4N0PA 4HAOA 1LTKA 3TPCA 2BFNA 4K3UA 3FYEB 3LBNA 1IONA 1AJPA 3H1KE 1HC7A 1N9GA 2B5OA 4K28A 4WBNA 4FB4A 2GDSA 2X1MA 1U3UA 5GOTA 3PGLA 1FSGA 3T54A 5HE9A 4EHJA 1YAJA 5TQ2B 4BATA 3BSSA 1KPIA 4TMYA 5F2NA 2YQ4A 4GKVA 1OCOC 5L7YA 3SQDA 4XIYA 3GV0A 4W6ZA 2CVOA 5HG0A 1MZEA 3C6BA 1JT9A 5DNYB 1FYVA 4DAEA 4QJFB 3U7EB 4N7MA 4LTMA 4ALLA 4A4DA 3U13A 4MW0A 2J5KA 1U8XX 4EPTA 4UUBA 1PW7A 3L4KA 3VH3A 4I55B 3BRWD 4H4CA 2IE0A 5EBMC 1Z28A 2JFVA 3N2GB 1VCOA 3B6EA 2VRZA 3K53A 1NQUA 4W9NA 1UAYA 3UMFA 2PJUA 4ER5A 3MRTA 3PC7A 3OW2U 3LNCA 4RIGA 4JVOA 1MB2A 3U1VA 4NAUA 1FQJA 4NPCA 5LL6P 1KE1A 4RM2A 4OUKX 1EFLA 3SEZA 5H80A 3M81A 4LHEA 5LCXA 1B0ZA 3JAMN 4DT1B 3PNLA 1R10A 5EJ7A 1QCEA 1SOVA 1BJTA 2I7TA 4LH6A 3DTNA 2HMUA 1M7LA 3HYTA 2QZ9A 4K6FA 1IHYA 2EULA 2JZNA 1JQJC 1P75A 1S7CA 5A6SB 5BWMA 1OWPA 1SBIA 3GW8A 4YGYA 2XSZA 4R1UA 1SC4A 4IJKA 4P3XA 1G5IA 3S6JA 1IJDB 4QRHA 4IFFA 3BMQB 1ZD3A 2WKQA 2TMDA 4RZUA 4C03A 2G63A 4OXRA 4BVLA 2EIXA 3QF7A 4FZJA 4KZKA 4PSDA 2ZZMA 4MW3A 1RC0A 2P06A 2V1DA 2R66A 1I1QB 4IJQA 2B9VA 3AF3A 4BFTA 3G6EV 2VQFB 3VSDA 2ZIAA 2IITA 3A05A 4WXMA 5BYAA 1Z6ZA 1IZ7A 1JG4A 2PTMA 4Q3AA 1PG2A 1C4KA 3OY7A 3KSZO 5HR5A 3MJFA 5FJJA 1M2OA 3LDCA 4FU0A 4KDRA 1USIA 2VQSA 2UYHA 5BORA 1W4CA 3H9UA 2BKUA 3UYLA 2QV7A 3K8OE 3WMRA 1WSDA 2ZIXB 3CZRA 1OZFA 3GUUA 1UK6A 2WTYA 4UV9A 5IFLA 3X1ZA 3TCNA 3H5RA 3WL6A 2D0OB 3O26A 1E5WA 5KBYA 5M7EA 4AECA 3UK7A 3LIEA 1RPTA 2HSJA 3CXCU 2OHFA 1K33A 3PPYA 4ECEA 3DYBA 3LTEA 3WBBA 1NH4A 4ZEXA 3KKLA 5FT9A 4X8HA 4DBZA 2A7WA 3GMTA 1QIDA 3LX6A 4ND7A 4QYIB 3SOPA 1LX7A 3DOUA 3SLGA 3DB1A 3E4DA 2P6MA 1OYWA 4X6XA 1XQ6A 1LPBB 1EVEA 1ULHA 4BX3A 1AK9A 1BE0A 1WXHA 3SYNA 5IS2A 3P1JA 1EN6A 2CXNA 2C9YA 3IURA 4KK4A 1K9MQ 1YC2A 3FHLA 3TK1A 1PFIA 3IP5A 1VM6A 2R6FA 3H84A 4ILKA 1O9HA 5B4VA 3RVJA 2HCFA 2X3YA 5MFPA 5C31A 4TV8A 3KZCA 3L1VA 1PW5A 4UVDA 3INNA 3P9YA 4BN0A 1XTQA 1GU1A 2FZ5A 3NJRA 5DHSA 3PXXA 3FYIB 3D43A 1Y3DE 2B2CA 1OW3B 4BQPA 2FCAA 1KP3A 1D9ZA 3TLZA 1PKXA 5AJHA 2G09A 4EUNA 1JCCA 5FOQA 5DOVA 1BJKA 2Q4EA 3TIGA 3IB3A 2CFSA 3LUGA 1MX9A 2C99A 1PCXA 2JLXA 2X4LA 2VF5X 1L7XA 2GJ9A 3C3MA 4WXHA 5NULA 1B43A 2VI5A 2WLIB 4R6WA 5JCJD 4IVRA 2ZVDA 3DWGA 3MCTA 2XQFA 2DW3A 2WV7A 4OSEA 2QX4A 2QPAA 5ALSA 4Y1RB 3NMUF 5AK3A 2C5AA 1XT6A 2Y92A 4BYGA 1S72V 4J0FA 5EKXA 1BDIA 4YCMA 5HRAA 2C0CA 4C04A 1M1NA 3LZ6A 4ED9A 3N27A 4YDRA 4E5VA 1N8RQ 1MXFA 4HB4A 4YP0A 4S1OA 2REXB 4C78A 3IKLA 1U6JA 1FNDA 4LCBA 2I6GA 3IP3A 4FLMA 3MIWA 4DQDA 1XNJA 2GKOA 2RI1A 5DGIA 4F4CA 4OK6A 2HIHA 5ER9A 1NL3A 4RH1A 1L7VC 1IZNB 1QYWA 5SZJA 5HUJA 1I3NA 3R40A 1L5HA 4IEEA 1L1FA 1GG8A 3PN1A 4Y9RA 3AHIA 1P8AA 1AZTA 4UEJA 4BO6A 1ROPA 1NY6A 1UOOA 5C81A 1ECCA 3ZGOA 4EGAA 1D2EA 4DWWA 4FBLA 5BW8A 5HM8A 2YJ3A 2QGNA 1JVBA 2Y1EA 5LB4A 4D0LB 3L8ZA 2P5OA 1C0PA 1IWOA 2EP5A 3R09A 3IXMA 1NRWA 4K0KB 2C20A 2JG3A 1KGSA 1QCCA 3CO0S 3JQAA 3AEUA 2O8BB 3WFIA 2LIVA 4DWJA 4ZGWA 4JVNA 3UQ8A 1JE0A 1BWQA 1PJ8A 1B26A 1G55A 2HSGA 1QH1A 3PUKA 4TYPA 4UTXA 2V7GA 1X8XA 3TL6A 1WEKA 3BEOA 3AE3C 2ZT9B 3HYRA 2H51A 2GO1A 2FE1A 2QRVB 2X22A 2ZQ5A 2E75B 4C7NB 2WIBA 4RUKA 3IUPA 1SQQD 3W5UA 4KE8A 1U0SY 3BMCA 1Z2AA 4Y6RA 3TIXB 4YJFB 3ZN1A 3AHCA 1NHLA 3UBTA 3ZEIA 4U5QA 2IZZA 5IG2A 5DHUA 1T25A 2Z3VA 1ZHFA 3A1WA 2FJ0A 3EK2A 3VJKA 4UHEA 3LXUX 3JRXA 1XRSB 1QJCA 5KLVH 1KI7A 3LD9A 3CF4A 4WWIA 1FZGA 1KD1Q 3UWPA 3AEKA 3JYHA 3H1LD 3R6WA 2OHGA 3DO6A 4US2R 4Q7LA 1UMKA 2OGWA 2Q6KA 2Z9CA 4JV5O 1G4UR 3D7NA 1JR3E 1MA1A 2HF9A 3FY4A 1OXXK 1H6CA 1LC3A 3P9IA 3TZ6A 1ZGAA 1UC9A 1KWKA 1QR2A 1GAEO 2O8EB 5FP0A 1YBKA 2O2XA 5EGSA 5IYDO 5JANA 1G20E 3WKDA 5KS2A 2IA5A 3AEDC 4MIYA 2BV3A 3CKLA 2L91A 1FTSA 3K58A 1E77A 5KTBA 3CPJB 3H1AA 4EI7A 1OCZC 4LJ8A 4RAQA 1G5RA 3IEKA 1U2TA 4CC6A 3F97A 3AF1A 3UBMA 2YEVA 5TPWB 4MTFA 3NHFA 3KVRA 1DWQA 5HX7A 3WGKA 4QEZA 1UINA 1MX1A 4AHCA 3QVVA 1JW9B 2FP4A 4A7PA 3E7PA 1I7QB 4LJ4A 1R74A 1GUFA 3H2BA 4BLQA 4KITB 2EZ8A 4TL8A 1K2VN 3BRSA 2NPSB 4UATA 4GR9A 4G09A 2GH1A 1MEEA 4ODIA 3FHTA 1OCRB 1EZVH 1SK9A 4BWFB 1QH8B 3ORYA 2WWXA 2V96A 4K8XA 4J49A 2PNFA 4GOOD 1GLGA 5DX0A 3VVMA 4FS3A 1IFMA 4IFBA 3U0BA 2IYPA 2CYCA 5L6LB 1NLUA 2YX1A 3EASA 5C39A 3WDLA 5DMHA 1DCTA 5CLQA 4JXKA 4P3OA 2ZYUX 3HWWA 3NGLA 3IKMB 1D07A 4BMPB 1VC2A 1T8ZA 1U5CA 3SQNA 2CXPA 4IIJA 8ATCA 3ZI7A 4F3KA 3IBTA 4ZO8A 5KYXA 2KG7B 3DBHB 3GRRA 4G5OA 1EG7A 4X85A 2QTRA 2YOHA 1MNAA 1H4QA 3X1JA 2OECA 3B8NA 2ZAYA 2W6BA 3EGWA 2R1ZA 1J0AA 5C51B 2WMOB 2GCIA 2YIMA 5JFGA 4OQDA 1XU9A 3HR7A 5FOSA 1IU9A 4IO1A 3K5NA 1U5BA 1YCIA 3VR4H 3BTVA 2LKDA 4PCAA 5E2AA 3UQZA 5FPSA 2EIHA 4DARA 3TTYA 2X6BA 2DU8A 2I91A 3LS2A 3L01A 1WBDA 4JIGA 2Q2WA 2QKAA 1E2QA 1Q43A 2UUCO 2FXPA 2WW8A 4KAAA 2VOJA 1COZA 3OFND 1S4MA 3S68A 2JIZG 2WFLB 2H1LA 2XNDH 421PA 1SN7A 3RUHA 3THSA 1N36O 3A5TA 3FBGA 1IC2A 4KAXA 1YQTA 2D00A 1LV7A 4JJGA 3IKJA 3DMRA 4MDEA 4YWJA 3HC7A 4FZ1A 2A0KA 2N05A 4TYYA 4WFIA 5L3ZA 3P94A 1SXQA 4KYTA 4X1KA 4NEGA 4S35A 1S2GA 5G40A 1JDJA 4I1SA 3VMAA 1HG1A 1JG7A 4NG5A 1T1SA 3HYLA 4E5KA 2QMUA 4M49A 4A2QA 2X2PA 2VLBA 1SZDA 2GEFA 2CCKA 2NQ8A 1N0UA 4ZKIA 1Y1KE 3LCRA 4P82A 1N0IA 4L5CA 2E1RA 4Q7JB 4R69A 3CC2P 1HQYE 4P7KA 1TE2A 2IDZA 5ALMA 4MOWA 4GZ6A 2IS6A 3SJZA 4DO2A 5CN0A 1JVSA 4B3MO 4BQIA 1X59A 2Q99A 5KJ7C 5IT0A 1PS9A 5EVCA 3MQFA 1MA0A 3V4SA 1HQCA 1KI6A 1PLLA 1VQNV 5K0ZA 3ZTTA 1KFCB 5DISB 1AROP 4AIIA 4J3FA 3M6VA 4M21A 2YBDA 4R8KA 5B1BC 1S5PA 4PYLA 4ZC8A 2NU8A 1NI4B 2VDWA 4B6QA 3G9XA 1UKAA 1C8KA 4HPJB 3OUZA 2O0MA 1UMCB 1L9KA 3IAM1 4MKFA 3K5MA 3ELYA 4BCCA 3AOEC 4CLRA 1HRKA 1JMVA 1GCIA 1AI6A 1Y42X 3SDZA 1NJIQ 4W8HA 4E5SA 2QU8A 4GI1A 4KVZA 5EXXA 5KTSA 1ND6A 1LI5A 3L6DA 4MCIA 1TAQA 1L9XA 2WPDA 1URQC 3IMEA 3T3MB 1CV2A 1NJSA 2YRXA 2W6CX 5SV2A 4E12A 3D64A 3C8HA 1JTVA 3R0ZA 4JT2A 4G86A 1IJKA 5M5BA 1FNSA 1SHUX 2Q28A 3T9FA 2SECE 1QAQA 4GYCB 3OEEG 1NA5A 5HCIA 1N7LA 4KR3A 2Y76A 3BE8A 4RNDB 1L5ZA 4M0MA 3V00A 2Y4NA 4ZWNA 4HFNA 4MHTA 3QOYA 3BF7A