2QM7A

Meab, a bacterial homolog of mmaa, bound to gdp
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
323
structure length
314
Chain Sequence
LPDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPGAGDELQGIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords GTPase/ATPase
publication title Crystal structure and mutagenesis of the metallochaperone MeaB: insight into the causes of methylmalonic aciduria.
pubmed doi rcsb
source organism Methylobacterium extorquens
total genus 121
structure length 314
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2qm7A03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2qm7A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qm7A02
3L0SA 5JWRA 3PENA 3CF6R 1F48A 3EASA 1ZM4A 8OHMA 1T0JB 4A8JB 5B58C 1G3MA 4B44A 4MKIA 3MD0A 1LS1A 3IHWA 4TYWA 1E98A 3I32A 1UDWA 2DWPA 2ZJ8A 3ZH9B 2AD5A 1CF4A 2JAQA 2JJ2A 5B2ZA 2C8VA 2OFXA 1OFUX 3KTAB 5BQ5A 3DOFA 4EAQA 4Q4JB 1D5CA 1GWNA 2BM0A 4MKHA 3EWSA 2IUTA 4JLVA 3GEIA 4A15A 3DM5A 5AW5B 1UBCA 1W48A 5JMTA 1JI0A 2R3CA 2WVJA 1DVRA 4ILEA 1LTQA 4DSNA 2PT5A 1NAFA 2YNYA 2ZI3A 2DB3A 4C7OB 1AN0A 1H88A 4QHYA 1FTSA 3NWJA 4KLNA 1G2CB 1JEEA 2HLDA 2ZTSA 4L16A 4P3YA 3B8EB 2RGBA 2WPRA 5UKDA 2WPQA 3CNNA 1HURA 4MH0R 3A1VA 2CLCX 3C16C 4QL3A 2HYDA 1L2TA 2O52A 2P2UA 1CTQA 3QXXA 4HAYA 5KO2A 5CM8B 2BCGY 1KJZA 1MO4A 4F4IA 1S0UA 2EFGA 3LBIA 1CI6A 3A3YB 4DDUA 5FUWA 1H8EA 5SZIA 5JRZA 2RGEA 4Q7JB 4WZAE 3ZZ0A 5EP2A 3K70B 3SQXA 1IN6A 3SWFA 1BYIA 4LBZA 4LJ4A 1IAQA 2JASA 3FTQA 1MO5A 1JXOA 3L8ZA 4DWJA 1X3SA 2FNAA 5IK2A 2BBWA 3SOPA 3VR3A 3LFUA 4LX0A 1VCOA 3GJ7A 4A82A 5EP4A 4B76A 2VP5A 5C18A 1NWQA 1KNXA 1TADA 4BGDA 5L3SA 1COWA 3GLIE 2ZYUX 1T2KC 5AVYB 4QOSA 4U7NA 4RSGA 1L8QA 1GFIA 1XP8A 1FL9A 1Z0DA 2F1IA 1CRPA 1R0WA 5JS7A 3IIJA 1BIFA 3T1QA 2WPDA 2JLWA 2NOAA 2Z5FA 1NKTA 4CEJA 2LFRA 1U8AA 5FPHA 4LYHA 3LIEA 4D82A 1ZNXA 3U61B 2C9CA 2YZ2A 1XPRA 3N70A 3AVUA 2ANBA 4M1WA 1Z0FA 4HAXA 5EZ5A 4KITB 1W1WA 3DDCA 4QM6A 3VKHA 3CKLA 3GJ3A 1P62B 3KZ1E 4D26A 4A2WA 5BN5A 3K70D 1F60A 2UKDA 1KO1A 1U9IC 4NYIR 2JLRA 2QM7A 3NC1C 1Q0UA 1P5ZB 3VNUA 3TW4A 4MDEA 3OFNA 3I5YA 4WAUA 3RSOA 4GZLA 4QRHA 521PA 1M6NA 1OXSC 3TBKA 3AP2A 1F2UB 3DKVA 1U0LA 2CEAA 3TNUA 2W6IA 2XGJA 4JS0A 3LLMA 1E1QA 3ZZTA 2E42A 3DL0A 3LV8A 3Q85A 4G5GA 1G19A 4BEJA 3H0KA 5DE3A 2ZM5A 1W4BA 2IF2A 2W00A 4XTRA 1KDRA 1NY5A 2XZRA 2OE2A 1WBBA 3T34A 1FOSF 5EXTA 3HU1A 1JAHA 3CB4A 4G5RA 5LB4A 2P5TB 5HKKD 2HXYA 1XCPA 1G16A 2YV5A 2ZAMA 4TQ9A 3THXB 4Q7LA 2H7HA 3BK7A 3K0FA 2IX3A 4ASUA 1GD2E 2O8BB 1R7RA 3H84A 5FUYA 2XJ4A 4LJ9A 5IDJA 1E69A 4HLCA 3T1TA 2V54A 4PC6A 1WXQA 1NVVR 5AUNB 4ABYA 3NHBA 4P4SA 4K81B 4IXNA 2GILA 1NG1A 1KI1A 4UXIA 4AG6A 3GLIB 3THWA 3K0AB 2WMNB 2ZPTX 3HR7A 2Q3IA 3SNHA 5FBVB 4TYQA 1YJ5A 3QVVA 4V0KA 4PSKA 3NBFA 3NDBB 4EJSA 2C95A 3T06B 4JLOA 1NBME 3I92A 4RFSB 4I2LC 4ESHA 5BXQC 4A0HA 4ZIRB 2J0SA 1IQPA 4M9QA 5DO9A 2B7BA 3SFVA 5LD2C 4D0LB 2H16A 1KI2A 4BFUA 2ZUCA 1D9XA 1FZQA 2NO7A 4HAWA 4KYUA 1BS1A 2K5UA 5JFGA 3NTNA 5APTA 4IHQA 4B3FX 3JVUA 2ERYA 4XD7D 1FQJA 1XD8A 3GLHA 4FXPA 2GZHA 3D8BA 3ZVLA 5JJLA 2QAGA 4I1VA 4M1OA 4W5HA 4TMTA 2WIAA 1PV4A 5KHOC 4PAQA 5AK0A 4CT4B 4TL6A 2JJ8A 2QGZA 5CLQA 3AF2A 2A5DA 1XJQA 621PA 5AW8B 1ZC3A 3KJEA 5KUTA 3U3KA 1PVOA 2OCBA 5AVUB 4HLQB 1KSHA 3NH9A 1G3RA 1OFTA 4ZDWA 4CRWB 4OI1A 2GKSA 5F3WB 4OQMA 2BASA 2WPSA 3VTPC 2XB2A 2WT7A 3NIBA 4OI4A 3L0IB 1ZM3A 3OEEA 1XDBA 4C0JA 3PEWA 1P75A 1Q1BA 4US0R 4KODA 3BH7A 2N9BA 2R2AA 3CZPA 3THOA 4ARZB 2HYIC 1RRGA 3TLXA 2B8TA 1E32A 1E96A 2HT6A 1SLQA 1XMIA 5LPNA 1WQ1R 2J5XA 4IOLA 4QBGB 4OK5A 2E43A 2YJTD 4TZ0A 5CMZA 2ZI7A 1DAFA 2OHFA 4YXWD 1G9XA 5AJXA 4A2QA 1G8FA 3WBJA 1QVRA 5KDLA 3JZMA 5AW3B 2YC2C 4PAMA 3VU9B 1P61B 2FFHA 2OZEA 1JQJC 2XXAA 1BMFA 5CLLA 2IHYA 3ZQ6A 4OJQA 2G1JA 3C8UA 4OBEA 3X1XA 1SVLA 2ZRNA 1N6HA 2WJGA 2Q9BA 2XEXA 4ZDJA 1ZAKA 3TSWA 4V0NA 1OH6A 2FEOA 1Y3AA 3B78A 1KI6B 1KMQA 1PUJA 2RGXA 1TX4B 2ZRLA 3OEHD 2BEJA 2J0QA 2O8CB 3W9YA 4D4KA 1V43A 4C3ZA 4OHZA 1Q3HA 2ZJYA 3QXCA 4DT1A 1ESMA 1UJ2A 1CJVC 4HEJA 3TUIC 4A4DA 1A7JA 4Q1EA 1VIAA 3L82B 2MSEB 4V0LA 5H1YA 4QC2A 4M4SA 5FPSA 2EFEB 5AW9B 1P2VA 1Z28A 4B74A 1VCMA 4B47A 1OWAA 3MUFA 3GLFA 2QUZA 2WWXA 3ASYA 1JBKA 4HB4A 1A82A 1NBMD 1GTWA 1IJEA 2ANCA 3RS4A 3UMRA 4L15A 5FL3A 1VG8A 2QGNA 1VYVA 4WA7A 1YZTA 1E9CA 5DN6A 4PX9A 2GJSA 4HAZA 1CKEA 1G5TA 1QHYA 4YONB 4F7WA 3EAQA 1MUUA 1HT2E 3DVLA 3W3ZB 4KFRA 1T5LA 3DO6A 2OFOA 4RZXA 5JI2E 4RFVA 2E1RA 1RRPA 4EPYA 2FMXA 1W0KA 5B1NA 3HJNA 4KP4A 5FL7A 1NIPA 2VSOA 3DPUA 5KU1A 2V8OA 5JJIA 4V0ME 1XPOA 2GXSA 4TZ6A 2Q9CA 1XEFA 1D6JA 2V9PA 4PHFA 1EK0A 3WBKA 4K46A 1XWIA 1DARA 4TMVA 5CB8A 1CU1A 5AVSB 1E9FA 3CUEF 3WNBA 1M1YE 3QQ5A 1AJEA 3NHAA 3ZCCA 2XITA 3MGNA 2C77A 5HZKA 3QJYA 2AK2A 1E3MA 1E0JA 1T3LA 3C5CA 4ITRC 4J0QA 2R5BA 2PH1A 2JLVA 3MJHA 4C2TA 3AKYA 2X1VA 1MT0A 4B73A 2NZ8A 4D4JA 3GPLA 1VHTA 1KO4A 5E4FA 4PPFA 5C2JB 4TLCA 4YLGA 1F5NA 4GMDA 3U44B 3B1WA 3B1XA 1WF3A 4DZZA 5KNBA 1HQYE 2EW1A 3FYHA 5FPTA 4A6PA 3TQFA 4IXMA 2WM9B 4TQAA 3SHFA 1G8HA 4BEBA 4V03A 3OF5A 5J4VA 2VPPA 2CDNA 4N3NA 4NE2A 1GU5A 4URYR 4JJZA 2ZSEA 2QG6A 4KYIB 4Q4LA 2AN9A 1NLYA 2AHOA 4CZ2A 1YHNA 1ZCAA 1SXJE 2QEQA 4DRZA 3CM0A 4ZDKA 1S4QA 3UWOA 2D7CA 3AUXA 3TQCA 3HU2A 3AF3A 1KZ7B 1XRJA 2IPPA 4Q18A 5AW6B 2RMKA 4AYTA 2C04A 5APVA 4Q20A 2Q21A 4JJKA 4LBVA 4XTCS 2NO1A 1W36B 1N6RA 4JYBA 1P4SA 3D36A 3QXJA 4PSAA 4A8JA 4V0OA 4DDTA 3ZIAD 2BOVA 4NH0A 2ZRDA 4W7SA 1ZJ6A 1W4AA 2GTPA 4Q1FA 1O87A 2HF8A 1AZTA 1ZP6A 3PIRA 3UKDA 1HBWA 1HQCA 5DHAA 2YHSA 4L9WA 1IN8A 4Q4JA 4V02A 5AUQA 2CHQA 2GCNA 2GHIA 4DLXA 5BN3A 1XCMA 4ZO4A 4KI0A 4CW7A 1GVNB 5G3ZA 3EG5A 3K9HA 4KU4A 1LVGA 1ZINA 5AW7B 4M1KA 4QGHA 5KSOA 1FP7A 3IO3A 2KP8A 2BKUA 4B3DA 4URWR 2F3TA 2D2FA 4GMXA 2GJ8A 2HJGA 3AKCA 3VHXA 3IEUA 3K8YA 1XD2B 4I1UA 3KQLA 4B75A 2DFLA 3QKRB 4HDOB 5FBQB 1KDOA 3B9PA 3I61A 1DAHA 4I6MC 2FZLA 1S1CA 4N0DA 5AR1A 4XOIA 5HCNA 5CM9C 3EA5A 4HYYA 1DOAA 1G3UA 4KCGA 4Q21A 2CCGA 4U7DA 2X2EA 3OIUA 3UWKA 1KMHB 3THYB 3P1JA 1RRFA 1ZD1A 4G5QA 4Q1DA 3TGPA 1X86B 3OIVA 5BWMA 1QHGA 1TF2A 4JVMA 2WOOA 4TL7A 2AXPA 3VR6A 3KQHA 4TYYA 1G4UR 1Q44A 5KPDA 5L3RA 3NC0C 1SXJB 3T5GA 3RHFA 1LY1A 2CLSA 2OILA 2X19A 1XX6A 1Z0AA 2FA9A 2KBEA 2VP2A 1ONBA 2V6JA 1KTVA 1T3HA 3B82A 1DG1G 1NSTA 2VSXA 5TARA 2ZXUA 2W58A 4G5SA 1VDZA 1JNMA 4E09A 5JECA 1MFZA 3EXAA 4LCBA 5ANRB 3CPHA 1Z6GA 1G291 2BM1A 1G6HA 2A78A 2GZAA 2QL6A 2ONJA 4LV6A 4WXRA 1W5SA 2WBLC 1CRQA 3BB1A 3MMPA 4UNSA 4Q9IA 1F2TB 5HKKA 3W8NA 3R9IA 1IY0A 4PXAA 2WIBA 2CE2X 1II9A 4O2RA 4BLOA 2PMKA 5BYKA 3WNDA 2NO6A 1VYTA 4P31A 5J4LA 1S3GA 5IHPA 2MMGA 2GESA 1YR8A 1II8A 5H70A 3AM1A 1SXJD 2O8FB 1ZC4A 2WWWA 1ZNYA 3GMTA 5J4YA 2ZI5A 2QTFA 2F3RA 2OAQ1 2XZPA 1GUAA 3NKVA 4RVCA 3BH6A 3BXZA 3CF0A 4FN5A 1WA5A 1T3SA 3GJ4A 2C2HA 2WHXA 4Q7MB 3M9HA 3H1TA 4MKGA 3ZVRA 4QBHA 2YWHA 2BMEA 4DVGA 2ZR9A 2GCOB 3ECCA 4GI7A 2QT0A 3ZRWB 3SQWA 1BO6A 4RD6A 2CL6X 3D31A 5A0FA 3S1AB 4XIGS 1P72A 3VHLB 4TLBA 3A5TA 2QP4A 2JA1A 4FD2A 2WMOB 1OF1A 1FOEB 3KB1A 1VTKA 3V5BA 1H8AA 2G0TA 2KB0A 1T5IA 2YVUA 3RRMA 2QORA 3EPLA 4XWKA 3A7OA 1N25A 3B9QA 3M1IA 1KYIA 1Z0JA 3M0AA 1DAKA 5JWOA 4XD7A 3NXSA 4C2UA 1EXMA 4R9UC 4B86A 5F9FA 1E1RD 1TMKA 5KNDA 1ODFA 1XF9A 2FF7A 4X8LA 4CEHB 4TYPA 2QTHA 4HAVA 4ZCLA 4EJSC 4DZOA 1GKYA 1UKZA 3D6TB 3K0AA 5DIFA 5IRCD 3BORA 4LJAA 3U7HB 3O8ZA 4P4UA 2ZR0A 5BN4A 1A2BA 4LYFA 3M4YA 3KX2A 4F4CA 4JLNA 3K09A 4FMCF 5CJPA 2P67A 4M53A 2CCKA 3MSXA 2VYFA 3VKGA 1N6LA 1W2GA 1KJWA 2REOA 2A5FA 1VHLA 1T4GA 1NN0A 2QNRA 2L0XA 3EW9A 3HWSA 5AW0B 2Z5HA 3KDPB 1U98A 4NZYA 3SEAA 4CVNA 4ZIRA 2LWIA 2XX3A 3F5FA 2JLXA 3AVQA 4FWIB 4Z1MD 1I2DA 2YINC 4XSHA 3GD7A 2RKOA 2IXGA 3HDTA 4PR0A 4MQBA 1PLKA 2J45A 1Z06A 2QAGC 3W3AA 3VMYA 3OAAD 5AVRB 4EPTA 4QBFA 2YKGA 4BZPA 2ZU6A 2AD1A 2AWNA 4WXPA 4KO8A 4D81A 4US1R 5CITA 4I5SA 5EUMA 4YXWA 5FBWB 1MKYA 1TF5A 1N5KA 3IQXA 3AP3A 5JSZB 4QM7A 5C93A 4JLPA 1OYWA 2ZROA 4IDQA 4DLVA 4O25A 4RY2A 3K9GA 4LPSA 4L5BA 1UAAA 2PT7A 3IPXA 4B3CA 2OESA 4HB3A 1RE0A 1KY2A 3K0EA 4PO8A 2R44A 2XB4A 5G3YA 3B1VA 5JCPA 2R6AA 3T12A 5KOYA 1T91A 4XJXA 2HDNB 2BDTA 1MRSA 3OIYA 1NMYA 3KJHA 221PA 3N5CA 3OEHA 4IOMA 4DLTA 3H2YA 2CK3D 5C46F 1N6OA 1FTNA 3W6OA 2QRZA 1RC8A 1W47A 3DZ8A 1KGDA 3NVAA 1TQ2A 2AL7A 4JSTA 1DO2A 2C03A 4ZPXA 2B6HA 4WIAA 3RWMB 3P8MC 4LHWA 4A92A 1WB9A 4BWYA 4EFMA 5TVKA 4LHYA 4DC9A 1C9KA 1YRBA 5FTLA 1ZU4A 1GRNA 4MYTA 4GP6A 1KI4A 2J46A 4EIWA 2W2XA 3VU9A 3WRXC 2DHRA 1C1YA 1XU4A 3AUYA 1XMJA 2R6FA 2GJ9A 1W4RA 1NBMA 3Q5DA 3G82C 5M04A 4R71A 2ZR7A 4TTPA 5CDFE 4U7OA 2YWGA 2JDID 3FKQA 4N1AA 2AFIE 3KKPA 2IS2A 4MT8A 5FBRB 3K53A 2RHMA 3I5XA 2VHJA 2AXNA 1RKBA 2PJZA 4KVAA 2N46A 2W27A 5H68A 1KI6A 4F91B 1I2MA 4PC2A 1G5PA 2VHQA 3LO5A 4XVQA 5TMPA 2OLKA 3CPJB 2O8CA 5LBIA 3A1TA 3QKSB 1KKMA 5GJWC 1Z2AA 5FTNA 4DB2A 1UPTA 1A5TA 4MUBA 1AS2A 3CRQA 3IIMA 3QE0A 1UKEA 3J81k 4LHVA 1OFHA 3RVBA 1FAVA 3CR7A 4MRVA 1VG0B 2BV3A 3QBVA 3HR8A 1J70A 2Q3MA 4PHGA 3CH4B 3VKWA 5E95A 1QHIA 5DISB 3QXHA 5KTYA 1CEEA 1KSJA 5TB5A 2IYLD 2D7DA 3FB4A 2ODEA 5KSZA 2CMKA 5AW4B 4NCNA 2QBYA 3F8TA 2ZJBA 821PA 1KI9A 3IQWA 1OPXA 3B13B 5AJWA 4RD3A 3LH5A 4AIIA 3EARA 4K8OA 4KAXA 4EPXA 3U3JA 4FWTA 5AVVB 5L3QA 3EA0A 4M8NE 1I4DD 1SVKA 1BH2A 3GJ8A 3MGCA 2P3SA 5CYOA 3HYTA 2IYXA 4JZKA 3GEEA 4MYHA 3M06A 1G1MA 2VEDA 3R9XA 1TEVA 4C0KA 4MGYR 2PBRA 4OHVA 2J0VA 4PAOA 3U60B 2G6BA 4FPPA 1KZGB 5HE8A 5E7JA 2FSFA 2IC5A 3W8RA 3BE4A 2VIIA 1SKYE 4QPKA 1AGPA 2F1RA 2D3WA 2WAYA 2XJ9A 2HXSA 2CHGA 1JR3E 2DY1A 2QMUA 4HAUA 3CBQA 1G6OA 1JB1A 4U02A 5FI0B 3V4WA 3A1WA 1QHNA 4XVRA 1DBSA 1CXZA 4PPNA 3HE4B 1U8ZA 3ZIAA 1XCGB 3SS8A 3IKJA 1L4UA 2LFSA 5APWA 1ZMXA 2WV9A 4Q00A 3U44A 3U6BA 2NMVA 5JJKA 1QG2A 1HWTC 1F3OA 1KO5A 1Q57A 3GJ5A 3IO5A 1XZPA 2NZJA 2LKCA 2VP9A 2ZI4A 1RYHA 3FMFA 3E70C 5FTKA 1OKKD 4G01B 4CGZA 3VR4A 4KHXA 3OIWA 1GL7A 2XNDA 3I73A 5C1BA 2IL1A 1GZSA 4DLWA 3BH0A 4I99A 4PO9A 1RVDA 2GEDA 4UNPA 1M7HA 1QG4A 3H86A 4XWOA 1E2LA 2IEYA 1KK3A 1ZUNB 2JCSA 3A1UA 1ZU5A 1JR6A 2H8KA 2C5LA 4PPGA 4A8JC 3MJRA 3UXMA 2ATXA 2IBMA 5C4MA 3QKTA 1KKLA 2RH5A 2PZFA 2ZRHA 5JEEA 3EPJA 5FUVA 2PCJA 2ZE8A 1CZQA 2HJVA 1E2HA 5CB6A 2OCPA 1OH5A 1CJUC 5FUXA 2GK6A 3CNOA 3A0RA 4M1TA 2IWRA 2AFHE 2REBA 2O8EB 5E7IA 3RDPA 4BZQA 2C96A 2W0MA 1KSGA 3IGFA 5AUOB 2Z4SA 2GJKA 3CX6A 4NU0A 5DYGA 3SN6A 2G0NA 4DIDA 1YZKA 2CBZA 4V0MA 4IFEA 1W5TA 1EWRA 4U00A 1U90A 1E2FA 2P5SA 3PV0A 4CIDA 5AUPB 2A30A 4D25A 1NI3A 1SHZA 2Z4RA 1HJBA 3KL4A 4GSYA 1HY3A 1SKYB 3SZRA 1KAOA 1GNQA 3GJXC 2F9LA 3N2IA 5JEDA 3KUCA 2PX0A 4Q4HB 4MRNA 3CRRA 3UK6A 1PUIA 2H57A 4DLYA 4ZI3A 4URVR 2ZUDA 1T9HA 4KJZA 5G53C 3AP1A 1ETUA 5EE0A 2F55A 2PJRA 4OHYA 1G18A 2ECKA 2RB4A 2WSSD 5TDHA 2NTYC 4HDCA 1OHHD 3EC1A 3L2OB 2E87A 3L0OA 3AF4A 1YKSA 1KMHA 2BEKA 3K70C 4JYCA 2GVDC 1K5DA 4L8GA 3ZGXA 4BFTA 2I1VB 4I4LA 3SFZA 1OXUA 3ZYCA 2KSQA 3W5JA 1I4LD 1Z47A 3FFAA 3VMXA 2OG2A 5HE9A 3A6PC 4B3BA 1NKSA 2JEOA 2XZLA 2QAJA 2XTMA 1SP4A 1SXJA 3GP8A 4Q9HA 1TTTA 1LF5A 4A0FA 1G7CA 1OE0A 2WKQA 2WWGA 3DOEA 4UNNA 4BQSA 2P2LA 5FR2A 1GITA 3WNCA 1JR3D 2ZQ5A 3AB3A 2H17A 4KFTA 3W90A 2BMDA 4YDHB 3EPKA 2ZFCA 3ND9A 4Q9LA 2FPMA 4UJ3A 4IOKA 4PSVA 1W4CA 2WOJA 3QBTA 4MRPA 3FGNA 3WRYC 3KDSE 3GCGA 2F43B 3ZVNA 3B8HA 4TN1A 2PLFA 4KBGA 1IXZA 4OQLA 3MG9A 3TNFA 2B7CA 1N2CE 1U0HC 4FMBB 2EWVA 4DSUA 3N2EA 4B3XA 2NG1A 2FH5B 4CDGA 1Z08A 4FCVA 1UBFA 4GZMA 3CONA 1NJFA 4NBSA 1P60A 1KO8A 2AX4A 1LNZA 2CNWD 2JJ1D 4A0GA 1J2JB 2O8FA 1XB2A 2R62A 4F93B 1E1RA 1ZD9A 1N5IA 2IXFA 2VO1A 3SJZA 2I1QA 2FPLA 1DPFA 2A5GA 2B21A 3U4QB 3ICQB 1JECA 4PC3A 5G41A 5HTKA 5TV2A 1W44A 3VFDA 4IEEA 1VCIA 1SVSA 5FOUA 4BFYA 3LIDA 3MRSA 4EOTA 1JEDA 2BVNA 2P6RA 1NRJB 2CJWB 3F3YA 3UIAA 1DS6A 2GCOA 2WJIA 1KI7A 1MABB 2OFWA 2GEUA 1TQDA 4Q4AB 3B6EA 4OK3A 3GLGB 2FFBA 2NPFA 1P2TA 1A2KC 3X1WA 2P7JA 1TF7A 2ZS7A 3ADCA 3FKSD 1E2PA 1N0WA 1P3JA 2QRNA 3UPUA 4JBWA 1Q21A 2GXQA 3HE5A 1G41A 4Z1MA 2OSBA 1NN3A 1HE1C 4XWAA 3OAAA 3NTUA 4MTXA 4US2R 1KAGA 1G20E 2QQ0A 1M34E 1TU3A 1KNQA 3FE2A 3KFXA 5EXSA 1US8A 1YZGA 4TLDA 5SZJA 2RAPA 1E94E 3H4MA 1GU4A 2QSZA 2W2TA 4CEHA 3K09C 4OI0A 3AGQA 3SU8A 1JPNA 4GKGA 1VG1A 2VHTA 3VX3A 1P9WA 4KVGA 1GOTA 5K8TA 1A1VA 1FQKA 1HA3A 3ZRVA 1GILA 2BIFA 4ZKEA 2YNMA 3AGPA 4AKEA 3MFYA 3QPVA 1GNRA 3UIEA 1E2KA 1U81A 4PQRA 4DKXA 3FHOA 1WE2A 4BFZA 1CS4C 1YQTA 3MCAA 1NMZA 4G5OA 3TVTA 3M0DA 2EQBA 2ORVA 1AKYA 2UZIR 2QPOA 2KWIA 2GCPA 2CK3A 2UVQA 3ZS8A 1RIFA 3ZZUA 1CR0A 1Q1ZA 1KHTA 5EE3A 1AQYA 3GJ6A 4GOXA 1AS0A 4QHTA 2DR3A 2LKDA 3V4RA 3GFOA 3K1JA 3ADDA 1II0A 5FPYA 5JSZA 1OT3A 1M7BA 1G8GA 2IYVA 5EP1A 3JZAA 1EFCA 5B30A 3Q7PA 4PZLA 5FI1B 1NJGA 2G3YA 2JDIA 4EQ6B 1CI6B 1PJRA 2HCJB 2W2VA 1E0SA 2R6GA 4OJKA 1K6MA 4KHZA 3CO5A 2DFKB 1S8FA 2IS6A 3KKQA 3K9LA 4R7ZA 2O0JA 1HTWA 2W6JD 1KK0A 4G0NA 5KDDA 4JL6A 4NCIA 1XEWY 3DHWC 2OBNA 3RS3A 4TLAA 2FV8A 1AGRA 1RPZA 2C78A 2NGRA 3TSZA 4RZUA 4XE5B 1G64A 4JBXA 3KQNA 4PQYA 2V3CC 5L3SB 1CR4A 3BFVA 4JKIA 4NP6A 2FOLA 1Q1QA 4TSFD 5JI3E 1E0KA 4BFWA 3EIHA 2CVHA 4MKFA 3OZXA 1T6NA 2Q9AA 2ZJZA 1XJ0A 2QPTA 5JRJA 1G7TA 3VMZA 1SHKA 1BYUA 4IJMA 3SJCA 3KQKA 2H7VA 4CEJB 1GK4A 1JJ7A 1GG2A 2DBYA 3LAWA 1Z6TA 3CRMA 3AKDA 3WYFA 3LD9A 4M1MA 3PJRA 4C9BA 1GIAA 4NMMA 4RD1A 4MGZR 4LDJA 1TU4A 3V9PA 4DCSA 5APXA 5SZHB 1GP2A 4D2IA 1DAIA 4R2IA 1LF0A 4PHTA 4ZKIA 1R0YA 3KTAA 3TR0A 4F4JA 1Z07A 3W34A 2TMKA 2ZSDA 3SI7A 5GJBA 1TQ6A 2A9KA 3C4JA 1IO4A 2EYUA 1AIPA 5F98A 5ELXA 2KBFA 1NN5A 2XNDD 4LV5B 3X1DA 4QG7A 4IRUB 1K5GA 3GJ0A 2H5EA 3AF1A 3I72A 1WBDA 1E2GA 4C7OA 2ZRJA 2G88A 2WTYA 1TUIA 1Z6YA 2VRSA 3OE7D 3Q72A 2ZRMA 5G40A 3KUDA 3LWNA 4ZCIA 1SGWA 4DHEA 4ZCMA 4QXAA 1E99A 1W36D 1KO7A 2ZRIA 5DGXA 4MA4A 4E5UA 6Q21A 2ZANA 4DLZA 3DKPA 3LBHA 4OL0A 1WRBA 2IUUA 2JLZA 5DYIA 2QMHA 3K0FB 1NVWQ 2OM2A 2D74A 3T35A 2J3EA 1OKKA 2B92A 1XXHE 4H1UA 2MSDB 2ZJOA 2ZRGA 3ONWA 4FMCB 1DELA 2CVFA 4PHHA 3THWB 1S1MA 4GRAA 2AK3A 2Q0HA 4JL5A 5CK5A 5JLJA 4HB2A 5HR5A 1JUNA 2QT1A 3LW8A 4TYNA 3CPEA 4EJSB 1HE8B 4YMWA 3DM9B 4NYMR 3UG6A 1HH4A 4W5JA 4YMSA 4FCTA 1GL6A 4GNKA 3BAFA 4AI6A 1L4YA 3K9NA 1RFLA 3CZQA 1PLLA 3FVQA 2ZAOA 3FMIA 1R2QA 2FPKA 3BD9A 3NFQA 3U6KA 4RESB 1E9DA 3KQGA 2Z83A 4FINA 4HZIA 4IOJA 4JSYA 2E9SA 4LJ6A 4G1UC 3SJAA 1Z29A 3LA6A 1G21E 3KKMA 2EWWA 3O8BA 4NYJR 2QMOA 3VR2A 3KFVA 4LJ7A 4UQOA 1NG9A 3IR9A 5GVRA 1Y63A 4HUQB 1TPZA 3D3QA 1E2QA 1G3QA 2YC4C 3KXIA 1N6PA 5DLQC 5E7MA 4JLAA 4Y0VA 2O0HA 1FMJA 1RZ3A 2FFQA 2W83A 4IEIA 4PZZA 4AY2A 3TE6A 4OKSA 3EIQA 1T8TA 2GXAA 3IHLA 3BS4A 4QNMA 4C4PA 1S9HA 3GLFE 2WWYA 3AVVA 4HI0E 4DEYA 4BRWA 1YVDA 2Z0MA 2WT7B 4LK2A 3IILA 2P6UA 3SDZA 1F2UA 1OXXK 1PZNA 2YOFA 1GKUB 2FGJA 4B2IA 4DLSA 4ZDIA 2ZRFA 1T8UA 3CR8A 4KFUA 2WSSA 3CX7A 5KSYA 1IN4A 3P7KA 2IYTA 5IDVA 4DCVA 2ZRCA 1OHHA 2O8EA 4JIMA 4YMVA 3M0EA 4IW3B 4MUAA 5J4HA 3QUSA 1FX0B 3IDQA 1BOFA 4KFSA 3WP1B 5AW2B 2VH5R 4Z8XA 4DUGD 3IBYA 2HT1A 5IF9A 1XXHB 4X8MA 3I62A 2X77A 2RGNA 3THXA 1KK2A 3QPWA 4L4UA 2YOHA 4C0QC 3HYRA 2VSFA 1XNJA 2O8BA 3QEOA 1RW4A 2WJJA 3EPHA 4IKEA 3LQRA 3VR5A 3UATA 3R8FA 4ZV4A 3ADKA 1NVUQ 3SYLA 1JR3A 2C9OA 1R5OA 1G17A 1P73A 1EX6A 2DFNA 2FSHA 3GLIA 2ZRBA 2FZ4A 4BRUA 1SVWA 1OB2A 1GDDA 5AJVB 4AKGA 4R98A 2GAAA 3ZS9A 3TH5A 2XV5A 4WZBE 3AVPA 1EFRD 4RFSA 3DMNA 4U5XA 1VKJA 4Q1AA 1SVOA 2A5YB 2V4ZA 4Q1CA 1Z0IA 5J40A 1YZNA 4B6EA 1SXJC 4H9GA 2VTKA 4F92B 1UKVY 4XSGA 1VCNA 1C4OA 1F51A 1XEXB 2OBLA 2YO3A 1FUUA 3CWZA 1DADA 1GAJA 2CNWA 2JJ1A 3E1SA 4QJ5A 4E07A 3BB3A 2O8DB 1IN7A 3RABA 4FW9A 4TT3D 3BFKA 4BLSA 4C0LA 1RRCA 2P65A 3A58B 2F6RA 4X8HA 1XMSA 3QG5A 3U7GA 4GCZA 3GLFB 4YDSA 1NF3A 1E2MA 1OXVA 2VRWA 3P4XA 1ZRHA 3U5ZB 4TMKA 1CJMA 4GDFA 1OFIA 2WWHA 3QG1A 3QXSA 3OESA 4FMDF 2PZEA 3P20A 1X1SA 2Y8EA 4FIDA 3T1VA 4B48A 2NO9A 4LY6A 3QPUA 3FKSA 5KNCA 2HEIA 3IIKA 1TQ4A 1NY6A 1FP6A 1ZIPA 2KI5A 4EPRA 1FW6A 1GZLA 1QF9A 1ZVQA 3VQTA 4NDZA 4JLJA 4WOPA 4ARZA 2DYKA 2ZYWX 4X8OA 1DG3A 2J7PD 2XTZA 3ASZA 4RD0A 2VA8A 1J2JA 1VPLA 2FGKA 3A2AA 5KDOA 3Q3JB 1VYUA 5B57C 3HTKA 2PEYA 3R7WB 2WKRA 1G8YA 5F2EA 2DPXA 4BLPA 4C0SA 4IFBA 3U4QA 5JWHA 2YO2A 5AVWB 2FFAA 4NKRA 4PPQA 1Z22A 4S35A 3CNLA 1ZM7A 2EU8A 3NEYA 1S9KE 4NPHA 1CJTC 1DAEA 1P7CA 2CHVA 3T5DA 1M2OB 4GT1A 2W0SA 2DFTA 1ZCBA 2BBTA 4Q4AA 2F9MA 5AJZA 3U2QA 1XBTA 2Q3FA 3BWDD 1N6KA 2QU8A 4DCUA 4LUCA 4C7NB 2EYQA 4A1FA 3EC2A 5B64A 4CEIB 3A1SA 5GJVC 3PQCA 1QBKC 1IXMA 3LW7A 2GDJA 4MGIR 5AVQB 1M7GA 4DSOA 5AVTB 4QNRA 2VP6A 3B2EA 2J0UB 4NTZA 1X1RA 4TMXA 2XSZD 4QKQA 2IS4A 2FWRA 3A4NA 1QRAA 3QKUA 3RS2A 3KJIA 3LVRE 3TAUA 2Z43A 2BKEA 1QZXA 2YYZA 4ZKDA 3T97A 4YMUA 1ZD8A 3U7EB 3SHWA 2ASEA 1CR2A 3A4LA 1WDTA 1XTSA 3FMOB 4Q03A 4YQFA 3AV0B 2QE7D 2WJHA 1IY1A 1XFAA 3L35A 1CIPA 2QM8A 4IDOA 2ZJ2A 1T2KD 2Q7CA 5L3VA 2ZEJA 1JAIA 4P33A 1JXMA 3FOZA 4NYIQ 1CULC 1ZNZA 2HV8A 4LGMA 5FOXA 4MITA 2HF9A 121PA 1H8HD 4LHXA 1EFUA 5J4KA 4M3LA 2R6DA 3TJZA 1IXRC 3O47A 3FWYA 2IT1A 1QDEA 2W6JA 3AEZA 3P27A 1N6IA 4JT4A 3LBNA 4NCJA 2NIPA 5E3HA 4URXR 1BKDR 3B60A 5JCZA 2QP3A 3QENA 3MLEA 2OEPA 3GFTA 3P4YA 4TTRA 3NMDA 2ZITA 1E79D 2H1LA 4ON9A 3BIFA 4LZZA 3WHKA 3TUZC 3G5UA 4TSFA 1RYFA 2JIZD 3KB2A 1FNMA 3LQQA 3TIFA 1VG9B 4UNRA 5FTMA 3UMSA 1W7AA 3T15A 1MH1A 3AF0A 3ZVMA 2BMFA 2G83A 4DIEA 4B43A 1OIVA 2I3BA 5C4GB 4EQ6A 4KV9A 3RRYA 5JBQA 1E0AA 2D4HA 5DI3B 2VL7A 3B7GA 4IVRA 5EE1A 2NPIA 1XJCA 2ZRAA 3TYYA 3TW8B 1Z5ZA 3BFXA 4DLUA 1DEKA 3RYTC 3WP0A 3QF7A 4UKDA 1NVVQ 2IF0A 4TLEA 3HPQA 4AWXA 2CL7X 1S96A 2ZYTX 4Q5IA 4TL8A 3PUXA 1TAGA 5CIQA 4A6XA 5LD2B 5FPKA 4DB4A 5FOWA 1XTRA 1HYQA 2G1KA 1J8YF 4O2LA 4EFNA 5D3MB 1V5WA 1GM5A 4GBMA 4Q47A 1Q12A 1WCV1 1NVXQ 1MV8A 3X2SA 2WTUA 2RGGA 1S9KD 1GL9B 4M22A 1G3IA 1P6XA 5HCIA 4DJTA 2GZDA 1MO3A 5CYPA 3C14C 5APUA 1TEXA 5FFMA 1OV4A 3OE7A 3KQUA 1EGAA 1EG7A 3NG1A 4OI2A 3AVYA 1M8PA 1N5LA 4GP7A 4BPBA 1EFHA 5K8UA 4Q9KA 4JAVA 2G77B 3E5HA 4BZXA 2ZS9A 4LRWA 4HLUA 1P2SA 4NL4H 1W0JD 1UDXA 1CLUA 2QZ4A 3E2IA 4Q01A 4QGAA 5KSPA 3TRFA 5J47A 5AVZB 4KSBA 2D62A 1KOFA 2RGDA 4LBWA 5K8IA 4EFLA 1E9AA 4JLBA 3PXGA 1IN5A 2J9RA 1DE0A 1JALA 3DMDA 3RS5A 4IVPA 4BE7B 3TK1A 4ESVA 1QHSA 1II8B 2IYRA 2ZE5A 2JLYA 2IS1A 1EESA 4ACAA 4BFVA 5SZKB 4FCWA 1DAMA 1E2IA 3PUYA 2GBLA 5EE9A 4M21A 2XOKD 2IYUA 4C0AC 2JLSA 2I4IA 2NQ2C 2XZOA 4AURA 3NDPA 4AKHA 1KY3A 1UEJA 2J7KA 5FOSA 4KSCA 3ZRXA 1NLFA 1Q22A 2WICA 4KXFB 3RANA 3T1OA 1UBEA 1U8YA 1Z6XA 3AVOA 1J99A 2FJUA 2O0KA 1FNNA 1OYYA 5FBLB 1YE8A 5FH9A 4GOJA 3SBEA 3TVDA 2DWQA 2CE7A 3NBYC 1KJYA 1XD2A 3QKRA 3NEJA 2AKYA 3LX8A 4A36A 1KDPA 4QHSA 1JQLB 5TY0A 5DHFA 2ZVPX 1HUCA 4MYCA 3GLGE 2AWOA 4MYUA 1XMVA 5AVXB 3EX7C 1N0VC 2ZI9A 1G5RA 4JVNA 3EIEA 3NBXX 1P2UA 4MRRA 2PL3A 4QFMA 1SQ5A 3THYA 3LNCA 2GWHA 1CSBA 4ACBA 1GK6A 1EFTA 2ZE6A 2IHBA 2QI9C 2J41A 5AWFC 5IT5A 3M91A 3G0HA 3I4LA 2C9LY 4HB0A 4EPVA 2V7QD 2QPAA 3REFA 4AKIA 1E9SA 3VNVA 4Z54A 1Z63A 1GNPA 4BIZA 3RC3A 2AR7A 2FE4A 2UZ3A 3NH6A 5EP3A 4LYJA 3PEYA 3EZ2A 5CK4A 1QHHB 3VMFA 3BBPA 2ODWA 5FR1A 3QNUA 2KJQA 2IYZA 2VBCA 2P0EA 2YOGA 3CRVA 3PFIA 3MWLA 4B2LA 3O8CA 2VF7A 4QPJA 1VECA 1ZNWA 4Q9JA 4C0BA 3FFBA 1WMSA 3HU3A 4F38A 4D0GA 3C15C 5HPYB 5LB2A 2WKPA 1F2TA 1Z8FA 2GA8A 4JKYA 3I5CA 4DUGA 4DBLC 2RHDA 2C9YA 1QHXA 2IYWA 3L8YA 1R4AA 1TUEA 4LPKA 4HUQA 1A4RA 2GVZC 3K0CA 3EZFA 2BJVA 4ERNA 1D2MA 1Q20A 1RJ9B 3AH8A 1Q3TA 3MWKA 4RCZA 2QMEA 4BASA 2OBMA 2H18A 3BC1A 3VR1A 4JT2A 1IJFA 4RD2A 4IDNA 4EUNA 1A02J 1OH7A 5B1OA 4JL8A 1MR3F 3JVVA 4QGGA 1S3SA 3D7MA 4QGFA 3WYAA 3QF4B 4LI0A 4C30A 2OCAA 1AZSC 1MOZA 5GVSA 1FMLA 3W5IA 3BJIC 3I3SR 4OHWA 3LVQE 2ZSBA 3ZRWA 3MAAC 4PFSA 2ZSFA 2GEVA 4DSTA 1NP6A 1EFRA 1W2HA 2FX3A 5BW8A 5JZVA 4LJ5A 2WAXA 3S1AA 1JOYA 2RGNC 3ETLA 4HZUB 4UXHA 4LV8B 4Z8YA 2EFDB 3PEUA 1FX0A 1XTQA 2XU6A 3QSYA 2GAOA 3IBGA 1XXHA 1YZLA 1X6VA 1R5NA 5P21A 5KPJA 4LHZA 1AA9A 1J8MF 2PLRA 4I1OA 1U94A 4TT3A 2R8RA 4TMZA 3UG7A 1MRNA 3BERA 2BCJQ 1ZM2A 2ZE7A 1IXSB 4B71A 1SKQA 2V55B 1GRQA 4PQFA 3V4QA 2J87A 2IXEA 2PX3A 2VHCA 4QJ3A 1DH3A 1NLZA 3VYIA 3AKEA 5A4JA 1NN1A 3FHCB 3C5HA 1IY2A 1SZPA 5APYA 4NONA 4XH9B 1YU9A 4OQXA 4D4MA 4EDHA 2GF9A 1VMAA 4B6FA 2JATA 4LOAA 4M2LA 1AKEA 3BB4A 2R32A 4AYWA 1DTSA 1K8RA 1N5JA 5A5GA 4OYHA 3TKLA 2P6NA 4IVQA 3KXKA 1IONA 3I8SA 1F6BA 4RZ2A 2OUKA 4JLMA 4EPWA 4M9SA 2ZI6A 1ZBDA 5GJCA 3RWOA 3KKNA 1YZQA 4MRSA 1XEXA 1XD9A 2VP0A 2J7PA 4JASA 4P0TA 3O8RA 1SULA 2O8DA 4URZR 5EJEA 4HLDA 2CLDX 3PCRB 4JLDA 4RZ3A 421PA 1GKIA 2LCFA 3FHTA 1X8JA 1U99A 3I8XA 3AVWA 1E9BA 3B85A 4BECA 4DCNA 2CCJA 2VP4A 4TTQA 3W6PA 4RKFA 1T0HB 4AYXA 1IHUA 5HZHA 1N0UA 2WJVA 2XTNA 4LYAA 1E2EA 4PANA 3ZQJA 3B1YA 1MO6A 4WW0A 2QBYB 4JVLA 1G7SA 5TXGA 4G3XA 3OHMA 5L3QB 2FSIA 4E22A 3DGEA 2YWFA 2ODNA 2VHUA 1E2JA 3SBDA 3Q9LA 5EUQB 1LV7A 2JJ2D 2HUPA 2X8AA 5GADl 2C2AA 1B0UA 1E9EA 1PLJA 2J1LA 3O8DA 2QN6A 4BFSA 3SR0A 2F7SA 1J7KA 1R8QA 4Q02A 1G7RA 1QVAA 3MWJA 4A2PA 4LBYA 3RNLA 3DEFA 2XSZA 1UADA 3LLUA 2R65A 1NIJA 2Q5UA 3NBZC 3QY0A 3RS0A 4AC9A 1GTVA 4GOKA 4RCYA 2XNSA 3ZJYA 1WP9A 2Q3HA 3VN0A 1H89A 3LXXA 5DNYB 1HEIA 2OAP1 3R7WA 2GNOA 3X1YA 4DXAA 1E2NA 2DCUA 3TAHA 2HLDD 1ZIOA 3ADBA 4BIUA 4AK9A 1TL7C 4D80A 4WZ6A 3BOSA 4O0MA 1ZW6A 2ZJ5A 3CX8A 1TNDA 4M9XA 2QE7A 2RGAA 3BGWA 3RS7A 4BLQA 4PC1A 1N6NA 3TMKA 5L8VA 3B1ZA 4DLRA 2WSMA 1KDTA 3EWAA 4GL2A 4Q1BA 4C7NA 3PITA 4D6PA 2QTVB 2FN4A 4B34A 1E4VA 4I1SA 4CEIA 3EZ9A 2C9NY 2JLUA 4FI3C 1H8HA 1IM2A 4CT5A 2PEZA 2ZIAA 1LFDB 1YRAA 4NCHA 2VQSA 1AQUA 1UBGA 2BC9A 1H8ED 3B5JA 2J0UA 1EX7A 1E2DA 4NYMQ 3W6NA 2IYQA 3F0TA 1XTKA 2IUSA 4OHXA 3TSOA 3QKSA 3U3RA 3PUVA 3GLHE 2KE5A 3SYNA 5IK2D 1IOZA 1E79A 2ZVQX 4P4TA 3ICEA 3Q8XB 2R9VA 1U9IA 4BLRA 3QOFA 3PUWA 1SVIA 2JIZA 1G4AE 3K0SA 1COWD 1G8PA 2X2FA 2CXXA 3EZ6A 1OJLA 3ND8A 4N0EA 3TNUB 3PUZA 4HYTB 2V6IA 4FMTA 1ZUIA 3QI2A 4NYJQ 4EKDA 2Z5IA 5EXXA 1KQLA 3SE0A 4IDHA 1OSNA 2EFHB 2WPDD 2ZREA 1VIYA 1OW3B 1N3BA 4HATA 2J59A 1NL3A 2BMJA 3SJBA 3GFPA 1HT1E 1X8YA 2IEZA 3ZLJA 1EWQA 2OO7A 2A3RA 4O3MA 3CLVA 2FEMA 3I1FA 2BHRA 1OIXA 4C46A 2AKAB 2IYSA 2BBOA 4TWZA 2ZRPA 2RGCA 4KLZA 3HPRA 3GQBA 1R0ZA 4I81A 3ZDQA 1E9RA 1A02F 2QA5A 3P32A 4Y0AA 2N42A 1DO0A 3KKOA 4RKEA 2GF0A 3OFND 2ZJAA 4P4SB 3X1ZA 2SHKA 3CRW1 3R20A 3WMEA 1S9DA 2ZUBA 4DEXA 1R10A 4B2PA 3FDIA 5DH9A 3EZ7A 4JBYA 1MV5A 1XTJA 2W6ID 5AJYA 1NSFA 4TQUS 5J5CA 4W9MC 5H8WA 1E1QD 3PEVA 4RJLA 3Q5EA 4JAUA 1YYCA 1W46A 2N1BA 2H92A 3C7KA 5CDFA 3WMGA 2OLJA 4H1VA 3FMPB 3AVXA 2GETA 5DI3A 2IWHA 1W0JA 3TUJC 4AG5A 2VLIA 1OB5A 3HE4A 2ZETA 3M6AA 4UXJA 4WVFA 1R0XA 3RRZA 4AYCA 3TR5A 3LDAA 1YR7A 1GSIA 4II7A 1YR6A 4ASUD 3LX5A 4YC7A 2WWFA 1X8LA 2WZQA 3BRWD 3VX4A 3GLHB 2XOKA 4XVUA 1AS3A 3KJGA 1ANKA 3U7FB 5F9HA 2ERXA 1P9RA 2QAGB 2R6CA 4FMDB 3RAPR 5D3MA 1YR9A 3VTKA 3C41J 3T61A 1J90A 4Q7KA 3M9BA 4IDPA 3WHLA 2Q6TA 1KIMA 2V1UA 1W49A 2NO0A 1W36C 3V00A 1JNYA 4P32A 1KK1A 1UF9A 4HLUC 2RCNA 2ZS8A 4B3GA 2JLQA 2QP9X 1ELOA 4D4LA 1KI8A 1OLOA 2A7QA 2PCLA 1UEIA 3LRPA 3MWYW 1UFQA 1Z83A 1CBUA 2IYYA 4BFXA 1U2RA 2C98A 1I4TD 1D9ZA 2WWIA 1KSFX 3UMFA 3WYGA 3PG5A 4LC0A 4AQRD 1ESNA 2GBLC 4MDFA 1HUQA 1SVMA 3U3OA 2G9NA 4QBIA 4POAA 1Z0KA 1JPJA 3L37A 4HDQB 1Z3IX 2HCBA 1L7VC 1Z6AA 2W6AA 1XTIA 2GRJA 1OIWA 1Q1EA 1U0JA 1E6CA 3OAKA 2D06A 3PVSA 4OQNA 4LSGA 5CIWA 5EZ6B 3A4MA 4JLKA 1HV8A 1IBRA 1R8SA 3FPAA 3A8TA 3KXLA 4HUTA 2ZRKA 5KYKA 1LB1B 2V7QA 3WMFA 2R5DA 2GK7A 3R8CA 4LJ8A 2ORWA 3A36A 1LW7A 3CIOA 3Q7QA 4M1SA 2XXAB 4URUR 5FOTA 5CJ2A 4Q66C 2QROA 1CJKC 1B23P 4Q4HA 5EQTA 1UKYA 2GXUA 2QY9A 5JHGB 4E03A 3HE5B 4HSEA 2EVWX 3OEED 4KBFA 4PTLA 3L36A 1DAGA 2C99A 1AK2A 2QENA 1D2NA 2IK8A 2FG5A 2WJYA 3DZDA 3WY9A 4BUJA 2JJLA 3CH5A 4OQFA 4C0HA 3ZD6A 3RSLA 2A2ZA 3SYKA 4Z51A 1H65A 1CR1A 3SC3A 2QSYA 3RRNA 4DDWA 1US8B 2YWEA 1ZM9A 5AW1B 3A37A 4A9AA 3AVTA 3RLFA 4CYMA 4M0LA 1XZQA 1D2EA 2ZYVX 2PZGA 2XAUA 1X8KA 4PZYA 2OT3B 4Q19A 3QIAA 5FOVA 1FUKA 1OXTA 3CWQA 2FTKA 3P26A 3VAAA 1FFHA 3GEHA 4GPTA 4LJYA 4TL9A 2F1HA 4Q48A 2OCYC 2JGNA 5LDDC 3V4FA 2QQEA 4MGKR 2ORIA 1AM4D 1BMFD 4D0NA 721PA 2ZXEB 1QHHA 2A5JA 3IUYA 4UNQA 2REXB 2BBSA 3PR1A 2EFCB 3HP1A 4OK6A 4UJ5A 4B33A 1P9NA 3LY5A 2B8WA 2ODBA 3L43A 2BWJA 3IPYA 1OH8A 4M9ZA 4CF7A 2F1JA 2F43A 1D8TA 2OXRA 4BLTA 5APSA 2O5VA 3K0CC 1ZYUA 2ONKA 4PO1A 5FTJA 2GJAA 3WXMA 4B32A 4L9SA 1CP2A 1FPMA 1XPUA 1NMXA 4R2HA 2Z6VA 3IEVA 2FU5C 5EE5B 2OV2A 5D3QA 2MSCB 1E4YA 1UM8A 4JMPA 1XEWX 1RJ9A 4AD8A 1ZUHA 4A0RA 4DCTA 5JS8A 2OXCA 4PC7A 3REGA 1FOSE 4TMWA 2VF8A 5DI9A 2CL0X 2PMDA 3U3MA 5EXPA 2FDCA 5DN6D 1NNEA 1GRRA 1O3YA 3QF4A 3ZD7A 2CJWA 1YZUA 1MABA 4DT1B 4ZI2A 1OXZA 3GLGA 3LXRA 4YMTA 3R9WA 4GFDA 4W5WA 4DDVA 2ZU0C 2IW3A 1Z2CA 2ATVA 4HZUA 1R6BX 4QJ4A 3QEJA 1W0KD 3AQ4A 4B35A 5JHHB 1S2MA 3CW2A 1M74A 4LWZA 5FL7D 2D2EA 2FSGA 2DWOA 5APQA 4WBSA 5DSZA 4RD4A 4AUWA 5K8LA 3L0PA 1LS6A 4JVSB 4M1YA 2BJWA 1KI3A 3QVUA 5BYJA 3CF2A 2IA5A 3RC8A 4NHOA 3UANA 2MMCA 1JJVA 2ZSAA 2V1XA 4LC1A 4NCKA 1R5BA 4S2EA
chains in the Genus database with same CATH superfamily
1HE4A 5CW1A 1IJDB 1DKUA 1GDTA 4IWNA 3WIUA 2GSWA 1N2CA 1ZN8A 4I08A 3NUZA 4RF2A 9MHTA 1MAWA 2QEXP 3IESA 3DM5A 2R3CA 2YXRB 1YVEI 2PY6A 4B84A 3DHNA 5CVUA 4P3YA 2AZTA 1YL6A 4UB8H 2FPPA 1E5LA 3DGEC 2KS1A 3QXXA 4M38A 4D9MA 2C3OA 1UIRA 1GM7A 5ICGA 1J56A 1C4WA 3VJLA 2ATIA 2YYSA 3ZZ0A 1STOA 1ZIXA 2FVXA 4RPHA 4YJ2F 5B3AA 4W4TA 4JNCA 3GN2A 1MO5A 3MWGA 1SRQA 1UKBA 5IAKA 3IC5A 4LXGA 2OGWA 5C18A 1Y67A 1SQQE 1T2KC 2FPRA 4XM1A 2F1IA 1NV8A 3ADPA 2AA3A 3N6RA 3HI4A 1ZTEA 1ZNXA 2O14A 4QM6A 2Q3LA 3GDOA 1LJ8A 4UEOA 5LQAA 2VK2A 2OHOA 2JLRA 5DLEA 1H0RA 1GQFA 4GZLA 2QRVA 3CNQS 5KMGB 3UYKA 5J9PC 4QAJA 2QJRA 2E42A 3DL0A 4BEJA 2WC1A 3I37X 3QOYA 1XIVA 1KDRA 5TISE 1H38A 1QDUA 2VCHA 4Z7NB 3PEEA 1GR1A 2QQ5A 5AQEA 4P2BA 3UJAA 1VB3A 4ASUA 3VBEA 2IHUA 1VQ5P 1GXSA 1Y4UA 1L4BA 1X94A 1JHXA 2OZPA 1KI1A 2FW8A 1OV6A 3THWA 4NJMB 2VJAA 1NPDA 4U3JB 1QE3A 1L1EA 4PTZA 2R6ZA 4ESHA 4H0LB 1TLTA 3SJAC 3IUQA 3W5VA 1XDSA 1ZD4A 2XASA 4UD6A 5H83A 3QVNA 1ECCA 2QD3A 2C7OA 4ZDWA 1GLGA 4OQMA 1I94B 3SXUA 5BVGB 3OHSX 3H1HG 1BXRB 1XZGA 1XVAA 4ARZB 3TPZA 3WK4A 1PN3A 4B09A 1JO5A 4GI3A 1XMIA 3PQFA 4YXWD 1SERA 3HD7D 4QE9A 2OZEA 3ER8A 4D99A 1I2AA 2IHYA 4JXZA 4GYWA 4OBEA 3DLCA 2H0AA 2I6QA 2Q9BA 4CM9A 1P0MA 1ZL2A 5M34A 2YDXA 1G0OA 1VF6C 4WACA 5EMHA 4PZ0A 3OMNB 3ACDA 5I45A 3AG1C 4C3ZA 4IG4A 3B77A 5FPSA 3ISTA 1FRNA 5LWHA 2YIUB 3ASYA 4RTSA 4P54A 2CH7A 4JI5B 1JHMA 1TJYA 3DO6A 4RZXA 2P4VA 2YKPA 1HG1A 4TXHA 3VSDA 4ENUA 4RJJA 2ENWA 1EK0A 1IHOA 1K4MA 2JI8A 4WTOA 1AJEA 3NHAA 3EEOA 1X38A 2AK2A 3TSAA 2ZWMA 3S99A 2QXTA 1IWPB 1MT0A 1DEOA 4MVYA 4X45A 1KIAA 4KQXA 4Y99B 5E6UA 2P77A 3SHTA 3RQSA 4GKAA 4KW7A 3KLMX 1YHNA 4O5AA 2QEQA 4EZIA 6REQB 2WMDA 4X44A 4EY3A 1E18A 2RMKA 4KIFA 3PX2A 4R7TA 4C2BA 3HVIA 5CA3A 1T0IA 4CU2A 3G9TA 3JZDA 3UW1A 2YHSA 4DXHA 1IX9A 2V4MA 4ZO4A 4LHEA 4UZEA 3L1JA 4URWR 4YJKA 2ZB4A 3L73J 1WZUA 3EVFA 3VDQA 2DR0A 4YXWH 4X1YB 1U3DA 2KB1A 4RMJA 3JQ8A 4TN5A 2EP5A 1SZXA 2OECA 5KPDA 5EERA 1UMDB 1K9MW 5ES3A 3CX4A 3HDGA 3DUFB 4D45A 2KBEA 1ULHA 2QYTA 3D2LA 4IIFA 3ELDA 4BYGA 2QLMA 5CHEA 4OMDA 3HTXA 3FETA 1G1IA 1PP9D 2YIDA 2DKOA 4JI2B 3LYAA 3LHFA 4UNSA 4Q9IA 1IHPA 1WUHS 5FNVA 4ITUA 5IYBO 5J4LA 2O8FB 1VJ0A 2JG3A 3NKVA 3VQWA 3LPDA 2CFCA 2JLCA 3E81A 4ZYWA 4Y9DA 2HZ7A 4M76B 1Y89A 2RC5A 4PG6A 3WE7A 2P69A 4DLLA 5H59A 3NHJA 3V5BA 3K1AB 3U62A 3DMTC 4OVNF 5AVXA 3QVTA 2REQA 4BIIA 2VQFB 4RA6A 2J67A 3U7HB 3NCTA 4C87A 2JFPA 2A5FA 3OMAB 4EENA 5A4MS 1KYOF 2JLXA 3AVQA 4FWIB 1I2DA 5THXA 1V47A 2QAGC 3CX3A 4MVRA 5EWMA 1MQ8B 2Z9DA 1U2DA 2YJNA 4A3SA 3WIOA 1HFEL 1JVSA 1I1QB 2J4CA 4L5BA 4FB4A 4B3CA 4A5UB 2R44A 1NZJA 5JCPA 3ABUA 4QTUB 3PC8A 5E9JA 4DCCA 1LLCA 3OIYA 2RNBA 5DWQA 4K6MA 2RHBA 3C0KA 2QAIA 3QGMA 2W6MA 3OQNA 1J1EC 2VQ3A 1XAJA 2W2XA 1C1YA 3ENQA 1EEHA 4U7OA 4Y3UA 1UBJS 2W27A 1OAAA 1P84D 1PP9H 2EINB 5GJWC 4MUBA 1T8WA 5FI5A 2CXTA 1OFHA 4HDKB 4CWAA 4KQHA 1RQGA 4PHGA 5LP6A 3IAEA 4MI3A 3ABMC 4Q9NA 4ZRNA 4FZ5A 3TOVA 5AJWA 2R96A 3U3JA 4LOJA 1I4DD 1JBEA 2P3SA 4DV3O 1YAHA 1NYHA 3R9XA 5JZSA 3HCFA 4NK5A 1A4UA 1OFUA 4ONEA 3WLMA 3WSVA 4JX8A 2Q67A 3WL3A 1VE7A 3CG4A 3RYCB 4LNHA 1MEEA 2RFLA 3ZCUA 4YCCA 5AVJA 5KAFE 2O01H 4Q00A 2DQ0A 3UVEA 2AOVA 3GJ5A 2OBBA 1Z3CA 1Z5UA 1Z7GA 3WICA 1USGA 4CGZA 1YS9A 1FUYB 5KVSA 1LBHA 4J1TA 2H8KA 4NS4A 1OLXA 3W05A 2C5LA 3UXMA 1W1UA 2CFOA 1QLEB 3VGJA 5K0CA 4NMLA 3SQDA 4J4TA 3CCFA 2GJKA 2XB9A 4HRVA 4IL6E 5KCMA 2WSIA 3M8KA 3CCQV 4CNQA 1MD9A 4GSYA 1M1YA 1DC3A 1T9CA 3J7TA 5TS2A 4Q4HB 3PNKA 5J2TF 3VBBA 1F3LA 4LAFA 1G18A 1GCGA 1Q81W 4C5BA 4OY3A 1YT5A 3GT4A 5AM3A 2WRZA 1RYDA 2XTMA 4ZO6A 1CZHA 5F2OA 5FYDA 4UHJA 4IUBS 3VR5D 1P84H 2Z6UA 2OTLP 1CJBA 3A26A 2ILTA 3NT2A 4HT3B 5C7IO 4I6EA 2AFHB 1EN5A 4TN1A 2OK8A 2E74B 1Z5PA 4Z4GA 5IVHA 2FDXA 2DN9A 1Z08A 4YTEA 3CONA 2AX4A 1LNZA 2CNWD 3LDHA 5B1AB 1H66A 4Z0NA 2QJTA 2NVUB 1GVHA 4DREA 1ULAA 1ZCZA 4CMBA 4CLXA 1NHGA 1JJ2U 2WJIA 4D3DA 1G5FA 2H00A 2NPFA 1P2TA 2EP8A 2P7JA 2P9JA 3BCSA 4IRXA 2YICA 2GXQA 2ZTUA 2FSSA 1L0LJ 3CUTA 4RDIA 2ADMA 3JCZA 4LX8A 5EXSA 1RAAA 2GZ1A 2P9EA 2VHTA 1LGYA 4R5HA 4KVGA 5A0VA 3BL6A 3FTNA 3EJ6A 4N3BA 4DPMA 2UVQA 3IUSA 3ZZUA 5TGDA 1L8LA 4RZHA 1SMKA 1D2CA 4RV4A 5E4TA 1II0A 2J5KA 1HDZA 5LQMA 4DG8A 1RC0A 3JQDA 3WGGA 1MC8A 1G8KA 5LFAA 5EYPB 2JGDA 1XKXA 4YXFA 1N8KA 3HBNA 2NLOA 4L07A 4Q4CA 5YASA 3H3JA 2PGGA 2FOLA 4Q24A 4RTNA 2ZINA 4KR0A 3SYOA 1G7TA 1BYUA 1A72A 2YFHA 5K8CA 3CRAA 3VR5H 1EUCA 4FTWA 3EIWA 3N6VA 4IEFB 4OGFA 1WHTB 3DEYX 4Z0HO 4UB8E 1O94D 3IJ4A 3C74A 4WF9V 2A9KA 2PM8A 3GJQA 4BFCA 1FX1A 4OXKA 2WR8A 2VWGA 3DCIA 1YB7A 3UMMA 3I3OA 2EWMA 5ICCA 4HVTA 2ZANA 4OL0A 3QE3A 1M1NA 1D1SA 3GHHA 5DU2A 3N3BC 3T35A 2TS1A 1ORHA 2G67A 2ID8A 4DFDA 2OD2A 4IOIH 1EQAA 2HMWA 4HS9A 2XYHA 3KUUA 1TGYA 3FMIA 1PJCA 3EVAA 2H06A 3KQGA 1Q91A 3CO0S 2EWWA 3NTRA 4GL4A 4W7HA 4GECA 1OCEA 5B2FA 4JLAA 4Y0VA 2W83A 2R5NA 3MHPA 5CPFA 2C4HA 1L5YA 4BRWA 4NBKA 4PCVA 5CVCA 1IN4A 1QYDA 1O1YA 2FPGB 1TW2A 3HBFA 1W4LA 4R8LA 3OJWA 3K16A 3QPWA 1XNJA 2C92A 4FJ1A 3QEOA 4XDYA 4QUAA 1ACLA 4R9SA 3OPQA 1WMEA 3D4PA 1I2ZA 1EX6A 2DFNA 4EG6A 4G63A 2ON6A 3NWPA 1SVWA 5E6SB 4RK1A 2BKAA 4GR9A 1XAGA 1GN6A 4CMEA 4LF9O 5J40A 1VCNA 4QRIA 4Z7QB 3CX5D 1WY7A 2HFEC 1U0RA 4GCZA 3NATA 4OJYA 2VSNA 4GDFA 2XVAA 2ZR8A 1QFSA 4D9BA 3OESA 4WQMA 2PZEA 3P20A 3UAVA 4LXHA 4XQ0A 5BV1A 4MI6A 1ISSA 1AQTA 2Y9MB 1NY6A 3QFCA 4GPD1 1GZLA 3P0EA 1C50A 1U96A 2IFNA 3L7NA 2XGGA 2RE8A 4NKRA 2EU8A 4RNDB 2YFQA 1UH5A 3CEAA 2YH2A 2EAUA 5AJZA 1GUBA 4ML3A 3LIPA 3SC6A 1UM9B 4K03A 1YFJA 2A58A 2BE3A 4FYMA 5IH7A 4QNRA 5TEWA 1ZR4A 4NTZA 1SQXK 3KUXA 5HP4A 5H6QA 3QSGA 4J7AA 4Z2WA 2FWRA 1UXOA 2GZMA 1X7WA 4CKWB 1ONPA 3HB5X 1FA9A 4BBJA 3TNLA 1YJNV 4PSUA 3A9CA 4PGGA 1IY1A 1GZHB 4IDOA 1ZD3A 4QYTA 4L8JA 3TGUD 1LPOA 4OOEA 1M75A 1T8YA 3IRUA 3RJZA 2HPCA 3B60A 4A03A 1B6QA 1WB5A 5DX0A 3WHKA 5KHIA 1PS8A 1SBHA 3IFMA 3P3PA 2WIDA 3GB7C 1XFDA 2HQOA 1TM7E 2O05A 1OX4A 3RGUA 1NI4B 2QZJA 4ZMSA 4IVRA 4DV4O 1DEKA 4MR9A 2R25B 1W34A 3OC6A 3D0KA 4TS1A 3PNQA 1Q12A 2Q6VA 1MV8A 5HCIA 2A0XA 2BGMA 3OIFA 2HQSA 3CX5H 3WKDA 2G77B 4JBGA 3KZOA 3TRFA 1UPBA 4IO0A 4H4EA 2D62A 4NFLA 4AY3A 4QPCA 4IVPA 4BNUA 4CBCA 1W8DA 3ZY2A 5EE9A 3IKMB 1B16A 2IBZD 4BTLA 4H3KB 4RVHA 1OREA 1NW3A 2UUOA 3T1OA 1VL8A 3RIGA 5LVAA 1ZRTD 1YQQA 3A28A 4BQNA 4I4TB 5HSGA 1JQLB 4QYIB 3V7YA 4P22A 5ETJA 4MYUA 1Z2EA 1OBHA 3GVMA 1O03A 3IUBA 1GN8A 2FYUG 1FJXA 5K8JB 2JD0A 5ALOA 1ZW0A 1RBZA 5CH3A 5ENDA 2VPZA 3QJGA 4BIZA 2B9ZA 5K0TA 2A1TS 2VC2B 2HH9A 4BXOA 2CLEB 1VIDA 3MWLA 1L0ND 3M9LA 4P3NA 5CYGA 1QRSA 4ZT7A 1MJFA 1Z8FA 3CGGA 4DUGA 3TGUH 1NULA 2P9FA 1V8BA 2KLHA 2GVZC 1PFIA 2BJVA 3RFTA 1D2MA 2EIMC 4U9UA 2PKQP 1BE3E 2Z2YA 2ZUUA 2VHEA 2OP1A 2MT9A 4UXHA 1K8XB 2GH1A 3G85A 3T38A 3OFSA 1NSYA 3PEUA 3QSYA 2V7TA 2ZB8A 5JXGA 1YO6A 4KIGA 4TT3A 4FLTA 1KFKB 2CUNA 3IJEB 1MRNA 1Z8HA 3M83A 3HKCA 2J87A 5CLFA 4OJMX 2GF9A 3E61A 5EIAA 4MB2A 2E76B 4H0LC 5DRYA 2KI7B 4MV9A 3D8NA 4OYHA 4IO1A 1IONA 5A6SB 1AA0A 1D6SA 1Q1NA 4RKRA 1XEXA 1NBHA 4YJ3F 5FLYA 4Y2TA 1EGQA 4JLDA 3GXBA 2ZT9C 3G2NA 4BNYA 2VS0A 4BC0A 2Z8XA 4Z0TA 4EYSA 1JJOA 2HU8A 4PANA 5KOJA 2XAJA 2IBZH 4JVLA 2NUTA 2QJPB 2BGGA 4LTMA 1Y7HA 2PGXA 1IDN1 4DJTA 1UADA 1NIJA 4LHSA 1BCRB 2BGWA 3H1ID 4WVLA 1HEIA 3HA2A 3X1YA 2W8ZA 1C9MA 4AK9A 5A5VA 3AI2A 5L8VA 1PP9E 4UUPA 4PJ0E 4UVHA 1V7PC 3OQOA 1L0NH 4X7PA 1M1JA 3VR3D 2QRJA 2Z04A 3DV9A 3X1MA 5BU5A 4BLRA 1PR4A 2YIUC 3D64A 1ZVMA 5IT9A 4LFCB 2FK7A 3L72J 3SIWA 1QLNA 1T8ZA 3DMFA 2A0UA 4KLZA 1IK7A 1YJ9P 3H17A 3ZDQA 2E49A 3H2GA 3M6IA 3DAHA 2DKFA 2PKYX 2VRNA 3H3FA 5JSQA 3FDIA 3NHKA 3EZ7A 1OCCB 1DIAA 1I4OA 16PKA 2VTBB 3H75A 3NC4A 2IWHA 1HE5A 5C8XA 4NFYA 4Y99C 1R0XA 4F85A 1YR6A 3AFIA 3W7AA 4M8LA 4FMDB 4HGZA 3C7DB 1GN9A 1YCHA 2ZUSA 3N27A 2QP9X 4AMZA 2VNSA 1Z83A 1RJGA 1YS6A 5CBFA 1M6EX 1UFVA 1YMQA 5LP1A 4GKKO 4PICA 2GBLC 4NMXB 1HUQA 4AJ2A 3H1EA 1K97A 5H5NA 3BKXA 4A73A 2PUFA 2OYRA 1PUXA 3RSFA 5AK4A 3FPAA 3KXLA 4W8GA 2R5DA 3I04A 2EZ4A 5EJAA 4B6OA 3H1IH 4EUSA 1FLAA 5EQTA 5A7GA 1HJ0A 1C30B 1GUDA 2AN5A 4YVFA 4AO8A 3L36A 2QENA 2GLUA 3BMOA 3WY9A 2W70A 1GU7A 4DDWA 4A2CA 3NTOA 5FOVA 2QE6A 3JCUZ 1OU0A 3HJAA 3NETA 1QX8A 3ACBA 2J9FA 4N4AA 2REXB 2ZBDA 1X1EA 4MQ5A 4K0RA 4WY8A 1DWQA 2NAPA 2ONKA 1FPMA 3CL3D 3MRTA 1RJ9A 3JAMN 3EG9B 2JVKA 4MTLA 3OJ0A 4YRCA 4F9EA 2HIHA 1NRWA 4YJ2B 4KKVA 2DZDA 4DDVA 3DFZA 1Z2CA 1THZA 4ASUG 1Z56A 2XE8A 1M74A 2FSGA 3DMYA 4IZHA 4RD4A 4N49A 3L0PA 2J85A 3K32A 4WCFA 5CBKA 2R7AA 3JD3A 1AI5A 4NBVA 3MJVA 4A8JB 2OYHA 3QE4A 3P2KA 2P2CA 2NYVA 1E98A 5EC8A 2ZJ8A 1CYEA 2PN1A 5L7TA 4ER7A 4I55A 3HABA 3GNTA 3GLRA 4JLVA 4ZODA 1JAZA 2Y05A 4YP6A 2DB3A 4C7OB 2LV8A 2EXXA 2X8JB 4KKXB 3E1KA 1XHFA 2RGBA 2WPQA 5LBTA 4OUKX 3SVTA 3UQ8A 4YRMA 4O1IA 2F9FA 4N0PA 3LBIA 2O20A 1YEWA 4YPFA 5JNTA 3VU1A 3S81A 1GPKA 2M6YA 4BB9A 3U1AA 1JXOA 2RH8A 2FNAA 4CPDA 2CMDA 2ZYUX 1VQOP 4U7NA 1KILA 3TR6A 1CRPA 2O0MA 3P2JA 1OA0A 2DUWA 2EINC 1N7LA 3LZDA 2IV3A 3OPXA 3SDBA 3F4BA 1Y3BE 5H02A 3FGZA 1N3LA 1N2XA 4ZVRA 1JUDA 1H2GA 4X3PA 3LV8A 1U2GA 3REQA 4B4VA 4DLKA 1NY5A 2Q69A 1R0SA 5EXTA 2KLBA 4G5RA 1XCPA 1CUVA 3NOQA 3BK7A 4WLOA 1DMRA 3T1TA 4DLNA 1HDJA 2QF7A 3NHBA 2ZPTX 2IU4A 4N8SA 4QQFA 4WBNA 2QLJA 1RADA 1PT8A 3VSEA 1FYFA 2DTEA 3O92A 5G2OA 4BMCA 3N4XA 1KBQA 1KI2A 1QE5A 2J9ZB 4PYLA 1DMSA 1KERA 5KNDD 4G5YA 2H54A 2LDXA 3LF1A 2Q1UA 3TF5A 4YHHO 3GO4A 3L4EA 1SQQD 1XJQA 1QLEC 1J8DA 2BELA 2CWWA 2WSCJ 4D97A 4OI1A 3JAKA 4HQNA 2W6PA 4I1PA 4D9FA 2CNDA 4Y0NA 1C9YA 2JAWA 3SR3A 3ZY3A 3MM4A 3IJ5A 1YA4A 4NESA 2R2AA 4E13A 3ORRA 1E32A 3HN7A 4IOLA 4TZ0A 1QR6A 5CMZA 2FMLA 3IBTA 4CHGA 4YIKA 1ZH2A 4Q3NA 3ZI0A 2H0QA 3VU9B 4PAMA 4CTJA 4DHWA 4EHBA 5IASA 3CJQA 4BMVA 4J4HA 3SSOA 4FHZA 4GZRB 3ZR4B 3ZWKA 4IIDA 1KI6B 1DXHA 2Z4EA 2YN4A 3NTVA 1V43A 1NLUA 4Q6WA 3ONFA 4J80A 1KYYA 2VDOB 1FSSA 3WLEA 3NTXA 2ZCEA 1OWAA 2JAOA 1D2AA 3GLFA 4D7SA 3UMRA 5A2GA 3QA9A 2V03A 1OGJA 5ILQA 2FKNA 4D5EA 4G1MB 4F7WA 2BFPA 4PA3A 2E74C 3EVTA 2Z57A 3U4CA 1T5LA 1R3LC 1RRPA 4QVGA 2O1KA 1W0KA 4IQ8A 4EABA 3D43A 1D6JA 2C58A 3JU3A 1KWKA 4TMVA 2F3UA 2FPXA 1P6UA 3ZCCA 3ICVA 3OKFA 3CLHA 3C5CA 3NAMA 2QV0A 2SKEA 3AKYA 1SVFA 2P1RA 4I5FA 2IIPA 1LTSC 1XQYA 4TLCA 5KNBA 3ROZA 2EW1A 2CTRA 4A6PA 5JT1A 3FR7A 1H93A 4GC9A 4BEBA 3T3PB 2VPPA 5DNUA 3S2IA 2JGMA 4MHTA 2D7CA 1LLUA 2R7MA 3ZD8A 3MIZA 3ERCA 1XRJA 4Q18A 1HDEA 4XTCS 1DFHA 4LBVA 1OVUA 2NO1A 5KNDH 1WPGA 2SICE 2QQFA 1ZJ6A 1FYXA 1SQQH 1QK3A 1HBWA 3NGMA 4L9WA 1IN8A 4Q4JA 4YJFA 5DXAA 2KOGA 1E6UA 1R9NA 1UOPA 5G3ZA 3EG5A 2Z5VA 1NKZB 1T4MA 3H5RA 4GHWA 5F5NA 1OVVA 4NJOA 4ZTZB 3WA6A 3KQLA 3O91A 1DAHA 3OT1A 4WESB 2X2EA 2AW3A 4X7MA 5BWMA 1XNQB 5TISH 5LMZA 5CB4A 3NC0C 2QL9A 5FFNA 2ZIVB 2RCVA 2FPSA 2VP2A 3RTEA 4OCZA 4YX9A 3HM9A 2NU7B 2ZXUA 4E09A 5AVYA 2CGEA 1DIOB 1G6HA 2A78A 1DEAA 3E23A 3V80A 1CRQA 1AE1A 5HF9A 3BHPA 1NI8A 4QUEA 1FTWA 1CZRA 4BLOA 3VZDA 4CQMA 4OREX 5H70A 3TAXA 4TZTA 3P8ZA 2WHXA 1EVLA 5AOBA 4D8UA 5D86A 2A9HA 2PRZA 3JRXA 3V5NA 2CMFA 1KARA 4GKVA 2EG9A 3CCUV 3FSGD 1SBZA 4XB6B 4JROA 2K4MA 1QOZA 3ZHTA 3E22A 1KH3A 1XF9A 3BVHA 4HAVA 4U3FJ 3O95A 3C39A 3VOAA 1J9ZA 4P93A 4GKJO 3EMDA 5BOSB 3TJTA 3MUDA 5F2NA 3ELYA 2PSHA 3OX1A 1XZMA 4N03A 3HDTA 4EL0A 2OPBA 5F5LA 4N6GA 1K05A 2QSIA 1FJ2A 1KOGA 4MQFB 4US1R 4I5SA 2ZCUA 3IQXA 2EW2A 1RDFA 4X85A 3ZW7A 2ZBFA 4DTCA 4NU5A 4FHGA 2DKNA 1NTMK 2F67A 5HM6A 2VK4A 2PI4A 4PO8A 3H4VA 4ENPA 4EITA 3T54A 1I3OA 2JHPA 1SZTA 3OEHA 5A1JA 3AY7A 1XK7A 2OXTA 1DBRA 4EFMA 3C6MA 1LTHR 3GB9A 4MYTA 3OZEA 1NTMG 2DHRA 4RW0A 3AUYA 1J1IA 2GJ9A 3C8DA 1FKAO 2IS2A 4HXGA 3AG7A 4S1TA 1S0VA 1FJGO 3PYXA 4R4MA 5BW6B 2X40A 4ZJUA 5BUSA 3CRQA 3UXYA 3EYWA 2ZGVA 4ALKA 1M76A 3W06A 2ZSIA 2BMWA 3D1JA 1QHIA 1LQUA 4HJRA 2CMKA 3IDZA 4RD3A 3EARA 4K8OA 4MUNA 3EA0A 2JEXA 1VSUA 2XDAA 2UVPA 1BH2A 1V5EA 3GQBB 4MPPA 4X9XA 3DVAA 4JZKA 5J2TB 4YRKA 4NBLA 1XVUA 2WVHA 3DNMA 1TDJA 3GT0A 2OV4A 3U60B 1KZGB 4LE0A 3NO4A 5BYAA 1J23A 3C2QA 2HDWA 1P1HA 3CBQA 3SYAA 4U02A 3V4WA 1QHNA 1DBSA 1U8ZA 1L7OA 5H2FZ 2MU1A 5D51S 2FHSA 1QG2A 5IUNC 2XQVA 1XZPA 4PA9A 1L5GB 4JUAA 1S7GA 5C1BA 3LC0A 4QQKA 4DLWA 4NOJA 4F86A 5C31A 4MUIA 5DB4A 3PD7A 4CM4B 5AOVA 3O4VA 2BFFA 1SKVA 1E2HA 4AIRA 3QVXA 5FUXA 1KE1A 5L3DA 2QN3A 2B87A 2X7XA 1QS0A 2O8EB 3MS7A 4BZQA 2CZQA 4UMDA 2C96A 1LTTC 2P3LA 3KU1A 3T7AA 5M3BA 1JE1A 2QDXA 2PKWA 3D1LA 3H16A 1XC7A 2IOFA 3EWNA 4DCMA 3JQFA 1LTIC 1S2DA 3QBDA 4E4YA 1D3AA 4Y18A 1N75A 1C29B 2F55A 3WHIA 3G0DA 2CLOB 4O3FA 4LFAO 4AZVA 1RHKA 1EA5A 4I4LA 4D3YA 5BR8O 1Z4OA 2EIXA 1Z47A 2EBWA 3A4VA 3H2KA 3MF4A 2K88A 2Z2IA 3DE3X 4A0FA 3TETA 1AGNA 1FLNA 1JQ3A 1M73E 2WKQA 3KQYA 4MUFA 4DK0A 5KVCA 4OAPA 4KFTA 4LY0A 1K6XA 1RBQA 5DT9A 1H2EA 1ECPA 2FPMA 2ZTLA 4IOKA 3UY4A 1EE1A 1AKMA 1M6HA 3B8HA 1OGIA 5EESA 5C8YF 5LHGA 5JPCA 5KC8A 1P60A 3NHLA 4C22A 4UV8A 3H1IE 2QZSA 3ETQA 3CRCA 1JRLA 3JQAB 1JECA 1WUIS 1W44A 1T36A 1YC2A 2BVNA 1JEDA 1NRJB 3OJOA 4F46A 2GCOA 3HDJA 4OK3A 4PLPA 3A11A 4ISCA 1KY5A 1GL2B 2OSBA 1NN3A 3EF0A 3Q0TA 3GBPA 1EM1A 2WFMA 4MTXA 3KSUA 3O84A 2RAPA 3T7CA 4ZMDA 1E94E 1P7YA 1F8UA 4UUBA 2W2TA 2EX1A 3OD5A 3QQPA 1WUKS 4RIFA 2QVXX 5H82A 1ILWA 4RVUA 5KHJA 4ESEA 4E51A 5H5JA 3PNOA 5EMJA 3JASA 2IGBA 1GKKA 2HY7A 4RTLA 2ZJ6A 2UXBO 2WDPA 3CE2A 4QHTA 3V4RA 1LBSA 2I99A 1LBIA 3W6UA 4U63A 1IDOA 4GO1A 2I6FA 2G3YA 5HJEA 1PJRA 1ML4A 1C9DB 2R4TA 2DFKB 2QVGA 3B38A 2WTMA 4JEMA 4B46A 4JL6A 4CV3A 3G4SP 3GH1A 4FILA 3TLGA 4PQYA 4B3SB 4NP6A 1NTKJ 3FNFA 1T5SA 5AK6A 2ZCJA 5EKDA 4XIFA 2H1SA 3OQ1A 3VZSA 2E76C 4JDUA 1QM5A 1YIAA 3UUGA 1TIKA 4MVXA 1LTGC 3BXXA 3UKJA 3PSHA 3RL0D 3S7TA 1W4ZA 5KAFH 4G8DA 1WPRA 4ZP1A 3OLZA 5JD3A 5I9BA 3AF1A 4WFHA 4RPLA 2WTYA 1XL0A 4GP9A 1DIHA 2QJPC 1E61A 2ZRIA 4MVJP 2DLDA 1PJ4A 1GTZA 1JZQA 2OM2A 4OH7A 5EMNA 2IW1A 3T94A 3FCXA 2B92A 2GBCA 2GTSA 2PA0A 4FMCB 4GOEA 1NFQA 3UH1A 2H9AA 3FI9A 2VWJA 1Y8AA 3G2IA 3QYFA 4X95A 3FM9A 3BAFA 4AI6A 3K9NA 4BUZA 2NPSA 3V55A 4HZIA 4IOJA 2DLNA 4LJ6A 1RJEA 3KKMA 5JNUA 4I3HA 4BY9E 4LG1A 5I48A 5DBFA 3LQ4A 1Y63A 1MB2A 2JIMA 2V7XA 4BQRA 2YC4C 1RZ3A 4S3MA 4C4PA 5IC6A 2WT7B 3FHLA 3SDZA 3ZDXB 3ZU5A 5DX1A 4JI6O 1YQGA 4O59O 1S5LZ 1M83A 2ZRCA 1K4DC 4TLFA 2CNBA 3CCLV 2OFFA 1BWPA 2I1KA 4X8MA 5L4LA 3PRYA 4J0IA 5EIHA 5ES4B 1U5BB 1RW4A 4FDTA 3LQRA 3WDSA 1OCCC 1NVUQ 3SYLA 5GTHZ 5DNAA 2FSHA 2FZ4A 4I66A 1T0BA 3BSFA 2A5YB 1F51A 1JPXA 3I28A 4NZOA 4KUHA 4EMUA 1RRCA 3L6BA 3W4KA 4RKUJ 3GFSA 1J0XO 2FCAA 5EIFA 4FMDF 5EN4A 4B48A 3FKSA 3NUQA 5K8VA 2GARA 1MA3A 4EO4A 4LJLA 4MYDA 1O9GA 3RU3A 5DYWA 1QF9A 2BMVA 3UO2A 4P58A 2ZYWX 1I3NA 3LFHA 2J7PD 1EFLA 3VPGA 3I2HA 4RLQA 4YQYA 1DAEA 3G71P 4RABA 2BBTA 5IT0A 4IDEA 4EY8A 3DYBA 1DIGA 1J24A 1GRJA 3AE9C 3TAUA 2N9UA 1C7FA 1QCEA 2JARA 5JSYA 4G0VA 4X6LA 2QWXA 3FROA 4UMFA 4BE9A 3AV0B 3F96A 5TQ2B 4YUZA 3L7CA 3SGIA 1W88B 3W67A 3DEIA 4M3LA 5K5GB 4WSOA 2F4NA 5AKEA 3BMCA 3GK3A 4RQAA 1N6IA 5JCZA 2AZ4A 1ZUD1 4RO2A 1SHLA 1PKXA 5DASA 1YDWA 1KXZA 4PRYA 1Y6FA 5LBUA 4I6GA 1P1IA 4GPIB 4AUKA 1N73A 1N8SA 1SF9A 2GPNA 1GNLA 4IGFA 1VRCA 5DI3B 2NPIA 2WSEJ 3EQZA 4TT3G 5AXAA 1OILA 2NUAA 1L5ZA 1J8YF 4PV1B 2FR1A 4GBMA 1NJ8A 1QBGA 1QF7A 1RYEA 3QHAA 3VRHA 3AEEC 1AJYA 2YY6A 1U7ZA 1OY1A 4EMTA 1J0BA 5JCJA 5K8UA 1XNRB 3E5HA 3G6BA 1CY7A 4G0QA 1JALA 2IPOA 4BE7B 3TK1A 2IS1A 1VXOA 2XA2A 2JLYA 4BATA 2XD4A 1N2HA 4LF6B 2XOKD 5B7NA 5I7SA 4E88A 4YPVA 2WYOA 1EU1A 1KVQA 2L82A 4DQDA 5FBLB 3SNKA 2DWQA 1X1AA 2H8PC 1XD2A 4CCWA 1HKHA 4DR5O 1QUEA 4KB5A 3WIBA 3IBFA 2CXPA 2JCXA 2HTFA 2HEGA 4C4TA 2ZI9A 2W2NA 3H4IA 4K9RA 4KO2S 4ZCRA 4ZOLF 3PLNA 4FOOA 3BA1A 1CSEE 4HB0A 4M60A 3PEYA 3NH6A 5EP3A 4PONA 1M3SA 1R3DA 3AIOA 4YJ3B 1I0ZA 2B8EA 3DTTA 4QPJA 3FFBA 4L2IA 4D0GA 1C1XA 3H1JG 2EQ5A 1UKCA 4DBLC 3AJ8A 1FRFS 3RV4A 3ZWWA 1TUEA 1QGZA 1A4RA 3LYUA 2CLKB 2E5WA 4FT4A 1PW7A 2PXHA 1FUEA 3AH8A 5CDSA 2I6GA 3IA7A 1DFIA 1Z4IA 3QF4B 5JH7F 2Y0BA 1FMLA 2ZSFA 5PGMA 1KP9A 2W0FC 2B7LA 3KQVA 1W30A 1FX0A 1HFKA 2FKXA 4QU5A 1H2SB 2AOUB 2Q4OA 3D5TA 3VDNB 1EM8B 2JVIA 3GLSA 3GMDA 3TL3A 2O7RA 3PE4A 4HR7A 4U7GA 3GL9A 3HDYA 1DC6A 4UOQA 3AK3A 1DL5A 1K8RA 1N5JA 3FFWA 2WTAA 4UTPA 2P6NA 4BVLA 5AW0A 4GNRA 1Y74A 3I2JA 5K6AA 3AOEA 2CD7A 3HVRA 1GPDG 1U99A 4JI7O 3RIEA 3V4ZA 2H31A 1WDMA 2Z5GA 1BJKA 4HWKA 4U7HA 2KS1B 1CG6A 1Z4NA 3I56V 1E9EA 1Q7TA 2PSEA 4HQKA 3DBRA 4KREA 3G89A 1BE3D 3E53A 1E2NA 1TRHA 4LEIA 2WFLA 4NMWA 3QE9Y 5EQJB 2XE7A 4BP9A 2ZJ5A 3P9CA 1FCJA 2PGDA 5DNVA 4B6QA 4PC1A 2ISSD 4W4LA 4YJGA 4C7NA 2A6PA 3UXHA 1U3FA 4EB6A 1E3IA 5AVQA 1QQTA 1SM4A 2IFTA 4ZCQA 3F0TA 3BDAA 4OHXA 3QKSA 1P8JA 4E1BA 3AE6C 1JB0J 5EJ2A 3G17A 3KOOA 3QFFA 1JSCA 5SY4A 3N2GA 2ZFUA 3PUZA 1X9VA 4NBRA 1PT9A 4H7EA 3ZHXA 2ZREA 5IJXA 1PFVA 2QVCA 3CLVA 4O3MA 4BMNA 1MHTA