2QM7A

Meab, a bacterial homolog of mmaa, bound to gdp
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
323
structure length
314
Chain Sequence
b'LPDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPGAGDELQGIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase/ATPase
publication title Crystal structure and mutagenesis of the metallochaperone MeaB: insight into the causes of methylmalonic aciduria.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Chaperone
total genus 121
structure length 314
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2qm7A03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2qm7A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qm7A02
4JVMA 4LV8B 2C98A 4MUAA 3X1XA 1Z28A 2OG2A 1W48A 3Q3JB 2IXEA 4JLPA 1UBFA 2OO7A 3CB4A 1XCMA 5FPYA 2X1VA 2C04A 3QIAA 1JEDA 2IBMA 2V6IA 1P3JA 3AKYA 2IHYA 5H68A 2BBSA 3X1YA 1AS3A 1QG2A 1XBTA 4KLZA 1SQ5A 4M53A 1XEFA 2FNAA 1TMKA 3AF2A 3FTQA 3AVVA 1N6RA 3AKEA 2WJHA 4U7OA 2IW3A 5BYKA 1K8RA 4GBMA 4HDOB 1D2EA 4WZBE 3U6KA 1VYVA 3LIEA 1ZC4A 1RFLA 1R0ZA 1R6BX 2ZVPX 3C41J 1G5RA 2PZEA 2LKDA 4AD8A 3RNLA 1N3BA 1LV7A 2GCOA 4TMKA 4C0SA 2NO9A 2DWQA 4EPTA 4EOTA 4D4JA 1X86B 2OCYC 2XJ9A 1WBDA 3HU1A 2F9LA 2XITA 4P33A 1Z63A 1MKYA 5L3SA 1UEJA 1NIJA 3A1SA 2WIAA 4RZXA 1VHTA 4Q1CA 1E2QA 1M7BA 1U81A 3WMFA 1XPOA 5FBQB 4F93B 1W7AA 2FF7A 3L35A 5AW9B 3BIFA 4UKDA 4A8JB 4D4LA 3A4LA 2WPRA 2A5JA 2W6JA 3F3YA 4C0QC 5AVVB 2CHGA 3NHBA 2CK3A 3WMEA 2YC4C 5APXA 3V4FA 1P73A 2XXAB 2AK3A 4FMDB 2V55B 2BMFA 1JI0A 4M1SA 3GLGE 4HAVA 4MITA 4II7A 5D3QA 1DARA 2ZU0C 4IVQA 3TSWA 1EFTA 5DN6A 5FI0B 1R2QA 1SULA 1OKKA 2QP3A 4HZUA 4AG5A 1KI9A 2AD1A 1NBMA 4A4DA 4B86A 5AVQB 4JKYA 1E0KA 3VR3A 2FSHA 1KNQA 2BVNA 2IYSA 2IPPA 3TMKA 4EPVA 2ZJ8A 2VEDA 2QQ0A 1G7CA 4UQOA 1IHUA 3MCAA 1E2HA 2HJGA 5FOSA 4MKIA 2GCNA 4PZYA 5LBIA 4HUQB 5E7IA 4RZ3A 2ZJ2A 3V9PA 2F55A 2J7KA 5EUQB 4ZIRB 3REFA 3EZFA 2TMKA 4PC2A 5FL7D 4I6MC 1VCIA 3GFTA 3T12A 3I62A 4TYPA 2OSBA 3IEVA 3FHTA 5JI3E 1YE8A 2X2EA 4G5QA 4HB4A 4TYQA 5F9HA 2WAXA 3BRWD 2Q9AA 2YNMA 2ZYVX 2DB3A 1T5IA 3T61A 5J4KA 1E6CA 1VG1A 4OHYA 1XXHB 1XZQA 4IDNA 2ZITA 4KBFA 1WE2A 2F1HA 3T1VA 1YR9A 4CEIA 2ZUDA 4P3YA 4IOJA 3QPVA 2FH5B 3DZDA 5E3HA 1TF2A 3MAAC 5TVKA 1QHSA 1ZW6A 3KB1A 3B13B 5C2JB 4Q7JB 3KTAB 1G3QA 2WPDD 1C4OA 1FNNA 2HCBA 3DOFA 3CRRA 1C1YA 1OFHA 2HV8A 4TLBA 1NWQA 3THYA 4V0MA 1DAHA 3TRFA 1E98A 2WHXA 3VTKA 4S2EA 1TQ6A 3GPLA 2Z4RA 4ZDIA 3BXZA 2C8VA 3F8TA 3GJ0A 1YRAA 1PLJA 2IWHA 4A36A 2AXNA 1NL3A 2DWOA 4I1VA 1G6OA 2ZI6A 4B76A 3ICQB 1NVWQ 1S9HA 3B9PA 3HP1A 1QVAA 2JEOA 1NSFA 3K09A 1AS0A 1BS1A 2QPOA 3QENA 2Z83A 4TT3A 2ZRCA 3O47A 1II9A 4MYCA 3Q85A 2I1VB 1R0WA 3ZRVA 3K8YA 3QNUA 5KNDA 2HF8A 4IHQA 5BYJA 4LDJA 1XD8A 1TEXA 3JVUA 4WXPA 4ZCLA 3VU9B 2BJVA 2H7HA 1AZSC 2JJ1D 5C4MA 4PAMA 4GP6A 3WBKA 1XCGB 3LW7A 3Q8XB 3I72A 1KAGA 4JLDA 5FR1A 2YYZA 3LLUA 3EIHA 1XXHE 2VL7A 4TMTA 4A2QA 1CJTC 5B1OA 3GCGA 1E9EA 1DBSA 3AF4A 4GPTA 1DAIA 5G41A 5EXXA 3W34A 4NZYA 5KHOC 3NC1C 5B64A 1CI6B 2G3YA 2VSXA 4LJ6A 5HR5A 4C0AC 5IF9A 1G16A 4RD2A 4E03A 4YC7A 1SP4A 4QL3A 1G6HA 4QGAA 5JLJA 4QHSA 1DE0A 5AW0B 4DIDA 1TQDA 2FZLA 1CBUA 4XD7A 1FX0A 2BWJA 2B8TA 1Z29A 3GLHA 1NRJB 2C9LY 4MYUA 4R71A 2FFQA 2PZFA 4GP7A 4OK6A 4W5WA 1E2PA 1UADA 5FOXA 3HPRA 2BCGY 2H1LA 1EX6A 3QF4B 3ADBA 4LX0A 2F9MA 4CT4B 1G9XA 1HA3A 1XMVA 3FKQA 3CX6A 4WW0A 5JBQA 4KSBA 4XE5B 3ICEA 1NN0A 2GJSA 5BWMA 3ZQ6A 1NLYA 1H8AA 4OQMA 5JCZA 3OIUA 4NKRA 4R9UC 5DI9A 2ZJYA 3A36A 1CRQA 1GUAA 1WB9A 4UXIA 1P5ZB 1GK4A 3SQXA 1XMSA 3AKDA 4JAUA 1YZUA 2Z0MA 1FOSF 4DLTA 1T8TA 2E87A 2YO3A 1G291 3OIYA 4I1SA 2Q9BA 5D3MB 2FPLA 2PL3A 2XSZD 1QHIA 4ILEA 5APTA 1S8FA 5B58C 1PZNA 2NZJA 5FH9A 4HEJA 2OESA 3NIBA 5L3QA 5JS7A 4QGHA 3CLVA 4XSGA 1UBGA 4Q19A 4ERNA 2I4IA 4A15A 4PSVA 2ZSAA 3K53A 2IT1A 4AYTA 2HUPA 2CL6X 2GNOA 3FKSD 3W3ZB 3L0SA 5C18A 3MLEA 4OKSA 4HLDA 2JJLA 3FPAA 4D2IA 1ZBDA 3B85A 1J90A 2CLSA 4LV6A 1KY2A 3U3OA 1GKIA 3PEYA 3QXCA 2VRWA 3B60A 3EZ2A 3KJGA 3RSOA 2WOOA 1AQYA 4EUNA 4BEJA 2D7DA 1KJWA 4DSUA 2ODWA 1Q12A 3EC1A 3PR1A 1CKEA 2FFHA 5SZHB 3VR5A 1KJYA 4KJZA 2IYXA 4IDOA 3CRW1 2OFXA 2H8KA 3AM1A 2NQ2C 1G1MA 3TNFA 3U3MA 2VBCA 4Q1EA 4ACAA 1H89A 5JHGB 2O8CB 4W5JA 1W4CA 1XEXA 4TN1A 1BMFD 2C5LA 4ZKDA 2ZVQX 1E0JA 2ATVA 4Z1MD 2CNWA 1I2MA 4CIDA 3BOSA 2RCNA 5C1BA 4C4PA 4JVNA 4IOMA 3AVWA 3VTPC 1FUUA 3O8ZA 2DY1A 4ASUA 4Q4JB 3GJ7A 5J4LA 4UJ5A 2Q21A 4OQNA 4ACBA 4PSAA 1EWRA 2F3TA 3OAKA 3AV0B 2OBMA 3NH6A 3CNLA 2QMOA 1G7SA 1LFDB 1XP8A 3AKCA 1A5TA 1NN1A 4TLEA 2RGXA 4G3XA 4URZR 4XTCS 4BLTA 2J87A 4I1UA 2QAGB 4Z54A 2C9NY 4WVFA 1KI6A 1YR6A 5HE8A 2J0VA 2O8BA 5FUXA 3CM0A 221PA 4FIDA 4P0TA 4TMWA 4QHYA 1JR6A 2ZRAA 3K0EA 4MDEA 4HLCA 3HYTA 2WIBA 4LBYA 1NIPA 4C30A 4BUJA 4PPFA 2GZDA 2O8FA 4MRRA 1DVRA 1R8SA 3ADCA 3SJAA 1F6BA 3K0CC 1XTSA 1ONBA 5AW6B 3IQXA 2Q3FA 2C96A 5LD2B 3V4RA 3W8RA 1Q3TA 3SC3A 2IHBA 2CEAA 3FMOB 5CJ2A 4D26A 1XTJA 1QZXA 1RVDA 1AN0A 1G3MA 4FN5A 4EKDA 4B2LA 2ZE8A 4KFUA 2A9KA 1Q1EA 1MRSA 3BFXA 2B6HA 4O2LA 3AP2A 1NJFA 4GNKA 1OLOA 3O8DA 2QP9X 2A78A 4HLQB 1L4UA 1PUIA 3EWAA 3KZ1E 2VRSA 3OEHD 3ZIAD 3ZS9A 3ZZ0A 3IIKA 2D3WA 1YZTA 2FGJA 2PEZA 3U44A 5AVXB 3V4QA 1SXJC 2ZE5A 4OJQA 4F38A 2ZRKA 2YVUA 4LPKA 2H5EA 1T6NA 1MO6A 1MRNA 2OV2A 1W1WA 4PHTA 4RCYA 1F2UB 2VHQA 4CEHB 5FI1B 3MUFA 5FTLA 4AYWA 1DAGA 5AUNB 3K70C 3BH7A 2DFKB 2CCGA 5EE9A 3KKQA 1U98A 3ZRXA 2KB0A 1COWD 2JASA 4D4KA 2FPMA 3AVPA 4TQUS 2AXPA 2YOFA 1CR2A 2CJWA 4QBFA 2GDJA 4W9MC 4X8OA 2V3CC 4GRAA 3PQCA 4E07A 4M1TA 3SYKA 3DPUA 2QTFA 3SN6A 1E2GA 2VP5A 3L0IB 3KQNA 3LXXA 1FAVA 4W5HA 2MSDB 4PC1A 3SFZA 4B43A 1OB5A 4C0JA 4QPKA 1SVWA 5J4HA 2PJRA 3BE4A 5E4FA 1NVXQ 5AJVB 4HAWA 3LNCA 3QE0A 4M9SA 3CPJB 1TL7C 1U2RA 2OFWA 1S3SA 1E32A 4Q7LA 3PUVA 4WZAE 2VSFA 1ZM7A 4A1FA 2REXB 5DI3B 3SWFA 2AD5A 2XTMA 4ABYA 2QENA 2YV5A 3IILA 1KYIA 2R65A 1Z22A 1FOEB 5EP3A 4DUGD 3VR1A 1T3HA 1ZM3A 2BIFA 1KK1A 4HAYA 4DT1A 4Q48A 4DIEA 1Q22A 2PT5A 4JT2A 3A6PC 1Q44A 4DLYA 2HLDA 1Z2CA 1IN5A 2RHMA 4JJZA 5KSZA 4C7NA 4LYFA 1IN8A 1DS6A 1OH5A 1G20E 2ODBA 3G82C 4MRSA 4V03A 4A0FA 1E9CA 1TTTA 3B1VA 3DDCA 1YKSA 4RKEA 4B74A 2RB4A 3F0TA 1KK3A 1CJKC 3P1JA 4FMTA 2IS1A 4MDFA 3Q5DA 4RZUA 3QKSA 1RRFA 4LJAA 4QBIA 3BS4A 3QKUA 4JLJA 1Z6GA 5FBRB 2E9SA 1FPMA 2J0UA 4FI3C 1G8FA 4IFBA 1N6KA 2OAQ1 5JEEA 1F5NA 1SVLA 4IRUB 4XOIA 3ETLA 1EFRA 2IA5A 1OXUA 3MGNA 1PLKA 1YR8A 1OIXA 2JJ8A 3FMIA 2Z5IA 5KSPA 1IJEA 2QPAA 1ANKA 4ITRC 3BB3A 3K0AB 1D5CA 2D62A 3SJCA 3T34A 4B32A 4FPPA 3PJRA 2Z4SA 1XJCA 4DB2A 5KDDA 1XJ0A 2ZRBA 1T4GA 1OXXK 2NOAA 1JQJC 1XTQA 2G0TA 3KDSE 4M2LA 4NONA 4PQRA 1CR1A 1ZD8A 4XVRA 1J7KA 5EXTA 4ZDJA 4MUBA 1ZNYA 2J0QA 3EZ9A 1LW7A 2HT1A 4PHHA 4OHWA 3M9BA 4KXFB 4LPSA 4NCNA 1OPXA 1R5BA 2E42A 2AL7A 2W6JD 1KDTA 4DDWA 3OIWA 4HDQB 2ZYTX 2ZI4A 1J8MF 3VR2A 4F92B 4F4IA 3H0KA 4MKGA 4BFSA 1Z07A 4E09A 1S96A 4LWZA 1CR4A 1S4QA 3A1UA 3QF7A 3GLFA 4ZKIA 3CZPA 4UNNA 1JJVA 3EIEA 2QY9A 3SR0A 1DO2A 5ANRB 3WY9A 2ZQ5A 1S0UA 3NWJA 3ZVRA 2LCFA 2CHQA 1GKYA 5DHFA 2QTVB 2QGZA 5JJLA 2R3CA 4JVSB 4LJ7A 1IBRA 3H4MA 1MUUA 2NG1A 3CF0A 1OF1A 3K09C 5FTNA 4TLDA 3W5JA 2VHJA 1R0XA 2F1IA 2O0KA 4C2UA 2IEZA 2XOKA 2GXUA 3FGNA 1QHHA 2OILA 2RGGA 4JT4A 2J7PD 3PFIA 3W9YA 2VLIA 4TMVA 5TMPA 1LS6A 1W36D 4QGGA 3B8EB 1ZIPA 2AFHE 1M8PA 4CDGA 1P75A 3ZZTA 3A37A 3TSZA 2BCJQ 2FFAA 3L82B 4B3DA 1GILA 2ZTSA 1FZQA 1IOZA 2REOA 5HKKD 3EPJA 1AJEA 5H1YA 2WSMA 1SVIA 2JCSA 2WJYA 1GNPA 3AF3A 5FTMA 1RZ3A 2ZSFA 2BOVA 2WJGA 5JWRA 5AVTB 4EJSA 4OYHA 1QVRA 4B6EA 3EASA 3SU8A 3FDIA 2V7QD 5B30A 5A5GA 4O0MA 2IYRA 3R8FA 5DYGA 1TADA 1YZKA 3BB4A 2BBTA 1MABB 3V5BA 4O2RA 2RGAA 3PITA 4LHZA 1VIYA 2ZXUA 4WZ6A 1VECA 2KP8A 3RABA 2P6NA 1W36B 4BPBA 4P4SB 3P27A 3CF2A 3OHMA 1EGAA 4YXWA 2BDTA 3I5XA 5AW1B 2QROA 1NKSA 1SHZA 4OQLA 1DAFA 2AWNA 3CH4B 3FVQA 2QPTA 1L8QA 1NSTA 3AF1A 3ZDQA 1X1RA 4P32A 3H84A 2PZGA 1QHXA 2GTPA 5CDFE 2XJ4A 2WMOB 1F60A 3K0SA 1Q1ZA 4A82A 2WVJA 1XJQA 4OHVA 3ZQJA 2Z5HA 1XNJA 3J81k 4CEIB 4ZV4A 4M9QA 2QT1A 4RD0A 3T1OA 1KKLA 1N5IA 3OF5A 3SE0A 3KKPA 3ZS8A 4TTQA 3I32A 3UIEA 3LA6A 2V54A 3NTNA 1XTKA 1M34E 3L0OA 5JRZA 2JLSA 1EFUA 1KMHB 1OHHA 3OE7A 4Q4HA 1OXSC 4A8JC 4CEJA 1NN3A 2PJZA 2JDIA 2I1QA 3KJHA 3TYYA 4IXMA 1SVOA 4B3CA 2Q9CA 5EE3A 2J45A 4TWZA 4GZLA 4KO8A 4NYMQ 2FWRA 1CU1A 5AVYB 2NPIA 3ECCA 5JCPA 4V0OA 2W2XA 1P72A 2AWOA 4M1YA 1LF0A 4YMSA 4A0HA 4B75A 3FHOA 3P26A 4Q4AB 1YR7A 1XX6A 2XX3A 4D82A 3W8NA 2VIIA 1ZCBA 4QKQA 3LD9A 4C3ZA 3TW4A 2JLQA 5CM8B 3AQ4A 5AW2B 3TJZA 1R0YA 4JL8A 3Q72A 3I3SR 4P31A 1P2UA 4DLRA 3OFNA 4AY2A 2D2FA 1SXJA 1MV5A 1KQLA 2NO7A 4EQ6A 2BKEA 4Q66C 3U3RA 3BERA 5TARA 3TUJC 1ZINA 2B8WA 3C5HA 4URXR 3TNUA 3GLIB 3VMYA 1D9ZA 4PFSA 4YMTA 4I99A 1HT1E 2ZI7A 3SJBA 2FDCA 2C78A 1FL9A 3M9HA 1GG2A 2PX3A 1WA5A 3T35A 3SJZA 1KI4A 5FPHA 4ARZA 2IYUA 1VCMA 1J2JB 1S9KD 5KPDA 4C7OB 2DR3A 3HTKA 5APQA 1UKEA 2XTZA 3ASYA 3UMSA 3THXA 1KDRA 2P2UA 3LRPA 2WSSD 4IKEA 5KO2A 1Q3HA 1E0SA 1S3GA 3SYLA 4B6FA 1UBEA 1EK0A 3THWB 1YJ5A 2Z43A 3LFUA 1WF3A 4PAQA 2CCJA 1BOFA 3WNBA 1AZTA 5AW7B 4PAOA 1YVDA 1G3UA 2R5DA 1E94E 5FOWA 3A1WA 1IXZA 3E2IA 2EYQA 4PTLA 821PA 1MO5A 5FOUA 3EPHA 2A5FA 3QI2A 1Z6AA 1KI1A 2CCKA 3E70C 3KB2A 2GZAA 1D2NA 5KNBA 3N2EA 4P4UA 1JECA 2LFRA 4G0NA 3SNHA 5AUPB 2GILA 4M22A 3DMDA 4AI6A 1XTIA 4MGKR 1OFIA 2ZRIA 4JLNA 5DH9A 2VA8A 3U4QB 4NYIR 5CIWA 4GZMA 3A0RA 2B21A 4D6PA 2P67A 4YDHB 1CRPA 4MA4A 2A30A 4RFVA 3KJIA 4TL9A 1NVVQ 3QVUA 1T3SA 3U5ZB 4IFEA 1YQTA 1KKMA 1KI8A 1RE0A 1KO1A 1ESNA 3GLIE 3VNUA 1M1YE 1SKYB 4GL2A 2V9PA 1MH1A 2XZOA 3PIRA 5EJEA 3FYHA 2IUTA 1OYWA 5FFMA 2QNRA 5AK0A 1L2TA 1Q57A 3SEAA 2W0SA 4POAA 1OW3B 1W0JA 5L3RA 4LV5B 1NI3A 1ZM9A 4BLRA 4I4LA 3SZRA 1KNXA 2XNDA 1N6HA 1P9NA 2HJVA 1Z0DA 2VQSA 4MYTA 3Q7PA 1UFQA 4FINA 1OFUX 1KMQA 3RS5A 4AURA 1NY5A 1KTVA 3X1WA 3ZRWA 5IK2A 2VF8A 1OXVA 3GLHE 4L5BA 1AGPA 4RVCA 3PUWA 3CPEA 3M0EA 3HR8A 3W6NA 3KUCA 1N6LA 5JMTA 1G41A 1HUQA 4Q1DA 3IPYA 1A02F 2A5GA 3UANA 4QRHA 1WP9A 2VHUA 1EX7A 521PA 4DWJA 2OBNA 2BMDA 2J5XA 4OL0A 3ZVLA 1KSFX 2R6GA 4DRZA 3BB1A 4MGIR 1A02J 1AK2A 1GL7A 4Q5IA 1V43A 3IGFA 5FR2A 2RAPA 2QN6A 2JIZA 3TW8B 1HUCA 1WQ1R 1S9KE 1NVUQ 4QGFA 4EPRA 1JR3D 3NEYA 4WIAA 3WYFA 3U7HB 4DLZA 1OFTA 4YONB 2DFNA 5APVA 2R32A 1HH4A 4ESVA 1Z6YA 3B1XA 5JSZA 1RIFA 3DVLA 3DGEA 2BBWA 3TVTA 5JS8A 3ZVMA 2IEYA 3I73A 2ZYUX 1UJ2A 4DLUA 2OHFA 3TAUA 1SKYE 3A1TA 3B1WA 3I5YA 1Z83A 2PCLA 2WTYA 5CB8A 2JLVA 3Q7QA 4M1MA 4KLNA 1CSBA 2PCJA 3CR8A 2QMHA 3NG1A 5KNCA 2VHCA 2VO1A 3QXSA 4Y0VA 3BC1A 3RWMB 2C95A 1JQLB 3CNOA 4Q00A 3LO5A 4US1R 2WWIA 4M4SA 4OK5A 2JGNA 5JI2E 3A2AA 4GI7A 3RANA 1HWTC 5TDHA 2KI5A 1NY6A 1XMJA 3NBXX 5AW4B 1GNQA 4UXJA 3RRYA 2W0MA 3AEZA 3EPKA 5GVSA 3PUYA 2FX3A 2O52A 4NCHA 1FW6A 3C15C 3U2QA 5DLQC 3ZYCA 2XZLA 121PA 1T2KC 1SHKA 3LV8A 1G5TA 2IL1A 3T06B 1GTVA 3NXSA 2WM9B 2O8EB 1FTNA 3V00A 1L4YA 1A4RA 1E2DA 4RD6A 1BH2A 4QNMA 1G4UR 2WJVA 1RJ9B 3NBYC 1RRGA 1JOYA 1IQPA 1HTWA 2W2VA 3IUYA 2D74A 3I4LA 5EP4A 3VX3A 4TYNA 5AW5B 3CR7A 4F7WA 2E43A 2XNSA 4TL8A 3HE5B 2OUKA 4Z8XA 3THOA 2EWWA 2Q7CA 3NFQA 3TR5A 4JIMA 5APWA 2IC5A 5JWOA 4PC7A 3CWQA 3LWNA 1LNZA 2NTYC 1E1QD 2FA9A 2YWFA 1EG7A 4C46A 2FSFA 3AGPA 4RD1A 1AA9A 4R7ZA 4NCJA 4HAUA 3B78A 1CJUC 4LGMA 1G7RA 3A5TA 5JECA 3IIMA 2ZRMA 1TF7A 1E2IA 1XDBA 1BIFA 4IXNA 1P4SA 3B1ZA 2Q0HA 3D7MA 4BIUA 4IVRA 3R9WA 3LBHA 4JBYA 2WWXA 4XJXA 5EZ6B 2G1KA 2ONKA 4US0R 3QJYA 3DEFA 4KU4A 2LKCA 2ZE6A 1E3MA 1W46A 3DOEA 1IXMA 1JR3E 1G17A 4XWAA 2IF0A 4NL4H 1IY2A 2ZRPA 3W6PA 1CJMA 2ZPTX 3NBZC 1IN6A 3RS3A 1X1SA 5E95A 4A8JA 4LOAA 1CP2A 5L3VA 4C2TA 3A1VA 4KAXA 2RGEA 2OLKA 4NTZA 3B2EA 4EFNA 2L0XA 5HCNA 3PVSA 4UNSA 2IUSA 4IOKA 4DCVA 1QHYA 1FMJA 4F4CA 1LS1A 3W90A 3KKOA 1HQYE 4TL7A 1E2FA 1X6VA 4LC0A 3K9LA 1G3IA 3VKGA 4TSFD 2QZ4A 4NMMA 4GKGA 4GT1A 1N6NA 4MRNA 3WNDA 3SI7A 4U7DA 2QBYB 4XWKA 3SBEA 2WWYA 1N5KA 5DE3A 1WRBA 5CMZA 2R9VA 3IBGA 3BWDD 2FJUA 4OHXA 3TUIC 2FG5A 3A3YB 1IN4A 2EWVA 1UM8A 3H2YA 3M06A 1QG4A 1ZAKA 1M74A 2NIPA 4HUQA 5AVUB 5K8UA 1XPRA 1SLQA 1J70A 3VAAA 2W27A 4EJSC 4ZIRA 1UBCA 1QBKC 3QPWA 4YQFA 4I2LC 3P4XA 3PENA 1IJFA 1KO4A 4D0LB 3DL0A 1J8YF 4LHXA 1FTSA 5AJYA 3G0HA 2MMCA 1ZM2A 2J3EA 3KKNA 4LY6A 2J0UB 3FHCB 1BYUA 1S2MA 1S1MA 1XXHA 1H8HD 3MMPA 5JFGA 4TLCA 2V1UA 2F1RA 4TYWA 1YHNA 1KJZA 5SZIA 2WJJA 5DISB 3CRQA 4NCIA 2XTNA 4LJ5A 2R6AA 3IR9A 4X8MA 4QHTA 2QG6A 2CVHA 4LYHA 2H7VA 4AK9A 3OAAD 1F3OA 1R8QA 1W0KD 3KTAA 3NBFA 5AR1A 1WDTA 1RRCA 4UNRA 3OEEA 3HR7A 2QSYA 1AQUA 3CUEF 1Q1BA 2BV3A 3MJHA 4A0GA 3NDBB 2EU8A 1X8KA 2ZJOA 3SHWA 1Q0UA 3VMXA 5FL7A 2F7SA 1ESMA 3GMTA 1ZU5A 2R8RA 3AUYA 4MRVA 3R9XA 2W83A 4L16A 1XFAA 2ZU6A 2ANBA 4GSYA 5AWFC 2Z5FA 2EFGA 3IPXA 2ZRGA 4HAZA 4M9XA 5KOYA 4KYUA 5IDVA 2WT7B 1P61B 4L9WA 3TIFA 3EPLA 1E1RD 3GLFB 1F2TB 3DMNA 2FFBA 1GWNA 2DFTA 1E79D 2QT0A 1VCNA 3PUXA 1G4AE 1AKEA 2QRZA 2HYIC 2IYQA 1JB1A 3VU9A 4B33A 5FBWB 5JRJA 2P7JA 3ZZUA 2DBYA 3RAPR 2WPDA 4LBZA 1A82A 2VSOA 1E9RA 1DO0A 4Y0AA 2D06A 2VTKA 4FMBB 4R2IA 2WTUA 4JJKA 4OI2A 1HYQA 1UEIA 2A2ZA 3TKLA 2W58A 3VR4A 2O8DB 1OIWA 3FB4A 1HT2E 1CI6A 2F43A 4HUTA 1SGWA 1XD2B 3VN0A 5CYOA 2B92A 4RD3A 2ORIA 3UMFA 1KAOA 5JJIA 3M91A 4RFSB 1ZJ6A 4N0DA 4BRUA 4WBSA 4G01B 2W6ID 4KBGA 3R7WA 2FSGA 2VYFA 2GESA 1IY0A 4PPQA 5SZJA 2G1JA 4N1AA 4KI0A 3U3JA 4MT8A 1ZD9A 3TSOA 3P20A 2WKPA 2EYUA 1E96A 2HYDA 2NZ8A 4IDHA 1RC8A 4AYCA 2WWFA 2WKRA 3QG1A 1C9KA 4XIGS 2Q5UA 3QF4A 3EAQA 3LVRE 2PLFA 3S1AB 1GFIA 3ZLJA 3LW8A 2GCPA 3PXGA 1GL9B 2WWGA 4PX9A 3LBNA 1U94A 2BEKA 1Q21A 3PEWA 3GLFE 2OXRA 4DCNA 1I4LD 4C7OA 1VIAA 5KDLA 3AP3A 1KZGB 4KP4A 3G5UA 2OBLA 3AVXA 2VP0A 1Z2AA 2A7QA 4QJ4A 4MQBA 4YMVA 1GAJA 3ZGXA 1HY3A 1GITA 1H8ED 1U8AA 1E2JA 1Z08A 3GFOA 1XEWY 4D81A 3B5JA 4DVGA 3B8HA 3QEOA 5D3MA 4PZZA 1N0VC 1MO4A 5AVRB 1T0JB 2YOGA 3WHLA 1XB2A 4MRPA 3O8BA 2D4HA 4H9GA 3VHLB 4AWXA 2BC9A 4DC9A 2ZUCA 4BGDA 5JWHA 4DLWA 3WRYC 3B6EA 3OFND 4AKGA 2C9CA 1OXZA 2ONJA 1SXJD 5LB2A 3IHLA 5BN5A 1MFZA 1DAMA 4BWYA 1EXMA 2B7BA 3GP8A 1ZNZA 3TE6A 2XGJA 2IYLD 3MGCA 5APUA 3N2IA 5EP1A 4ZCMA 1CULC 2QSZA 1Z06A 3FE2A 5J5CA 3VKHA 2ZSEA 2ZSDA 2AR7A 4CRWB 1MR3F 2FZ4A 4V02A 2Q3IA 1OV4A 1VG8A 4BIZA 1P2SA 2RH5A 2D7CA 3R20A 3QBVA 4NYMR 1S1CA 5FPTA 4Q1AA 3AVOA 4LUCA 1OWAA 3K9NA 2G0NA 4B48A 2DCUA 3OZXA 1LF5A 4BFYA 4JL5A 5L8VA 1NG9A 1CEEA 5K8LA 2YC2C 1E9AA 5CIQA 4TYYA 4HYYA 2ODNA 4UXHA 5GJVC 5CK5A 3R8CA 1GIAA 4FMCF 1IY1A 2GBLC 3EW9A 3M6AA 4GOJA 4C0KA 2X77A 4R98A 2H18A 3FMFA 4OJKA 1X8JA 2B7CA 2W6AA 2RMKA 2ZSBA 3KXLA 4CW7A 5HZKA 4O25A 2OCAA 2QL6A 1Z6XA 1SXJB 2JJ2A 5AJZA 4CVNA 4JZKA 2QP4A 5J47A 4URYR 4JYBA 4Q47A 4FWTA 3CH5A 2XU6A 1W36C 3FKSA 3BFKA 3K0FA 4LHYA 4Q03A 1W5TA 2HT6A 3ZJYA 4ARZB 1NKTA 1W4AA 3EZ6A 4Q4JA 2CK3D 4QM6A 3BFVA 3AP1A 4U02A 2H16A 4D0GA 3AF0A 5DN6D 1D8TA 3BD9A 2ZI9A 2LWIA 1OKKD 1NBMD 4JAVA 3SDZA 3QKRA 2XB2A 3UATA 1U99A 3KFXA 4IOLA 4FCWA 2GCOB 1ZUNB 2IK8A 3UIAA 3RS7A 2OCPA 2QEQA 1YZQA 1M7HA 2G83A 5AUQA 5BW8A 1N6IA 5L3SB 1BMFA 2YINC 3L8YA 4NU0A 5EE0A 3BAFA 4KODA 2WMNB 3UG7A 5CB6A 4QNRA 3REGA 3ADKA 4Z1MA 1G8YA 3GJ3A 3B9QA 4OI4A 1F51A 1TF5A 1KZ7B 2HXYA 3BK7A 4LBWA 3TR0A 4KCGA 3D6TB 3QUSA 4JVLA 4NPHA 3WP1B 3DO6A 5IK2D 4EFMA 4AC9A 2P5SA 2QM8A 3MWKA 1T5LA 4BFUA 621PA 4M21A 1SKQA 3KDPB 4JBWA 1PV4A 3OESA 4HZUB 2VP2A 5TY0A 1SXJE 2RGBA 2REBA 2ZYWX 5IDJA 2WJIA 4DSOA 2BM0A 2Z6VA 2G88A 4GFDA 2XZPA 4FW9A 3RHFA 4K8OA 1NP6A 2DFLA 4A6XA 4TLAA 3HE4A 4XVUA 1HBWA 1JEEA 2JIZD 3N70A 2Y8EA 2QTHA 5DIFA 4XH9B 1CXZA 5DHAA 1F2UA 2EFDB 3CBQA 3L8ZA 3QKTA 2JLXA 2GVDC 4CEHA 3RS2A 2JAQA 2ZIAA 1GP2A 4OK3A 4PO9A 4NE2A 2ZM5A 3HU2A 5CM9C 4PR0A 5DSZA 2KE5A 3D36A 4DZZA 2UZIR 4M1KA 4B3BA 1R7RA 2DYKA 5EUMA 2BASA 1SZPA 4BLOA 1GSIA 1ODFA 1XU4A 2GHIA 2ZR7A 2AKAB 5JEDA 4TT3D 4JLAA 2X19A 5UKDA 4LJ8A 5J40A 2GXAA 5AUOB 4BRWA 1ZIOA 1X8YA 3GEIA 1VG9B 3FOZA 3MSXA 4PANA 1HE8B 1UDWA 1UDXA 1ZRHA 3OEHA 3NMDA 3LX5A 3ZIAA 1E9FA 3GJXC 4K81B 2SHKA 2P5TB 1XWIA 4D25A 721PA 3I92A 1ZC3A 5FBLB 3THYB 1YZLA 1E2EA 2CVFA 3VX4A 1HE1C 1HURA 1GZLA 4RZ2A 2EFCB 2CMKA 1KOFA 2J46A 3O8RA 5DI3A 1NBME 1KO7A 1E4VA 3O8CA 4FWIB 3D8BA 4KITB 2ORVA 1DEKA 1KY3A 4A9AA 4A2WA 1COWA 2RKOA 1G5PA 4OI1A 1IXRC 5P21A 1AS2A 2GJAA 2QMUA 3CX8A 4L4UA 4CYMA 4BLQA 3HYRA 4M0LA 1YU9A 4AUWA 2JLRA 3I8SA 1XF9A 4DB4A 1VG0B 2RGNC 2O5VA 1F48A 2ZRFA 3EZ7A 4HSEA 2JLWA 2PLRA 2WPQA 4PHGA 4XD7D 3L37A 3TVDA 3WRXC 3RRNA 1PVOA 1Z0IA 2ZJBA 3X1DA 1OH7A 2NGRA 2CLDX 4DEYA 3U7FB 2V6JA 2FSIA 1G21E 2FGKA 4DJTA 1CF4A 2ERYA 1AKYA 3TBKA 5HTKA 4HYTB 5K8TA 3BH0A 4E22A 4BEBA 2ZI5A 1KSHA 4B2PA 4JL6A 4FMDF 1EFCA 1DAKA 1DOAA 3SOPA 1NMXA 2FEOA 4Q20A 421PA 4Q9JA 2GETA 5E7MA 2J0SA 1P62B 4JS0A 3UKDA 3K0AA 4GOKA 4KSCA 2FU5C 4DUGA 4B34A 3ZD7A 4IEEA 4KVAA 1BKDR 1ZUIA 3RVBA 2R5BA 1N25A 4LSGA 1Z0AA 2IYZA 5TB5A 3JVVA 2Q3MA 2ZRHA 2ERXA 4L8GA 1A2KC 1E9BA 1VPLA 3D3QA 5BQ5A 4NYJQ 2CE7A 1PUJA 1FX0B 3T1TA 1ZM4A 1WXQA 2WOJA 4V0ME 3GLHB 2D2EA 5AJXA 1GNRA 4M8NE 4B71A 3Q9LA 3CONA 2LFSA 1K5DA 4LHVA 2JLZA 4URUR 3QG5A 5J4VA 5ELXA 1Q1QA 1JALA 1KI7A 4Q1FA 1P7CA 1S9DA 2EQBA 3MJRA 3MWLA 4C0HA 4AIIA 3LDAA 2K5UA 4LJ9A 4TQAA 4Q7MB 3IKJA 2ZUBA 1ZUHA 3SS8A 3LAWA 3X2SA 4XWOA 4YDSA 2GEVA 3M1IA 3FWYA 2AFIE 1W2HA 3DKPA 1MV8A 2CL0X 5CDFA 3KQUA 3C7KA 1N2CE 2EW1A 1LVGA 1G18A 4LJYA 1E9DA 1I2DA 2ZJZA 3RS0A 1XTRA 3LH5A 2OXCA 5KYKA 1IO4A 2P6RA 4OBEA 2XB4A 1AIPA 3MWYW 3LLMA 2RGCA 1M7GA 4B47A 5F9FA 1T3LA 4M1OA 3T5DA 1OH6A 1U0HC 2AX4A 4JLKA 3B1YA 1H88A 3ND8A 4BFWA 3TK1A 1US8A 4TMZA 5FPKA 3IIJA 1ZCAA 4NCKA 1KI2A 4QXAA 4ON9A 1NLZA 1OB2A 5KUTA 2N1BA 4JSYA 5L3QB 3F5FA 2YO2A 1NJGA 4TTPA 1WBBA 2CXXA 1KO5A 4PO8A 2ZXEB 4W7SA 2RHDA 2QQEA 2GEDA 1MOZA 2W2TA 2CNWD 2F3RA 3BORA 3KFVA 3QY0A 2FPKA 3CRMA 4YLGA 3EIQA 2QM7A 3NHAA 1UPTA 4X8HA 5SZKB 3U3KA 3QSYA 1T91A 2GBLA 2CLCX 4HB0A 4ASUD 1EFHA 1GRQA 2ZS9A 1ZMXA 3X1ZA 4NHOA 4B73A 4DCSA 3QXHA 2WPSA 4BLSA 2C77A 2IF2A 1MABA 3N5CA 2CDNA 4NP6A 5BN4A 3ZH9B 3RC3A 2GZHA 3OEED 4ZDWA 4Z8YA 2HDNB 2PMDA 1E2LA 2J7PA 4IVPA 4QM7A 3FFAA 4JLVA 4QG7A 5F3WB 5HPYB 4P4SA 1NF3A 2CBZA 2DHRA 1W47A 2KWIA 2NO6A 1ELOA 2JATA 2W00A 3RS4A 3UWKA 2ZR0A 4NH0A 4QJ5A 1B23P 1R10A 3A58B 4OQXA 5AW8B 2F1JA 3LY5A 3RSLA 1TUEA 5FTJA 3PEUA 1TU3A 3AB3A 4IDQA 4KHZA 1XEXB 5HKKA 1II8A 3GEEA 4DCTA 3HU3A 1TAGA 5EXPA 5TXGA 3RC8A 1DPFA 2WWWA 5DO9A 2WBLC 3RLFA 2ODEA 2QU8A 4LHWA 4HB3A 4LBVA 4JLBA 2IUUA 4FCTA 1TQ2A 4V0LA 1DADA 3I1FA 2ZRLA 5AJWA 5G3ZA 1ZNWA 1W4RA 2IYTA 2HXSA 2V7QA 4XVQA 4U5XA 1Y63A 1ZVQA 1GTWA 1E99A 1TU4A 4U7NA 4RESB 1KMHA 2YHSA 1X8LA 2GAOA 3BGWA 2ATXA 1TX4B 4B3GA 1G3RA 4NBSA 3K9GA 4DCUA 1OT3A 1GDDA 4H1UA 3GQBA 1EWQA 3V4WA 2YJTD 3AVYA 1KI6B 2GWHA 4Z51A 1FP7A 3TAHA 1UAAA 4Q9HA 2O8BB 1TPZA 1TQ4A 2GKSA 2VP6A 3CF6R 3ZD6A 2YZ2A 4QBHA 4V0NA 2V8OA 3UMRA 2ASEA 2QA5A 3CWZA 3Q5EA 5F98A 2FEMA 2NMVA 2ZRJA 4F4JA 3WMGA 4EAQA 1Z6TA 2O8FB 3IO3A 1OSNA 3JZMA 2FV8A 2DPXA 2R6DA 3U6BA 4KFRA 3D31A 4Q4AA 1NLFA 2QE7A 5HE9A 2YWGA 4A2PA 1P2VA 1DG3A 1N5JA 3AUXA 3JZAA 4DHEA 3GLGA 4Q7KA 1UKYA 1V5WA 5GJWC 1ZNXA 4LYJA 5GADl 2C9OA 4I5SA 3U60B 4KFSA 1CLUA 5B57C 2GK7A 2GA8A 2R6FA 4U00A 2AHOA 1JPJA 2C03A 4KFTA 3M0DA 4RD4A 3LQRA 1HJBA 4Q18A 2QRNA 3GLIA 1BO6A 3IHWA 2OAP1 1GU5A 1G8HA 2OLJA 1E2KA 4EPYA 2PT7A 1A1VA 2AKYA 4GDFA 2EFHB 1W5SA 1J2JA 2F43B 4NDZA 4URWR 4B35A 5M04A 3U44B 4LI0A 5GJCA 1E2NA 2VP4A 4A92A 1Q20A 2ZR9A 2GXQA 3RWOA 1UKZA 1CJVC 4UNQA 4D80A 5KTYA 1OH8A 1GL6A 4GCZA 1LB1B 1T9HA 3QVVA 3HPQA 1M6NA 1D6JA 1P9RA 3GJ4A 3THWA 3FFBA 4LCBA 4GOXA 5CLQA 5EXSA 2XAUA 2V4ZA 2R62A 3OIVA 1KGDA 3WBJA 1GU4A 3R7WB 1KO8A 2GXSA 3UXMA 3IEUA 1NMZA 4LRWA 5APYA 2IS4A 5FL3A 1ZYUA 2HLDD 5FUWA 1GOTA 2CJWB 1SVMA 1II0A 4B3FX 3QOFA 1NAFA 2QAGC 1P60A 2YWHA 2AK2A 3GJ8A 1W49A 3AVQA 4PC3A 4OI0A 3DKVA 4US2R 4DDVA 2XXAA 3TLXA 4K46A 3U4QA 1T2KD 3CPHA 4WAUA 2KSQA 4HAXA 4AKIA 4NYIQ 3P32A 1JNYA 1R4AA 1GRNA 3L36A 1W2GA 2WSSA 1CS4C 4PPNA 3TQCA 3WYAA 1E0AA 4KV9A 1PLLA 3CKLA 2RGNA 2NPFA 1CZQA 4TL6A 1EFRD 4HLUC 2H17A 3UG6A 4ZDKA 3WXMA 2GJKA 1CR0A 4JMPA 4M9ZA 4YMUA 3QEJA 5LD2C 4DKXA 2YKGA 2G9NA 3RRMA 4JASA 4DT1B 1E2MA 5CLLA 2E1RA 4JSTA 2QMEA 4BZXA 1NNEA 2ANCA 1GVNB 3C4JA 3U7GA 4QJ3A 1YRBA 4C7NB 2YWEA 5IT5A 1E4YA 1U9IA 1Z0FA 2BEJA 2GEUA 2JJ2D 2PX0A 4PPGA 5C4GB 4D0NA 2ZAMA 4G1UC 1KSJA 1VMAA 2I3BA 2ZS7A 3K9HA 1E9SA 4RCZA 1NMYA 3KKMA 3K1JA 4BZPA 3QKSB 4F91B 3L2OB 5K8IA 1JUNA 1Z8FA 4P4TA 4RJLA 1D2MA 2KBEA 3VFDA 3ZVNA 3QQ5A 1VYTA 3U61B 1G19A 4A6PA 4EPWA 3EX7C 4MYHA 4ZKEA 1W44A 4S35A 1ZU4A 2J1LA 5IRCD 1XPUA 4FCVA 4CT5A 4B44A 3KXKA 2BJWA 2ZI3A 1OXTA 1GK6A 3TUZC 5GJBA 4Q01A 4G5GA 4TZ0A 4I81A 4GMXA 1VCOA 2UZ3A 2VF7A 3A8TA 1JXOA 4DSNA 5C46F 4L9SA 5HZHA 2PH1A 1WCV1 2JLUA 3KQLA 4PSKA 3KUDA 4KHXA 3RYTC 2VHTA 3VQTA 4CF7A 3VNVA 2NO0A 1GRRA 1HEIA 3IBYA 4B3XA 2XOKD 3I8XA 5BN3A 1IN7A 1RPZA 1JBKA 3K0FB 4JLOA 3CNNA 3VYIA 1YZGA 5FUYA 1U90A 3VHXA 2C9YA 3L0PA 2PBRA 3BBPA 3B82A 2ZJAA 2HEIA 5DNYB 1KIMA 1KSGA 4AKEA 2FMXA 2C2AA 1U0JA 1RYFA 2A5YB 2KJQA 4PXAA 2WZQA 4KYIB 4QBGB 5FOTA 2P0EA 3NTUA 4DLSA 1KDPA 3EG5A 3QKRB 4FD2A 3IDQA 4KVGA 4WA7A 5KSOA 1NN5A 2A5DA 1VKJA 2IX3A 5APSA 1QHNA 2VH5R 1JPNA 4FXPA 5CITA 2HCJB 4J0QA 4MGYR 3B7GA 2CHVA 3BJIC 4EIWA 1O87A 3KXIA 4ZI2A 4C0BA 1JR3A 1FP6A 5E7JA 4ZCIA 3MD0A 2GRJA 1QHHB 1CTQA 1XCPA 1GKUB 2FOLA 3LXRA 1XEWX 2N46A 3KX2A 3KQKA 3M4YA 5G53C 2GF9A 2ZEJA 4G5OA 4YXWD 1H65A 2O8EA 4DBLC 3QXJA 3EA5A 3DZ8A 3EARA 4BFTA 4MGZR 3LX8A 3VKWA 2BBOA 1RJ9A 2R44A 1DAEA 3PCRB 5JJKA 1G64A 2XV5A 1FOSE 1IXSB 6Q21A 2OZEA 4Q9KA 2QGNA 3IO5A 4EJSB 3MFYA 3QXXA 2ZROA 1Z0KA 4DDTA 5LB4A 4DLXA 1T8UA 3HE5A 1IAQA 3WYGA 3NVAA 1N6PA 1PJRA 2GAAA 2GJ9A 4E5UA 3A4MA 4JLMA 4YMWA 4OQFA 4CGZA 1SVSA 2JJ1A 2N42A 3HE4B 2ZS8A 3HJNA 3ONWA 5EQTA 5KPJA 1OHHD 3CIOA 3OE7D 3ND9A 2ZJ5A 4IDPA 1N0WA 1XD9A 1XMIA 3P4YA 4PQYA 3R9IA 5KSYA 2ZRDA 3WNCA 4Q9IA 2JDID 3WP0A 3EC2A 4BQSA 3C14C 4EDHA 3RDPA 3UWOA 1LTQA 3A7OA 4BFXA 3KL4A 5CYPA 3C16C 4EPXA 3SYNA 3AH8A 2C2HA 4WXRA 3I61A 2WAYA 3SFVA 2J9RA 2GF0A 2OEPA 4BLPA 1MT0A 3LIDA 3GD7A 3E5HA 2ZAOA 2BMEA 4N0EA 4PHFA 4Q02A 3DHWC 3TGPA 3HDTA 5H70A 5BXQC 2MSCB 5JHHB 3GJ6A 1KHTA 3T5GA 4DSTA 4HATA 2ORWA 3ADDA 2XZRA 2IWRA 1JXMA 1QHGA 1SVKA 4IW3B 2WICA 1A7JA 3GEHA 3W3AA 3T15A 2AN9A 2CL7X 1Z3IX 4Q4HB 2FN4A 1E1QA 3E1SA 3LBIA 1QDEA 5EP2A 2G77B 4CEJB 5EZ5A 2ZRNA 2ZREA 2ECKA 3PG5A 1GD2E 2OT3B 4M1WA 3K70D 3TQFA 5B1NA 5IHPA 4BECA 2QUZA 2ZE7A 5G40A 2QBYA 4B2IA 1FNMA 1BYIA 1AGRA 3QPUA 4URVR 3HWSA 3C8UA 2WKQA 3AGQA 3RRZA 5HCIA 5A0FA 1MO3A 1X3SA 2FTKA 5CK4A 1VHLA 2Q3HA 1KK2A 1ETUA 1DTSA 2XSZA 4RKFA 2V1XA 3PEVA 4PO1A 3NDPA 1R5NA 2MSEB 2P3SA 4O3MA 1JNMA 4TMXA 1P9WA 5GVRA 2O8CA 2YNYA 2CE2X 1DH3A 3NC0C 3WHKA 4Q4LA 1VDZA 3DM5A 4ZPXA 2A3RA 1GM5A 4AG6A 4EQ6B 2UKDA 5F2EA 4MKFA 4QOSA 2IYYA 3SQWA 4PQFA 3TNUB 5CJPA 1T0HB 1ZD1A 3P8MC 2IXGA 3FMPB 4Q21A 4TSFA 3K70B 2OM2A 3NH9A 2DWPA 2H57A 2WV9A 3T97A 2X8AA 3MWJA 4PC6A 2GK6A 8OHMA 3THXB 1UF9A 2NO1A 1XRJA 2R6CA 3CX7A 4N3NA 1P6XA 1XZPA 1A2BA 4WOPA 4NYJR 1E69A 2HF9A 3CO5A 3CW2A 1FUKA 2J59A 2QAGA 4ZI3A 3KQGA 1JAHA 1ZP6A 5AVWB 1VTKA 1WMSA 5LPNA 2IS6A 4BE7B 1R5OA 4RY2A 5H8WA 1VYUA 3KJEA 3ZCCA 5J4YA 1W0JD 3LVQE 5EE1A 4Q9LA 3EWSA 2XNDD 1H8HA 4TTRA 3PUZA 4G5SA 5FBVB 1OE0A 2WT7A 4GMDA 3EXAA 3NKVA 1IONA 4HLUA 3QBTA 4XTRA 1F2TA 1G7TA 4HB2A 1TNDA 1K6MA 4AYXA 1KDOA 2MMGA 3M0AA 2VP9A 1G8PA 2XEXA 4X8LA 5DGXA 4ESHA 4BASA 2EFEB 3OAAA 1W0KA 2WWHA 2BM1A 4QPJA 1NVVR 2IXFA 4BFVA 3GJ5A 2BKUA 4JBXA 4FMCB 1D9XA 3AVTA 3W5IA 1LY1A 1M2OB 2H92A 5A4JA 3NEJA 1U8ZA 4R2HA 1YZNA 1US8B 3SHFA 3I5CA 2O8DA 4XSHA 3AVUA 5KU1A 3EA0A 4BZQA 2QORA 3L43A 1XD2A 4C0LA 4MTXA 1KK0A 2N9BA 3GFPA 4V0KA 1KI3A 4OHZA 1TUIA 5KDOA 2C99A 1QRAA 4RFSA 5FOVA 2R2AA 2PEYA 1E1RA 4EFLA 4BFZA 3ZRWB 2ZETA 3VR6A 1E79A 2IYWA 4AKHA 5AW3B 1G8GA 1OJLA 1W4BA 2G6BA 1NG1A 4UJ3A 1EESA 5DYIA 1OYYA 2RGDA 4IJMA 1JAIA 2FE4A 4JKIA 4DXAA 4CZ2A 1Y3AA 3BH6A 4C9BA 2P6UA 4DLVA 4RSGA 4HZIA 5FPSA 2OFOA 3S1AA 4DDUA 5LDDC 1UKVY 1TEVA 2ZFCA 2IS2A 1Z47A 2IYVA 2JA1A 1U0LA 4JYCA 5AVSB 4PZLA 3MRSA 1U8YA 1I4TD 1CIPA 5TV2A 2ZANA 2QAJA 5AVZB 3ASZA 1P2TA 1HQCA 4DZOA 2X2FA 3A4NA 2O0HA 3U7EB 1G2CB 3KQHA 1II8B 1O3YA 5B2ZA 1N6OA 1RW4A 3H1TA 2Q6TA 5JSZB 4LC1A 2EVWX 2O0JA 5G3YA 2W6IA 1YYCA 2QE7D 4H1VA 2BHRA 1QF9A 2PMKA 5FTKA 3MG9A 4AQRD 1N5LA 2F6RA 4L15A 4LZZA 3TH5A 1Z5ZA 2OCBA 2JLYA 1J99A 4I1OA 4ZO4A 4MKHA 3W6OA 1I4DD 2P2LA 4HDCA 4D4MA 1FMLA 3VMZA 1DG1G 4TQ9A 2P65A 3CZQA 1AM4D 2QI9C 4IEIA 2GJ8A 2BMJA 4Q1BA 4LYAA 4MH0R 4TZ6A 4QFMA 4HI0E 3T1QA 1N0UA 3K0CA 5FUVA 3UK6A 5EE5B 1B0UA 3CRVA 3VMFA 1K5GA 2GVZC 5JZVA 2YOHA 2OE2A 2UVQA 1IM2A 1HV8A 4LK2A 1RKBA 1U9IC 1FQKA 4DEXA 1JJ7A 3LQQA 3IQWA 4M3LA 2KBFA 3H86A 1GZSA 4QC2A 4A0RA 2J41A 1H8EA 1FFHA 1L7VC 2VPPA 1DELA 1OIVA 1RYHA 1FQJA 1Z0JA 4LJ4A 3PV0A 3P7KA 3UPUA 4G5RA 3DM9B 3C5CA 4UNPA 3GLGB 5C93A 1RRPA 3SBDA
chains in the Genus database with same CATH superfamily
4N7BA 1W48A 3WOVA 3CB4A 5TQ0A 3WK9A 4PVDA 5KWJA 2C04A 2OD7A 3OSZA 3OEEG 2HPVA 4HXEB 1TMKA 5DNCA 1WT6A 1K8RA 1S2NA 3U6KA 3BZBA 3HKBA 2LKDA 1B1CA 2DSTA 2HO4A 4D4JA 3RLIA 2Q6LA 5CM2Z 4BN0A 1O54A 5J2UB 1NIJA 2WIAA 3A1SA 4JBHA 1MG1A 1U81A 4F93B 4UKDA 2FFJA 2EKZA 4I7ZC 5JADA 2WPNA 2WPRA 1TKCA 3D02A 3VU3A 2YC4C 4EKNB 3ZWKA 4MITA 2MCFA 2ZU0C 4HZUA 2F43G 4FZJA 2XB9A 3TMKA 4CKYA 4DIOA 1LC3A 2UUCB 3DL4A 3EDYA 2IYFA 3DYIA 1PWEA 4LQDA 5LBIA 4L57A 3KQTA 4RZ3A 1GZUA 4R5HA 3S3WA 3H1HE 2TMKA 2JRCA 1F4PA 3PPYA 2A79B 4HZ3A 3OIGA 4KMRA 4OMDA 2ZTVA 5F9HA 3OSUA 4FGLA 4XAQA 2WLKA 2CWWA 3E9CA 5C5IA 4N7RA 3WMRA 1TZCA 3KEGA 3LLVA 3DOFA 3DDNA 2Z4RA 2IWHA 1N33O 4WOJA 3G5AA 3ELDA 2ZI6A 3DBLA 1ND5A 1II9A 4YJGA 4ZAZA 1ZMTA 3EWKA 3O1JC 4YY3O 1O6ZA 2PXCA 2HMTA 4AS1A 2CAZC 2YYZA 4XIYA 5KYXA 4P54A 1RE1A 4O5OA 4GEKA 3QVJA 5KHOC 3UAOA 4I9WA 4E03A 3WISA 5K05A 4ABTA 2D1RA 5GV8A 2GA9A 2O48X 3FF4A 4TTVA 1X1CA 4R71A 4FQ5A 1B4DA 1RYNA 3PXDA 5LMUB 3DB2A 4EX7A 3EB9A 2FHSA 4R9UC 1HLFA 3WIEA 2GOYA 4GPAA 3DJFA 3A36A 1GUAA 1GU7A 1IHPA 4O29A 3UGJA 3W06A 2OHVA 1G291 4FFVA 4CIWA 1NNUA 2RI6A 1Y74B 5J2TB 2I4IA 3CYOA 2Q6AA 2IPOA 4D2IA 2A94A 2UXNA 3BVOA 3CU5A 5DFAA 3EWNA 1ORVA 3NOVA 2XGSA 1EH5A 2JKYA 4M87A 3M5DA 1ZWLA 4YAEA 4D0RA 4YRNA 2JPDA 4KJZA 4KPGA 1NGMB 1E77A 4MUGA 3L8DA 1DQRA 4ZKDA 2KSJA 2PTHA 1Q0HA 4ENWA 3DSQA 2PI5A 1P7GA 4XFKA 4KO1S 3KQQA 2VRNA 3H32B 1PEYA 2VG8A 1WXDA 3LQKA 1MB0A 4ZEMA 3HACA 3KQMA 1EN5A 1JSZA 1FQOA 3ETEA 2BUCA 4HSGA 1LDYA 1RRMA 1IURA 1D5WA 3K0CC 3IQXA 3EJ6A 3IVRA 4RPIA 2XQVA 1U2QA 4KFUA 4H3HB 3LU1A 4GOFA 2W2QA 4E5PA 2I2CA 4NSNA 3ZS9A 4DCOA 1PJ4A 4G5FA 3F78A 2PEZA 3GJTA 4F8JA 4I8DA 2I76A 3QJ5A 2H5EA 1H6BA 1MAWA 2BRUC 1F2UB 3CD6V 3KYQA 1I14A 5C5CA 1Y6GA 2DUMA 3FVRA 1W5AA 1VI2A 1XRLA 2GDJA 1AGNA 4DJFC 4DG5A 5HDQA 4HPWA 3L0IB 2AS0A 5JAZA 5KTTA 3CCJV 3KQNA 3LOPA 3JS5A 3CSSA 5E1OA 4LQCA 3BHIA 3BE4A 2FMTA 1XI2A 4DC0A 1C41A 3CPJB 3JAMA 3UJ8A 1UK6A 3AUJB 1KYIA 1WHSA 1XDWA 2WHPB 1FOEB 2VT3A 3RVJA 3HMQA 4RW0A 3A6PC 4PTYA 1OREA 4XDYA 4D42A 2EHJA 4R83A 5KNDH 4INPA 1T3UA 3BGDA 3B48A 2M5AB 5FA8A 1ODLA 4OJNA 3EXG2 1PLKA 2Z5IA 4X00A 5KSPA 1Y6ZA 1IJEA 1OV9A 1URQB 4IHJA 2OM6A 2AZDA 4AF7A 1P7ZA 1QYVA 1VE9A 3PYMA 5CEJA 1I6WA 2YC0A 4J10A 4OQPA 2J5QA 3AI2A 2YYAA 4F4IA 1RM1B 4MKGA 1RU3A 2QY9A 4MLPA 5JJEB 2O54A 4CLRA 1NXSA 3QEMA 3EIFA 4PDLA 1JU3A 1Q90D 1JR9A 3DF7A 2WSEH 4DDHA 3KT0A 4X62B 1GILA 1FZQA 1RF0C 2BOVA 2R3SA 2BLLA 5HFLA 3LLSA 2FEWB 2KXPB 3FDIA 1NXOA 3DMPA 1RXEA 1TADA 3BB4A 2BBTA 4YHBA 2F2TA 3MUNA 4O4JB 4WPGA 2ZXUA 1OI2A 4D9NA 1OLUB 1DAFA 4DWVA 3H84A 4EKGA 1QHXA 3W8EA 3OI7A 4H7FA 2IOFK 3M83A 3I32A 1XEAA 3NTNA 2B5WA 1D0IA 4JAAA 4Z4IA 3TYYA 4X1KB 2NSJA 1PW5A 4I0XA 4LDQA 5KVSA 1N0HA 4KO8A 4NYMQ 3QK7A 3PE4A 2J9YB 4YJ2A 4B40A 4Z9BA 3H1EA 1XX6A 3UBMA 2GS9A 4ZV9A 4QKQA 3LD9A 3CCUP 5LCXA 2LKMA 4JV5B 4WUVA 2DJIA 1SA0B 1RM5A 3HD7D 1CJCA 4PFSA 4HDSA 1C0LA 1U8XX 5GW7A 4NAUA 1QR6A 3Q87B 4XM2A 4G56A 1KDRA 3DOUA 2AMFA 1E0SA 4KXYA 3H42B 4XWWA 5KAMA 3TOSA 2C7OA 4AICA 5KLIB 4N3GA 3E2IA 2F1KA 1WSBA 1PL0A 2H1OA 3E1RA 4EOGA 1EYZA 1OFIA 2ZRIA 3T7KA 3FTNA 3U9LA 2PIDA 3IT2A 3KE9A 2BLNA 2DULA 1FRZA 2VPZA 1VLHA 5KAIZ 1YULA 2O1KA 4HDKB 3V9AA 5FNVB 1L2TA 4FSHA 1SCKA 2V6GA 2E3CA 4GR9A 1CEXA 5IJ9A 3IQIX 1N8KA 1H2GA 1KTVA 1PSDA 3GLHE 2CY0A 5GQSA 1J5PA 3HR8A 1LU9A 5J3JA 1Z18A 2AVNA 3CUWA 3S28A 1YC5A 3JRWA 3SZGA 3H1KE 4PSCA 3R40A 1WB8A 2CN1A 4YCLA 5G0SA 3QBDA 3NEYA 4GXQA 2NXNA 1BMDA 3LVBA 1Q74A 1YBFA 3TAUA 1PT8A 4M1MA 2VHCA 3WLAA 4CNBA 4KW7A 2C4NA 4GLBA 1HYHA 4BS9A 5CTJA 1OCRC 3V1TC 1UMCA 3ELWA 3SDSA 4OTZA 3SICE 1N33B 1NUAA 3PUYA 2FX3A 2HDWA 1L8AA 3U2QA 3L6CA 1RAFA 1U0BB 3L9WA 3P8CD 1IQPA 1TJNA 2W2VA 3FNRA 3BMCA 2YZMA 4R2WA 3CR7A 4YY3B 2X6RA 2VFAA 4EG4A 3TR5A 4NV1A 5G4KB 1LCIA 1UFOA 1LNZA 2FA9A 4IIJA 5SYNA 4C6RA 4BIUA 3DHVA 4JBYA 4XJXA 4ZHSA 3VDNB 2H63A 2IY8A 3PFHA 2ZRPA 1WPXA 4A8JA 2NM0A 1F1JA 4R1UA 3ZE7A 5T8KC 2J9GA 1RR6A 1IBSA 4PI2A 1NH2B 2C7PA 3EXIA 5J9PC 5GV7A 4EVSA 1UR5A 4L1KA 3Q5PA 5CHEA 3UJ3X 2XBMA 1TYEB 1U9JA 1NU1D 4UM9D 3UO8B 4RL6A 4CG2A 1SLQA 5JVDF 3OJWA 5F23A 4LJKA 4P5PA 3GUUA 5JAQA 3PENA 4WBNB 2UYGA 3HCOA 1MZPA 4JI7O 3NRJA 4HDNB 4R69A 4BCCA 1REQA 5AJYA 4YIKA 5HYVA 4FLMA 2ZIFA 3ET5A 3BG5A 3FPJA 3IURA 5L3CA 2COUA 2Q28A 2PUSA 3BCRA 3KWMA 1N3YA 3JTMA 5LQNA 1W0KD 3KTAA 1WDTA 1RRCA 2X13A 1JHXA 1Q0UA 1XYYA 4E21A 1BCCH 1UAGA 2Y0DA 4LSMA 2R8RA 3OUTA 2ZU6A 4LTDA 2Z5FA 3C98A 3EIUA 1T9CA 1L7DA 3BSSA 1USGA 3A2FA 4YDRA 2FKWB 3B7PA 3R6LA 3QYAA 4TMYA 2HU7A 3VU9A 3HJGA 4B4KA 2VSOA 1U2PA 1KTIA 2I2WA 2EXXA 3HR0A 1HYQA 4CM1A 3LK6A 3PQFA 4EMBA 3WRVA 5IY5C 3UUEA 1N5RA 3TQRA 4KE9A 1BHQ1 1PX2A 5DXAA 2XHZA 8MHTA 5KAIE 5KMGA 2FSGA 2G1JA 4O02B 2EYUA 4JJIA 1RC8A 1UBRS 1RMQA 1NM5C 4BJ5A 4M38A 2AF4C 4NNJA 3I9NA 1Q21A 4E15A 2HG5C 4JC0A 3OZ7A 1MA3A 1U8AA 4YRLA 1XEWY 2PZLA 3DFFA 3OPVA 3PNPA 3WHLA 2PZJA 1G5HA 2ZUCA 1YFZA 3FM9A 2CKDA 3R0IA 1MABG 2IYLD 2F64A 2O5EA 1LVUA 2C57A 4QBTA 1V8OA 1VA4A 4BQNA 4X88A 3ZV4A 1NT4A 2WMYA 3MXTA 4PBSA 3LKDA 1GIAA 4FMCF 3FNEA 1XTGB 4B87A 4G0VA 2VK2A 5HZKA 4C3UA 2JJ2A 1U3VA 1U3DA 1J0XO 1T2EA 3FKSA 5E4TA 2HT6A 3SR3A 3W4IA 5JS1A 3BWXA 3Q3EA 5M1BA 4UQPA 4HT3B 1H1LA 4RTQA 1D8TA 3ZCSA 3TB4A 1UAYA 3Q9SA 1HBJA 1KZ4A 5A9TA 3FCEA 4NU0A 5HBGA 3WA7A 1DKMA 1OLSA 1EC5A 3WP1B 4LFAO 4EFMA 2IUYA 4MUJA 1PFIA 621PA 4FGZA 2ISCA 1SKQA 3LHSA 5FORA 1HH0A 2REBA 5IDJA 2P9JA 3ZMUA 2JIRA 3IQFA 2QTTA 4NJOA 1E8MA 2WLLB 3IE1A 1CXZA 2JLXA 1E3TA 4DL9A 5A2QA 2QW1A 1RKQA 4YN3A 2UZIR 2EKBA 1TQ8A 3EDRA 4ND4A 1DMSA 4ICIA 3JASB 3CX5D 1DZIA 2HHCA 1YA8A 3GRRA 1PR5A 3OEHA 4N01A 3ZIAA 2P8SA 2X0NA 4UUOA 2XAHA 1ZC3A 1RQRA 1E2EA 1HE1C 2OQVA 1Y7HA 3G0BA 3G0OA 4DV4O 4A9AA 2QOEA 1YU9A 3H1HJ 1SCUA 2FZEA 2O5VA 4AKSA 3ZHCA 3WRXC 3LUAA 4B4WA 1DAOA 4Y2XA 2X41A 1CF4A 1Y8CA 3BH0A 4ZVVA 3AE8C 5CA1B 2BOBC 1EFCA 4YI5A 1DOAA 3SOPA 1JX9A 3DV0B 5JNLA 1U7HA 1RAEA 2OTKE 2R5BA 2M6RA 3E9ZA 3IAHA 1J1EB 2BM8A 1QVVA 3I9KA 1TW3A 3N2LA 2IZOA 1ODJA 1X0TA 3Q9LA 4IILA 2B25A 2ETXA 2JLZA 4ISBA 5BORA 1Q1QA 4FM0A 3ZBQA 1G1JA 4MSUA 4MW2A 2DW3A 2OLEA 1X13A 2EW1A 1NYLA 4LJYA 1JBEA 3RS0A 1VPEA 3WHIA 1IZZA 3LLMA 3DEIA 1ZXLA 1T3LA 4M1QA 4JLKA 4N8SA 3FWHA 3M82A 3B3QA 1EFPA 4G84A 2QRJA 1XCJA 1NJGA 1O0SA 2W2TA 4CCSA 1PV3A 3DBHB 5BU5A 2YW2A 3E8SA 2UXCO 2Y1KA 1M6VA 5KJ1A 1QO0A 3NWBA 3MAGA 1SOWA 1T36B 1PTJA 2W00A 2ZR0A 3CPWU 1J2UA 1TUEA 4WE3A 5HKKA 2CNNA 3FD9A 3H4TA 4O63O 3RIGA 2J5RA 2Z8ZA 3UAVA 4PNPA 2QU8A 1KQNA 2Q6IA 4HB3A 4TXMA 2IEGA 1ZNWA 2X5NA 3JQFA 4KNWA 4X6UA 4U7NA 2H00A 3V8VA 3QSGA 4OMUA 4LMPA 3GQBA 3M4ZA 4M98A 5C52B 3CF6R 4GM1A 1JLMA 2QA5A 1A8SA 1Z4OA 1JIUA 1U7ZA 1F17A 1K97A 2YWGA 3IAXA 3S27A 3L06A 4UBLA 3Q2OA 5IFLA 1KQ3A 1V45E 2OOKA 4KJXA 2B0CA 5JYCA 1NU1G 1FNSA 2EFHB 2FG6C 2ZUFA 1VL6A 2CBGA 1D6JA 1DEEG 2IQ5A 3MWGA 4KMOA 5I7RA 1NQXA 2V4ZA 4GR5A 3IJRA 4YACA 4GRDA 3F7YC 1UOQA 1ZYUA 3MCZA 5KHHA 3PHCA 1CUAA 5LA6B 2YWHA 4U7FA 5JDCC 1HDRA 1W0KG 4DFDA 2D2XA 4OI0A 3U4QA 1HRKA 2HVJC 1OGYA 4PPNA 4NDNE 1I5EA 2W2LD 1EFRD 4ZDKA 3WXMA 1LP1B 4DKXA 3EVGA 1D04A 4JASA 4NV3A 4DT1B 2QMEA 3U7GA 1WNTA 1E4YA 2BEJA 4I5FA 1PNLA 3GYBA 3D4PA 3AG4C 1Y3FE 3S1LA 1UXHA 2WW8A 5IRCD 2BJWA 1L4FA 1NYTA 3GHYA 1CE8A 1JXOA 3CKKA 4DREA 5T4EA 1A5ZA 2VZ9A 1S3JA 1ZV8A 1WAMA 4JI7B 2KIKA 4W6QA 5PNTA 4JLOA 3VYIA 2DRIA 1U90A 4NBLA 4P4GA 2KJQA 4X54A 4ZI7F 2VH1A 3NTUA 4ZU6X 1KDPA 4L51A 4I50F 2IX9A 2IDMA 2FR1A 4Z9FA 4ZI2A 4WNAA 1EEXB 4BX9A 3MVEA 1R0SA 2NV0A 4RJJA 2QD2A 3IR7A 2GF9A 5JDIA 4RWZA 3QXJA 5BY2A 1L5KA 5CVEA 1DAEA 1R0KA 1QXSA 1URQC 3B53X 4KXWA 4I7EA 4KPYA 3A4MA 1V71A 4CGZA 1GQOA 1GG9A 3W9UA 3A32A 1EDIA 2JDID 3EC2A 1VIDA 2R4QA 3HVJA 3UHJA 2C2HA 3TXXA 1Q7YW 3ABMC 4LWOA 5K6RA 3LIDA 3HZOA 1V1RA 4X66O 1DAPA 5H9VA 5EJ9A 2R8PA 1D1PA 3HA5A 1ZEMA 3M34A 3M4NA 4LISA 4Z4EA 3ZW8A 3JYLA 5SV2A 1JSCA 2XKBA 5TGDA 3EDCA 2FWIA 3WGGA 2QUZA 1BYIA 4Y7DA 3LC7O 4AJ1A 1VHLA 3UENA 1KK2A 1DTSA 1Y76B 4RKFA 2QLLA 2MSEB 4IJUA 1DH3A 4IINA 2UKDA 2X3UA 5LHGA 4QO8A 1NV9A 2ETVA 1EK1A 4MWGA 4K6OA 1UF9A 2R6CA 4HVLA 2XYQA 3L1UA 2Q4PA 2PLWA 2PMCA 2HF9A 3OT5A 5I48A 2BGGA 3WLLA 5AVWB 3KZNA 4WDQA 4W5QA 2G04A 4J80A 1DCFA 1KYWA 3ZCCA 5J4YA 3M4JA 2H1SA 1TUBA 1NMSA 2JIOA 2BSKB 3L7MA 3H75A 4I5DA 2MMGA 1PL4A 3WLQA 3BRTB 1HG0A 3NHZA 2WSSH 1A4IA 6ABPA 3RWRD 2NQ8A 1US8B 1DQNA 3T94A 2EINC 4ZVKA 4RTNA 4E6PA 1OAOC 3NTOA 2YXLA 2ZWIA 3HUUA 4BRYB 1XLUA 2ZETA 1HP8A 4XIJA 2WF7A 1VQ7P 4IJMA 3ABUA 2NU9A 3HLTA 5TT1A 2QJOA 5FWNA 4UFPA 4PJ0H 1P2TA 3EVAA 4R1NA 4DOJA 1UZUA 2XCRB 2W6IA 3TSYA 4JD5A 1K66A 2OCBA 4BBAA 4ZO4A 3K5IA 4QNNA 1RJEA 1FPOA 2XQJA 2CD7A 1R3IC 3VMFA 4IKPA 5EYPA 1JJ7A 1NNLA 1U1CA 4DV4B 3H1KJ 4IJ6A 1FYFA 1RYHA 4BV9A 3DM9B 4MS4A 4XIFA 5D5QA 1B8OA 4RKWA 3IDOA 3EVDA 5FOQA 1Z6ZA 1K6IA 3FTQA 4F97A 3II6A 1CZKA 1D2EA 3OFSA 1N3BA 3SKVA 1U5BB 3SS7X 1EIZA 2OCYC 2FUKA 3WUVA 3O74A 4RZXA 2Y4OA 4Q1CA 1YBAA 4QGBA 3KJZA 1S89A 1Q17A 2ZT9D 4D4LA 5JRDS 2ZZMA 2E76B 1XCLA 5KHLB 5APXA 2V55B 1JCHA 1S2OA 1SCAA 3E7XA 2HADA 3U3DA 1JA9A 4HNUA 4GOOD 4B86A 2P30A 3VR3A 3OX2A 2BVNA 3EOZA 5BSFA 1U6KA 5LGTA 1WY5A 4IJKA 2KM1A 1BXGA 1MNQA 5HEKA 2X22A 2C8LA 4ZRMA 3L73D 1PYDA 1JDUA 4YRFA 2Q9UA 2AGAA 3REFA 1G21A 3SHOA 1KOJA 4RLHA 1FBNA 3Q6MA 1BKYA 1FMTA 4HB4A 1SXIA 1AQJA 1F4MA 2FWJA 2UXCB 3UV3A 9GPBA 3AJRA 3KB1A 2PUWA 4TLBA 3ZXUB 4XIIA 4S2EA 3QMVA 1SD2A 2JZCA 1H9CA 2VHVA 4B76A 2VH2A 2UUBO 2XA1A 5CFMA 1NSFA 4CR8A 2Z83A 1K8QA 3Q85A 2I1VB 4BO4A 3NB0A 1QYXA 3KVOA 1EFRG 4LDJA 3GBVA 3QWIA 2P91A 4YCDA 1K63A 4E12A 3LPDA 2Q5JA 3ICCA 3IDSA 4B6JA 1SQVK 4QDOA 3AYXB 1YNOA 4MWCA 2XZDA 3V1NA 3IGAC 1JAXA 1PV0A 3DNMA 2QLTA 2G3AA 2B8TA 3RUPA 2XUQA 1DKUA 4NMXB 5FOXA 3UB2A 2F9MA 3CX6A 3NHYA 2QRMA 2QEXV 2E74D 4IUYA 3DW3X 1UIXA 1PBTA 4HR7A 4ZT5A 3F7TA 1O6GA 1HK7A 5L3QA 5ETJA 1JL3A 2K9PA 2HUPA 3FPAA 5CDYA 5F2NA 2IDKA 2MK3A 3R7FA 4EUNA 2D7DA 1PR4A 5F5NA 3FCOA 4OXQA 4DV1O 2XDWA 4GG1A 1A50B 3VSCA 2FI1A 3NHFA 4ZYLA 4C4PA 5I3ZA 1SKAA 2E85A 2HJHA 2VYQA 2JDIG 4R6ZA 2Q21A 1H3FA 4H44D 4BJ6A 4XTCS 4ZOBA 3BYZA 2QAGB 4UFZA 4QHYA 1YQDA 3HFGA 4ZRNA 3ZJ5A 1TMGE 2I7CA 1ZL0A 3OCZA 3G9UA 4FN5A 3KK0A 4NLLA 3TJMA 3ZMTA 1ULBA 1KQFB 1TU0A 4Y1RA 3C3PA 2A9KA 1D5AA 3ZHSA 1CJBA 3O8DA 3WQQA 3LCCA 1BXRB 3E8XA 3G0GA 1JY3N 1DFIA 1ENZA 2P2DA 5DHUA 5JPCA 2ZYHA 2B89A 2KB0A 4IRXA 1SQQK 3A9CA 3LKBA 1EDBA 3FMVA 4F4DA 4QBFA 1RPAA 2G67A 5I4IA 2Q69A 1H2YA 3PQDA 1ZK0A 2VP5A 3SFZA 4FYWA 1RABA 2PRIA 1O6CA 1LPAB 4WCVA 3SWFA 4TXLA 1IWOA 1CRZA 4P82A 1V96A 4H60A 1DRKA 4DLYA 3KZCA 1E9CA 4QQKA 2I8LA 5IAAA 2V7TA 4LFBO 2EAUA 4QBIA 1TT7A 3DE6X 1NPYA 3TLBA 3ECSA 2J6CA 1VDMA 1X77A 4ITRC 1W2BU 1QLED 2WVGA 4MV5A 3GG2A 3CURA 4OH7A 1LWOA 3PJRA 2W90A 4R9VA 3CJTA 4Y67A 4FFBB 1GPKA 2O2YA 1V95A 3NM6B 2OCXA 1WHTA 2ZI4A 5BPFA 1NXTA 3H9BA 1Q91A 1RH5B 2IH2A 1CR4A 1S4QA 1Y4DE 3SR0A 1RHUA 2QD1A 3G7UA 2R3CA 3CF0A 4ROSA 3FW1A 2YWDA 2AFHE 3GCDA 4B3DA 4H13C 5JFTA 1N34O 1XRNA 3HL0A 3S8YA 5BW6B 3EASA 2KG7B 3N05A 4CKWA 2HNBA 5DYGA 3W7UA 1J1EC 2PWAA 3W5BA 3ESAA 4O0LA 1B43A 5AOVA 3HXKA 2JZOA 5MN5A 2M2IA 1YS4A 2PZGA 4G63A 3K0SA 4UZEA 3PD0A 4PNEA 2Z3ZA 1R5SA 2H4YA 4I9NA 2ODMA 3KKPA 1A7AA 3FYUB 3ABVC 4LOKA 1SESA 5JRZA 2ZYSA 4MGEA 2PJZA 4XWTA 1P8AA 2EG9A 4HVCA 4MUHA 5E6RB 2HO5A 1H2MA 4HC4A 2J45A 1VYHA 3UWSA 3I1IA 3K92A 1E5XA 3P2OA 1YI2V 2M9MA 4UD2A 1UKAA 3O4VA 4D82A 4F9GA 1ZCBA 2OYRA 3FLAA 1TZKA 4K9KA 2E4YA 1DJQA 4AY2A 3RAFC 3TUJC 5CR9A 3EHEA 3L73G 4TS1A 1UBMS 2Z09A 1KI4A 3HYCA 1ZPDA 5AIAA 3UMSA 3WSTA 2RKBA 1BVUA 2ZYGA 4NC9A 3BVHA 3BF8A 1UWVA 2ZYIA 3WNBA 4D41A 1E1NA 5FOUA 2Z2ZA 4OHCA 1C30B 4JGSA 2FXMA 2YIAA 5T64A 3KJFA 1CRPA 2P67A 2XCIA 4J4TA 2HIAA 3WLRA 3AM4A 1QH1A 1I5OA 4DY6A 1GPH1 2J3QA 4KGXA 1JVMA 4TUYA 3FYHA 3FGAD 4GBED 3I9V6 1LGYA 4PV1D 3LFHA 4N23A 1G8SA 4I4LA 4JR1A 2YMLA 5JY6A 3QRWA 3BQ9A 1JMBA 1PPJG 4GZ3A 3CPEA 1XHLA 5JMTA 1AQNA 3IPYA 1HWYA 4QTTB 1DEBA 3W5DA 3IGFA 2RAPA 5AVZA 1FRFS 2WNIA 2NZXA 4MWSA 2PGXA 1CJSA 1AA6A 4X8AA 2VQEO 2UYCA 2EULA 1I2CA 1VQ4P 3V1KA 2WTYA 2B9EA 2I71A 2NUBA 3PB3A 1IB6A 2PNFA 3CNOA 5CVDA 1BCRA 3A2AA 2XZTA 3KZMA 4ZQIA 2DT8A 5IARA 5A0VA 1U0SY 4QATA 4NCHA 4KXRA 1UJ6A 2UUBB 4BO2A 2ZINA 4MVJI 2WYOA 1I10A 5EC1C 1E2DA 5KLVK 1QDUA 3FXAA 5DBHX 1JIJA 1HTWA 2NTVA 3MOSA 1KILB 4I8XA 4TYNA 1I6MA 4J3JA 4F7WA 5H9WA 4LRTB 3K2IA 2OUKA 1JG6A 4RJIA 1RI4A 1E1QD 1VOTA 2FSFA 4R7ZA 2J3IA 3AU8A 1IXBA 1XDBA 5H7XA 3LBHA 5EZ6B 5BZBA 1X1SA 1CP2A 5ICMA 2YIBA 2ORED 2YHAA 1T5EA 1SQGA 3OO0A 1EVYA 4QX6A 2D00A 3W78A 1TVKA 4RY8A 3EGVA 2C7RA 5IVKA 4TL7A 2C59A 5ERXA 4M60A 5CA0B 2QRKA 4EWLA 3VKGA 1XI1A 4HRVA 2RMZA 4XWKA 3SWKA 1C3OB 3OPYB 2EWVA 4DYVA 2W27A 3JWIA 3QPWA 2QZSA 5JYEA 2A0XA 2EW2A 3EFOA 4CM8A 1JU4A 2OGSA 2BR4A 5JNRA 1TZ2A 5KYWB 1RF1C 3HXQA 3PSAA 2R84A 2QG6A 4KQCA 4AK9A 2YV4A 4XW2A 1CUBA 2ZTHA 3PEFA 1P84F 4LHEA 3I55P 1XZFA 2Q0SA 2VZLA 3CUEF 4DV1B 3NDBB 4U6NA 3N0VA 4PZAA 3RTBA 2DLCX 3UOWA 3KE8A 4TKVB 1T3ZA 4M46A 4GSYA 5AWFC 4PIPA 5KNBH 2WP8J 2ZRGA 3DCNA 4HAZA 2JI6A 1C80A 3IPAA 4MVJH 1JB1A 2X6CA 4LBZA 4QUGA 1E9RA 3MXOA 2IDBA 2LCIA 1PYGA 2A2ZA 1CEZA 3VR4A 4E33A 3L75H 3H11A 1GTL1 4RBNA 3UMFA 1G1XB 2VJCA 2QU7A 3SEFA 4B3RO 2PZAA 2AF3C 1P5RA 3G9XA 1X8XA 5LJIA 3L1HA 5JSQA 1N32O 1Z4QA 2C3UA 4MR8A 2XV1A 3PYLA 3PXGA 2G5GX 1GL9B 1QQCA 2FHPA 4EW3A 3HRHA 1ZW1A 5KDLA 3M1AA 2QRQA 2C0CA 5HWSA 4UTOA 3AVXA 2BGRA 5CDGA 2C54A 3GMAA 6REQA 4JOBA 2XUHA 2PSEA 2YOGA 3OFND 3P94A 1MFZA 1EXMA 1KJJA 5KHJA 1E60A 2Q3IA 2BPOA 3B40A 3R8XA 1S1CA 1E1DA 1OWAA 3W6ZA 4MQLA 3ZE9A 2FYUH 2G07A 2D4AA 4LJRA 2QD3A 3P0IA 3EDMA 1C5KA 3VV3A 1WPRA 4R3WA 2UYHA 2Q2QA 2B7CA 4B7XA 1Z6XA 4UTRA 3C6ZA 4AG3A 4R2JA 1ZN9A 1SBYA 1SUPA 1KMIY 2A06E 3ZJYA 4K87A 4EZEA 4UPDA 4AW9A 2PKWA 3GP3A 2XR1A 1KVRA 1OKKD 3SDZA 4BC0A 3ZE6A 1CNFA 1T3GA 2ID4A 2CGOA 2JR8A 3O6QB 3VQVA 3ADKA 1NKVA 5LQCA 2I65A 3ILVA 3A1EA 1WXHA 5AH0A 3X2EA 4X62O 4KCGA 1TTQB 3D6TB 3T5AA 1UEXC 3T4XA 1CUIA 4EO7A 4M21A 1GAQA 1L0LD 4B3JA 1ZICA 4XB1A 2VP2A 1KS9A 2IXAA 1VBNA 4UATA 2VJBA 3GUYA 2P9GA 2AXTH 4N41A 4QXPA 1WKVA 3RF6A 3FZEA 1IFXA 1N34B 2OYIB 3IP7A 3OZTA 1ODFA 1XR3A 3SJ7A 2AKAB 1GK9A 4Z86A 3W2EA 3G6WA 5L3DA 2IU0A 2VDKB 1WUTA 3ZN0A 4FLUA 3I92A 3THYB 3C7TA 4BBPA 3U1CA 4KITB 5KC8A 2RKOA 3FUXA 4XR4A 2X0IA 4ZANA 4BLQA 4BLVA 1EG2A 4AROA 5BQ3A 4KNVA 3KYCA 2PLRA 3TVDA 3EVEA 3NHSA 1KSHA 1WD7A 4JL6A 4FMDF 5ENDA 2BGMA 3NIFB 4KSCA 3S4RA 4LF7O 2Q3MA 1P2BA 3WK7A 3C1LA 3P5SA 1NJIQ 1L0NE 2CE7A 1SCJA 4EAAA 2PU5A 5BUCA 2Q7XA 2CMDA 3M33A 3ZY6A 4M8NE 6YASA 4URUR 4IIXA 1LJUA 3FX0A 3RE1A 4Q1FA 3KD2A 2C4MA 4OMFG 4TQAA 4Q7MB 1IFNA 4DO2A 1AV1A 5K4GA 4QRDA 3X2SA 2PQ2A 1N2CE 5JJIA 2OXCA 4OBEA 2I7VA 3HKCB 2RGCA 1X1QA 2OTLV 3FGZA 3VR5D 2F59A 4NCKA 4MTLA 2FSPA 1NLZA 3QVMA 3WYNA 1UWCA 3C45A 4PO8A 2QQFA 4MSWC 2YJ3A 4YO7A 4OAOA 2QM7A 1QYWA 1UPTA 4WXHA 5JR3A 1JLHA 5A62A 2CLCX 2H1FA 2WYVA 3CLSD 5HBRA 1PZMA 1XTVA 5BN4A 3HGTA 3SHQA 4JLVA 1FUYB 1DDGA 3FB1A 1P6UA 2PZKA 4C7XA 5FTJA 3U7RA 1EX9A 3GAZA 1E1QG 4JLBA 4G37A 2HK7A 4XVQA 2HXSA 2V7QA 1XROA 1ZVQA 4EABA 3OT1A 1Y8QB 3BGWA 1GTMA 1LLFA 3K5WA 4DE5A 2XYVA 3ECAA 2K3RA 2ASEA 3KETA 4EAQA 2VQEB 3EGXB 3JZMA 2NPOA 1T9AA 3EVKA 1YTFB 3ROGA 3SMQA 5AW2A 3VGJA 3TL2A 3UV7A 1CLUA 1VKNA 3M0DA 2ONCA 1IVYA 4BE9A 4AZ0B 3PNYA 2ZDGA 4GX1A 2YKQA 4EMTA 2YMPA 2DH5A 1LB1B 3E3NA 3GJ4A 3ITKA 1QHEA 1ZQ1A 4KP7A 4JT9A 3L4EA 5CFOA 3WBJA 3ILYA 2VNSA 4ZZ2A 1UODA 2CJWB 4B3FX 2QAGC 3BXFA 3KKKA 3GJ8A 1W49A 2OAGA 5LQJA 3WU2H 2XXAA 3CZ9A 4HAXA 4OGFA 1X15A 1JNYA 4WCEV 4PFJA 4G1CA 1VE5A 2WF6A 1OZGA 1TZBA 1L5OA 5CLLA 2FW6A 4GMKA 3HPLC 1KP9A 1U9IA 4D0NA 5C4GB 1V5EA 1IRIA 1EK5A 1MIHA 4A3SA 1U1EA 1JHPA 2OWOA 4P4TA 1GPMA 1XF1A 4M7OA 3FAZA 1G19A 1WDLA 1ZU4A 1U0TA 1IZ9A 2TSYB 4X7BA 2QVYX 1MJFA 4RELA 3NEAA 3RM3A 3SWWA 5LYJA 1QFSA 1PN3A 2GM9A 4LI3X 4X89A 5D84A 1A77A 1RPZA 4LNHA 3BBPA 2HEIA 1NVFA 4QBGB 5FOTA 4G8JA 2ZSUA 3EG5A 3OTQA 2O3QA 5CT8A 5BNZA 1CQJA 1QHNA 1JPNA 2HCJB 4UUAA 3FYEB 4EIWA 2JFOA 5KKCA 5DOVA 2RHRA 3ZGOA 4JTAB 2N0SA 3OMXA 4LY3A 4ZCIA 4UCOA 1YGYA 3OFNG 4DBVO 1H1TA 1OZAA 2CUKA 1B8PA 1HEYA 2O8EA 3TZ6A 3LX8A 2QN2A 2EGHA 2G1PA 1FOSE 3HDQA 2G71A 4RM2A 3WGZA 5DXJA 3MCWA 5HXAA 1HX7A 2ZAEB 3CCLP 2W8BA 2XNKA 2N9YB 3WNCA 4OYLA 1FYJA 1H0SA 2KYVA 4EPXA 4TVKA 3OLQA 2H4HA 2Z5LA 5CFLA 4PHFA 4B3RB 1MIOA 2HQSA 3JX9A 5BT8A 4FOLA 1N32B 2OWDA 1ZI9A 4R1MA 4A0QA 2ZRNA 3HLYA 3FFQA 2P9EA 1GD2E 2OT3B 2O3RA 3F4KA 3K70D 3L71J 5IVIA 1XZMA 4C87A 4Y2JA 4BECA 1E3JA 4URVR 3HWSA 3AGQA 1WULS 3B5ND 4B7AA 3LHKA 5JCXA 1YNSA 4RVHA 1VGQA 1L0LG 2B9ZA 3Q10A 3FYCA 2AR0A 4TS3A 2YNYA 1I2ZA 5ICCA 4YRZA 3TNUB 3HDGA 3BMQA 4WQMA 4UDXX 4DR1B 3NH9A