2QM7A

Meab, a bacterial homolog of mmaa, bound to gdp
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
323
structure length
314
Chain Sequence
LPDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPGAGDELQGIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and mutagenesis of the metallochaperone MeaB: insight into the causes of methylmalonic aciduria.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Chaperone
molecule keywords GTPase/ATPase
total genus 121
structure length 314
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2qm7A03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2qm7A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qm7A02
3OE7A 3SYLA 4RSGA 4Q4LA 1P61B 3LNCA 2JLQA 1OFTA 2GCOA 2QNRA 4DBLC 4IEEA 3U61B 1OXZA 1J7KA 3PITA 3L0PA 2XXAB 3K70D 1GTWA 1TQDA 2W6ID 4MKFA 4A8JB 3GEEA 3WY9A 1R0ZA 4JLDA 1I4TD 4PFSA 1T2KD 4HZUA 4TYPA 1TUEA 1P9NA 2J46A 4C0QC 3UIAA 2H16A 2P2LA 2V54A 4I5SA 1G7CA 1NBME 3CWZA 4WZ6A 2UZ3A 3EIQA 4QBFA 1US8B 2YOFA 5FBWB 3SI7A 3MLEA 1D5CA 4OI2A 3IDQA 2QN6A 2OE2A 4DLRA 2XTMA 2JLRA 4F7WA 1KAGA 3OIVA 4BASA 4HSEA 1NMYA 4LJ9A 3T35A 3AUYA 4RD1A 2D7CA 1G64A 4Z1MA 1Q1BA 3OIWA 2PLFA 1DOAA 1NIJA 4V0OA 4NCHA 3OFND 1FW6A 3K9LA 1AZTA 1OXTA 2IT1A 3QKUA 1A1VA 1KK1A 1YYCA 3QXJA 4HB0A 3U5ZB 5FFMA 5B57C 4MTXA 1MOZA 4OK5A 5B30A 2O0KA 2B7CA 5E7IA 1G8PA 3TUIC 3WMEA 3L2OB 5K8IA 2NPIA 4B74A 5KDOA 2XNSA 3VR6A 3KKNA 4AYCA 1IBRA 4D25A 4XE5B 4GNKA 3BB3A 3LRPA 2ONJA 1G8YA 3HWSA 4RZXA 5AVXB 3B82A 3AF4A 1CEEA 2C9CA 2HT6A 4B44A 4LYJA 4B6EA 2FU5C 3GLIB 4ACAA 3VKHA 2FF7A 3M9HA 2IHYA 2JCSA 1JNYA 1QHIA 4CEJA 5BYKA 5FTJA 4Y0VA 4DLSA 4ESVA 3AF3A 4HAVA 5UKDA 2WJHA 3QG1A 4ARZB 4Q66C 4A2PA 2HXSA 4A2QA 1FX0B 5TV2A 4NYJQ 2QGZA 1BH2A 3HU3A 1NN3A 4OL0A 2NO1A 2C99A 3DM5A 1ANKA 2XNDD 1J90A 4PQFA 4AI6A 2HV8A 1SVIA 4QGFA 3SU8A 1BOFA 1E1RD 5H70A 1S4QA 1DTSA 1AQUA 3NTNA 2DBYA 3RVBA 1UADA 1EFHA 4B71A 4OQNA 5C2JB 3AKYA 3LBHA 1Q20A 1GOTA 2KWIA 1N5IA 4XIGS 1JAIA 1XPRA 4QHTA 5H68A 4OI1A 3SQWA 3VHXA 4IDHA 4QHYA 3CH4B 3WMGA 4A9AA 4BQSA 2DR3A 3RSLA 2DCUA 2YWFA 4X8OA 4HB3A 3WBJA 3ZRVA 1FNNA 1NKSA 4WW0A 4D6PA 3THYA 3QVUA 1QVAA 2XJ9A 1ZUIA 2ZJYA 2ZYWX 2P67A 1MUUA 1P62B 3QNUA 2OCPA 2CDNA 3V4RA 5JJIA 5DHAA 2VRSA 5CDFE 2A30A 1T6NA 1VMAA 2N42A 4NPHA 4TL6A 1L7VC 2GJ9A 3SEAA 4IJMA 4A0GA 1OIWA 5HZKA 4AIIA 4JVMA 2EFHB 2R65A 4BUJA 1F2UB 3KB2A 1YKSA 4QBIA 2IWRA 4EJSB 1LS1A 4TTRA 1JUNA 3TYYA 2DFTA 1GKIA 5CITA 4IOJA 1XMVA 4BLOA 5AVTB 4Q48A 2FSHA 4DCSA 2ZS7A 3RRMA 1C4OA 2ZRKA 4KLZA 1NLZA 3ZLJA 1ESNA 3LBIA 4GZMA 4DRZA 3LLMA 4L16A 4PZLA 4LCBA 1Z2AA 2WKQA 3PVSA 1LW7A 1XXHB 4NH0A 1JPJA 2ZI7A 4TL9A 4TSFA 4V0NA 4CW7A 4YXWD 2KI5A 1OXUA 3FHCB 3IEUA 5KPDA 1F51A 1P9WA 2CK3A 5FI1B 4R71A 4C3ZA 4YDHB 4C0KA 4MRSA 3FKQA 2CCJA 3CPHA 5K8LA 2JJ2D 4L8GA 2QM8A 3KFVA 1QHSA 2HEIA 2Q3MA 4XVQA 5FBQB 5EE1A 2PZEA 1L2TA 4JYCA 1ELOA 3LH5A 4MGYR 2C5LA 1ZC4A 1BYIA 1G16A 1GU5A 3X1YA 4JLOA 2VEDA 5EUMA 4FWIB 2ZREA 1XBTA 1VIAA 1EG7A 2OILA 4KFRA 2REOA 4ZKIA 4BIZA 1DEKA 2DWQA 3KJGA 3NH9A 3A8TA 3UMFA 2XZPA 3A37A 2AWOA 3KJHA 2GCOB 5CK5A 1WMSA 3I5CA 1HY3A 2CBZA 3AB3A 4PAQA 1Q3TA 2IYUA 2AFHE 4Q19A 2ZM5A 2V9PA 1SVLA 2PEYA 4EFLA 3PR1A 3HE4A 2IYLD 4NYIR 1AIPA 4Q1CA 3DOFA 4DUGD 4A15A 2ONKA 3NWJA 4OK3A 1M34E 1SQ5A 1NF3A 3U3RA 3R7WB 1T2KC 2WJJA 3L8YA 4M1OA 2ZE6A 3B85A 4PPFA 4KFUA 2GXQA 5GJCA 3T5GA 1S96A 1RRPA 4EOTA 1KJWA 1UEIA 4PHFA 4EQ6A 1E2PA 1YR9A 1P3JA 4IDNA 5C4MA 1CP2A 1EFRD 2W6AA 1E96A 1F2TA 1OYWA 1GL7A 1Q0UA 3LDAA 4MUAA 1CSBA 8OHMA 4TT3A 2YC2C 2YOGA 4QL3A 4G5QA 2I1VB 5DYIA 4MGKR 2DFNA 2N1BA 1GZSA 3N5CA 5FI0B 4BZQA 3CRVA 4LJ5A 3PUZA 4QXAA 5DN6A 4TMKA 1LF0A 2ZI3A 2GZHA 4JLPA 3CR7A 4M9QA 4FMCF 2AN9A 2D3WA 1OHHD 4YMWA 3P4XA 1ZM4A 1TUIA 3NKVA 4LJ4A 1MR3F 2AK3A 5LB4A 3VAAA 3THOA 3JZMA 3WBKA 1Q21A 5H8WA 1JALA 4C46A 4C0LA 4KHXA 2WJYA 1U2RA 5BYJA 1D2NA 3R20A 4XH9B 1KO4A 3LX5A 5AK0A 2VP4A 4YMTA 1RFLA 4PQYA 2F7SA 4A0HA 3DMNA 4AG5A 2O8EB 4Q02A 2A5GA 2OFOA 1ZD1A 1E9BA 1KKMA 4FMDF 4TLAA 4B76A 3RRNA 4DZZA 1X8LA 4BLTA 5J4YA 3IHWA 4LSGA 2F55A 1H8AA 5FOTA 5CLQA 2FMXA 5CIWA 1DO2A 3FHTA 1EGAA 2BOVA 4GOJA 2NO7A 3K0EA 2YWEA 4X8LA 4LHWA 5DISB 1K5DA 3A0RA 3ZDQA 4A1FA 3DEFA 1OPXA 1COWA 2O5VA 3CPEA 1G5PA 4LHYA 3NC0C 1A82A 3H86A 4E03A 3PEYA 3NVAA 2CHQA 4CVNA 3QXCA 4M9XA 1P75A 3NIBA 5FOXA 4GKGA 5APUA 4FW9A 2Z4RA 3ZJYA 1II9A 1G3RA 2PCJA 1EFRA 1X8KA 1Q57A 4KHZA 5FTLA 5ELXA 4MH0R 3H1TA 1NJGA 4O2RA 3SDZA 4DLTA 2Q9BA 4XSGA 3CB4A 3ZIAA 2ZANA 4PSVA 4UKDA 1QVRA 2AXPA 2XV5A 1QBKC 4HAZA 4ITRC 3E2IA 2EWWA 3KKMA 1CJVC 1G8FA 2P7JA 2J41A 1XXHA 3SJZA 2OXCA 4HUQB 2WHXA 2IPPA 2LKCA 3IUYA 1T4GA 4NONA 3C7KA 4M21A 1IM2A 2PJZA 1YR6A 2AR7A 5FOUA 1YHNA 5L8VA 1BIFA 5G41A 3VU9B 3U7HB 3U6KA 2ZRGA 3GLFB 5APSA 3EG5A 1E98A 1TQ6A 1XU4A 2Z4SA 1HJBA 1G7SA 3EPKA 5CIQA 2RHDA 3EW9A 4LPKA 4TT3D 2OHFA 4JYBA 1R0WA 2O0HA 3AM1A 3KQUA 1GNPA 4PZYA 2B8WA 3RRYA 1ZU4A 4HI0E 4HDQB 2H5EA 1DVRA 3T1VA 4M2LA 1E2QA 5GJBA 3RAPR 1F6BA 2RGGA 3LW7A 3BFXA 4GBMA 2CL0X 2QL6A 1Q22A 3B1XA 4RFVA 3TSZA 4XWKA 2ZSEA 3FHOA 5KNDA 1CR4A 1M74A 4JBXA 4BFTA 3KDPB 1CRPA 3T97A 2F9LA 4MT8A 3DKVA 3UPUA 4AURA 1LTQA 2C77A 4UNPA 3MUFA 4TMXA 4D0LB 2BVNA 4GZLA 4EPRA 4QFMA 2ZSFA 1GFIA 3EWAA 2G88A 4PO1A 4TMTA 4WXPA 5JEEA 2W6JA 4JL6A 1HEIA 3GPLA 4OHYA 3KJEA 4NCJA 3FPAA 4IDPA 5EE9A 1E0JA 2W6IA 2IXGA 1Y3AA 3X1XA 4RD4A 1GKYA 1NSFA 4D4JA 5AUNB 3HE5B 2O8FA 2NO9A 1KNXA 2IF2A 2R6FA 3D31A 5FTKA 1SULA 1OB5A 1D6JA 3UANA 2ODEA 4P4SA 2JLUA 1Z0AA 1KSGA 4DSTA 3O8ZA 2BJWA 2ATVA 4IOMA 2PL3A 1UAAA 1W2GA 4PPQA 3DM9B 4B35A 1EFCA 2P65A 4QM6A 2GETA 3I4LA 1E9AA 1KMQA 3O8BA 2V55B 1G7RA 4KYIB 3WXMA 1XMJA 4TYYA 1HV8A 1P72A 1T5IA 3EPLA 1ZNXA 3T5DA 4MGZR 3WHKA 5JI3E 2ZE7A 2QRZA 1G9XA 1E9RA 5P21A 5JCZA 1OKKA 1VYUA 4TYNA 4B2LA 2C98A 1JNMA 4PC7A 4EPWA 1LVGA 4EQ6B 1UBCA 4F91B 1TF2A 2XXAA 3W90A 1TQ2A 2YO3A 3T1OA 2Q3FA 2WKRA 3B9PA 3C4JA 4LHZA 3EASA 3GLFE 3X1DA 1XXHE 3GJ3A 3FTQA 2GF9A 1IQPA 3F0TA 4POAA 3MWLA 2PX0A 3H0KA 3AVYA 1AA9A 3QKTA 3OEHA 4GT1A 2H17A 1KDRA 2R2AA 3QEOA 4UNQA 4JLBA 4DDVA 3VTPC 1CRQA 4DZOA 3A3YB 1GRNA 5A0FA 2XZRA 4BE7B 4NMMA 5AVZB 5FL7D 2FA9A 2WPDD 4EKDA 1KTVA 2ZI4A 3B1YA 1EX6A 3EPJA 1XJQA 2CJWA 4UNNA 4XWOA 2PZFA 5LD2C 1DS6A 1G5RA 3I73A 2A5YB 2R6GA 2WIBA 3GLFA 4E09A 4KU4A 3RRZA 4JBWA 2XJ4A 2QTVB 4H1UA 2AK2A 3U3OA 4BFSA 1MRNA 3EC1A 1TNDA 1Z0JA 1XD9A 1N2CE 4BFZA 3TE6A 1R6BX 4MDFA 5DLQC 4QOSA 3OHMA 1R4AA 1UKYA 4F4CA 1E9EA 4BFVA 3KQGA 3B1WA 3CX8A 3L35A 5JHHB 4BFYA 1CF4A 2WWFA 3M4YA 3GLGB 1Z2CA 3CM0A 3WRYC 3DMDA 3QXSA 5FPTA 5BQ5A 4ZDIA 2BKEA 5IF9A 2GJAA 2WOOA 4TL7A 1SVOA 1KHTA 2C8VA 2C9OA 3K0CA 2BWJA 5KPJA 4ZKEA 3SJAA 2R62A 2H8KA 1E99A 2QENA 2YHSA 4CEIB 1Q3HA 2ASEA 4F92B 3SOPA 2XZOA 2PCLA 2GESA 2G3YA 4QKQA 2F3TA 3FFBA 1OKKD 3PEUA 4PSKA 3LWNA 4TWZA 1CZQA 2CCGA 2BJVA 4ZDWA 1NRJB 4BZPA 2ZE8A 4QG7A 2G1KA 1H8EA 4LJ6A 3HYTA 2FNAA 4BRUA 4UQOA 3CF0A 2V8OA 1QHHB 3AVVA 4JJZA 3FOZA 4MUBA 1Z6YA 3OEHD 4RZUA 5FOVA 2RGEA 3LIEA 1JR3D 1U94A 5F9FA 1GK4A 2ANBA 1N6RA 3IO3A 2W58A 2ZVQX 2BEKA 2HUPA 1Z47A 2NO0A 1X1RA 1YZLA 2D06A 3W8NA 5G3YA 2FX3A 3I72A 3CX6A 3KUDA 3TMKA 3F5FA 1LS6A 4CF7A 4FMDB 2FPMA 3QVVA 1TX4B 3SHWA 5EZ6B 3GJ6A 5AW6B 1KO8A 3LQQA 4L9WA 3RHFA 4V02A 3TW4A 1AS0A 3PUWA 2DB3A 4HB4A 3PQCA 2FOLA 4KFSA 3AVQA 3IHLA 3QSYA 1EFUA 5FOSA 2I3BA 1PUJA 2O8FB 1XRJA 3IILA 5DIFA 3N2EA 1CJMA 4JVLA 3PUYA 4Q00A 4OQLA 1JAHA 3BH7A 5E3HA 5KUTA 2DHRA 1YZKA 4IDQA 4RD3A 3IR9A 1JXMA 3ZD6A 1H89A 2Z5IA 1XMSA 3EIEA 4Q7LA 2D2EA 3RC8A 5AVUB 1OXSC 5HCNA 3TH5A 5SZHB 3IQXA 4ZPXA 1G5TA 2Z5FA 4O3MA 5L3RA 1S9HA 2VHJA 1IN7A 4DKXA 4OJQA 2UZIR 4CZ2A 4JL8A 3VX3A 4DCVA 1XEXA 821PA 4UJ5A 1ZM7A 3TQCA 3KQNA 3RLFA 2WWYA 1ZIPA 4XD7D 2C2AA 2J1LA 3LW8A 3ZCCA 3PIRA 5IT5A 4XJXA 3UATA 4B6FA 4HUTA 3M0DA 1UF9A 3R8FA 3D6TB 1SHKA 1XD2B 1F48A 4U7OA 1Q1QA 2OBNA 2IUSA 4DIDA 3GLGA 1E1QA 4C7OB 2AFIE 1KDOA 3RS4A 3I8SA 1BYUA 1CJTC 2QMHA 3FWYA 1E1QD 3TQFA 1O87A 4A82A 1P6XA 2WWHA 2E1RA 1T8UA 4HLCA 1W2HA 1OIXA 4ZCMA 2ZROA 3CWQA 1VG8A 1R5NA 4ASUA 3IIKA 3V4FA 5JS7A 1FZQA 2NQ2C 4AKGA 4J0QA 5CLLA 2ZRIA 1J70A 2ZAOA 4KODA 1DG1G 2GCPA 2ODWA 3B7GA 1W5SA 4JIMA 5FR1A 3K70B 5J5CA 1HE8B 2RHMA 3LO5A 4XVUA 3U7EB 1HWTC 1JPNA 4MYCA 1NNEA 2O8BB 2C2HA 1W0KD 1T91A 1R2QA 3QBTA 3U3JA 4CEHA 2JIZD 1X8JA 4L15A 2J3EA 4F38A 1Z28A 3ZQJA 4IVQA 2GK7A 1W0KA 3QKSB 4K81B 1ZU5A 4E07A 2GILA 4FCWA 4LY6A 4Q4AA 2BBOA 3REGA 5EE0A 4BLQA 1E2LA 2QPAA 2P5TB 3BE4A 3EARA 3U60B 1CR0A 4PSAA 1YU9A 1ZRHA 1E2FA 3ADCA 3AVWA 4CT5A 1ZCAA 4Q18A 4I1VA 2E42A 4AC9A 2P5SA 1Z6XA 3UMRA 4CEJB 3M9BA 1FTSA 1LFDB 2EFEB 2RGDA 1I2MA 2XITA 3A2AA 3EC2A 4JLJA 4JVNA 3V4WA 4RD0A 1W47A 5B1OA 2XNDA 1S3GA 1GWNA 3IQWA 1DAMA 1E1RA 3T1QA 2FFAA 3U4QA 4Q47A 4IEIA 2BC9A 3QENA 1YZUA 1IJEA 3QF7A 5JZVA 1VG9B 3VMYA 4WZAE 3QJYA 4O25A 4HYYA 4LZZA 4TYWA 4BFUA 2WT7A 1D8TA 1MO3A 1XTRA 3RDPA 3S1AA 4Q21A 4R2IA 4BZXA 2CLDX 5EZ5A 1DAKA 3MG9A 1KI6A 1DO0A 2RH5A 4UXJA 5JMTA 1E9SA 2QAGA 2VLIA 1MO6A 2GXSA 1T3HA 4OK6A 5GJWC 1KY2A 1ZBDA 2AD5A 2V3CC 1XCPA 1H8ED 4B3XA 5DN6D 5CB8A 5JBQA 3BJIC 5G53C 5DH9A 5EXPA 2CVFA 2CJWB 2N46A 4OHWA 2J0SA 3ZZ0A 2JLVA 4I1OA 1W7AA 5LDDC 3W6PA 3BD9A 1E2EA 4AQRD 2HCJB 3NHAA 1DG3A 3BERA 3JVUA 2EYQA 1R5BA 3HE5A 2IF0A 5AVSB 1KGDA 2FPLA 1EXMA 2C9YA 1PLKA 4RJLA 2NMVA 2ZTSA 2IL1A 2RCNA 3AP2A 3K8YA 1US8A 4HAWA 1RKBA 4NCNA 3W8RA 2HYIC 1WQ1R 4AYWA 1XX6A 2B21A 1RC8A 4ZI3A 1E4VA 4DJTA 2YOHA 2HLDA 3GFOA 3WYGA 4IFEA 4AYXA 2VSXA 3FFAA 1YZNA 2AD1A 2YNMA 3QOFA 4Z8XA 2PJRA 5AVRB 4PPGA 1PV4A 4TMZA 4F4JA 4DVGA 1ZNYA 3ZS9A 1NBMA 4V03A 1QHGA 1ZJ6A 3WP0A 2ZXUA 4B3BA 1XP8A 5APWA 1E4YA 2R32A 4EPYA 5AWFC 5IHPA 5AW7B 1GIAA 5DE3A 1OH5A 4TLEA 1M1YE 4C30A 4LHXA 1E9DA 4LI0A 1A2KC 3MGNA 2ORWA 3IKJA 2R6DA 2ZR0A 1DAGA 1YZTA 3AEZA 1NMXA 4FCVA 1K5GA 1OXXK 4A8JC 1E94E 1MKYA 4RESB 3C8UA 1FQKA 5L3VA 3MJRA 2H1LA 2NO6A 4EPTA 4G5GA 3TW8B 3QKSA 4D0NA 3E5HA 1JI0A 4M4SA 2QBYA 2WSSD 5B2ZA 1U0HC 2IXEA 2CHGA 3EWSA 1CI6A 3NBFA 2F1HA 1Z63A 1N6PA 4B3GA 4M1WA 3TKLA 2FJUA 3P4YA 5E4FA 3C41J 4EIWA 4FPPA 1FPMA 2UVQA 4I99A 3ECCA 3R8CA 3M06A 4AKIA 4KSBA 3VFDA 3KXIA 5KHOC 4CYMA 2BDTA 2JJ1A 1XF9A 5KOYA 3U7GA 4M8NE 3K9NA 4GP7A 4JSTA 3D7MA 121PA 3HU1A 2LFRA 3LAWA 5TARA 3OFNA 1S2MA 3L43A 2Q3HA 1M8PA 1ZIOA 3NG1A 1TTTA 2I4IA 4PC3A 1KI3A 2YNYA 1R0XA 2FSFA 2GNOA 2VP6A 2YJTD 1WE2A 1AN0A 4GPTA 2R5DA 2QT0A 3V9PA 5GJVC 2GJKA 2PX3A 5AW8B 2O52A 4PPNA 1K8RA 4DIEA 1ZNZA 2B8TA 2W00A 2C03A 2Y8EA 1X3SA 1E2MA 2A5FA 2D4HA 3K09C 4MA4A 5DYGA 1MRSA 1HE1C 1VG1A 2K5UA 1VIYA 2J7PA 3AVTA 3CONA 4PC1A 3LXXA 4RZ3A 2OBMA 1SLQA 1XEXB 2JJ8A 5D3MB 3THYB 5FL7A 2C9LY 2W0MA 5APXA 2WJGA 2P2UA 1NN5A 1P4SA 2REBA 4GOKA 3T15A 3O8CA 3NBZC 1E2NA 5JCPA 1XEWX 3NHBA 3HE4B 4QBHA 3SN6A 1NY6A 2IWHA 2KBFA 4KITB 5J4LA 3P27A 3LV8A 1XDBA 1G3IA 2X2FA 3BGWA 3QPWA 4OHZA 5BN5A 3KQKA 3GP8A 4Q5IA 4XOIA 1GU4A 2FH5B 2KB0A 2ZITA 2CEAA 1U9IC 4DHEA 1X1SA 2OBLA 2JDIA 5L3QA 1S1MA 1H8HA 5L3SB 4D26A 3D3QA 1WF3A 2G0NA 4TLDA 4M1YA 4D0GA 2JDID 4RFSB 5DI3B 2QE7D 1EWQA 2O8CB 4A36A 2MSEB 2C96A 4JJKA 4B3FX 3CR8A 3ZVNA 621PA 2GKSA 1CJKC 2PT5A 4N3NA 5AW9B 5FTNA 2UKDA 2WIAA 4Q01A 4EFMA 4BGDA 4QJ3A 1WP9A 2RGNA 4JLNA 4DSOA 5CM8B 4Q4JB 1X86B 2F1JA 2HYDA 3ADDA 1VECA 1JBKA 1HT1E 4LDJA 4ON9A 2PZGA 2R6AA 2TMKA 4A6PA 3KQLA 4Q9KA 3HPQA 3VMFA 4KCGA 2GVZC 3T1TA 3BOSA 2PT7A 2VYFA 1P2VA 1W36B 1XZPA 2ODBA 3W5JA 2QAJA 4M22A 1FUKA 2A2ZA 3PFIA 5AR1A 2F1RA 3PCRB 2CLCX 4XSHA 3AKCA 4QGHA 3UWKA 3TNFA 1M7GA 3R9IA 3VX4A 5KYKA 1AGPA 2VSFA 3ZRWB 3PJRA 3BORA 4XVRA 2GA8A 4ZO4A 2IEYA 3TSOA 5EXXA 4Q9JA 5BWMA 4GRAA 3FDIA 2B6HA 3A1WA 2WWWA 2GRJA 2HJVA 4IRUB 4C2TA 1YJ5A 1YR8A 3L0OA 3DZ8A 4KSCA 3QE0A 4MDEA 3FGNA 3OZXA 2VSOA 4C9BA 3O8RA 1VHLA 3Q9LA 2V6IA 1YE8A 3UG7A 1PLJA 5D3QA 2OFXA 5ANRB 2C9NY 1TF5A 2DYKA 3NDPA 3GMTA 1HQCA 3CO5A 2O8DA 1WBBA 3AH8A 2RGBA 4I1SA 3QEJA 5K8TA 2CLSA 1NBMD 4MRVA 3KQHA 1QRAA 2QP4A 1KI1A 1NN1A 2VA8A 2W83A 4JSYA 2JLWA 2XEXA 3AKEA 2V7QD 1XZQA 3TVTA 1SXJE 1TMKA 3B1VA 1WXQA 1XFAA 3L82B 2H92A 2ZJ2A 1J99A 2ZI9A 1U8AA 3PV0A 4B86A 2CL7X 2FGJA 2J87A 3HPRA 1CBUA 4JMPA 1G4UR 5IK2D 4TTPA 5J4VA 1XWIA 4JZKA 2Q5UA 5FR2A 2IC5A 4CT4B 1E2JA 1ZAKA 4N0EA 1NIPA 2OV2A 4FINA 4YC7A 2PMKA 4AD8A 4II7A 5M04A 3HTKA 2IYVA 4NL4H 1U9IA 4G5RA 1FTNA 1GRRA 2Q9AA 4NYJR 3M0AA 3K09A 3QBVA 1C9KA 3GEHA 3VMXA 2ZJBA 4QNRA 1HTWA 2DFLA 3SFVA 1WBDA 1GRQA 2AKAB 1CU1A 2GBLA 4DUGA 2H57A 2WTUA 1E2IA 3ASZA 2ZRAA 1Z6GA 2EFDB 2IBMA 2X8AA 2ZS8A 3SZRA 1ZD8A 4P4UA 4UXHA 3U44A 5JS8A 2PMDA 1QHYA 1FMJA 3SE0A 3VMZA 1KK0A 1S0UA 3Q5DA 2WKPA 1COWD 1Z8FA 3TBKA 2J9RA 3SYNA 1S9DA 2KSQA 3KZ1E 2QI9C 3N2IA 2J45A 3M91A 3B6EA 4TTQA 3LXRA 1HH4A 4DB4A 4L5BA 2PH1A 2FGKA 2DY1A 1G3UA 2FEMA 4Z8YA 1E2GA 1SXJD 2CHVA 5L3SA 3TNUB 1FOEB 2XSZA 4L4UA 4GMXA 2QM7A 1KJYA 3GJXC 4Q1BA 4PANA 2NPFA 4D81A 2JATA 1D9XA 1VCMA 1OFUX 4Q20A 1NAFA 1T0HB 4HAXA 4PX9A 4AYTA 4PC2A 4AK9A 2J0UA 3OESA 3LD9A 4CGZA 1XMIA 4CEIA 4KYUA 3UWOA 4QC2A 2X2EA 2GZDA 2X77A 1H88A 3Q8XB 4M0LA 3EA5A 2KP8A 1N0WA 1E2DA 2LCFA 3WP1B 4P3YA 2IUTA 2ATXA 2QU8A 1KI6B 1W36C 1KQLA 2WSMA 2V1XA 2JGNA 4EJSA 1MV8A 3HR7A 4HZUB 2OSBA 2QP9X 3IIJA 4U7NA 1A2BA 3K9HA 3O8DA 3SHFA 3U7FB 1N5JA 1LY1A 2VQSA 1ZD9A 2BBSA 2ORIA 1AGRA 1Z06A 2WPDA 1E79D 2ZE5A 4JLAA 1GL9B 3BC1A 3BIFA 3KB1A 4WAUA 4EPXA 1Q44A 4FXPA 3CNOA 3ZQ6A 1P2TA 1XD2A 1RJ9A 5E7MA 2ANCA 3PEWA 5GVRA 3EPHA 4ERNA 1E9CA 3NEJA 2QRNA 3CRW1 1AQYA 1NI3A 4URUR 2EQBA 5EP3A 3I62A 2CK3D 3UK6A 4YLGA 2EFGA 2R44A 4P4TA 4AG6A 3EXAA 3FYHA 2VF8A 4IVPA 4NDZA 4OQFA 4QPKA 2CNWD 2P0EA 2QMEA 2G6BA 5CYPA 3HJNA 1QG4A 3F3YA 2ZRHA 2OXRA 4NYMR 1N6IA 4G01B 4W7SA 1RPZA 3SBDA 4HLUA 5A5GA 3RWMB 1X8YA 2XB4A 4S2EA 3CW2A 4DSUA 2Q6TA 521PA 2F3RA 4FMCB 4PQRA 1GUAA 3LBNA 1Z29A 1ZUHA 3B2EA 1VHTA 1Z07A 5SZJA 3CF6R 2IS6A 1ODFA 3RANA 2DPXA 4FMTA 4XTCS 4MKIA 3WNDA 2SHKA 5JSZA 2NTYC 2B7BA 2DWOA 2QMUA 3T34A 1YR7A 2ZSAA 4MYHA 4A0FA 4URXR 3BS4A 1NVVQ 1IY1A 1IJFA 4HATA 4AKEA 3I92A 4TLBA 2V1UA 1RYFA 2IYQA 3IPXA 2WAXA 2G83A 3EIHA 4URWR 2P6UA 3MWJA 5G3ZA 1CS4C 4PAMA 3QQ5A 4CIDA 2KBEA 3S1AB 1F3OA 3FMOB 2QBYB 3KL4A 2V6JA 2HDNB 3FMFA 5DO9A 4TN1A 1T3LA 4LV5B 3GJ5A 1HBWA 1KDPA 2Z6VA 1U99A 5AVWB 3ZZUA 3OAKA 1U8YA 4LHVA 4UNSA 1G2CB 5FPYA 3BBPA 5KTYA 3WNCA 4Q1DA 1LB1B 2RAPA 2H18A 1ZM3A 2QQ0A 2W6JD 2CL6X 2ZUBA 3ONWA 1P5ZB 4JKIA 1JR3A 3CPJB 2WWIA 2XOKA 3UG6A 2QUZA 5KNBA 4JAVA 4OYHA 1VYVA 3ZD7A 3QPUA 4DLZA 2HT1A 1DBSA 1S9KD 1DAFA 2OCYC 1FMLA 4BRWA 5F3WB 5BW8A 3DPUA 4Z51A 2WTYA 3VTKA 2JA1A 3TSWA 5AJXA 1YQTA 2BV3A 2VP2A 2WV9A 4ZCIA 2VL7A 3QKRB 3A36A 3K0AB 4WBSA 2ZRFA 1RVDA 1Z0DA 3U3KA 2NZJA 4Q9LA 1HT2E 4K46A 3SFZA 4TZ6A 2A3RA 1CJUC 2EW1A 3CRMA 3Q7QA 2EWVA 1XB2A 5H1YA 4MITA 2BM1A 2QMOA 2CCKA 1OIVA 3OAAA 4V0LA 3KTAA 1II0A 1VYTA 1UBEA 4MKHA 3B13B 1H65A 4DEXA 3RS2A 1OXVA 2QT1A 5HZHA 5AVQB 1UM8A 3ZVRA 4P0TA 5BN3A 2XTZA 3DKPA 4QGAA 3LVRE 2RGXA 5CMZA 3IPYA 3LVQE 1BS1A 2BMFA 2WICA 1XJCA 4PO8A 1UDXA 2MSCB 1HA3A 2QORA 2ERYA 1IXRC 4LYHA 2BM0A 1WA5A 1IOZA 2FEOA 5APQA 3GLHA 4XD7A 5FUYA 1GK6A 2L0XA 1FX0A 1CXZA 1OE0A 2RB4A 4US1R 2WM9B 1U90A 3SYKA 3ZS8A 4ABYA 3ICEA 2BMEA 2GEVA 2AKYA 3C15C 4JL5A 3TVDA 4D4LA 4DDUA 1N5LA 2XX3A 4Z54A 1VCNA 4F4IA 1DELA 4DXAA 2GK6A 1L4YA 3CZQA 4BEBA 3U4QB 5FBRB 3KJIA 3TRFA 1IONA 5FL3A 1KO7A 5EQTA 2WOJA 3A1SA 4C7OA 4KXFB 2YVUA 4TZ0A 5JJLA 3GJ8A 3TUZC 1G21E 1Z0KA 2OO7A 4WXRA 2OAP1 2WT7B 3GFPA 4IXMA 2QPTA 4ASUD 5AW3B 2JJ2A 4LWZA 4A8JA 3P7KA 4A4DA 2JJLA 3U6BA 1W4BA 3NEYA 1ONBA 2ZRMA 3FVQA 3BFKA 4B33A 3MJHA 2QROA 4Q9HA 1W44A 2ZUDA 1Z0IA 2A5JA 2FZLA 1ZNWA 3DVLA 3IIMA 5J4KA 3I5YA 3LIDA 4DT1B 1TEXA 3U44B 1QF9A 3UMSA 5HE9A 4US2R 3DHWC 1G6OA 2ZXEB 1P60A 4MGIR 1VKJA 4BECA 4JLMA 1UBFA 4C0JA 1YRBA 2PBRA 3H4MA 4IXNA 2D2FA 4IKEA 2W2VA 4M53A 4E22A 1P73A 3VNUA 1NVXQ 1MABA 1Z08A 3SS8A 3E1SA 3KKQA 4B47A 4GP6A 3VR5A 3JVVA 5EP4A 1U98A 4BEJA 2CVHA 2CNWA 4PXAA 5AW4B 1G6HA 1P2UA 1N25A 2FN4A 4LBYA 3TK1A 4M1SA 1FOSF 1JQJC 2AL7A 3NFQA 1D2MA 1ZM9A 1DAHA 3CUEF 2ZS9A 3JZAA 4DLWA 3EAQA 1GKUB 2O8BA 4PHTA 4GOXA 1XPUA 2VTKA 4DC9A 1LNZA 2GAOA 2IHBA 1FFHA 4IOLA 3X2SA 3CBQA 5JI2E 2GXUA 3UKDA 4NCKA 1MH1A 4U02A 2HXYA 4HAYA 3FMIA 4D80A 4AUWA 3RSOA 4JASA 4Q7JB 4B3CA 4Q9IA 3KFXA 4IW3B 3CRQA 1W0JD 2JAQA 4C7NB 221PA 1PUIA 1R7RA 1GSIA 1T0JB 1V43A 2IYYA 1A7JA 2OM2A 2QSYA 4M9ZA 4TMVA 4A2WA 3A1UA 5E7JA 4W5JA 4RVCA 4PR0A 1Q1ZA 1T8TA 2CMKA 4KBFA 3TIFA 1TU4A 1KK2A 1I2DA 1TQ4A 5E95A 1KJZA 3H2YA 4RZ2A 3AVOA 1SVMA 3SJBA 4JT2A 3FKSA 3IGFA 4B34A 4C4PA 4DLUA 1I4LD 3CNNA 3QG5A 5DSZA 4B2IA 3ZH9B 4LK2A 3VU9A 2J0VA 1OB2A 3TLXA 1BKDR 4R9UC 3NBYC 4GI7A 2MMCA 1GAJA 3W3AA 4YDSA 1W4CA 5KSPA 5CJ2A 1QZXA 3NH6A 1AKEA 5FPHA 4QJ5A 2W2TA 5JWOA 5EXTA 1FQJA 5FBLB 5LBIA 4D4KA 5TVKA 2JASA 4KJZA 4LJ7A 5DHFA 4QJ4A 1OH8A 5EXSA 2Q9CA 5F9HA 2ERXA 1IN4A 1FP7A 4W5WA 3RYTC 1J2JB 3VR2A 1MFZA 4HEJA 4EUNA 5AUOB 5APTA 2FFHA 3K0AA 4BFXA 4TQUS 5HR5A 4HLDA 2QAGB 4JBYA 1Q12A 1U0JA 5EUQB 1NP6A 3L8ZA 2PEZA 1IY2A 5EE5B 4EPVA 1DARA 1P7CA 3GJ4A 2HF9A 3K0FA 4NZYA 4URZR 1Z0FA 5HPYB 2DWPA 1W4AA 3ND9A 5K8UA 3B8HA 2OCBA 2KE5A 2QTHA 3ZIAD 4AY2A 4H1VA 2EVWX 5IDJA 1GVNB 4QPJA 3ZVMA 2WPRA 4ZIRB 2QQEA 1EWRA 2P3SA 1OV4A 1SKYE 5SZIA 4H9GA 4ACBA 3RWOA 3X1WA 3MD0A 1UBGA 2GEUA 1S3SA 2H7VA 3GLHB 2IEZA 2JLZA 3BAFA 1T9HA 1Y63A 4S35A 2ZYTX 4CEHB 3GJ0A 4G0NA 1HUCA 3I61A 1NY5A 2FSIA 3GQBA 5J4HA 3THXA 2W27A 1RRFA 2ZJAA 4W5HA 5CDFA 1F60A 1Z6TA 2VRWA 4B43A 2D74A 4LYFA 1G7TA 5AJZA 5TXGA 2Z5HA 3V5BA 1JECA 1TPZA 2JLYA 3K70C 3MMPA 3OEED 3BK7A 1U0LA 4DLXA 3FB4A 1OLOA 1JR3E 1E69A 2ZFCA 4Q03A 2B92A 1NMZA 2GEDA 5BN4A 1NLYA 2J0UB 5CM9C 3SQXA 2GHIA 4W9MC 2BHRA 3GEIA 2NIPA 2ZJOA 4EFNA 5D3MA 3K1JA 4LJYA 3NDBB 1QHHA 1FNMA 4RD2A 1SVSA 2ZU6A 3VNVA 4MYUA 4Q4AB 5C18A 1OFHA 3C5HA 2QTFA 2F43A 3I5XA 4NP6A 5JRJA 3O47A 3AGPA 3CNLA 1KO1A 1GNQA 4CDGA 4G5SA 1E32A 4F93B 1R8SA 2O0JA 1G8HA 1R8QA 1HUQA 2IYSA 4ZCLA 3QI2A 4QNMA 2JLXA 5AVYB 3RC3A 4JS0A 3N70A 4M9SA 5APVA 3L37A 1G20E 2ZRBA 2VP9A 1L8QA 3Q85A 4Q1AA 2IYZA 1RZ3A 3P8MC 2ZUCA 1IXZA 3P20A 1GG2A 3BB1A 3CKLA 1IXSB 5AJVB 3AUXA 4Q4HA 1N6OA 2RGAA 3CX7A 4WOPA 1GP2A 2ZU0C 3MSXA 5KNCA 1ETUA 1NJFA 3X1ZA 5APYA 1KI9A 3LA6A 4PC6A 5EP1A 4C0AC 2GF0A 3TAUA 1DPFA 1OJLA 1J2JA 1XD8A 5L3QB 1KI2A 3AP1A 4Q4HB 5JLJA 3IO5A 5TDHA 4ARZA 1FP6A 4LRWA 1S9KE 3WHLA 3Q5EA 1WRBA 3U2QA 3ZYCA 3VHLB 3HU2A 5C93A 2ZYVX 1G1MA 1UKZA 2WJIA 2Z0MA 4LX0A 2BIFA 1GITA 3ADBA 2XGJA 2IXFA 4LGMA 1E79A 1RRGA 4TL8A 3WNBA 2R9VA 1EFTA 5F2EA 1UDWA 5DGXA 1QDEA 3KDSE 2ZR9A 4LC1A 2VH5R 1EX7A 4I81A 4NYIQ 1SXJC 4P31A 1G291 1XJ0A 4BLSA 4IVRA 1A5TA 5FUXA 1KOFA 4LUCA 1J8MF 1N5KA 2YZ2A 4NTZA 1SHZA 3ASYA 1GZLA 4Q4JA 3U3MA 1OF1A 2QGNA 2ZJZA 3K0CC 4I4LA 5FBVB 3K0FB 3OEEA 3EA0A 4G5OA 1DE0A 3VR4A 2D7DA 4YMVA 3K53A 4O0MA 4X8HA 1G19A 2FG5A 1OYYA 2REXB 2OG2A 3PG5A 4LV8B 5DI9A 1XCMA 2QP3A 5LPNA 2AHOA 4KVGA 3AVUA 2JIZA 1CKEA 1ZCBA 5LD2B 1DAEA 5J47A 5B58C 2ZIAA 5KSOA 3CH5A 2RKOA 2FE4A 2WSSA 2IW3A 3THWA 3LFUA 4YMUA 3AKDA 1Z5ZA 1JEEA 2QY9A 2VHQA 3AGQA 4MRRA 3C16C 3M1IA 4DSNA 5HKKD 3SR0A 3AVXA 3PEVA 3A5TA 1A02J 2G0TA 2EYUA 5JRZA 1Z3IX 2LFSA 3C5CA 4BPBA 4KVAA 1E2HA 4ZV4A 3WYFA 3VKGA 4DT1A 4EJSC 3V4QA 4JLKA 2HCBA 3P26A 3B1ZA 4JAUA 2OCAA 4FI3C 1W49A 3AF1A 4HZIA 3Q3JB 3WYAA 1OWAA 2GAAA 4BFWA 2IS4A 1M7HA 3PUXA 3T06B 1G41A 5FUVA 3AF2A 1P9RA 2G1JA 2VO1A 4EDHA 1CIPA 5AW0B 3ADKA 4C0SA 1FOSE 4RD6A 1MABB 3SNHA 1CR2A 1IXMA 2FSGA 4X8MA 2IS2A 4AKHA 1W5TA 1OT3A 4FCTA 2IUUA 3TGPA 3A1TA 4OBEA 1VDZA 2KJQA 2R5BA 1E9FA 1NG1A 1W4RA 4DCTA 2GXAA 4YONB 2WWXA 2XU6A 1XTQA 4OI4A 3Q72A 2VPPA 1AS3A 1KY3A 1CLUA 3W9YA 1UKVY 1TAGA 2WAYA 2I1QA 3A4NA 2H7HA 1OH6A 2AXNA 4N0DA 1R10A 3RS3A 2NOAA 4A92A 2VF7A 1BMFD 4C0BA 3GD7A 1AM4D 5KU1A 3IEVA 3OE7D 3TUJC 1VPLA 3B60A 4TLCA 1NKTA 2FPKA 5IDVA 3ICQB 1RW4A 4TMWA 4PHHA 421PA 5AW5B 4NYMQ 3NMDA 3QF4B 4QGGA 4KAXA 3TJZA 1GD2E 3VKWA 3WRXC 1IN5A 2ZRLA 1ZYUA 1TF7A 5JJKA 3NTUA 2ZJ8A 2IS1A 2ZRNA 1KI8A 1SP4A 2QZ4A 3KUCA 3OAAD 5CB6A 2X19A 2YWGA 2GTPA 3LY5A 3MCAA 3W5IA 1XCGB 1JQLB 3BFVA 2E9SA 1RYHA 1T5LA 2OT3B 4B3DA 1OSNA 2W0SA 3LLUA 2WBLC 3A1VA 2A9KA 2GZAA 4HUQA 4URYR 4M1KA 1NVVR 1R5OA 3W3ZB 4OI0A 2BBTA 1TADA 2OUKA 1FAVA 1XNJA 1R0YA 2FFBA 3DDCA 4R7ZA 2AX4A 4MRPA 3GLIA 2ZRPA 1N0VC 1IN6A 1N6NA 2J59A 1NN0A 5IK2A 1PJRA 2ZI6A 1CR1A 3I8XA 2ZI5A 6Q21A 1SVKA 1G17A 1KIMA 2GJSA 2YO2A 4KO8A 1IAQA 5HE8A 1M7BA 1ZMXA 2F1IA 1QG2A 3HP1A 1E6CA 2QA5A 3KXLA 3UXMA 721PA 1QHNA 4RFSA 5DI3A 3W6NA 2FV8A 2O8CA 5JWHA 2BMDA 2J7KA 2FZ4A 1JXOA 1KNQA 4GL2A 1XTJA 3A58B 5AW2B 4HDCA 4US0R 3RNLA 2IX3A 2VIIA 5A4JA 4OKSA 4BLPA 2WPSA 1L4UA 2WMOB 4BLRA 4DLYA 1MT0A 3GJ7A 2FWRA 1W46A 2OLJA 4WVFA 4LJAA 3THWB 4GMDA 4IFBA 2CE2X 4DLVA 4DDTA 4TYQA 2R3CA 2WZQA 5C46F 2IYXA 1YZGA 1Z22A 1GNRA 4DCUA 2FDCA 1J8YF 4LJ8A 3QY0A 3REFA 1KYIA 4HAUA 1HURA 2HJGA 2P6NA 1E0KA 3PXGA 4XWAA 2DFKB 4LBZA 2JJ1D 3DZDA 4RY2A 3C14C 5C1BA 3MWYW 3LX8A 1Z6AA 1T3SA 4LV6A 4MKGA 5FOWA 4OQXA 3MFYA 5SZKB 1N6KA 1XTKA 1II8B 1UEJA 5AJWA 1KK3A 2IYWA 1MO4A 1D2EA 2Q0HA 2WMNB 1XPOA 1ZC3A 4JVSB 5EP2A 4KI0A 3EX7C 3A7OA 3FE2A 4B2PA 3AP3A 3AV0B 4IHQA 1X6VA 4TSFD 3B9QA 4YMSA 3A4LA 1CTQA 5B1NA 4WIAA 2Q3IA 3HYRA 4LYAA 5TMPA 2JLSA 3I1FA 4MYTA 3DO6A 4XTRA 1EESA 5J40A 4B75A 1ZP6A 4BWYA 4MQBA 1UKEA 1BMFA 2XTNA 3D8BA 4JKYA 4D4MA 2BCGY 2BASA 3GFTA 2V4ZA 5TB5A 1U8ZA 1G18A 2ECKA 1JJ7A 3IBGA 1ZVQA 4HDOB 1ZW6A 5CYOA 2R8RA 4URVR 2IA5A 1F2UA 3THXB 3QKRA 3R9XA 4AWXA 5CK4A 1V5WA 2C95A 3MWKA 3SWFA 2BMJA 2YINC 1C1YA 3VYIA 1IHUA 4OQMA 1JB1A 4JLVA 4UJ3A 2ORVA 1G3MA 5HCIA 5KDLA 4M3LA 2CE7A 2C78A 5KO2A 2X1VA 2QSZA 3I32A 4BIUA 3CLVA 3ZGXA 2OESA 3ETLA 4MRNA 3Q7PA 1A4RA 3SBEA 2ZSBA 4IOKA 3B8EB 1KZGB 3P32A 1RJ9B 4K8OA 1AS2A 2AWNA 2JEOA 3EZ7A 1OH7A 4M1MA 1KO5A 3QPVA 4PAOA 2YKGA 1AK2A 2OFWA 2GJ8A 1KI4A 4NHOA 1OHHA 3FKSD 4NCIA 4DCNA 3K0SA 2MSDB 1U81A 4L9SA 4A6XA 3AVPA 3E70C 4DDWA 3EZ2A 4TQ9A 4YXWA 1W1WA 2XSZD 2BKUA 1NVWQ 4P32A 5KSYA 3HDTA 2IYRA 3P1JA 3TR5A 2ZR7A 3CZPA 4I1UA 1G3QA 1HQYE 3WMFA 1UJ2A 1UFQA 5JWRA 1W0JA 2Z43A 2PLRA 4G3XA 4NBSA 4B32A 1RIFA 5F98A 1AKYA 4KFTA 1W48A 4FD2A 4HYTB 2J7PD 5JFGA 1IO4A 4ZDKA 4KP4A 3A4MA 3W34A 3DGEA 1JEDA 5EJEA 3KXKA 2CXXA 2IK8A 3ND8A 2P6RA 5AW1B 1XEFA 1LV7A 4KBGA 2VBCA 4OHVA 1DH3A 2HF8A 4QRHA 5IRCD 1GL6A 4ZDJA 1G4AE 3KTAB 2BCJQ 2Q7CA 1Q1EA 1N3BA 3VQTA 2WJVA 4ILEA 5FTMA 2E87A 1E2KA 3EZFA 3A6PC 2D62A 3V00A 2A78A 2QG6A 1PLLA 1XEWY 2WWGA 4O2LA 5CJPA 1JR6A 3QF4A 3L0SA 1IN8A 2J5XA 2LKDA 4GCZA 1NWQA 4LBVA 1F5NA 4LPSA 2GBLC 2F6RA 2O8EA 4V0ME 1K6MA 1JJVA 1F2TB 4PZZA 1MV5A 4Q7MB 4ESHA 1DADA 1CULC 4D82A 3AF0A 4B48A 4LBWA 3NC1C 4NU0A 2NG1A 3VN0A 2EU8A 1SGWA 3EZ9A 4FIDA 3GLGE 3EZ6A 1NL3A 2OZEA 2V7QA 1G8GA 4B73A 1SXJB 3BH6A 3FMPB 4WZBE 4Q7KA 5FPSA 3RABA 2A5DA 5GVSA 5BXQC 1YRAA 3CRRA 4Z1MD 5JEDA 4M1TA 3G82C 5KSZA 2NZ8A 2VHTA 3RS7A 4U00A 1BO6A 2WPQA 1KSHA 3OF5A 1VCIA 4Q1EA 2XZLA 2HLDD 1KSFX 3ZZTA 5JECA 5DNYB 2GWHA 1ZUNB 4UXIA 1M2OB 3SC3A 2QEQA 3MAAC 2XOKD 1GM5A 3D36A 2W2XA 4GDFA 3OIUA 4U7DA 4R98A 3M0EA 3SJCA 3VR1A 5AUPB 1KKLA 3GCGA 2ZJ5A 1VCOA 3IBYA 4QHSA 1PVOA 1II8A 1OW3B 1RRCA 2ZEJA 2E43A 1E3MA 1NSTA 1WDTA 2A7QA 4P4SB 2F9MA 5JSZB 1IY0A 2ODNA 2IYTA 1D9ZA 3AQ4A 1CI6B 3QIAA 4PO9A 3ZVLA 2GVDC 2LWIA 3QXHA 4DWJA 1SKQA 2ZETA 3PENA 3CF2A 1S8FA 2EFCB 2RMKA 3KX2A 1WB9A 3I3SR 4E5UA 4OJKA 1NG9A 5G40A 1E0AA 4G1UC 1B0UA 3OIYA 2N9BA 4C7NA 4V0MA 1XTIA 2G9NA 4QM7A 2G77B 3R9WA 4TQAA 5HTKA 4KV9A 5TY0A 1PZNA 4IDOA 4LC0A 2OLKA 1LF5A 1SXJA 1SKYB 3DL0A 4HLQB 3TNUA 1GTVA 2YV5A 4FWTA 1M6NA 1E0SA 1TU3A 2C04A 2ZRCA 1GILA 2WVJA 2BEJA 3GLHE 5LB2A 2QPOA 2ZRJA 4I6MC 3BRWD 2VP5A 3BWDD 5FH9A 3G0HA 3MRSA 5FPKA 3CIOA 3BB4A 2QE7A 4RKEA 4C0HA 1KMHA 1YZQA 3QUSA 5AUQA 3T12A 3LQRA 1NLFA 4GFDA 1W36D 2Z83A 2ZYUX 2GCNA 5AVVB 2FTKA 3MGCA 1Z83A 3QXXA 3RS0A 3ZRWA 3UIEA 1SVWA 4P33A 2ZQ5A 3G5UA 4GSYA 1QHXA 1SZPA 1ESMA 2QAGC 4FN5A 4YQFA 2J0QA 1N6LA 4EAQA 1ZM2A 5HKKA 4FMBB 1O3YA 2Q21A 2YYZA 1XTSA 4WA7A 3KKPA 1B23P 3T61A 3TR0A 2VP0A 4U5XA 3BH0A 4Q1FA 5C4GB 4Y0AA 3RS5A 5FUWA 3VR3A 4C2UA 3B78A 1KAOA 3DOEA 5JHGB 4V0KA 2RGNC 1MO5A 1VG0B 2NGRA 2BBWA 1WCV1 2XB2A 4HLUC 1KSJA 4KLNA 4ZI2A 1AJEA 3NBXX 1KDTA 2ZPTX 5AJYA 2O8DB 3J81k 1NVUQ 2VHCA 1GDDA 2ZRDA 4NKRA 3BXZA 2OAQ1 1RE0A 1TEVA 2YC4C 4RCZA 3L0IB 1EK0A 1KMHB 2OEPA 1JOYA 1TL7C 2ZSDA 4NE2A 4PTLA 4I2LC 2F43B 3H84A 4QBGB 3TAHA 2GDJA 3ZRXA 1OFIA 1ZINA 5EE3A 1FUUA 4R2HA 3R7WA 1N0UA 4UNRA 3B5JA 2R6CA 1A02F 4JT4A 3HR8A 3L36A 2MMGA 2RGCA 4A0RA 4ZIRA 4DB2A 2YWHA 1KI7A 1H8HD 3F8TA 3KKOA 2VHUA 1P2SA 1FL9A 1VTKA 4LOAA 2XAUA 1N6HA 3PUVA 4D2IA 5GADl 1I4DD 3M6AA 3GLIE 5KDDA 1UPTA 4OHXA 1AZSC 2FFQA 4HB2A 3K9GA 1DAIA 1KZ7B 3NXSA 2ZVPX 1S1CA 4PHGA 1YVDA 4N1AA 4ZKDA 4DEYA 5B64A 4CRWB 2ZAMA 4RKFA 4RCYA 1HYQA 3W6OA
chains in the Genus database with same CATH superfamily
2YIUB 1N0HA 4R84A 5LQDA 3LCJA 2I29A 1J7JA 1AGNA 4LEIA 2JLQA 2PGJA 4DV1O 4IEEA 3KHUA 2BFFA 4J1SA 4WY5A 5AVKA 2OLEA 3PITA 1H5UA 1NTZE 1Q2XA 1X87A 2DW4A 1FS6A 2PIAA 2R6ZA 4MIKA 3N27A 4FLWA 5JZOA 1TCVA 2FRVA 4HRXA 4MUHA 1SQPD 1CP9A 1JQ5A 3GEEA 4TPKA 3ICOA 3GIWA 3HDVA 2B0CA 3SVZA 1I4TD 3QH4A 3W5HA 3S3WA 2VT6A 1NR1A 3V6MA 1LT9A 1SCIA 1Z7GA 4NPAA 4TYPA 3TXAA 1P9NA 4LJLA 2EZUA 5DTIA 3L1JA 5CUQA 5HA5A 1QOQB 3SP1A 2MJZA 2IBZG 1HYHA 1X2EA 4E1VA 3D8RA 1NBME 4RPLA 3AEBC 3AI2A 2QVCA 3CWZA 3IQIX 3PPWA 3N6RA 3DE2X 2F1OA 2YOFA 2XQIA 2Q4OA 3LXMA 4YRMA 1VJRA 3NM4A 1KRWA 3STLC 1STOA 5K8CA 1EPUA 4WASA 1XDUA 5KINB 2DBRA 2HA2A 5AIAA 2JLRA 3EXG1 3MT9A 4QPZA 4F7WA 1KAGA 1U3GA 2AMYA 2DOKA 3OIVA 3ZNNA 4BASA 4PYNA 4HSEA 5A7FA 5AW6A 1XNRO 3TLEA 1NMYA 1EUCB 1GKLA 2JGRA 1U2GA 5JXIA 2QKYA 4RD1A 2HJFC 1ZRNA 4D74A 4ZICA 1FXUA 4YI3A 4Z1MA 1OCZB 2A0KA 5KTYA 3F6EX 1SUPA 3OIWA 2EZPA 1DOAA 1NIJA 2PLFA 1SQBD 4LWQA 4NCHA 5JJNB 2YW2A 3DLAA 4HOYA 4CU2A 3EPRA 1FW6A 4WT7A 1OXTA 3WSVA 1FZCC 2NADA 1XHZA 2X0JA 4FC6A 3E3LA 3UVEA 3U5ZB 3I1JA 4O59O 5FFMA 5B57C 4MTXA 2JJYA 2I87A 2A9RA 1E7WA 1DEAA 4ECAA 3BTVA 1TK9A 5B3AA 3V7YA 4ZOQI 4ZYWA 4LZPA 4Z4GA 4IWNA 2O0KA 4XJSA 5I7AA 1G8PA 3GRZA 3TUIC 2VPWA 4BVFA 1Y8QA 4RZQA 5E6SA 4FZVA 4LVUA 1XA4A 3M6UA 3E53A 2OD9A 1DUIA 4NOMA 1WDLA 5T6MA 2OYRA 2XNSA 3P9XA 1RHZB 4R68A 3VR6A 1J6UA 3PEFA 1JMBA 5B6JA 1GPMA 3AEUA 1IBRA 2Z5GA 2PH5A 3PYLA 5EMLA 5LC1A 4GNKA 4M8LA 4X3PA 4I8IA 4PZAA 1XDDA 4XM0A 2ONJA 1SQPH 1RJGA 4DTCA 5AVZA 3WXBA 3K5LA 1A8SA 2P1RA 3CUYA 3HWSA 4I7EA 4RZXA 1CEEA 3P8ZA 4F11A 2JK0A 4H15A 4JBGA 1SCUB 1B6SA 4RIFA 3NRBA 1ILEA 4OOFA 1NR7A 1YGPA 2FU5C 4ACAA 4KFMA 3U1AA 3M9HA 3L0BA 4PYIA 3RU2A 1QHIA 3MJCA 2E74D 1LA2A 1TIPA 5MDHA 1V11B 3KKYA 4ESVA 3E9EA 1KVQA 4G8DA 5BR8B 5UKDA 3WGTA 2WJHA 1C8KA 3FBTA 2UZAA 3FYUC 4KI7A 4QXMA 1Z0ZA 1FX0B 2F90A 4W7YA 4NYJQ 4U2EA 1BH2A 3KKZA 3OGIB 2IJHA 4BW5A 3CX5F 1NN3A 2ZUUA 1PSDA 1FYWA 2WPDG 2ILVA 3DM5A 1V0JA 2Z6UA 3TX2A 1B1AA 4PQFA 5BZBA 1SVIA 2FLWA 4G0MA 4HJRA 5ITZA 1AP5A 1NI8A 1S4QA 2YXNA 3A11A 3G8BA 5KVAA 1FBNA 3D8UA 3WIBA 1UADA 2CLFB 1GMGA 4U3FH 4I9QA 1L7NA 1NX9A 2CGEA 3Q9NA 5IXJA 3FYUB 3NFYA 3HL4A 5T3YA 2QTAA 1DG9A 3QFCA 3DOHA 2VN8A 4ILKA 3UQYS 1BXZA 4KREA 3EBLA 4XIGS 3O94A 4JI6B 1N5IA 3TCNA 3PPIA 4OI1A 3SQWA 3VHXA 1KJIA 5AW7A 4IDHA 3K20A 4MKZA 4HEA1 4NY1A 4A9AA 3R0QA 4OXIA 2DCUA 1AKTA 2BGMA 2I6TA 3OZTA 1EMDA 1P4AA 1FNNA 2XUFA 2V7QH 1QVAA 2Y4OA 1ZUIA 3CINA 2ZYWX 3ILXA 4F5DA 1P62B 1RI5A 2AJTA 2VUIB 2WG0A 4GP9A 3PQ3A 4Y2HA 4UXNA 1MGPA 4DIKA 3ZBHA 1T6NA 3ORFA 3GD5A 2N42A 4FDMA 2YV1A 1IRIA 3AC0A 1Y4UA 1JF8A 4JQCA 4R8MA 3HKCA 3BIWA 4FS3A 3TW8A 1QRTA 4R9RA 2JIRA 2VSQA 2V0GA 2AVDA 4DOMA 4PBSA 4UTVA 2OG1A 1UMDB 2R65A 2PHZA 1F2UB 5ILGA 4CFZA 2WINI 1HQKA 4QBIA 4NF2A 1LS1A 4TTRA 1JUNA 1OLUA 1NUTA 1Y33E 4L4YA 4WDQA 4O6VA 4DR1O 1M2NA 2WZDA 2DFTA 4XZ3A 3FDZA 2VT7A 2WPVB 4KV7A 1MAUA 3SC6A 1JEYB 2FQQA 2LQTA 2C2KA 5AVTB 3B6MA 1BA3A 4DV5O 3M70A 4L8LA 1TW3A 4DCSA 2JF0A 2P79A 4UU8A 5A3QA 2XYGA 4L95C 4D8WA 1T36B 1JHRA 4JPRA 2HO4A 2QRMA 3CC8A 2X14A 3ITKA 3N8DA 3LLMA 4L16A 4AMYA 4YXWG 3VZPA 4D9IA 1W75A 5BSFA 4HDRB 1XXHB 4NH0A 1PP9H 2FQXA 5EK0A 1LQTA 1TK2A 2P9EA 3PGXA 1ZEJA 4TSFA 4V0NA 2OFFA 2Z9CA 3O8OA 2BCCD 1F51A 1P9WA 4MEJA 3BPSA 2H1VA 4OX9O 4C3ZA 4YDHB 3DFKA 4MVJM 2XZTA 4PIVA 2Z5LA 4GI2A 2V03A 4MWOA 4NH4A 4JOQA 1SH7A 4XEHA 4Y2PA 3GFQA 2KI7B 1W85B 4IKOA 5CFMA 2JKVA 1QHSA 2Q3MA 4KTTE 2VF2A 3LP5A 4KPEC 1L2TA 4UB6H 4JYCA 1P9LA 3LH5A 4JC5A 4FYXA 2IW5A 1YDEA 4O2BF 5AKKA 3Q3HA 1ZUQA 1G8KA 3H11A 3L6RA 3L92A 3MC1A 3X1YA 1R15A 1A32A 2VEDA 1N2IA 4ND8A 4RJJA 5EUMA 4CCWA 2ZREA 3K8OE 1XBTA 1VIAA 2P7IA 1SESA 1VQ7P 3QYPA 4FHGA 4MR9B 3UOWA 4ZKIA 4BIZA 2M5AB 2X13A 2RJ3A 3BD8A 4L4SA 5JRDS 3T1NA 5KTTA 1DV1A 3C8VA 3NH9A 3GMAA 2AN5A 3UMFA 3K31A 3BRCA 1WU7A 2FPPB 3F9CA 4ARAA 4B80A 2QVZX 2IUEA 2QN7A 3KJHA 3SSMA 1W34A 5CK5A 2WUVA 1WMSA 2CBZA 2BOCC 1JGTA 1CEQA 4EPRA 1XA3A 4LYGA 4Q19A 3QE9Y 2V9PA 5HCUA 3RQSA 3M5DA 3ODGA 1RXWA 2WSEH 3RL0g 5I5EA 3K57A 2X76A 4IDEA 5H4GA 3U61B 3IUMA 4Q1CA 4MLDA 821PA 3KSUA 4DUGD 4Q3AA 1JLSA 1HFKA 1M34E 4LTNA 1TAEA 4OK3A 3RJMA 4HNTA 1T2KC 1TVKB 2WJJA 4IV5A 3L8YA 4QPCA 5AKJA 3WL4A 3H01A 5JADA 1IN1A 2H1WA 3T5GA 4BQQA 2ATIA 2HSJA 5CCHD 3EXIB 1RRPA 1M54A 4GI5A 2BGTA 3HHPA 4EOTA 1Y4AE 1NAIA 3C43A 1AB5A 2GZMA 2IHKA 3IVXA 4BNZA 2FEWB 3FGPA 4QX6A 5EUBA 5LBQA 2YXQB 3AUTA 3F7MA 2C07A 3KQOA 2ECFA 3ND6A 1P3JA 4IDNA 1USEA 2W6AA 4Y2TA 1F2TA 1M1YA 1UPBA 2BISA 2VZ0A 1I0IA 4HH0A 1KOLA 3N2KA 4MUAA 1CSBA 2ZCJA 2HHHB 4TT3A 7ABPA 4KGXA 5U9CA 1K3FA 1OLSB 1Y8CA 3CE9A 2YOGA 4RUKA 2IU6A 1BCSB 4GKBA 2OZLA 4PTZA 3MJSA 5DYIA 3TTTA 1BE3E 4FSXA 1RHUA 4EHHA 2KYVA 1ABEA 2N1BA 1GZSA 2G1AA 1YJ9V 2QRJA 3G9QA 4FFWA 3DDHA 5FI0B 2VDLB 3C0KA 3STWA 4EKYA 5ALVA 2P41A 1NPYA 3AI1A 1GO2A 4UE6A 3PUZA 4XCVA 3URMA 5IZ4A 3B48A 1KMIY 2ZI3A 2OBYA 3A4VA 2GZHA 1MZFA 3U4IA 4JI4B 3V1MA 4AZ0B 3PDIA 1OX5A 4YMWA 1HLPA 1MNAA 4OFXA 1JSZA 1XNRB 2EQAA 3MPUA 2DQSA 5LJIA 1IZ3A 1BZYA 4PYKA 2R6R1 2NTVA 3WBKA 1KQGA 3PXBA 5H8WA 1GNTA 3VP8A 3HDYA 2D1SA 4L8VA 3FHJA 1LTJC 4TOIA 2JCYA 3QITA 3E9MA 3OZAA 4M1EA 5HF6A 4L9AA 1B3QA 3LX5A 2IYFA 2P6JA 4OM8A 4ZVVA 1XVVA 3LWBA 3O4RA 5IJ0B 1NUSA 3RIYA 3SKVA 2AEMA 3T0IA 3WR5A 5K5EA 1S77D 1G8SA 3SZUA 2GM5A 1PNLA 4PQEA 5A4DA 2O8EB 4D9MA 4M8KA 3RODA 4QYTA 2FZKA 4WCDA 4TRJA 5D85A 4B76A 2E4XA 5B6PA 1JU4A 1PJAA 3BILA 1X8LA 5DOZA 4NICA 3AQIA 3AHDA 3L70G 3W5BA 1YTZT 3SJ7A 4BLTA 2OK7A 2YZKA 5ICEA 1R6DA 4Z3KA 2F55A 2XHEA 2FMXA 1AKQA 1LTAC 5CIWA 2E75D 3H5AA 2O2XA 2XGMA 3IRUA 3UQ8A 1J07A 3E7KA 3I6IA 4FZ5A 1Y6XA 4MTLA 3ZI0A 1FS0G 2W6IG 4J80A 5ILOA 3KZMA 3P3PA 4OLAA 3ASOB 4N4AA 4K9OA 3UMBA 4AJNA 4X8LA 4LHWA 5A9TA 3A0RA 1ZR4A 3TLBA 4CI0B 3QPCA 2D5BA 3DEFA 1QF6A 4IXTA 3CPEA 1QVFU 1GAWA 4Q7EA 1N73B 3NC0C 1YI2V 1GSAA 3H86A 4IGGA 1V7CA 1C7IA 3HSSA 3NVAA 1RDFA 3QXCA 4KQXA 3UJNA 2W6QA 3CCMV 3DMRA 1P75A 4WK2B 3EVZA 3L7BA 5FOXA 1BN7A 1EFPA 1OFVA 3L93A 3S7ZA 2Z6AA 1MABG 4I4CA 2DULA 2ONYA 3DQQA 5KHIA 1FNBA 4KE6A 1EFRA 1L8AA 1MF7A 4WWHA 5HMMA 1A7UA 3OQMA 2EINC 4JJ6A 4U0KA 5AD1A 3PRYA 5ELXA 4KXLA 4L4XA 3PF9A 1F0PA 1QKJA 4Z4HA 1NJGA 4O2RA 4DLTA 1BE3J 1JY3N 3ZN0A 2Q9BA 3J81N 4KGZA 3VGPA 4PSVA 1KILA 4Z9YA 4AS1A 1QVRA 2AXPA 1YDMA 2WSLA 4ITRC 3NI2A 3F74A 3RIHA 1YCDA 3UEOA 1G8FA 2P7JA 2HTEA 2E5FA 1QDUA 1XXHA 1EE2A 1MW9X 1NTMD 2AOTA 4HUQB 4XDYA 5KI6A 4B6OA 5BNIA 1J8QA 3IUYA 3OKCA 1SIUA 2XUQA 4NONA 1FXHA 4UCQA 5LU8A 2PJZA 5KAIZ 1CZLA 2B1JA 3OI7A 1CQIA 1QTQA 4EAAA 1VKNA 2A92A 2QM4A 2NXCA 5L8VA 1PWZA 4BPRA 1AX9A 4TWRA 4F60A 2ZRGA 2L18A 3OPMA 2QTBA 3I6BA 5APSA 4G1VA 1E98A 3KZKA 1TCBA 4XOUA 1U4OA 4Y6OA 2AXQA 1U6IA 1TGOA 2NN4A 3PHIA 3KU1A 1DIRA 5CIQA 4FOTA 1DUSA 4KDFA 4CMGA 1QO0A 4L0DA 3L75G 3DE5X 3DEJA 1MX3A 2J4FA 4JKIA 5EGNA 5EOVA 3AM1A 3HJBA 4PZYA 2B8WA 5FRDA 5DNUA 3L71H 4L50A 2Q99A 3PHLA 1U2ZA 1L4LA 4N23A 2YN4A 1U28A 1GRCA 1FS0E 2CPBA 5GJBA 1QNFA 3ETNA 1EFKA 1GPLA 2RGGA 2ZQYA 4K28A 2GI4A 5ALOA 3ICVA 1N2CA 1X1AA 2DC1A 1TRKA 3V4SA 3VR4H 3FPJA 3UMGA 2QEXV 2ODPA 1M74A 4JBXA 2Y9YA 4EL5A 3E22A 3CPWO 4AURA 2DOSA 3TSYA 3DT9A 1R3IC 2X41A 1MB0A 1QVZA 2J33A 4AI8A 2EIMB 1BNCA 1GFIA 1P6QA 1KU6A 2L17A 2YZNA 1VP9A 3E7XA 4PO1A 4WXPA 4JL6A 3CWBE 5A7HA 1TJYA 3ZU6A 1SU8A 2Z30A 3AL0C 4IXWA 4EECA 3LNNA 1H2XA 3GPLA 4KXRA 1O7JA 1LLUA 4P7BA 3WLLA 2IPXA 4UCFA 2KNCB 4K0RA 3K92A 3X1XA 4F71A 1WQ3A 1IOLA 2YJNA 2QZPA 3HD7B 3OZRA 3HUFA 1KNXA 4B4DA 4DWOA 2R6FA 3D31A 3REOA 5BPHA 1GPWB 4JNKA 2ZBVA 2ILMA 5GGXA 3SVTA 3UANA 4E4EA 5DM60 1Y89A 1L1FA 1PJ3A 2LCIA 2P9TA 3K1AB 4BAGA 2H1OA 4DSTA 1R8YA 3EIFA 2ATVA 3L6DA 5KTPA 3PH0A 4P0QB 1T6XA 1T36A 1NKZB 5L3FA 4J29A 3DM9B 4C3VA 3OLWA 5A71A 1THTA 3BJZA 2ZBGA 3ZMUA 2VSNA 1NYQA 4OB8A 4MYSA 2Z56A 3FNFA 5EC1C 3STVA 1E9AA 4O4IF 4KYTA 1G7RA 3K2BA 1XMJA 3DZCA 3NZEA 4MLPA 1KUQA 1WEKA 3VYTB 2HADA 4DLLA 4F4DA 2YHUA 5JSUA 2A9JA 2G1UA 1WBJB 3T5DA 3L75E 5GGYA 5JI3E 2ZE7A 1WOYA 4JC8A 5KAPA 4FB4A 4GAEA 1T8PA 2D2CD 5IS2A 2A9QA 5AQEA 5CD9A 4I3HA 4B2LA 5L3CA 1Q0QA 1QNMA 1JNMA 1U4NA 2JVKA 2PTHA 4RA6B 1UBCA 2DEUA 5I4CA 5HFJA 3EX7C 1AMOA 4KJXA 3NT2A 1MP0A 3EODA 1RYDA 2B99A 3BK2A 3W90A 5IVPA 2YO3A 1RHMA 2R8BA 5DLYA 3GHGA 1DQYA 1XNQB 1U5AA 2I34A 2Q3FA 2WKRA 4OMUA 3JSVC 5T57A 4AF8A 4CUJA 2IXDA 4HG2A 4N39A 3GVCA 3H1EA 1XBLA 2Y66A 4DA9A 4CF5A 1SQPK 1HNZB 3OETA 3N2GB 2MINA 1FXWA 2PX0A 3BKXA 5EYPA 3MWLA 4MVJE 1AA9A 4Q93A 1M72A 1RSOA 4GT1A 1KDRA 4CS3A 2L82A 4PPYA 4JLBA 4UNQA 3WU2E 4DDVA 1B8NA 3OQJA 4KVZA 5DMXA 1JQAA 1VF6A 3CVJA 1JDJA 4EHNA 1J5EB 4UAVA 2VDRB 4DUZO 4V0SA 4UVCA 3HN6A 1HG1A 4PHCA 3J7AU 4BE7B 4DCVA 1NASA 2R7LA 3V8EA 1QX8A 2GSDA 5ITVA 2R5FA 3OZWA 4EKDA 1KTIA 4OCZA 4HYOA 2R85A 1EX6A 2PVSA 3QM1A 1V3QE 3ABRB 3TM4A 5CLJA 1VQNP 3HPLC 4LF4B 1DS6A 1SZXA 1TCAA 1Y7TA 1ZFNA 2PZFA 3DVSX 4ESEA 5K0JA 2A5YB 2R6GA 3W77A 5L8RJ 1BE8A 4H1UA 4GLLA 3U3OA 1T6AA 1YU6A 3MIWA 4JT9A 1Z0JA 4U3FD 1Q6YA 4ND4A 4N7JA 5ESDA 5ICFA 1YI8A 3IB3A 4FS8A 1FUYB 2H43A 1Y76A 1R4AA 2EL7A 2JRCA 4LK3A 4RIGA 5CNJA 3CX8A 3L35A 3RTEA 4ZYLA 4OSEA 2V4DA 3GB7C 4BAUA 3M4YA 1AQJA 3KYJB 1Y8RB 1VQ4V 4BYGA 4CETA 4CM9D 3CM0A 2P7TC 3E9NA 1BE3H 5FPTA 4ZDIA 2P6PA 5IF9A 1XA0A 2WHEA 3GPIA 2ZBPA 3LUKA 2QEXP 3L8FA 4TL7A 1KHTA 4GS5A 4PGFA 2C9OA 3E9DA 1TYDE 3FCOA 3A0BE 4RAIA 2PZSA 3HUDA 3JWEA 1PR4A 2FETA 3D43A 3KEGA 2CL5A 2I6FA 4IG9A 3U48A 4QREA 5I7UA 2K7FA 4YVFA 1JCDA 1Z56C 2YXRB 2YHSA 1WKVA 2X1LA 1Q3HA 2CJXA 5G0TA 2QTGA 2G8YA 3JQAB 4G1CA 5A5DA 4P81A 1YB1A 2IIVA 3EZXA 4J16C 4RMIA 3BF8A 1KF0A 3LVBA 4JDUA 3QMVA 4ODIA 3LWNA 3WGNA 3B20A 1N0IA 2OCLA 5I9TA 3FOBA 3LSUA 2Y1CA 5F73A 4EY7A 2M32A 5IWAB 1E59A 3L75J 4KO1S 4AZWA 2C2OA 4EVRA 4UUBA 3U31A 4BZPA 4D3FA 4Z1OA 1XXLA 3NWOA 5B3SB 4E3WA 1QH0A 2Q45A 1SUFA 2V6FA 3K35A 4N3BA 2B8JA 3OOWA 3SAJA 4AZTA 2O7SA 3CF0A 1GPAA 1U7MA 3EOBI 1QHHB 1E3QA 3DMTC 1ZIXA 4RDCA 2V7QJ 3CX5D 1I7FA 1VF6C 4ZI7B 1Z6YA 4WBXC 1BMTA 1NH2D 3OEHD 1W5FA 3TPCA 5IH7A 4O4LB 1JR3D 1U6KA 1U94A 2OCIA 4V0RA 1JB0J 2XRYA 5B7PA 2ANBA 2W58A 2BEKA 2EJBA 4K35A 3HXQA 2PE5A 2DE0X 2ZIUB 1YZLA 1NNSA 1RTTA 1FRQA 4BFLA 3GRKA 4FBMA 3KZIE 5A3JA 4CIWA 4H4EA 5F5NA 2WLIA 3GHGC 1E3EA 1ODLA 3JYHA 1YZHA 3HUEA 1NW7A 3F5FA 4H31A 2C92A 2R96A 4ALMA 4CF7A 1W5CE 3PQ2A 1PKXA 3GUVA 1K63A 4K2HA 4WFBV 1DFHA 1QGDA 5AW4A 1TX4B 1GW3A 3Q10A 4B4UA 4UCTA 3P2IA 2WQ6A 3CF4A 1LZKA 4P9PA 3ZMZA 4JA0A 4TX1A 5EZ6B 4DV6B 2R7MA 4L9WA 2DWUA 3U7RA 4V02A 4HMPA 2OTCA 5IC6A 1C30A 3NAMA 3RVDA 2AE2A 3QSYA 3KCYA 1FXSA 2I3BA 4K9KA 3IILA 1CJMA 2W6BA 2K3RA 1EDDA 4ASVA 3HA5A 5E3HA 5KKZC 4OHMA 3HUUA 4TN5A 4X1OA 4ENVA 2GM4A 3EGIA 4IDQA 3C3WA 2Q7DA 3ZK7A 4GQAA 4CM7A 4D3YA 5JO9A 3KSDO 4C76A 1K7SN 1JXMA 4O4JB 3ZD6A 2OCCB 4KL1A 1KEEB 5JZMA 2O57A 2ODQA 2X0NA 5SZHB 3R6LA 3IQXA 4MP6A 4F9EA 3LQ1A 1BWSA 1PPJD 3SFTA 3W2GA 3RT1A 3AFMA 3PE6A 1S9HA 2VHJA 3NJRA 4DA6A 1SCUA 4E31A 3GNQA 6ABPA 1NHWA 2YS7A 3EYAA 4JL8A 3B38A 3E89A 2GBGA 5BWBA 4HWRA 3ZZ1A 1CY6A 1MJFA 4DW1A 2QLFA 5KLVD 1WKBA 5G0WA 4WFFA 2I80A 4AKIA 3RLFA 2EV9A 4OQDA 3DLPX 4CMIA 4XD7D 3EULA 2XUPA 3ZCCA 2M5AA 4MVJD 2I9KA 3INNA 1XAJA 4ZU1X 1YUMA 2ZTHA 1AV1A 4YPFA 2BTEA 4YT2A 4KR3A 4W1QA 5TX7A 4B6FA 1UF9A 1RR6A 1RRVA 1DJLA 1XD2B 1JPVA 3ZS8C 4BNTA 3GLGA 4S0XA 4BV9A 3GUHA 3ELWA 4YREA 3G2KA 1EVQA 3W7VA 4YIKA 1S5LZ 1NI5A 4E2ZA 1LWOA 1LTKA 5K3BA 3FB5C 2IH2A 3KBOA 1U28C 3V6IA 1P6XA 2C9MA 3ESQA 4LGVA 2E1RA 4RTMA 1CC1S 3BIOA 4BC0A 4D7TA 3NEPX 1H5NA 1EM8A 4WFKA 5KVSA 2FZCA 1NU8A 1VG8A 2XMSA 4L5CA 1R5NA 2C3UA 4ASUA 1L0LG 2C1EA 7AT1A 1EBUA 1G6KA 4DCPA 5BVHA 1FZQA 4KAFA 2NQ2C 4J0QA 5CLLA 4GBGA 2V0NA 2ZAOA 1CDDA 1WHTA 4DMCA 1DG1G 2ODWA 1YIOA 3MJDA 5IDXA 1JQDA 3TI9A 5A1JA 3LO5A 2NVWA 5FL7G 1KC1A 1NI4B 1JPNA 1QS0B 3HMQA 4MYCA 3HBFA 4BX3A 1W0KD 4HFRA 1NW6A 3HO8A 1FBTA 5BSVA 1ML4A 2QE7G 3P2JA 4F38A 5KVCA 2HIHA 4NYKA 4DRXA 1NA5A 1Z28A 1XKXA 2HWKA 2W4QA 3OLCX 4IVQA 4OHOA 4MR7B 4RHYA 2C8KA 1ZU5A 3GRPA 5A9GA 1W52X 2GUZB 3TTYA 3QIVA 4BLUA 5F3RA 5L3BA 2BW0A 1E2LA 2Z1MA 3HZZA 1KFMA 1OLUB 1RPTA 1CR0A 1ZDMA 3PK0A 4N40A 4PSAA 5TNXA 1Z2PX 3SWYA 2BL4A 4HH2A 3L7NA 3S2GA 3SZ3A 1E2FA 4DLPA 3AVWA 3FR8A 3GH1A 3TIFA 2JFOA 3VO9A 4I1VA 2WHRA 2P5SA 2H2AA 3OWOA 4FUQA 4U9HS 4CEJB 2PUSA 3NWPA 1XK7A 3O1LA 3A2AA 1Z17A 2D5AA 3BA1A 2B5OA 3V4WA 1CY4A 1X7ZB 4HF7A 4RD0A 3VPBA 4QNHB 5B1OA 1ZSVA 1S3GA 5GADl 5TPZD 1R5JA 4OV6B 4WXHA 3UGKA 1JX6A 2ZR8A 3NATA 5AVRA 2HSDA 4IEIA 2Q1YA 3JQ8A 2OXEA 4RADA 1XLTA 4HD8A 5JZVA 3QY9A 1PYGA 4DUZB 3DCYA 3EVCA 2AQHA 1FB5A 3QJYA 4ZQEA 3H1LJ 2VJAA 2F95B 4RABA 1LTIC 6CHYA 4ZZ0A 4LZZA 4TYWA 3K2IA 1QIEA 2WT7A 4P30A 1YHYA 4U9UA 5D1HA 1TQ8A 3B7WA 4BFUA 4FLTA 2DYSB 4Q21A 3H11B 2R4UA 1AJQA 4I1YA 3ZW8A 1KFCB 1IEQA 2KMLA 3G80A 4UXJA 4EA9A 1E66A 4X95A 2PSEA 3NV9A 2J08A 1HT0A 2CAZC 3HU5A 3V4ZA 2GXSA 1T3HA 2CNBA 4OK6A 1KY2A 1ZBDA 1XAIA 2AD5A 1SKBA 2PRSA 2XYPA 1XCPA 4MTFA 1KIAA 2GD0A 3HFSA 5DN6D 1DEHA 1U2TA 1JFVA 1SQBJ 5DH9A 4LDZA 3NCTA 5G53C 1L5NA 4F21A 5F2VO 1W7AA 1KB9I 3NPAA 5LDDC 1WSBA 2E89A 4YY3O 1ROPA 2BGIA 2PL1A 3ABQB 3CYFA 2DUUA 4QT0A 4CM4B 3CO0S 4W6QA 1IFMA 2VHZA 1EZVG 3B5ND 2KOGA 1R5BA 2FW7A 3HE5A 1HTLC 3E0QA 4BVAA 3RYIA 1G5HA 1ZH0A 3AXSA 5EWLA 4TS3A 3JD2A 2JGIA 3B1KA 4RJLA 3AP2A 3HVKA 4Y2XA 5F5LA 2OWEA 4L57A 2FMHA 1RKBA 4H2DA 5FNZA 3W8RA 3H1LH 3TNJA 1WQ1R 3BWXA 1XX6A 2WJWA 4AJOA 1RC8A 5C53B 4RLHA 3BRVB 2HLDA 4AYXA 4NHEA 1HTTA 4KXNA 1YZNA 4YRNA 3QOFA 3T6KA 3QOWA 3L8GA 1G0NA 5AVRB 4HNUA 2E4UA 4YCAA 4HB1A 4TTIA 4PPGA 1ID8A 4OH8B 4CV0A 2N74A 3TS1A 2JDIH 2NUPA 5DLPA 4CMAA 1W88A 1NBMA 2QD1A 1U0BB 4L27A 3COPA 1PJSA 1SIWA 4W82A 2EILB 4RM2A 4WZAA 2WU3A 4CKYA 5CGQB 3VYVA 5D01A 5TJHA 4F9GA 1GIAA 1D6SA 1NW9B 4TLEA 2AMJA 4C30A 2I78A 4L78A 5FB3A 4EEKA 1QBZA 2XKAA 2A9PA 3IKJA 1P7GA 1YZTA 4I50A 4H18A 1A98A 2WD7A 1XZAA 2QE6A 1KP9A 3HUSB 2WE7A 3L4FA 1JEOA 2KYRA 1FQKA 4LY3A 2QUKA 3ID6C 3A6ZA 1U2EA 1E1CA 1UDAA 3DB2A 3ZV7A 2VNAA 2PSFA 2WVHA 3UNXA 3E5HA 3SJQC 4PG4A 3RV3A 3RC9A 1JN0A 2IXEA 5BW5A 5LP6F 1DP4A 3H1HH 5EKSA 4W4TA 5REQA 3ED1A 3WZ2A 3NBFA 4AWAA 4DNFA 4EJMA 3FROA 4ZQBA 4DMGA 3HS3A 5A9SA 1LWUB 2BGRA 4M1WA 1W2EA 3SQXA 3KZIH 2Q49A 4FFKA 3ECCA 3M06A 1GUDA 3O0DA 4I9GA 5DCLA 1YBFA 2GN4A 4KSBA 3UB3A 3VFDA 4CTJA 4MP8A 4KR2A 5E0KB 1BEUB 5I47A 2JJ1A 3NRJA 3GN2A 1WMFA 3BXHA 3C7TA 3QJ5A 2ZCVA 5EERA 4ZVPA 4E5DA 5JNVA 2PUEA 3D7MA 2GBOA 121PA 3LAWA 4BRYA 4I2NA 5KOHA 3NG1A 1LWUC 2PBZA 5KVVA 3OICA 4JB2A 4XR4A 1GZUA 1SKAA 3V46A 4DV2O 2GNOA 3JYLA 1E8DA 4D0SA 1AN0A 3FGOA 1XTZA 2WM3A 2ZT9D 1VQMV 2R5DA 1URQA 3T7DA 2X0EA 3WIOA 4HDMA 1QIJA 2O52A 5FWYA 3A6FA 3UBTA 5EVJA 3VR0A 1RBZA 3KALA 4CBVA 1X39A 3K32A 2QSAA 4IIDA 3T3OA 4QDKA 4B7UA 3L74H 2KS1A 5EMNA 1V37A 1QO7A 2Y8EA 3GYGA 2D4HA 1E2MA 1XCLA 5GTHH 1MRSA 2FPXA 1HE1C 1VG1A 3E2EA 2IU4A 1KEZA 3R3UA 1RWXA 2H07A 2OWOA 3EFBA 1PU2A 5AK5A 5MGBA 3AVTA 4DR1B 1P0IA 5KWSA 2B3TA 4I4TF 1T1GA 1KB9H 1XEXB 4X63A 1ENOA 3B8MA 3IIIA 2ATEA 3CZ5A 4NEHB 5KCMA 4DABA 2P2UA 1RJFA 4Z5XA 3FDFA 3V97A 3T15A 2PH3A 1HNXO 1T13A 4FJ0A 2C54A 3NBZC 1EXDA 1X7ZA 1AB6A 2ACKA 1XEWX 2BYTA 4JI8O 3AUFA 4MW4A 5DM1A 3RVKA 3CZ9A 5J4LA 1TVMA 3LV8A 3OM3B 1G3IA 1WPQA 2ZWPA 3QA3E 4HNAA 3CD6P 3R6WA 5AI5A 1K34A 3UJAA 4BJ5A 1CY0A 1RHKA 1YCHA 1ZGZA 2BGLA 3RAEC 2ZITA 4D44A 1JHUA 3M8AA 2XA2A 3C1AA 1D5NA 2XKJE 3KV1A 4DHEA 4CLRB 5HQTA 2YJ3A 4MA5A 4CS4A 3IAOA 4U7WA 1F0NA 2GAIA 2NPSA 1UODA 2G0NA 4FR0A 4DFDA 1MB9A 2XE6A 1VJCA 5M5BA 1N36B 3EF0A 5I4IA 5DI3B 4BRSA 3IOBA 1I94B 1H2BA 2MSEB 4PLHA 1PL5A 4UATA 4RQFA 4WX2B 5MN5A 2C7OA 2GEKA 2NQ8A 5AW9B 2WIAA 4BGDA 4QUGA 1PD0A 3R74A 3MP7B 1CB7A 4QJ3A 4BKMA 4RVHA 1R4NA 5CFLA 3ASNB 4W63A 3ESYA 1X86B 1XJWA 3F6BX 4DCGA 1K92A 2F1JA 2LR2A 2HYDA 4MVRA 2ZRQA 3IBFA 1VECA 1HT1E 3QVGA 5DNVA 5H59A 4ON9A 3VR2D 3VSEA 5DLEA 4FE7A 1HG0A 3ZZNA 1UKCA 4MS2A 4CNQA 1F8YA 3VMFA 3CWBG 2X9NA 1NFFA 2AZTA 5I7WA 3YASA 3T1TA 4E5VA 2VYFA 2YWBA 1ORWA 1SWVA 2FOIA 2ZWMA 5IBRA 4N65A 4DPLA 3L74D 2PS3A 1T0IA 1WXWA 1JVMA 2BH9A 3W5JA 3QKIA 3ANNA 4Y6QA 1FUKA 1FTYA 1F17A 1X9IA 4B4KA 3GJSA 4PJ0H 1KYVA 3IR7A 4QGHA 3TNFA 3HJGA 1CUYA 5K0ZA 3RCBA 4ZO4A 4Z3DA 2DWDC 2GUZA 2IEYA 4P5PA 5KJFA 5LQJA 1LK0A 3CMAV 1D7MA 3H8JA 4O4IB 4MR8B 4Q9JA 3CCSV 3HGMA 3LTNC 2B61A 4UE3S 4R4LA 1J9EA 1ECBA 1XZKA 1FNCA 2CDCA 3CQ9A 3EWIA 4IRUB 5TQVA 1HGXA 4MIOA 5AOBA 5CEEA 4C2TA 3JYPA 4G25A 1XTUA 3VU0A 2UAGA 3KDAA 3NBMA 3VOSA 1I13A 4BP9A 1K8ZB 5K0TA 1W94A 3OZXA 3E7FA 4FSHA 3KUKA 4Q39A 4ND3A 1ZOOA 3O8RA 3ENZA 3JWGA 4FZ1A 3PTZA 3AIMA 3DAGA 2WYHA 4TUYB 2OFXA 2JD1A 3IA7A 2B4RO 5ANRB 3Q6IA 5C1IA 1S2NA 2OYSA 1PD3A 2W6JH 5AVSA 3E23A 3ZWNA 1E5XA 4XVHA 1W25A 2O3RA