2QM7A

Meab, a bacterial homolog of mmaa, bound to gdp
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
323
structure length
314
Chain Sequence
b'LPDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPGAGDELQGIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase/ATPase
molecule tags Chaperone
source organism Methylobacterium extorquens
publication title Crystal structure and mutagenesis of the metallochaperone MeaB: insight into the causes of methylmalonic aciduria.
pubmed doi rcsb
total genus 121
structure length 314
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2qm7A03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2qm7A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qm7A02
4LYHA 4A2PA 5BYJA 4RKEA 4Q9HA 3SJZA 1N0UA 5DE3A 3UATA 2XNDA 1P62B 4D82A 2VF8A 3UMRA 3PJRA 4RFSA 1UKYA 3TVTA 2J0SA 2G0NA 1FX0B 2ZITA 4KLNA 2J0UB 2WOJA 4R7ZA 3HR8A 3QEJA 1NWQA 4A8JA 3SZRA 4U7NA 2FPKA 2QGZA 4ARZA 5D3MB 2FJUA 5CYOA 4DLTA 1KSGA 1OXZA 1QG4A 3I62A 1ESMA 3EPKA 3FGNA 4HI0E 2Q6TA 3FKSD 3SYLA 1N2CE 5B2ZA 3U5ZB 3FMFA 4LBWA 2WPDA 5GVSA 3DOFA 5JS7A 2WT7A 2O52A 3CR7A 2JIZA 2WWHA 3AP2A 4LX0A 2D7DA 3GLHB 2PT7A 4CEJB 1G7CA 2ZSBA 2WJYA 1SKQA 3CRVA 3FHOA 4LHZA 1H89A 1FTNA 3D31A 1SXJA 1Z06A 1NG1A 1G6HA 4LJYA 4PSAA 2ASEA 1SKYE 2OAP1 4V0NA 2BMJA 1P75A 5DI3A 4M9XA 3I8SA 4B71A 3DVLA 3LO5A 4PQYA 4LBYA 4L5BA 3BERA 2Z5IA 2BIFA 3THXA 4RZ3A 1GNQA 1ZC4A 2Q3MA 1FW6A 1KOFA 2ZRNA 2QPAA 2ZRFA 3V4QA 2UVQA 221PA 4HYTB 1VYTA 4XE5B 3Q5EA 4A0HA 4DZZA 5JCPA 1AGPA 3SR0A 3P7KA 2W2XA 1K5DA 1UEIA 1SVKA 2LCFA 4M3LA 2ZROA 3ZQ6A 3IIKA 2GDJA 1J70A 2GEDA 4CW7A 1KY2A 3HPRA 1OWAA 1EFTA 4QNMA 4ASUA 5FPHA 4DB4A 4Z54A 3U2QA 4XH9B 1KI6B 4PC3A 4KFSA 1HH4A 3M1IA 1KNXA 2BWJA 3U7EB 1W46A 2GRJA 2ZSDA 3B1WA 2RGAA 5AUNB 2ZI3A 3B78A 3X1XA 3GEEA 1MRSA 4RZXA 3L43A 2FNAA 1SVMA 2J3EA 2R5BA 4GP6A 4P33A 3TLXA 5GJBA 2GXQA 1AQUA 3IPXA 1D2MA 1U81A 2OM2A 4EIWA 2Z5FA 4BEBA 1X8JA 4GSYA 1GILA 5EE9A 2XGJA 2HEIA 2GCOB 4KJZA 2DBYA 3WP0A 5K8TA 2QQEA 3IUYA 2OG2A 1H8AA 2WBLC 3VR2A 1DAIA 4LJ9A 3KJHA 3H86A 3UIAA 1GKYA 2GTPA 4TLCA 3X1DA 3QXXA 4Z1MA 2XXAA 4TZ6A 1KI7A 5CLQA 1ETUA 2J41A 3OIYA 4RZUA 2F6RA 2XZPA 4B47A 4Z8YA 4MKFA 4GFDA 5EXPA 2HLDA 4U00A 4PHFA 4LY6A 1NLYA 3TR0A 3ZQJA 3OF5A 1S9KD 1TAGA 4YLGA 3ZD7A 1Q1BA 4GOXA 4I1OA 4NHOA 4C2UA 3EA5A 4MYUA 1IHUA 4Q02A 5DYGA 1VKJA 2NMVA 4AG6A 2OT3B 5AW1B 2YOFA 4HLUC 3QF4B 3H1TA 4KYUA 1IY2A 3LAWA 1NN5A 3FPAA 4LJ4A 1S9HA 1XTQA 5JRZA 2B7CA 1QDEA 2X8AA 4JL5A 2ZETA 1IN4A 3B8HA 3L2OB 4TYPA 3ZRWA 3B60A 2O8BB 1UDXA 5AW7B 1R10A 3ZVRA 5BXQC 1GTVA 2IYRA 1OXTA 4O25A 1N6IA 3IPYA 1FOSE 1XEXB 2D4HA 4IRUB 4LHVA 3V5BA 1XMIA 4O2RA 2DFTA 2GJKA 4Z1MD 1K5GA 2BJVA 3ZRXA 3LV8A 3MCAA 4TYQA 2A5FA 4BFVA 1SZPA 5KPJA 4BEJA 4DLSA 1NKSA 4IVRA 2I1QA 4J0QA 2A5YB 2ZTSA 1W7AA 5LD2B 2FF7A 5L3RA 3KQNA 2ZUDA 3RRNA 1W5SA 1TMKA 5HTKA 1CP2A 4QM7A 1HUCA 3U7FB 3AVYA 4ZDKA 3FFBA 1KQLA 1S1CA 3OAAA 1R5OA 1QHHA 5FTNA 1E9EA 2C78A 1NVXQ 4A0FA 5IF9A 3T1TA 2ZYVX 2XZLA 3RC8A 4EPWA 1P9WA 2E42A 1ONBA 5AVVB 4BIZA 1MO4A 1Z0IA 2MSEB 2N46A 2QY9A 3QY0A 3U3JA 2GBLC 5SZKB 4NDZA 2QUZA 1IJFA 3SYKA 3AVOA 3B2EA 2FFAA 4L9WA 4BPBA 1XTSA 2PCLA 1EK0A 3C4JA 4ZIRA 2DHRA 4Q1BA 4MYCA 5E7IA 1L2TA 4XWAA 3UK6A 2F1IA 3AQ4A 2IYZA 4H1VA 3A4LA 4DLYA 1UEJA 4Z8XA 2F1JA 5HCIA 4JLVA 4TQAA 4EJSC 3EA0A 2WKRA 1CKEA 1P2VA 3MGNA 4LBVA 1BH2A 5APUA 4EPTA 4PSKA 1CEEA 1CZQA 5UKDA 1XPUA 1GVNB 3I5YA 5J4KA 4RFVA 2JJ1D 2J7KA 5JBQA 2FTKA 2GNOA 3K9NA 4M1YA 3QEOA 4M2LA 4HEJA 3TW4A 4QGFA 1KO5A 2MSDB 2D3WA 2C9OA 3K9HA 3HE5A 2E9SA 4HATA 1DH3A 2OFXA 2ZXEB 4A4DA 4C0HA 2R5DA 2CJWA 3AKEA 4MRRA 3W3ZB 1SLQA 1ZUHA 2N9BA 3AP3A 3QPVA 1E2KA 4KI0A 3LFUA 1RJ9B 5FR2A 4AI6A 1CR1A 1XD2B 2QENA 2IT1A 4G5SA 5EZ5A 4Q00A 2IC5A 4IXMA 3NFQA 2LKDA 1ZP6A 3D7MA 1FQJA 3M06A 1KI4A 1VCNA 4IHQA 3PUZA 3CLVA 4M9SA 1GSIA 4DCSA 3GEHA 1T2KC 521PA 1W36C 4M22A 3AF1A 1EWRA 5FL7D 1HTWA 4MYHA 2WT7B 1G21E 4FXPA 4PAMA 1HWTC 1G41A 2WZQA 1RC8A 2AXNA 5G3ZA 2XNSA 4TQUS 1YR7A 1W0KD 2F3TA 2AK3A 3MFYA 4XSHA 4MRVA 5C4MA 1MRNA 3BH6A 3KDPB 3IEUA 4PR0A 2FFBA 2XAUA 1LNZA 5SZJA 3DPUA 4RSGA 4DLZA 5AVUB 1E98A 3LLUA 5H68A 4U7OA 3K0AA 4DLXA 3F8TA 3ADKA 2F55A 1SQ5A 1E69A 3NBFA 1T2KD 1E4VA 1FTSA 2QMOA 2G3YA 2Q3IA 1OLOA 4XOIA 2ZQ5A 1NY5A 1P5ZB 2WVJA 2ZJBA 4FCVA 2SHKA 1Z28A 1XFAA 2DFLA 4QG7A 5EP3A 1IXZA 3VMZA 1KDTA 3KJGA 3SE0A 5DYIA 4TLAA 4XVUA 1VDZA 1WB9A 1GM5A 4B2IA 1OFIA 2R6GA 3GJ5A 3D8BA 1GKUB 4KO8A 3NXSA 3TNFA 1SGWA 3IIJA 3NEJA 2AK2A 2FH5B 1LB1B 3LQRA 5EP1A 1ZMXA 2QP9X 3QKRA 2ZIAA 1V43A 1D2EA 2FSIA 5JMTA 4JBYA 3NG1A 4URWR 2FV8A 3AVUA 2FN4A 4LDJA 3T5DA 3EZ2A 1Z22A 1KYIA 2F7SA 2ZRHA 3M9BA 2ZJOA 3RWOA 1AKEA 5A5GA 4QHYA 1K6MA 4XD7A 3VHXA 4MUAA 4WAUA 2JLZA 2A5DA 2IWRA 5BN5A 2YKGA 4V0KA 2FSHA 3IBGA 3NWJA 5JSZB 2V1XA 1XU4A 3QVUA 1JR3A 1E2DA 2G88A 5KNBA 1WDTA 3I1FA 4IOMA 3IR9A 2HCBA 1FFHA 3K0CC 1Q44A 4D4LA 4E5UA 2Q5UA 4F4CA 4PANA 2B6HA 3DM9B 1Y3AA 4BLTA 3ADCA 1TEVA 1G7TA 3TNUB 2ZRPA 3SBEA 2J7PD 5CDFA 5LPNA 3A4NA 2BKUA 1OKKA 3L37A 2HJVA 2ORWA 2YVUA 3LA6A 3GEIA 1OFTA 1NVVR 4ZCIA 2H5EA 1NVWQ 2ATXA 2W0SA 4M1MA 1UBFA 4Q9IA 1M34E 1N5LA 2PEZA 3MGCA 4ZCLA 3C14C 1LFDB 1DAHA 1YR6A 4ZDWA 1TQDA 1X86B 4ACAA 3PXGA 2QM8A 5BQ5A 1E1RD 1JI0A 4TZ0A 4M0LA 1HYQA 4PPQA 3U6BA 5AVTB 2IWHA 1GFIA 3LH5A 1YZQA 4PO8A 3E70C 5IDJA 1E4YA 5JCZA 3U7HB 4OBEA 2WV9A 1G291 1WA5A 4B44A 5APVA 5AVRB 4URXR 3EZ6A 3W6NA 1NJGA 4Q01A 1X6VA 3WYFA 4JLKA 2AD5A 4KVAA 4TMKA 2HF8A 4OK5A 4URZR 2J0VA 2EW1A 3DKVA 1N6NA 2CLSA 4K46A 3K9LA 1BYIA 1JALA 1T3SA 1XCGB 4LPKA 4M1OA 1KMQA 4H1UA 1KI8A 3NTNA 4FMDB 1TEXA 3LW7A 3RLFA 2PLRA 4PAOA 1S9DA 3OEEA 4OKSA 4Q48A 4QRHA 2H57A 2D74A 4JZKA 3TH5A 4KLZA 1YU9A 1G9XA 2Q0HA 3W5JA 1NY6A 2IF0A 3B85A 2WAXA 3CIOA 3VN0A 4IOLA 1IXMA 4Q18A 3QKSA 2KWIA 3CH5A 3U6KA 2XU6A 1NN3A 1OH5A 3QXCA 4JL6A 3EZFA 1BS1A 4ZKDA 3NDBB 3PFIA 1AJEA 1SVIA 1FP7A 2CLDX 1X1SA 4XVRA 2ZRBA 3LBIA 3QBVA 5FPKA 4DZOA 1TADA 1LF5A 3NDPA 1KY3A 4W7SA 4ITRC 2GCNA 1CJTC 3ZJYA 2LFSA 2C2AA 1MO6A 2ZI9A 4NCHA 5LB4A 4MGZR 4B86A 1WMSA 2ZJAA 4TL7A 1D8TA 4Q03A 4XSGA 1NLZA 1G8YA 4KSBA 3H4MA 1IN5A 2W6AA 5J4LA 2QMUA 2BM0A 3A0RA 1KK1A 2DPXA 1J99A 1KSFX 4I1VA 1CJMA 3FWYA 1SVWA 2JLSA 3KJEA 3BAFA 3OEED 3OIUA 2XV5A 2NPIA 3BB3A 4PQFA 4Q9JA 4GBMA 1XTRA 3HYTA 1Z3IX 3A4MA 3C8UA 3OAAD 2CNWA 3CWQA 4Q1AA 4Q4HB 4ESVA 4D25A 1LS6A 3A36A 3LQQA 1RYFA 1PLLA 4B3BA 4CIDA 1RYHA 2GKSA 2WSMA 1JPNA 3CF0A 4C0AC 4UNNA 4EQ6A 5G3YA 1AS3A 3WXMA 3WNDA 5JJIA 1ELOA 2F1RA 1XF9A 2OCYC 3CO5A 4ON9A 2PMDA 3L0IB 3OFND 3TVDA 2IK8A 1W0JA 2YWEA 3BK7A 3O8ZA 4WW0A 2VIIA 1JR3E 3NIBA 1HEIA 4FMBB 1FUKA 3CKLA 1U99A 3QE0A 1E2JA 1OYYA 4OI1A 3AVVA 1VCIA 1ZC3A 3WNBA 1FUUA 3A3YB 1TU4A 1IN6A 1DOAA 1O87A 3QUSA 4WBSA 3RRMA 1P72A 2VSOA 1CR4A 1HE1C 4FIDA 2IEZA 4Q7JB 4YONB 1CULC 2GXSA 1F51A 4Q7KA 4Q66C 4DSUA 2G1JA 4DXAA 4U02A 1NN0A 1X3SA 2AX4A 1IY1A 2W2VA 4M4SA 421PA 3FMOB 5FBQB 2R32A 2RKOA 1T4GA 3ND8A 3AB3A 3UG6A 1XJ0A 2WKPA 1II8B 3TUZC 2BBTA 3B9PA 2P3SA 4IVQA 3KKMA 3T5GA 2Q3FA 2PZFA 4B34A 4C2TA 3HP1A 3ZH9B 2WPSA 2WIBA 3CPJB 3RYTC 5FBRB 2HUPA 3LBHA 4AYWA 2X1VA 3IBYA 1RW4A 4AKHA 3AV0B 1CSBA 1T8UA 3IQXA 4LYFA 4YXWA 1QF9A 2IYUA 5H8WA 4WZBE 3QOFA 4JVNA 2IPPA 2RHDA 1QBKC 2E87A 1SHZA 1XXHB 5EUQB 4PHTA 4WVFA 4LUCA 4D4JA 2HDNB 4GT1A 2VP5A 5F3WB 1C9KA 1A4RA 2L0XA 1KI2A 2Z6VA 3GFTA 3OE7D 4KBGA 4MKHA 3W8NA 3TNUA 2FGKA 4BLOA 1KK3A 2C04A 1NI3A 4FMDF 3HE4B 3VU9B 1EXMA 4EJSA 1S1MA 1AA9A 2ZRDA 4Q4JA 5C2JB 4PO1A 3JVVA 2WWFA 4ARZB 2MSCB 1Z08A 1UKEA 3PQCA 4BASA 1EFHA 4WZAE 1LY1A 1OIWA 4NZYA 1IO4A 3V4RA 2HT6A 2AFIE 4IEEA 1HURA 4W5HA 4JT2A 4ZI2A 4HAVA 3UWOA 2R6AA 1LTQA 4DT1B 3VR5A 4R71A 5KO2A 2GF0A 4NH0A 1J7KA 5AW2B 4KBFA 5AJWA 4PHHA 1A2KC 2BM1A 5ANRB 5E95A 4P32A 1H8ED 2BCGY 4C46A 1W2GA 2JGNA 2A3RA 4IOKA 4B2PA 3NHAA 3MMPA 3Q85A 4ASUD 5J4HA 2WJVA 1XPOA 2VA8A 3LRPA 3SFZA 5BW8A 1BMFD 1OXXK 4PAQA 4JLOA 3P8MC 2K5UA 1JR3D 4Q1FA 4QGAA 2GVZC 3THYA 2PT5A 4MDEA 3TIFA 1LF0A 2VPPA 1W4BA 4DCTA 1E0AA 2IYXA 5B57C 2RCNA 2OE2A 5FOTA 2QBYA 2HYIC 2IA5A 1NBME 2WJJA 5BYKA 4WZ6A 4YMWA 5CLLA 1F3OA 1IM2A 3T1OA 2QAJA 3IIMA 3TGPA 4R9UC 4B43A 4OHVA 2QM7A 1CJVC 2EFCB 3I92A 3PUVA 4MKGA 4LBZA 3ZDQA 2OSBA 5FL7A 3REGA 1KI3A 2GA8A 2JJ2A 3OZXA 4FWTA 3CX7A 3FFAA 2ZVPX 3R7WB 2XITA 2C9LY 3K0SA 1OIVA 5CB6A 1QG2A 1E2GA 1CJKC 4JBXA 1Q12A 2OILA 3EAQA 4KP4A 3WYGA 4ZKIA 3ETLA 2I4IA 4ZV4A 3HWSA 1U0HC 1Z8FA 4MT8A 1RPZA 1SXJB 2C5LA 2WHXA 3TUJC 3SJBA 2Q9AA 1LVGA 2G0TA 3E2IA 3CZPA 3QF4A 3AVTA 4IW3B 4DCVA 2IHYA 4TLEA 2EYQA 3HE4A 4RVCA 1QVRA 1GL9B 3NBXX 1FL9A 2AXPA 2NGRA 4HB4A 4I1UA 4OQMA 3AGQA 5HR5A 4C9BA 5BN4A 1G17A 1T3LA 2W0MA 1Z6XA 3NC0C 4DSTA 3HE5B 3GMTA 3V00A 2TMKA 2GJSA 4QNRA 3VR6A 1BYUA 1ZUNB 2ZI6A 4UXHA 1ZD1A 5TB5A 2IS2A 3Q7QA 1PZNA 5KNDA 2NO6A 1LV7A 1U8ZA 3VX4A 2NIPA 1WF3A 3KKOA 3U4QB 2CMKA 2R2AA 1EESA 1MV8A 3SHFA 1R8QA 5DHAA 2VL7A 4QC2A 2Z4SA 3N2EA 1SULA 3O8RA 2YINC 821PA 1XD2A 3SNHA 3MWJA 1NVVQ 3IQWA 4MGKR 5CIQA 4BLRA 5KU1A 4PTLA 1JEEA 3DHWC 1NIJA 2D62A 4CZ2A 1Q57A 3PEYA 4NYIQ 2DB3A 3A37A 3AM1A 3R9XA 3MD0A 4LZZA 1XEWX 2EVWX 2QE7D 2C77A 121PA 1BIFA 2QSZA 5FUWA 1JBKA 1Q0UA 1YR8A 2ZS7A 5AUPB 3A5TA 2QAGA 4H9GA 1E2MA 1QHIA 1HE8B 3SN6A 2YOGA 1ZNWA 4ZDIA 1SVLA 1PVOA 5KSPA 4KAXA 3P1JA 1HT1E 3CF6R 1NP6A 2FWRA 4PSVA 1I4DD 2IBMA 4G01B 4BLQA 1ZINA 3THYB 1ESNA 4JLAA 3EPHA 2ODBA 2Y8EA 2YO2A 1Z07A 1M1YE 1YRAA 4JYCA 1M6NA 2I1VB 3EIHA 4HZUA 2FOLA 4JYBA 1KI9A 5APSA 4MRNA 2GJ9A 1YJ5A 4C0LA 3LD9A 2ZREA 3QPWA 3N2IA 2FA9A 1HQYE 1NBMD 3L35A 2GAAA 2YC4C 1TUIA 1TQ4A 1SXJC 2CVFA 1KSHA 2R8RA 1XMJA 4DLWA 3M9HA 1II9A 2GK6A 2WOOA 3THXB 4QFMA 1CJUC 3DL0A 2ANCA 4PXAA 3TBKA 3K0EA 1EFUA 2OZEA 1R8SA 3L8ZA 5FL3A 3OEHD 4HAUA 1E99A 3T1VA 1GD2E 1KO8A 4GRAA 4P4SA 2VRWA 2B8WA 2A5JA 1E9RA 3AH8A 2DWQA 3TUIC 2W6JD 8OHMA 2FFHA 5JECA 4QPJA 1MUUA 1OIXA 2Z83A 1G19A 2AKYA 3GJ3A 2P5TB 3K0CA 2FSFA 1OT3A 3BJIC 5AVWB 1XEXA 5J47A 4GOJA 5BN3A 2Q7CA 5B1NA 1CR2A 1N6OA 3BFKA 2RGNC 3LWNA 4TL9A 1S3GA 2R65A 3RANA 2JJ8A 2QROA 3K70B 1HV8A 1U98A 4EFLA 2W6ID 5J5CA 4LOAA 3TSWA 4DEXA 4F92B 2R6DA 1U0JA 1OF1A 3CM0A 5AW9B 2QA5A 3O47A 2VRSA 4CGZA 4DHEA 1NBMA 4IKEA 1NAFA 2KBFA 3WRXC 5C46F 4Q7MB 2BBWA 3LVRE 4N0EA 5FOSA 4RCYA 3Q8XB 1X8LA 1DTSA 3KKQA 5F9FA 4B75A 6Q21A 2FEMA 2H16A 1IAQA 1KJZA 4HB3A 3AGPA 1LS1A 2ZJ2A 1T5LA 3KJIA 4IXNA 4B76A 4TYNA 3QSYA 2ZR7A 1IXRC 4QBGB 2JJLA 1S2MA 1SXJE 1P61B 4CEHB 4PC6A 1P7CA 5AUOB 2OEPA 5AK0A 5FBWB 5EE0A 4AKEA 5E7JA 1OFUX 2C99A 1I2DA 4DDVA 4FMCF 1BOFA 4JJZA 2QRZA 4B3XA 2O0HA 2KB0A 3QXHA 2O8EA 2RGCA 2JLYA 1S9KE 4JIMA 1I2MA 5B1OA 3K70D 2GCOA 4B3FX 5AJXA 4OI4A 3RS4A 4OYHA 4HZIA 1Z6GA 1GNRA 1A7JA 5CB8A 3ADDA 5FH9A 2HF9A 5JZVA 4JSYA 1G8HA 1EG7A 1ZW6A 2J87A 3U60B 4HLQB 4ZKEA 3D36A 1A02F 4POAA 3P20A 1R5BA 5B64A 1XZQA 2ZANA 4DLRA 3AF3A 4UNQA 2HT1A 2O8CB 3I32A 3Q3JB 3U3RA 4C7OB 4LJAA 1MKYA 2F43B 3OIVA 4HDQB 3R7WA 4EOTA 2GZDA 3K9GA 4MRSA 1FMJA 3KXKA 4LJ8A 4I4LA 4M1WA 4NU0A 1F2TA 4V02A 2ZEJA 2ZRMA 2FE4A 3KQLA 2O8CA 1UPTA 3SC3A 2ZAMA 1W2HA 1XTKA 3LXXA 2WTYA 1T3HA 4KXFB 4O2LA 3WRYC 4IDNA 4QBHA 2DFNA 1XD9A 1FQKA 5HE9A 4TTPA 3V4WA 2VHJA 4BE7B 1G20E 2C8VA 4KVGA 4IVPA 2ODNA 5APTA 2RB4A 2VSXA 5JWOA 3WHKA 4HZUB 3BGWA 2P0EA 1OH8A 5AVXB 4A8JB 3M0AA 3UG7A 4KYIB 2JDIA 1P2UA 1UDWA 4PQRA 4CYMA 1XX6A 1W44A 4AK9A 2P6RA 1QHHB 4RFSB 2QEQA 4PZLA 3T12A 1W4AA 3SFVA 4A2QA 2IEYA 4RD0A 2PH1A 3U61B 2FFQA 1G5RA 3MWYW 4B35A 3HYRA 4JLNA 4QXAA 4TL6A 2ZR9A 3FOZA 1N6RA 1YZKA 3ECCA 2V6JA 1UBGA 2AWOA 2ORVA 5GJWC 2QQ0A 2GJ8A 1R4AA 1YZNA 2Q9CA 3K0AB 2CBZA 1AZSC 4GDFA 3VR1A 1SKYB 4BZXA 4DSOA 2Z43A 2IYLD 3RWMB 4E03A 2XTNA 1FZQA 1EGAA 3UMSA 2D06A 5TDHA 1XTJA 3P32A 2H92A 4I81A 1JECA 5AVSB 2RGNA 4M8NE 2WSSD 3ZIAD 3F0TA 4QGHA 5K8LA 3J81k 2KP8A 1IBRA 3CNLA 3PITA 2REOA 2P6UA 5EUMA 3HTKA 2YO3A 4BECA 1U8AA 4JJKA 2AFHE 1GU5A 4K8OA 2CCKA 4HYYA 1KJWA 4LI0A 3VKHA 4IDQA 2HCJB 2BOVA 3GD7A 3HPQA 2H18A 2FPMA 2MMGA 1CTQA 1VCOA 1XCMA 2QPTA 3GLFB 4AYTA 4AIIA 2ZJ5A 2ZS9A 5EE1A 3VTKA 4A6XA 3SU8A 2DFKB 2ZE7A 3G0HA 3BBPA 1KMHA 1QHGA 1P9NA 3IHWA 3FHTA 2R3CA 2EWWA 2E43A 2PMKA 3B9QA 2D2FA 4HUQB 4BFUA 5IK2D 4X8MA 3Q7PA 1JB1A 4KV9A 5CITA 4AUWA 2PJZA 4A0RA 5AJZA 3UMFA 1ZYUA 2Z5HA 3HR7A 3A1TA 2QE7A 2XX3A 3EZ7A 3QF7A 4M1KA 3AVXA 4MA4A 2WKQA 1SVSA 4AG5A 5JEEA 1B23P 1MOZA 1G7RA 2G1KA 1R2QA 1GL6A 1GZLA 3NHBA 2YWFA 3IKJA 1A02J 1A5TA 1J2JA 3U3OA 4CEIB 4EPXA 2VH5R 3CH4B 1OJLA 2CCGA 2QAGC 3IDQA 3A6PC 4OI0A 1YKSA 3U44A 3E5HA 3OFNA 4XTRA 3R9IA 1Q3HA 5G40A 4BZPA 4D6PA 4QBFA 2DCUA 4PC1A 5AW5B 2IYTA 1KNQA 5J4YA 1UBCA 2BC9A 5FBLB 1OYWA 1DARA 1US8B 1XMVA 3PUXA 4P0TA 3FHCB 4L16A 3QKRB 3WP1B 3EXAA 4B6FA 3KTAB 3VAAA 3B1VA 5FPYA 1ZNXA 2OESA 1KKMA 2ONJA 2P67A 1X8KA 1KGDA 1NN1A 5APQA 3FMIA 3NMDA 1NSTA 4DT1A 3VNUA 5CJ2A 3VQTA 4OK3A 1ODFA 4BRWA 4C30A 4MGYR 4CVNA 2C2HA 4BUJA 2JASA 4JVSB 5FFMA 1T6NA 3QXSA 5DN6A 2MMCA 2OHFA 3BH0A 2DWOA 1F48A 3TRFA 3H2YA 2ZUBA 1Y63A 4DVGA 4Q1EA 5HPYB 1NG9A 3ZD6A 3EPLA 4TSFA 3GP8A 5L3VA 3PCRB 3OHMA 5JHHB 3VMFA 4URYR 3UWKA 2VP4A 3B6EA 4LJ6A 4MITA 4L9SA 4F7WA 4JAVA 4NBSA 2V3CC 2KE5A 4B74A 1E1RA 2GEVA 1M2OB 2B7BA 4B2LA 5JWRA 2OV2A 2N1BA 4KODA 4DIEA 1CXZA 3KDSE 2WJHA 3K0FB 2WMNB 1ZVQA 2J5XA 3I5CA 4D0NA 3L0OA 2XZRA 1EFRA 4P4TA 2CK3D 1DAFA 3GJ6A 4Q4AB 1FOSF 3C15C 1DADA 2RGEA 1OB2A 4CT4B 2R9VA 4FWIB 4DLVA 3ZS8A 1X8YA 4TWZA 2QNRA 1U0LA 4A15A 3EARA 3I72A 1P6XA 3B82A 3A7OA 4Q21A 3VYIA 2HJGA 1DS6A 1Z0DA 1VYUA 1KI1A 2QSYA 3DOEA 4KHZA 3AVQA 4TMZA 2ZRCA 1AZTA 1EX6A 3CNNA 1MFZA 1N0WA 2IUUA 3U3KA 1ZM2A 3LX8A 1G3IA 1XXHE 4US1R 2A30A 5L3SA 1UKVY 3BB1A 4V0MA 1W0KA 4RJLA 1KAOA 1AS0A 2XSZA 1NLFA 2W27A 1CRPA 2VSFA 2O5VA 4LC1A 3MWKA 1ZM4A 1KSJA 4RKFA 1TQ6A 4P4SB 5M04A 4HUQA 4NYMR 2H8KA 4TL8A 2YHSA 2V55B 3BS4A 4JLDA 3AVWA 3I61A 4OQLA 1Q22A 4ILEA 1OB5A 3RC3A 1QRAA 3EIEA 2OO7A 2ZU6A 3LVQE 1IONA 4BZQA 1G4UR 4U5XA 4GOKA 2P65A 5IDVA 5AW8B 3SS8A 1NMYA 1RRGA 2H17A 4PZYA 4DDTA 4GNKA 3LX5A 3OESA 4M53A 4MRPA 3K70C 3B13B 1JQLB 4DUGD 2YNMA 2ZRLA 2H1LA 3EASA 3F5FA 1G1MA 2BBOA 2P2LA 2IUTA 3OIWA 1WE2A 2EFHB 3WHLA 1PUIA 3W9YA 4DB2A 4NCKA 2PEYA 4E09A 1GWNA 2FPLA 1QHNA 2V54A 2W2TA 5AR1A 5JEDA 5GADl 1Q1ZA 4F4JA 1HT2E 2WIAA 3JVUA 1W0JD 4TMVA 1GK4A 5C4GB 1KZGB 2GHIA 4UNSA 2VHUA 4PFSA 1R5NA 4JKYA 3EX7C 2O8EB 1UKZA 4EPRA 4NYIR 1V5WA 3WY9A 1Q1QA 2OFWA 3QVVA 4EKDA 2PL3A 1DAKA 4CF7A 1OKKD 3B8EB 2EFDB 2J46A 3EC2A 4QM6A 5JJLA 3FB4A 3GFPA 4IEIA 5EQTA 4QGGA 3BWDD 1RRFA 2JIZD 4US2R 2JLVA 3RRYA 1AN0A 5KPDA 1ZM9A 1A82A 2XOKA 1JAIA 1II8A 1WCV1 5APXA 1C4OA 1D9ZA 2JEOA 2VO1A 2GAOA 4PZZA 4V0OA 3GCGA 1KAGA 1DE0A 1MV5A 1CIPA 5EP2A 3SJCA 2OBMA 2IS1A 3REFA 4B3GA 2WTUA 5EE3A 2H7VA 2GZHA 4PHGA 1Z47A 2P7JA 1XTIA 5TXGA 4LHXA 1NNEA 5FTKA 1CI6A 3KL4A 4ABYA 4PPGA 2QPOA 2A2ZA 1AKYA 2ZJZA 5KSZA 1M7HA 2QP3A 1ZBDA 3A58B 3U4QA 1E9SA 3Q5DA 4TTQA 3KQKA 1R0YA 1DEKA 2VF7A 3ASZA 4PX9A 2REXB 3AUXA 4JSTA 1J90A 1FNMA 2GCPA 2QT1A 4EDHA 4U7DA 2OXRA 4G5GA 3GJXC 3BC1A 1R6BX 2G6BA 2AL7A 1P60A 1G8FA 3PV0A 4JLBA 1G7SA 3ZZ0A 1U9IC 2EYUA 2J1LA 3CZQA 4GZMA 4AKGA 2P2UA 3TW8B 1GTWA 1Q21A 5GJCA 5KDOA 621PA 1OXUA 3VKWA 2RGXA 3BE4A 5JSZA 4URVR 3MJRA 4HDOB 3PUWA 4V0ME 3R8FA 1E2IA 2ZUCA 2BCJQ 1Z0KA 2F9MA 2BV3A 2GILA 2WJIA 1U94A 4XD7D 3TJZA 5AW3B 2OUKA 4S2EA 4AY2A 2XNDD 3IILA 2G9NA 3TSOA 3CF2A 1TU3A 1XB2A 1TF2A 2HXSA 1JJ7A 1JR6A 4LC0A 1SHKA 5AW0B 1NVUQ 3V4FA 3AEZA 3IHLA 4IFEA 2XB2A 1R7RA 2O0JA 3BFXA 4LV8B 1ZD8A 2W6JA 3T35A 3SI7A 1CLUA 3GLGE 2NG1A 1D6JA 4B73A 4BFYA 1JUNA 4WXRA 1GU4A 4DCNA 1Z2AA 1AIPA 4NYMQ 1AM4D 1XRJA 4X8OA 3S1AA 4QL3A 3AKYA 4D0GA 1CI6B 1VTKA 1XWIA 4ACBA 4B6EA 3SOPA 5E7MA 3FKSA 4MTXA 4Q47A 4II7A 1RRPA 1E9AA 2WPDD 4C3ZA 1E2PA 2GBLA 4MH0R 2CE7A 3WMFA 4D26A 3B1YA 5AJVB 5FPTA 4BIUA 2WPRA 1KHTA 4B33A 4DDWA 2Q9BA 3GLGA 3QKSB 1GK6A 3UXMA 3B5JA 1J8YF 2BVNA 3KB2A 1E32A 1FX0A 1W4RA 3G82C 2GZAA 5EE5B 2NTYC 2IYQA 2QI9C 2ZPTX 2C98A 2JAQA 4G5QA 2CDNA 4DEYA 2IYVA 3ZRWB 1Q1EA 2IYWA 2ODWA 4DC9A 2CE2X 2V6IA 1WQ1R 4JLPA 2O8FA 3QG5A 2GVDC 2RH5A 4KFRA 1I4TD 1BKDR 1M74A 1YZTA 5AW6B 1G64A 2CL6X 2FGJA 4QOSA 4TN1A 3SHWA 1S0UA 2KSQA 2NPFA 1N5JA 1W48A 4HAZA 4NE2A 3TR5A 2I3BA 1G6OA 1DAMA 4DCUA 1U8YA 4KITB 4QBIA 3MRSA 3GLFA 3FKQA 1RJ9A 1SVOA 2O8BA 1JPJA 4A82A 4D80A 2VYFA 1AGRA 3W6OA 3H0KA 4AWXA 2ZRAA 1MT0A 4Q4HA 1ZIPA 5A4JA 1PJRA 4AYCA 1BO6A 1Z0AA 1R0WA 1MO5A 3ZZUA 5IHPA 5CK4A 3D6TB 3B7GA 3CBQA 5B58C 1HA3A 1W5TA 5FUYA 4OI2A 1NRJB 1F2UB 2VP0A 3QQ5A 4RCZA 2WWWA 1XEWY 4JLJA 4TT3A 3RS7A 4D81A 4YXWD 5C1BA 4MKIA 3UANA 1YVDA 2ZJ8A 4UJ3A 1GITA 1XCPA 4UNRA 3QI2A 3GLIB 4YMUA 1JXMA 1P3JA 1XJCA 2GJAA 4GI7A 1GKIA 1OHHA 2Q3HA 3ZVLA 4PO9A 1E6CA 2JJ1A 1OXSC 1DBSA 5E3HA 2DYKA 2QTFA 3OE7A 2H7HA 4B3CA 4Q7LA 4ZO4A 2R62A 3IO5A 5FOWA 5APYA 4BRUA 3EWAA 1A1VA 4JKIA 3WMEA 2G83A 2R6CA 4I99A 4BQSA 3CRW1 3KX2A 1Z29A 3BORA 4N3NA 1DO2A 2QAGB 2YC2C 4B48A 1E0KA 4HDCA 4IDHA 2LWIA 3GLHE 3A1WA 3DEFA 4C0BA 4BGDA 4A36A 4TYWA 2HV8A 5EZ6B 1E1QA 1GRQA 5DGXA 3LIEA 3CR8A 1H65A 4Q9LA 3HU1A 2NOAA 5CIWA 3EIQA 1HY3A 4GKGA 1S3SA 3P26A 3AF4A 4MYTA 3PVSA 4W5JA 2VTKA 3X2SA 3VHLB 5KSYA 1FP6A 2ZSAA 1G18A 1IOZA 4S35A 2BMEA 1VIYA 2C03A 2BEJA 5P21A 1DAEA 1RZ3A 2XTMA 2GETA 1I4LD 4RD6A 2ODEA 3A1SA 3M6AA 1ZNYA 1G4AE 4G3XA 1D9XA 3OEHA 2AR7A 3QKTA 3D3QA 3C5HA 2J9RA 4IJMA 4HB2A 4ZDJA 3R9WA 3PG5A 4LWZA 4XWKA 1VECA 2YV5A 4B32A 2CK3A 1G3QA 2HYDA 1N6LA 1ZD9A 1ZM3A 2XEXA 4JBWA 4C0SA 5F98A 5HCNA 5TARA 2CL7X 1QVAA 2BEKA 1Q3TA 3Q72A 1VHTA 4EAQA 1F6BA 1OFHA 3FMPB 2ZYTX 3QNUA 2ECKA 2EQBA 2ZVQX 2Q21A 5FUVA 3BXZA 1O3YA 2B92A 4R2HA 4G1UC 3GJ7A 1OV4A 5SZIA 1FOEB 4RD4A 4E07A 3ZVMA 2OLKA 2VEDA 1N6PA 4I6MC 5TV2A 4DIDA 5FR1A 3U7GA 5BWMA 1MABA 1PLKA 2IW3A 2Z0MA 4JVMA 5FI1B 1FPMA 3LW8A 4HLUA 3T34A 2X2EA 4B3DA 1VPLA 1CU1A 1VIAA 2CJWB 4HAWA 5EXTA 2WWXA 4N0DA 3T1QA 4OQNA 2RGDA 3I3SR 4GP7A 4RY2A 3NBZC 4CEHA 1KK0A 2QTHA 3AF2A 3AKDA 1S96A 1F5NA 1J8MF 2QBYB 4XWOA 3ZVNA 1EX7A 3IO3A 2WWGA 3DMDA 4FN5A 4BFXA 3K1JA 1K8RA 3TAUA 4D4KA 1E79A 1L4UA 2NQ2C 1Z5ZA 4DJTA 2ZE5A 1XBTA 2BMFA 3UKDA 3GJ4A 2BHRA 1GAJA 1N6KA 4FPPA 2EFEB 1PLJA 4MGIR 2ZS8A 4LCBA 1NL3A 1XDBA 2OCPA 4RD2A 4NMMA 5F9HA 2A7QA 4FINA 1VG9B 1KO1A 1T9HA 1SXJD 5EXSA 1F2UA 4E22A 2W58A 2FMXA 1P2SA 4AYXA 2IX3A 3MG9A 4BFTA 2ZFCA 1GNPA 1UF9A 4UQOA 4LV6A 4A2WA 3TQCA 4TMXA 1XXHA 4C4PA 2OFOA 3ZLJA 1IXSB 1A2BA 2RAPA 3KXIA 4W9MC 2JATA 4UNPA 1Z0FA 5HZKA 1OXVA 1AK2A 4TQ9A 4D4MA 4JLMA 2C96A 4AURA 1GRRA 4JASA 5ELXA 3RRZA 4NTZA 2PJRA 1E2HA 4GMDA 2OLJA 4EFNA 5FI0B 2V1UA 5CM9C 2PLFA 1G3MA 3K53A 3UIEA 3UPUA 5G53C 1ANKA 4X8LA 4RD3A 4Y0AA 2D7CA 4OL0A 1DAGA 1E0SA 1KTVA 4YC7A 3ICQB 2DY1A 3DM5A 2O8DA 1QHXA 5FOUA 1D2NA 2XOKD 5C18A 3K09A 3RS5A 4TYYA 5TVKA 2XJ4A 1WP9A 3CRQA 1AQYA 2F1HA 4L4UA 4V0LA 1B0UA 1S4QA 4G5RA 1VCMA 1LW7A 2XJ9A 3ICEA 2EU8A 2CXXA 3JZAA 5DHFA 1H88A 2JLRA 4DDUA 4TLDA 5A0FA 1G3RA 4K81B 4AKIA 3SQWA 2JA1A 2A9KA 2ZJYA 1XEFA 2ZE6A 5FUXA 2VHTA 2QORA 3QENA 3SEAA 1COWA 1T8TA 1GUAA 4IDPA 2Z4RA 2WMOB 5JJKA 2QTVB 2P5SA 3O8CA 2WICA 3AKCA 3KQGA 4OJKA 5G41A 4Y0VA 4QPKA 2YNYA 3CB4A 4O0MA 1XP8A 2UZ3A 1YRBA 1HJBA 4OQFA 2W6IA 3RSLA 5JWHA 4RESB 4DBLC 3KFVA 3R20A 3KZ1E 4C7NA 2YWGA 3M0EA 3TQFA 3B1XA 3FE2A 5FTJA 2CCJA 1VYVA 4TLBA 1CF4A 2IL1A 1L8QA 2VQSA 1OH6A 3K09C 1T5IA 4MUBA 4MQBA 3GPLA 3IEVA 2RHMA 4IFBA 3ZCCA 1WRBA 4ZCMA 5KDDA 2BBSA 5IRCD 2ZI4A 4A6PA 4EPVA 5JI2E 1EWQA 3QIAA 4LRWA 5JHGB 4JL8A 3I73A 1E94E 3THWA 2XTZA 5F2EA 5JI3E 3L0SA 3C16C 1H8HD 2ZI5A 2G77B 4GZLA 3G5UA 1X1RA 2FG5A 4UXJA 4P4UA 2QG6A 2X19A 3TKLA 4KU4A 3T61A 2C95A 3Q9LA 1E9DA 3NH9A 3A2AA 1UM8A 1PUJA 3FDIA 3VMXA 5APWA 2KJQA 3VU9A 3RHFA 2CVHA 2WJGA 3EG5A 2IXGA 3A1VA 5KSOA 3L82B 2ZYUX 3W6PA 4NCNA 2PX0A 2RGBA 3MAAC 4C7OA 3LBNA 4TSFD 3SWFA 1G3UA 1KJYA 2N42A 1N6HA 1VG1A 2WPQA 4AD8A 3THWB 3L8YA 3CX8A 5JS8A 4OHYA 2AKAB 1VG8A 3TK1A 2C9NY 5FTLA 1RIFA 2F3RA 2O8FB 3P27A 4NONA 5DLQC 1UFQA 1D5CA 1M8PA 3CX6A 5J4VA 5AVQB 2GK7A 4A8JC 5HKKD 2PBRA 1ZUIA 1TNDA 2ZRKA 2OAQ1 5DH9A 3KUCA 4XTCS 2PZGA 4RD1A 4KHXA 3BD9A 4OK6A 4BFWA 3MJHA 3ONWA 4QHSA 1R0XA 4V03A 4LK2A 1T91A 1XPRA 4YMTA 1ZU4A 1JNMA 1F60A 5TMPA 3PEWA 5L8VA 3ASYA 4GL2A 4YDHB 4M9QA 1GG2A 4G5OA 3T15A 4LYJA 4XJXA 5TY0A 1G8PA 4A1FA 4CDGA 1KIMA 5L3QB 3R8CA 2QRNA 5DISB 1TL7C 3C7KA 3LDAA 1N0VC 3ADBA 3QKUA 4NPHA 5FPSA 1U90A 4OQXA 1ZRHA 4Q19A 2CNWD 4ZI3A 3MUFA 2IXFA 3A1UA 5FOXA 4EPYA 2WM9B 4NL4H 3T97A 4PPFA 2WWYA 3HU2A 2XSZD 5DIFA 2NZJA 1N5IA 1KDRA 4C0KA 1Z83A 1UAAA 3X1YA 1ZIOA 3WMGA 4Q5IA 1JQJC 2DWPA 1KI6A 3MLEA 4EQ6B 2RMKA 4FMCB 4BFZA 3VKGA 3P4XA 2GXAA 4LSGA 4I2LC 5LBIA 3SDZA 2VHCA 3OAKA 4YDSA 2NO9A 5HZHA 1GP2A 4I1SA 1H8EA 2ZRGA 3TMKA 4F91B 3SJAA 4Q1CA 4WOPA 3RNLA 5AVYB 4TMWA 4Q20A 1OHHD 1GOTA 2IS4A 4ERNA 2WAYA 4UJ5A 5EP4A 1UADA 3FVQA 1BMFA 1W4CA 3RDPA 2YJTD 1JXOA 3X1WA 4HLDA 2OCBA 2BKEA 3M91A 2ZYWX 3LIDA 1L4YA 4N1AA 4EUNA 3VR4A 3EC1A 1Z6YA 3GJ8A 4C0JA 4X8HA 3CONA 2CHGA 2D2EA 1P73A 2ZU0C 4M21A 3SQXA 2C9YA 3AUYA 1OW3B 1N5KA 1ZCBA 2VP9A 1NIPA 1TQ2A 1US8A 2LFRA 2AD1A 3GLFE 4LJ5A 3VMYA 4Q4LA 2OCAA 3KXLA 4M1SA 3TE6A 5AJYA 3WNCA 1NF3A 1DG3A 3HDTA 2A78A 1ZJ6A 2VHQA 3GFOA 4ZIRB 1FMLA 1XNJA 1NSFA 5AW4B 4C0QC 4A0GA 4A92A 3DDCA 2B21A 2PCJA 3LLMA 4M1TA 4WA7A 1TF5A 3VTPC 3ZRVA 4FD2A 1ZM7A 3WBKA 4XIGS 4NKRA 5KHOC 1S8FA 1N3BA 2CHQA 1XJQA 2CHVA 2CLCX 3LNCA 3WYAA 3F3YA 1MR3F 2YYZA 1YZUA 1E2QA 3GJ0A 4FI3C 4QJ5A 1KDPA 2V4ZA 5CJPA 5FBVB 2AHOA 3KFXA 5LB2A 3DZDA 1P4SA 1Z2CA 1E9CA 1W47A 3W8RA 3VFDA 1IY0A 3WBJA 4O3MA 4L8GA 3U44B 1YZLA 2IXEA 2AN9A 3DGEA 3EZ9A 2JLXA 1TTTA 2HXYA 4LYAA 1VHLA 3DZ8A 2J7PA 1E9FA 1KMHB 4CEIA 1YQTA 4WIAA 2VBCA 3KQUA 4HAXA 1GZSA 5FTMA 2V8OA 4AC9A 4EFMA 2FSGA 4Q1DA 1E9BA 1MABB 5C93A 2KI5A 2QZ4A 2VLIA 3DO6A 3ZZTA 3MSXA 4P3YA 1OE0A 3GLIE 1E2NA 1SP4A 4OJQA 3EWSA 4JS0A 4L15A 1GL7A 2GXUA 3BH7A 1M7GA 2J45A 3RS0A 3HU3A 3SYNA 1ZAKA 1JAHA 2E1RA 1TF7A 2GESA 2HLDD 2JLQA 3N70A 4G0NA 5LDDC 2VP2A 3KQHA 1NMZA 4NYJR 5CM8B 4FCWA 2ZE8A 5D3QA 4CEJA 5HE8A 2QP4A 1UBEA 3K8YA 1P9RA 4QKQA 4Q4JB 721PA 3PEUA 2ZM5A 1M7BA 4HB0A 3RSOA 2LKCA 2RGGA 2WSSA 3KB1A 3ZIAA 3CPEA 1CBUA 2F9LA 4IOJA 3QPUA 4JAUA 2J59A 3A8TA 1RE0A 2FZ4A 3SBDA 2R44A 4KFTA 3CNOA 4MDFA 4AQRD 3H84A 1E3MA 4TTRA 1E79D 2ERYA 2WWIA 5KUTA 1G8GA 3ZS9A 1W1WA 5IT5A 3I5XA 3VNVA 1TX4B 1WBDA 1TUEA 4PPNA 1W49A 4HLCA 1JJVA 1ZU5A 2O0KA 2C9CA 1WBBA 3PUYA 4HAYA 4R98A 3VR3A 2YZ2A 3BIFA 4W5WA 2FEOA 3QXJA 4LPSA 5KOYA 2XZOA 1IJEA 5JLJA 1KZ7B 1QHSA 2EFGA 4URUR 1G16A 3PIRA 5SZHB 4UXIA 5IK2A 2GF9A 4JT4A 1FAVA 2IYSA 2NO1A 1G5PA 2JCSA 1Z0JA 4YMSA 5LD2C 3THOA 4DKXA 3NTUA 3GLGB 3KKPA 3I8XA 5DO9A 2JLUA 5AWFC 5CYPA 2YWHA 3B1ZA 1DVRA 2QU8A 3DMNA 2ZRJA 4UKDA 3W90A 1YR9A 3P4YA 4CRWB 4Z51A 3VX3A 4QJ4A 3M0DA 2IYYA 1VG0B 3ZGXA 3RVBA 1JOYA 2ATVA 3AVPA 3ND9A 1GIAA 1EFCA 4BFSA 3W3AA 1E1QD 4LHYA 1N25A 1II0A 4CT5A 2V7QD 3N5CA 1T0HB 3O8DA 3PENA 3NC1C 1RRCA 3RAPR 1YE8A 4DLUA 1T0JB 1F2TB 1GDDA 1Q20A 2GWHA 3LY5A 4A9AA 1W36B 1XZPA 5DI9A 2UZIR 1KO4A 2QGNA 4EJSB 2EWVA 4GPTA 4FW9A 3MWLA 2IF2A 4DWJA 1G5TA 3L0PA 5KDLA 4PC2A 2GEUA 2OXCA 2X2FA 5HKKA 1JEDA 1WXQA 1U9IA 2AWNA 3NEYA 4F38A 3BB4A 4US0R 4QHTA 3CW2A 4DRZA 1Z63A 1OPXA 3NKVA 1DPFA 1NKTA 3BOSA 3CRRA 3GQBA 2QN6A 3E1SA 5JRJA 2B8TA 1CR0A 5E4FA 4D2IA 2FU5C 1QZXA 2BASA 1IN7A 2ORIA 5H70A 4JVLA 3KKNA 1COWD 5CMZA 1VMAA 4Q9KA 2BJWA 5H1YA 5JFGA 1DG1G 5DN6D 1YZGA 1PV4A 3U3MA 1OSNA 1IQPA 3L36A 1E0JA 1KO7A 5D3MA 2QMHA 2ZRIA 1HBWA 3T06B 2P6NA 2V7QA 3BRWD 3C5CA 2REBA 1NJFA 4KFUA 4JMPA 4F4IA 1XMSA 1GRNA 4OHXA 2A5GA 2IHBA 5L3QA 4FCTA 4TMTA 2NZ8A 2V9PA 4BWYA 3PEVA 3PR1A 2UKDA 1P2TA 5GVRA 5EXXA 2BMDA 2QT0A 4Q4AA 1XD8A 4GCZA 2VP6A 4FMTA 1YYCA 2NO7A 2IUSA 2YOHA 4RZ2A 1HQCA 3HJNA 2FDCA 4PC7A 2O8DB 4D0LB 4HUTA 4QJ3A 1W36D 1E2FA 3K0FA 5EJEA 2W83A 4I5SA 3BFVA 1J2JB 2OBLA 2XB4A 1KDOA 2ZAOA 3KTAA 1AS2A 2QMEA 4KCGA 3GLIA 2ZXUA 2PZEA 5GJVC 4GMXA 4NYJQ 4ZPXA 2IS6A 4BLPA 1EFRD 2ZR0A 4IDOA 4NCJA 1H8HA 4LV5B 3ZYCA 5KTYA 3AF0A 3CRMA 3NVAA 3M4YA 5DSZA 3S1AB 2X77A 4OHZA 1MH1A 4KSCA 2OBNA 3CWZA 1R0ZA 4F93B 2PX3A 3QJYA 1FNNA 1DELA 5DI3B 2JJ2D 5FOVA 5K8UA 2CEAA 3W5IA 1CRQA 1OH7A 1U2RA 1RVDA 3GLHA 3TAHA 2J0QA 2CL0X 2ERXA 3W34A 4YMVA 1UJ2A 4BLSA 5AVZB 1Z6AA 3EPJA 3LXRA 4LGMA 2NO0A 2JDID 1C1YA 3FTQA 3NH6A 1MO3A 3JZMA 4P31A 3TYYA 1QHYA 1JNYA 1RFLA 2ONKA 4NP6A 4OHWA 2FX3A 4WXPA 5J40A 3TSZA 3CUEF 4XVQA 5K8IA 3O8BA 2F43A 1Z6TA 4LHWA 2DR3A 3NBYC 5KYKA 2QL6A 1ZCAA 2ANBA 3FYHA 3V9PA 1RKBA 1E96A 3QG1A 3QBTA 4YQFA 5AUQA 1E2LA 3KUDA 1DO0A 4C7NB 1KK2A 4DSNA 1E2EA 2ZI7A 4TT3D 3RABA 1TPZA 3RS3A 2KBEA 1L7VC 4LJ7A 3EW9A 3I4LA 4NCIA 4HSEA 1G2CB 1ZNZA 3C41J 4M9ZA 5L3SB 3AP1A 1KKLA 3IGFA 5DNYB 3RS2A 2ZSEA 3X1ZA 5B30A 1IN8A 1YHNA 2W00A 4ESHA 5KNCA 2ZSFA 2R6FA 1CS4C 3CPHA 2FZLA 4DUGA 4R2IA 1NMXA 2JLWA 2XXAB 1HUQA 3DKPA 5CDFE 2BDTA 5CK5A 2J0UA
chains in the Genus database with same CATH superfamily
2F67A 2PWBA 4ZODA 1AJYA 1MQAA 4MR8A 4UUAA 5L4SA 3G0BA 2NR5A 3SJZA 3UATA 4D41A 5DGDA 3TFOA 5KKAA 4QGSA 3KS9A 2VF8A 3M4NA 3UMRA 3ROTA 4RFSA 2VK4A 2K9JB 3C85A 4F45A 5BSHA 2ZBVA 3CWBD 1FP4B 3ZH2A 1UP7A 2P4HX 3CLQA 1NP3A 4KLNA 2PXHA 4R7ZA 3HR8A 5LZ9A 4AQYO 2WTEA 1XVAA 2UVDA 1NVEA 2G07A 2XBUA 3FNRA 3W5UA 2P75A 4K3VA 1QQAA 5D3MB 4ZVRA 1YL7A 5DDIP 4DLTA 1RQUA 1SQSA 3MS2A 3RBXA 5A4FS 4R31A 4WFEA 3ABRB 3NHRA 1SCJA 1TJ4A 3FGNA 3UCEA 3LYUA 3W7SA 1Q14A 4U6NA 3SYLA 3FKSD 1NT2A 4JDPA 1N2CE 4F9TA 1YZYA 4H31A 5B2ZA 3U5ZB 2HN9A 1G2CA 4F5YA 1KMIY 2WT7A 1BVUA 2O52A 1WWKA 3UGKA 2WWHA 3EVNA 4XI9A 1WMAA 1D6SA 2D7DA 2CMGA 3LT0A 2KNCA 4LHZA 1QFMA 1BFDA 2A6PA 2YV2A 3AB8A 3D31A 4PSAA 1SXJA 4QLOA 1NG1A 4DLYA 1IZNB 1SKYE 2GTHA 3A1FA 5DI3A 1R37A 3NAQA 1WEHA 3OY7A 2ZBEA 5KHHA 4ZC1A 4MYSA 4A6DA 3UT6A 4Y99B 2GZRA 5HJ7A 4PQYA 2PA3A 3CCEP 3DTVA 4L5BA 5F9MA 4JZ2A 4G0OA 2BR5A 2HMSA 2P6OA 4N54A 3WKEA 3ANYB 3THXA 1W76A 3OZUA 1U7HA 1FW6A 1KOFA 4PI2A 2VDRB 1HYBA 1T4MA 4RH0A 4HYTB 2CV2A 5F35A 1VYTA 4XE5B 1NTZD 1FZGA 2OMKA 3GUCA 4LNAA 4WWHA 1CUFA 3TTVA 4DZZA 5JCPA 2HHCA 3H97A 3SR0A 1JR9A 1P0PA 3V1MA 1SVKA 2LCFA 4M3LA 4GVLA 4LRQA 1TKAA 4DJAA 3IIKA 4EI7A 4CW7A 1QR8A 5IJWA 2H4WA 3ORHA 4BFCA 3L73D 2BJHA 2OHHA 4EWLA 4PSDA 4PPYA 5DSXA 1GPWB 5IKOA 5HW0A 3NJ4A 2ZJSE 1CQXA 1AB6A 3OQIA 3WYNA 4LXUA 3TWOA 5BNTA 3EGEA 2O6HA 3ETCA 3IAOA 3M1IA 1SQVE 2BWJA 3U7EB 3GELA 1H2AS 2OGUA 4ZYXA 2G4LA 1Q6YA 1R6VA 1R27A 3FCEA 2WU4A 3B78A 3KOZA 3L04A 4BN4A 2WA2A 3COPA 3GEEA 1EG2A 3FNBA 3K15A 4E13A 4RZXA 2C7PA 2L42A 2BCCJ 2OMEA 4L27A 4U9HS 3B20A 5FAXA 4OH8B 1U81A 3GT3A 3U4AA 2I8CA 3IMCA 2HW8A 2YV1A 4PG7A 1P7VA 2B4YA 1U0FA 5AW2A 4TRJA 2HQBA 1G20A 2Y1KA 3WP0A 1DTEA 2DBYA 5K8TA 5LHHA 3E3MA 1NW6A 2ZAIA 1DAIA 1CUEA 3NCHA 2QJYC 4M49A 1X7ZB 3KJHA 3C48A 3F71A 3H86A 3WA6A 3FCAA 3GRFA 4BNNA 2P9GA 3UJDA 2ZNIA 3AW8A 3DXXA 4TLCA 4W1PA 1Z13A 3X1DA 1BJTA 2Z3VA 4G2TA 4A92A 4D99A 3HNRA 2DQ4A 4RZUA 2F6RA 1IK4A 4D6TH 2XNJA 4MKFA 1KKUA 3SYAA 3J80N 4TYMA 5H4HA 2BMWA 1RR6A 5TQVA 2HLDA 4NJEA 3TIVA 3CJQA 1NLYA 1DF4A 1WW8A 1Y7TA 3CGGA 3R6WA 4MPRA 3D64A 1DD3A 1MC4A 3DVSX 3RC9A 3ZQJA 3EDMA 3EZLA 2ZCUA 1JPUA 3GWOA 3EZGA 1Y9ZA 3T95A 5IN5A 3TZ6A 3OD5A 3ZU4A 5EMHA 3HFJA 4AW9A 4C2UA 1P5HA 2UYOA 3F5WC 1IHUA 2A06H 1AOXA 2VYND 4W9NC 3R5FA 1VCHA 1VKJA 3HLKA 2P22C 1JGTA 2VK1A 3PXBA 1HDYA 3STVA 3W8DA 5AW1B 5B1EA 1LW6E 1EE9A 3H1TA 1QGKB 1IY2A 2PBZA 3IXMA 3LAWA 3O73A 1F51E 4KYUA 4LF6B 2JGAA 2EILB 3FPAA 4LJ4A 5A9RA 1ITZA 1P19A 1QDEA 2B7CA 2P30A 4DLSA 1KB9F 1KB9D 1BJRE 3BTOA 3B8HA 3L2OB 1EDBA 3O83A 2JH9A 4WINA 4Z2AA 1UDXA 5AW7B 1XA4A 2FLVA 5BXQC 1EWTA 2OBFA 4R1QA 1O9HA 4XLLA 3IPYA 1FOSE 2BFFA 2D4HA 4IRUB 4NVRA 1BROA 4U9IS 2NUPB 3VNQA 4Z4GA 4GMGA 4RQTA 4BHTA 4UE6A 4LJLA 5BRAA 4Z1MD 4BWNA 1XRRA 1K5GA 3EIUA 4E5MA 1T2FA 3MCAA 1GGMA 4LY0A 3L18A 3TEFA 3VISA 3D8UA 3B2QA 2I1QA 3OC0A 2P2ZA 2DU8A 1T6XA 4N0PA 5DCLA 3A9CA 1AMNA 4IL6E 4MCJA 3O92A 1W7AA 5LD2B 1WKCA 2IOYA 1IM5A 2WFAA 2C42A 4QUHA 3RRNA 1TMKA 3UXYA 3TQOA 4QM7A 1GV1A 2ARHA 3VOBA 4W8HA 3U7FB 1O97D 4TKMA 4JI2O 2AC7A 3FFBA 4BUZA 4EKWA 4C43A 3LSUA 1KQLA 3BA6A 3OAAA 4BX3A 4ZCTA 2P9FA 1DP4A 1C7EA 3QWBA 2WVGA 2OKCA 4EPWA 4ZU6X 2V03A 5B4UA 2N46A 5AVVB 4BIZA 4DRXA 1MO4A 2MSEB 2OCDA 2QY9A 2ZJFA 3C6BA 3QY0A 4EK9A 3GLFA 3RCBA 2CF5A 1TU3F 3CVVA 3KVRA 2XYVA 1LPBB 2QUZA 1RADA 1IJFA 5H4GA 2WA4A 2FFAA 1I32A 3LCJA 1Z73A 2UUOA 4IMIB 4PYMA 1PP9D 1NMEA 3C4JA 5ILQA 4E2WA 4UOZA 5JYDA 4CH6A 2WZDA 4UCRA 4MYCA 3WK5A 2P8JA 2UYHA 5T67A 1T15A 3VXKA 1ENZA 4OBWA 2CYBA 3OTFA 3VDMA 1BX0A 3RVNA 1QL2A 4RVUA 5AHKA 3OUSA 1NVTA 1TYEB 4YBRA 3RIGA 4C4SA 4EJSC 4ETIA 3EA0A 1ST2A 2Q5EA 3R0ZA 4GZ6A 4WZBB 4PSKA 3KE9A 4DV4B 1CZQA 2VUSA 3A6EA 5KYUB 1JX9A 3IOEA 4LDPA 4MUGA 4GGMX 1XPUA 5J4KA 1MX3A 1P84H 2JJ1D 3AHHA 4PX5A 1LQ2A 1H0TB 3K04A 1KBOA 3K9NA 4LDZA 4UATA 5ALFA 4XCQA 1KO5A 4INJA 4IXWA 5IT9A 4J0HA 5LMNO 3D59A 2OFXA 1PN3A 2CWWA 3ZCTA 1ZUHA 4MS3A 1CNMA 4UVGA 4MIKA 2QQ5A 3NHPA 4UASA 3QGMA 5FR2A 1QZTA 2IT1A 3NHYA 5K03A 1OCRB 2QX6A 4TTIA 4Q00A 2KSJA 1IZ8A 3K71B 1XTZA 4IXMA 5LA6B 3D7MA 4OPMA 1H8EG 1IHDA 1HSOA 1LBQA 1VCNA 1WOMA 2GN4A 1RLUA 2Q5QA 3HB1A 3MTJA 3PUZA 1JT2A 2VPZA 1EFLA 5KKZB 2XTJA 3KT6A 4MUFA 2VDPB 5A2QN 3ZXYA 5JXGA 4MSWC 3AF1A 3F6CA 3HWRA 3SCZA 5ITVA 3PNQA 1EWRA 2PTHA 3U17A 2CSXA 1XN4A 4MYHA 4OYRA 1OLUA 1FYVA 1TCUA 2AXNA 1SG0A 2PV0A 3N0TA 1UQTA 3LP5A 2IKSA 5ICSA 1U7WA 1M0SA 1KQSU 4GE3A 1ORIA 2XVYA 4FYVA 3MFYA 1TPYA 4MJ3A 1L5HB 5B53A 4F3CA 1E61A 5J59A 3H75A 3OX1A 5HJ2A 4ML3A 4FOTA 3JR7A 3FXEA 1LNZA 3DPUA 1T4CA 1AI4A 3ASOB 4WOJA 5SZJA 2E74B 1K88A 4B45A 4DLZA 1U9CA 2EJCA 4U7OA 4JDUA 3K0AA 3PKIA 5LGNA 1KZYC 3F8TA 1NU1H 4N23A 3CC2V 4DMMA 1SK8A 1E69A 1F06A 1GAEO 3OEHG 3CUVA 3H6KA 2EJTA 4K9KA 2QMOA 4Z0HO 3QU5A 4IIJA 4ZIBA 4HAMA 2ZJBA 5LYJF 2H59A 2SHKA 4MVZA 1CY4A 2XV1A 2DFLA 3EPRA 1P7BA 1MDFA 4JTAB 4HH2A 1BXZA 1OU0A 1SH7A 2W8BB 5ULLA 3S28A 4CQMB 5LJLA 3SE0A 4XVUA 2EQ5A 1VDZA 2ZB7A 3V4VB 3LUTB 2R6GA 4CIYA 3GJ5A 1LPMA 2E6KA 3CUYA 1VF6C 2Q29A 1FVOA 4X6LA 1AZWA 3NXSA 1FNDA 1PL7A 4FFBB 5TF4A 4NMWA 4UEOA 1CFZA 1Q17A 3O84A 5B58T 3LQRA 3WWPA 2YMYA 2D4AA 2QRMA 2WM3A 2BCCE 1ZMXA 2AMFA 2QP9X 3QKRA 3L79A 1J6UA 4P7JA 5BOSA 3HJHA 3SP1A 3BQMB 5SYNA 4BNKA 3NG1A 3BMOB 2FV8A 4KQFA 4Q82A 3EZ2A 1MPXA 5CN0A 1VQ1A 3AU8A 3MZWB 5EZQA 3GIDA 4NS1A 1W581 4Z5XA 2R79A 1K6MA 4Q3OA 3ZDRA 4G1FA 4AMZA 4Z3KA 1JM0A 4R8CA 4WAUA 4YK7A 1NW8A 4BBJA 4V0KA 3WB9A 3Q1LA 4CH5A 1SZXA 1L7EA 3NWJA 2VQEB 3FHLA 5JSZB 5AW9A 2OCGA 1E2DA 4IS2A 2BEVA 2KNCB 1QWOA 2Z98A 3W4IA 4PNPA 5L6LB 1IH8A 3K0CC 3CCSV 3L8CA 3HEBA 1Q44A 5FP0A 2ZW9A 2SECE 4F4CA 3EDOA 5L3GA 4PANA 3ZBQA 3NXKA 2R9IA 2YNMC 1GMJA 3C6XA 3QX8A 1KYZA 1TEVA 4GVXA 4UMDA 2J7PD 4Y2TA 1Z5WA 1JIKA 3MUOA 1T4BA 4I5IA 4CLHA 2V58A 3EYWA 5AUPB 1DEAA 5LPNA 3DV2A 3P9IA 1OFTA 1HLDA 1UK9A 3EAFA 1HE3A 5LQNA 1JOCA 4YPFA 2VF4X 1J9ZA 4ZDWA 2D1QA 1JJOA 4RM3A 3SEQA 5I01A 1X86B 1GM9A 3QVKA 1RKUA 2GPBA 4XFKA 1IOLA 2JGUA 3JQQA 1YF2A 3L49A 4KEAA 2YI8A 2RAVA 2X76A 4WKBA 5BQ5A 2GSMB 3WDSA 4YUAA 2Q5FA 2ZOSA 3I2KA 1UOPA 3LXUX 3PC6A 3U49A 4TZ0A 1HYQA 2XE6A 3L7LA 3H1GA 4EHHA 3U6BA 1TU0A 3QIVA 2R9RB 1QCYA 5L7YA 2IWHA 3STHA 2KZIA 3CSSA 2IGTA 3TGUG 3F73A 4Y3UA 4BMVA 1JWLA 2IYPA 2YHIA 5JCJA 3QYAA 2V45A 5E2IA 3U7HB 3KIPA 4DR7B 2GWRA 3AJEA 3EH2A 4PAWA 1UZUA 1QH1B 2VI5A 1FSGA 4PS0A 4HKZH 3JTMA 1X6VA 1T8WA 3VHRA 3IXQA 5LXTA 4P9PA 2HF8A 4F3YA 1NYQA 2XDQB 3VTZA 1XOUA 5JO9A 8GPBA 1JU9A 5IJAA 1BYIA 3ZGOA 4FOOA 2DLNA 1KDZA 4CR7A 3CTPA 1D1PA 5JT1A 5AVSA 5AMXA 5G1PA 2AJTA 4LHSA 4KC0A 2GF2A 2Q67A 5CMUA 3FLMA 4FMDB 3L1KA 3SVZA 3RLFA 3EF1A 3AM5A 3OE7G 4PAOA 3UUFA 1Y3CE 4QRHA 4EJ2A 3WB1A 4JZKA 1P6UA 3E8GA 1M2HA 1YU9A 4ND1A 4XYEA 4C4OA 4EQZA 1W73A 3DHVA 4C4YA 3OA7A 5JOQA 3RVPA 4NV0A 4Q18A 2K7FA 5GPBA 3FOZA 1CEZA 2VKTA 3DDNA 2DGDA 1BHJA 2ORED 3CH5A 3ESQA 4L51A 4EP1A 4YUXA 3BPZA 1NN3A 4ZYLA 3QXCA 3PFBA 4K88A 4WY2A 4Y0NA 4DZRA 5KWSA 1QJ4A 4ZKDA 1BS1A 4Z4QA 3KTFA 1AJEA 1RCFA 1VLQA 4KQXA 2QE7G 5CJ0A 4UUBA 4DA6A 2ZVJA 4GQAA 2ZRBA 4CU5A 5FPKA 4DZOA 3CG0A 3MHTA 4L9AA 3FTFA 3NDPA 2UXDB 5AVKA 2ONYA 5J43A 2GCNA 1Z8HA 4NKGB 2V7WA 1NPYA 3KWFA 3A04A 2ZI9A 2NO5A 1YFZA 2Y99A 3S55A 4ARAA 1VSUA 4KXNA 1BS2A 1D8TA 4XSGA 1E6LA 2HPCB 4QA9A 5AW1A 1G38A 4EFEA 3SDSA 1XREA 3JC22 5KKZC 2L6LA 3CUWA 3A0RA 4HFJA 5F7ZA 4CFYA 5K8CA 4JASB 1NDUA 1J99A 3CEJA 1KSFX 1AR5A 4X1KA 1XTBA 2XIQA 3FWYA 4I4IA 2XHBA 1CQIA 1NZ6A 1QRRA 4DMLA 3HXMA 2B35A 3G8BA 2UZ4A 3OEED 3NATA 1VJ0A 1R3KC 4Q9JA 3T7KA 5IZCA 4GBMA 3JD2A 4BIOA 2ISCA 4F0JA 3HYTA 1MKMA 1TO6A 2TRSB 1WETA 3PE4A 1A95A 2CNWA 3ZNQA 1QLWA 5EBMC 4ZOLF 2EKBA 2DEUA 2VZEA 4Y99C 3CZMA 2WMYA 4KXRA 2Q27A 4X65O 5CEEA 3LQQA 5CA1B 2JFWA 3I64A 2PX6A 3LS2A 2BFWA 2XMBA 1HE4A 4JFAA 1IFIA 5FA6A 3WNZA 3ANLA 1Q0RA 3PWTA 3CF0A 1ACMA 5EFOA 4EELA 5KHAA 4EQ6A 2BUCA 5KJ6A 3CNHA 2Z4TA 1M83A 4LNUB 2F1RA 3FCXA 3MJFA 3AEEC 2W98A 4S1NA 2IK8A 1CS0B 3TCKA 2OCXA 2QL9A 2RHRA 2D2IA 1JB9A 1D5WA 2JA2A 1SQVK 2WD8A 2RBKA 3EVFA 3GA7A 4Y9SA 4WEOA 4BGIA 2ECQA 3LW5H 2IEIA 2PJDA 3AEXA 1QLEB 1NX6A 4JP5A 2B0JA 1OYYA 4CCSA 4HDKA 1CZHA 3AVVA 1VCIA 3V4FA 1FUUA 3WNBA 2BM9A 3H2GA 5A2GA 5FLXA 5IN4A 2IJJA 3A3YB 1TU4A 3QUSA 5IEJA 3BIOA 5AT1A 1CR4A 4KUMA 4QFCA 4XIFA 2KXPB 1CULC 3R5SA 1P4GA 3NIGB 4Q7KA 4S05A 1K5PA 1RAFA 3HV0A 3EF3A 3COZA 3PFKA 4U02A 2PD6A 1YUMA 1OJ7A 1XZBA 3AG2C 1L4GA 4M4SA 1DIBA 3FMOB 3RBZA 1HKHA 4HTFB 4W8OA 3NU1A 5DK4A 1COZA 3PC3A 5JQGA 1MX1A 5JWPA 1LZLA 4HXYA 1M7LA 4LE0A 4AN4A 3QWOC 5CCBA 4LXTA 1MC5A 3W1VA 3QVWA 4NJMA 4U3FG 3UG6A 3V7YA 4BX2A 1XJ0A 3I2YX 4Q1VA 5DKFA 5ECGC 5ER6A 2BBTA 2A3NA 5C8DA 3B9PA 1RWBA 5FD8A 2FB9A 5F2NA 3HWX1 2C4MA 2NXJA 2VNIA 3FR7A 3DULA 4W6ZA 3KKMA 4FE3A 4C7JA 5IX8A 4O2AF 8ABPA 2PZFA 4O4JA 3LJKA 1F9AA 1K04A 2EILC 4RF4A 4ZMDA 2WPSA 2WIBA 1H1LB 1IJKA 5DV9A 3FX7A 3F9IA 4IL6Z 1GN8A 3P2EA 2CXOA 3ROQA 3LBHA 3JAWA 5JTTA 1I0HA 3DC6A 1UC9A 2A9QA 5ENVA 1RW4A 4BNVA 4YAWA 4NK4A 1CSBA 4C07A 4NRDA 3SK0A 3BMNA 3IQGX 4PA3A 5JJBA 3HBFA 3QNEA 1FJKA 1GRJA 3K5MA 1JDTA 3FGPA 4UB6H 3QK7A 3LXMA 1SHZA 3MTDA 4IXDA 2VTEA 3MSCA 3NB0A 2VZLA 4WVFA 3RK0A 1I36A 4C1NA 3D5QA 5LFAA 1TC1A 4DSZA 5L4LA 4P5PA 3S4YA 4L73A 1A4RA 1NKZB 1KI2A 2Z6VA 1XRSB 2YR0A 3P2KA 4D79A 2ZYSA 4BLOA 3D7NA 2RHJA 1N86A 4JU8A 1NTZK 2OYIC 3HBJA 4DQDA 2NSLA 3T4ZA 4EJSA 1H9AA 1AA9A 4AAYA 3KG2A 3IDZA 3PFGA 4QMAA 1SBZA 1PK8A 1RWNA 1SCKA 2WWFA 1XDWA 2Y9ZA 2WVAA 2X0NA 2QA4V 3CQ9A 3NHWA 3OD1A 3Q6MA 4NPDA 2XNHA 3S5JA 3VZDA 4BASA 1ZONA 5BSKA 5ED4A 4GSKA 1K7FB 2WT9A 4LMBA 4RL4A 5M29A 1ZXBA 1S5LX 3U56A 4MHTA 4GWLA 1TCCA 2HD4A 1WEKA 3C3EA 3G9XA 1HURA 4HRAA 4IEEA 4JT2A 2WD7A 1P74A 3HY3A 4H7FA 1L4AB 3VO2A 3GQVA 4K1LA 4CH3A 3CRNA 4KP7A 4R71A 5KO2A 3RYIB 2OB2A 1UL1X 5AJWA 3K2EA 3BMCB 4MV9A 4CTJA 3T3EA 1KKDA 4L8WB 1UK8A 1U5BA 4X61A 3ZDFA 5BPHA 3JVEA 2BCGY 2XKKA 2OBXA 2A3RA 1ZJYA 3V4SA 3C3MA 1SCUB 5K3DA 1TQ8A 4DQXA 3SVTA 4B83A 4IINA 4R5HA 4LFAO 3LRPA 3SFZA 5BW8A 4EUHA 3WLOA 3P8MC 3G0CA 4M1QA 3PDCA 2KW5A 2FW8A 1SQPK 4DO2A 1RFYA 4QGAA 1EC5A 5HUHA 3H1JE 4MDEA 3OZAA 3TIFA 1LF0A 1FVXA 3DPIA 4JQCA 3BHPA 2UUCO 4DCTA 1M2WA 2E89A 1KILA 5HGXA 4PYLA 1LI4A 1PM9A 2B37A 1YTFD 2R7LA 3GLKA 3UHJA 3W2HA 2HJHA 2IA5A 3EULA 5K5EA 5KYTA 2HYIC 2VUTA 5FV7A 4EMTA 5K0CA 4O1IA 7ABPA 2GKGA 4XWWA 1F3OA 1IM2A 1UQRA 4J0GA 4GM1A 3SF8A 1NU8A 2CGNA 1L4AD 1QKJA 1JQ0A 4Y2SA 1EVYA 2A94A 4ND8B 4OHVA 5H9WA 1CJVC 2O5RA 4CG1A 1M1JA 5A71A 2OSBA 5FL7A 3REGA 2GA8A 3D6AA 3MTBA 3OZXA 4LP8A 3FFAA 5KYXB 1YDXA 3KB8A 5J47A 1XN1A 1E18A 2XITA 1KZUB 2C9LY 3QBJA 4HOYA 5IE9A 1VRCA 3EGXA 5BN4B 1P91A 3JYQA 3U1VA 5CB6A 3C8ZA 4YJ3A 3HLYA 2HRBA 3RADC 4WFAV 1U7JA 4BBPA 4EZBA 1VPDA 1QO7A 2HV9A 3ESCA 4UFZA 5TRTA 3HWSA 1YZFA 4R01A 1JLMA 2Z3ZA 3V80A 2IFMA 5J3JA 4P86A 3SJBA 3NLLA 4WKOA 3AVTA 1ULUA 1N0JA 3FWPA 3Q5GA 1CDZA 2H85A 4NPEA 2XWPA 4IJ6A 3WUVA 4IW3B 1AV7A 3KQMA 4O4IA 4NXNB 4RVCA 2FXVA 4H33A 4X62B 1K8AW 2AXPA 2NGRA 4I1UA 4O2BF 3T4EA 3V7UA 2B98A 3MB8A 4UHHA 5CVVA 4V1CA 3RQSA 3OJOA 4BNDB 1I3MA 2EGHA 2YL2A 1Z5NA 4AP9A 3OTGA 3HE5B 1GLVA 3V1UA 2N1TC 1J2TA 2WPDG 1I30A 2A1UB 2W6MA 2ZI6A 1ZD1A 1B3RA 3RYFA 2BH9A 3I9NA 1UQUA 5TB5A 5U4QA 3S1KA 1LV7A 1U8ZA 1AHNA 1BDHA 1A0OA 1L1QA 2OZLB 3KZIE 2R2AA 3E81A 2ZKLA 1CY2A 1CQWA 3AUAA 6PFKA 5B1AB 4QJIA 4UU8A 3H99A 3CGWA 1O5TA 2GPAA 4MB0A 3N39C 3UBMA 3TFQA 2YINC 3LM8A 2FCAA 1YJXA 821PA 1DJQA 4BO4A 1XD2A 2IQ5A 3MWJA 3Q12A 3SYMA 1E7MA 1V3UA 2NM0A 2Q0AA 3DZHA 3GEPA 4CZ2A 2J5QA 3PEYA 2P90A 1G63A 4M7WA 2HK8A 2JZNA 1KMCA 1H0HA 2AG6A 2JGIA 3CCRP 5THKA 4C6TA 2QE7D 1HLGA 4I46A 1QZZA 2C77A 1Q0UA 1RACA 1NUPA 3A5TA 3TRHA 1J23A 2QJWA 1WXDA 1E2MA 3L7BA 5IYBO 1NH2B 4QBKA 3E15A 1IL0A 2JFYA 3PXAA 4CF6A 1HDGO 4Q7EA 1SJ9A 4I5EA 3HVJA 1SERA 3PYLA 2YOGA 3H5IA 2WPVB 1ZNWA 5T3UA 3SN6A 3X2QC 1RJDA 3IAS6 2R00A 3T7CA 4ZDIA 2FWRA 2OA0A 3THYB 1GXSB 1S2OA 3PA8A 5REQB 3HUSA 4F06A 4GUDA 2Y8EA 3QJGA 2TSYB 2YO2A 4KGXA 1NKNA 1M1YE 4JYCA 1GQSA 1GEEA 3EIHA 1KE1A 2PAJA 5A05A 3PHJA 4ZVTA 2AXTE 3KOWA 1FJPA 2HF2A 4P38A 4OEHA 3KZOA 4FYYA 4PBSA 3STWA 1HQYE 4RDXA 2GAAA 4NE9A 3HGTA 1TUIA 3SSMA 3PLRA 1SXJC 2PPVA 3HXTA 3EOAI 3NVKI 3CC2P 4DLWA 5GM2A 1YGPA 3I9FA 3OICA 4D0SA 4B8YA 4J7AA 3QBDA 3THXB 4ZI2A 1ZX3A 2QUKA 1R73A 3UAYA 4AECA 4E4YA 3UNXA 5CDTA 1EFUA 3L8ZA 2XCIA 1VL6A 3LOUA 3KYCB 3OEHD 3O5AA 5FL3A 5IG2A 5KBYA 3N8GA 4WLEA 2HHAA 5AOVA 4DC1A 5GIOE 4UBNA 4X20B 5AK3A 3H1LG 2JZCA 1YK1A 3SGIA 4Y2PA 4F9EA 4D9KA 2FFDC 3PTAA 1JU3A 4XQEA 2CD7A 1ZLYA 1VQ7P 4LISA 4P4NA 4BVEA 3ZHTA 1UJWB 2ZR2A 1MOSA 2DWQA 3WJ1A 4ZYUA 3SIPA 4EVIA 2PXAA 4ND2A 2K9PA 2FWNA 1WAZA 1I3OA 3UJAA 1OIXA 5JECA 4G8DA 2RK3A 3AWDA 4L0MA 4S0ZA 5LWHA 1RHRA 1Y7LA 3E0XA 1QU3A 1S3FA 3L8FA 1MJFA 2Q7CA 7REQA 5HKBA 5B1NA 2QX4A 5F5LA 2D1TA 5TC4A 1YCDA 2QM3A 3LGAA 4TL9A 3ZGNA 4JOCA 1JVBA 1ORTA 1X8XA 4ZEXA 3RANA 1KY4A 5TT0A 3RC7A 1HV8A 1X92A 3A6HA 2W6ID 4EFLA 4LOAA 4EGAA 4E08A 5B4TA 3ZWBA 1V9CA 4PCVA 1U0JA 4E88A 5I4IA 1IUNA 1QE0A 2FMTA 5DP2A 1U2PA 2MWMA 3O47A 1WT6A 3U1AA 1N73A 4DHEA 4I50B 1NBMA 1LKZA 2ECFA 5KLVJ 1A9ZA 4GX1A 5B7GA 3LVRE 3AI3A 4N0EA 1RIIA 2Q2WA 3CINA 3GLRA 1JKIA 3PFFA 3S29A 3Q8XB 4C5CA 1YCIA 4MVRA 1DTSA 1F0KA 1GT91 4B4DA 1NBEA 5F9FA 1F7YA 5J9PC 5CFLA 2BTQB 5JY1A 1ABEA 1M57B 1IAQA 3ZBTA 3SKYA 5GZ6A 1TEHA 1ZRMA 4KQ1A 1LS1A 4LXYA 4YIHA 3KJIA 2WTBA 1U28A 1YNOA 4TYNA 5BV8A 2ZR7A 2O01J 4MA5A 1R0LA 1FSPA 4KO1S 2QX7A 2JJLA 1S2MA 1XMQO 3VYRB 1XILA 5HILA 4LF6O 4JELA 4RLHA 5AUOB 1BGYE 2VDOB 1JZSA 4AKEA 2NPSD 3VSCA 1ZRNA 1X0TA 4DDVA 1LX7A 4LQCA 3CPWU 1X74A 2OQVA 2WDZA 3DE0X 3NOQA 2O0HA 1R4MB 2EATA 2QKYA 4IDGA 3DEAA 5K4AA 4ABYA 4J16A 4E7OA 5FO1A 2E4WA 2R1ZA 4L3OA 2RGCA 2JLYA 3UK2A 2OLEA 2R8OA 1ISMA 5EVCA 1TECE 4W4LA 4ZT3A 3HU5A 4HZIA 2G9ZA 1F7UA 1BN7A 2R66A 2JEYA 4WACA 4K9OA 5FH9A 1GA6A 2ADFA 2HF9A 1G8HA 2Q4EA 1SC3A 1SOUA 1GPYA 1ZW6A 4WOKA 3TFWA 1SOMA 5KYVA 3P19A 4ZKEA 3U60B 4TXJA 1PEYA 1RYZA 4GZ5A 2JC3A 2IPLA 2HT1A 4QTXA 4UCTA 2BCCD 5F3DA 4QYWA 3M33A 3LCRA 3I32A 3Q3JB 1YITV 1YH3A 4TWBA 3IKVA 1V8BA 1E7YA 5AKEA 3OIVA 4COOA 5L95A 1CJBA 2GZDA 2E76C 1E89A 3MINB 4MRSA 3G2QA 1NOKA 4BQFA 2GA1A 3F5SA 1MIOA 2RJZA 1I0LA 2DULA 2WE7A 4I4LA 4NU0A 5ES3A 1NJSA 1QX4A 1YQEA 4E46A 4EF6A 1BDCA 2FE4A 3WB0A 1PP4A 1NTMJ 1TZJA 1UPTA 2ADMA 2B61A 1OJHA 2OD9A 1TRKA 2CWDA 4H0CA 3EZXA 1CUSA 1GGJA 4INPA 4UHCA 3S70A 2VF5X 1T3HA 1GEGA 4J7KA 2AN4A 3ELWA 2YEVB 3H1EA 3IX7A 3M6IA 4IDNA 4QBHA 4KR9A 2A57A 4ENWA 3H2IA 3RE1A 3FVTA 4UTPA 4DA4A 3I34X 1X15A 1O0BA 3TIGA 2V5VA 3D7LA 2VHJA 3IIIA 3PQ8A 3RIHA 1G20E 2J3LA 1Q7BA 4KVGA 2I7CA 1F2DA 2Z0AA 1RPTA 1VI2A 3JALA 3ZDZB 3SZLA 3F97A 3R3UA 1QBZA 2ODNA 5APTA 2B83A 1DC6A 2NZYA 5ALZA 5H16A 4C21A 1EQUA 1CW2B 1V37A 2HGZA 1ONNA 1KB9E 2K88A 2PH3A 3WHKA 4DY4A 5JXHA 1IAVA 1ZCZA 2AXQA 3F67A 4BQQA 3C3JA 2WFZA 1S5LE 1OCCB 2N05A 1Y6JA 1DMRA 1LVHA 4J11A 1J5PA 2PN1A 1HNWB 2WF5A 2XWQA 1Y48E 2A1TR 4KYIB 1KXZA 2P6RA 1QVVA 4AK9A 3F6BX 3PHGA 5IJ0A 1QHHB 1XU7A 3C7AA 5LQDA 4PZLA 4UUOA 3WK8A 2G0AA 3N1UA 4XEUA 3BWYA 4RD0A 2WLTA 2GCGA 5CJ4A 3MWGA 2WYWA 5CDFE 4QOHA 3UO8B 4BMNA 2GAFA 1IDOA 2O7RA 3EVEA 3GFVA 4R81A 3N6VA 1OAOA 1PS0A 2R8PA 1UBJS 2VS0A 2YKQA 4RTQA 1VGRA 4FFBA 2A9PA 5GJWC 1ENYA 2I66A 1R4AA 1YZNA 2CXUA 1ONPA 4H7IA 4REQB 4WK0B 2QJYB 4D9JA 2CBZA 4EOGA 1Z9BA 1GCAA 1OGJA 3I6BA 5A2QA 1M9NA 2ATKC 1ZD5A 4MI1A 3EFGA 1EB8A 2PKQO 1EFRG 3DF7A 3ZKWB 3SC4A 2P4EA 3FOEC 2EIKB 1B06A 2D06A 2L18A 2IBZH 2PWZA 3HO6A 5D01A 2H92A 4C7MA 1RYYA 3ZDBA 4IIGA 5H9VA 2ZR3A 1DEHA 1JECA 2RGNA 1ESZA 4PFJA 5TGTA 4GOEA 1IBRA 3CNLA 3PITA 3LKBA 4H15A 4YP6A 3B8MA 3HKBA 3ZS8C 1U8AA 3OCYA 5CAEA 2O2EA 4BYMA 4HYYA 3CB2A 3EWKA 1KEKA 4AQYB 4LI0A 2IOFK 3SZUA 3AJ9A 2QLLA 3I1YA 5LMUO 2CZGA 2J3HA 3IPLA 1ZH0A 4IV8A 3DMHA 3ND7A 5CPBA 5HMLA 1GRCA 2MMGA 3AG1B 1XCMA 2C2KA 2QPTA 4NTXA 3M4ZA 4XQCA 5FADA 4UVDA 1Q2NA 2B5WA 1I7DA 4TTSA 1L5OA 1SHTX 1C0LA 3L7NA 5DTMA 2EIJC 5FPOA 2OV4A 1A71A 3GA0A 1X9HA 2XT0A 3CF4A 3MTGA 4WLVA 1SBYA 3I04A 1VSVA 1P9NA 2JZOA 3IHWA 4ND8A 2PMKA 3B9QA 4BZWA 5DYNA 4HUQB 2I03A 4EEKA 1C8KA 2Q1XA 1O94D 1LT1A 3KCQA 4AS2A 3G9UA 4B3SO 3ET4A 4KV9A 4C01A 1OCZC 2CDAA 4ZN6A 1BVHA 1YL6A 4J1QA 3C1TA 2GD6A 5F7OA 4ALKA 1X1EA 2JIOA 3A1TA 3BJMA 2QE7A 2XX3A 3EZ7A 3CZ5A 1DKUA 3H16A 1KRWA 4KNWA 1EDOA 3KOYA 4XB6B 4NS4A 5JEEA 2ZM6O 2OYOA 2OYCA 4BGDA 4TGLA 1MOZA 4KR2A 2J3DA 1E6MA 2CJYA 4YCJA 1L3CA 4FJCC 5KAFH 4IIJF 4DC0A 4CIBA 1GZLA 5ENZA 5LCXA 4FTWA 3FB1A 4CMEA 1FAFA 3IKJA 4HWPA 2BRUA 4IAOA 4RDIA 4CG2A 4MQMA 4CQLB 4EPXA 2VH5R 4CUZA 1NW7A 3L75G 1R88A 3IA7A 5IWCA 2AFVA 4HVCA 2FPUA 2DUUA 4XA4A 4CC6A 4ZZ1A 4G9BA 3CRAA 1VQPV 3U44A