2QM7A

Meab, a bacterial homolog of mmaa, bound to gdp
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
323
structure length
314
Chain Sequence
b'LPDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPGAGDELQGIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and mutagenesis of the metallochaperone MeaB: insight into the causes of methylmalonic aciduria.
pubmed doi rcsb
molecule keywords GTPase/ATPase
source organism Methylobacterium extorquens
molecule tags Chaperone
total genus 121
structure length 314
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2qm7A03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2qm7A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qm7A02
1HBWA 1WXQA 1G4UR 2DHRA 1G8GA 4EJSB 1G6HA 2P6RA 1HE8B 1Q1EA 2F1JA 4L9SA 4FWTA 3OIYA 4IW3B 1LV7A 2A2ZA 3CF6R 4QJ3A 1Z6TA 3CBQA 2GEDA 1X1SA 2OCYC 4JLBA 3I62A 2ZS7A 1FQJA 3Q7QA 1MRSA 2VP0A 3ETLA 4HAUA 4HLQB 4A36A 2PT5A 3R9WA 5FBLB 1X8KA 4RD4A 4NYIQ 1E6CA 2CCJA 4GMDA 1IY2A 1Z28A 2L0XA 1JR6A 2FEMA 3CH4B 3FPAA 1VHTA 2R5DA 3VR4A 5CB6A 2OFXA 1E98A 4L9WA 3MWLA 4TTRA 1XNJA 2XJ9A 2VL7A 2QRNA 3UG7A 5ELXA 2WWXA 2FG5A 2YYZA 4B32A 4GDFA 4Z54A 2R6GA 2PZGA 4HI0E 3B2EA 3EAQA 2W6ID 4P31A 1T8UA 2WTUA 5B64A 2BVNA 4KLNA 2PT7A 2IUSA 2E87A 3QKUA 3AF4A 1Z2AA 3OAAD 1IXMA 2PJRA 4BRWA 3WMGA 2QPTA 4TL8A 3AP2A 5FBVB 3R7WB 2CHVA 4DT1A 4U7DA 1Z8FA 1N6IA 1U94A 2WIBA 5CYPA 3EZ7A 4PPFA 3FMPB 5K8UA 2CEAA 4UXHA 4ZKDA 2EFCB 1KI8A 1XJ0A 3M06A 2G3YA 1PVOA 4XE5B 3D31A 1NVVQ 4ASUA 5TARA 3QPUA 1DAGA 3C5CA 2WSSD 4BEJA 1SHKA 5JSZB 4QG7A 1CR1A 3I3SR 1NI3A 4Q4JB 1TQ2A 1YRBA 3LA6A 5JI2E 3T97A 2PCLA 5GVRA 1OT3A 3LW7A 2JJ2D 3LWNA 4NBSA 4QBFA 3T5GA 3GJ0A 221PA 3NVAA 1G5PA 1KI3A 2IS1A 1W49A 4GRAA 1EWRA 4NCIA 5G3ZA 1IHUA 3NBYC 1T2KD 3BGWA 5FL7A 5GADl 2WT7A 1HYQA 4XTCS 4DDUA 3FVQA 2DFNA 3H86A 3B5JA 4MUBA 3ZD6A 4P33A 1KK1A 4HB4A 3RYTC 2AX4A 1M7GA 1RYFA 1PUJA 2CL6X 2WJIA 1OF1A 1DG1G 1UBGA 2V6IA 3NEYA 4XSGA 4AWXA 3ADCA 1JXOA 1UADA 4GFDA 3KXKA 2PBRA 1XCMA 2Z5HA 3UXMA 1KZGB 1VG8A 2GCPA 3AVXA 4DRZA 2DY1A 1CI6A 2WKRA 3E1SA 4D4JA 1KYIA 3IQXA 4BZPA 2ZJOA 2J7PA 4P32A 4BLSA 1S8FA 1KDTA 1Z6GA 2F9LA 4P4TA 2G9NA 3TNFA 5F2EA 1XPRA 3X1YA 2IS6A 3WMFA 4ILEA 3U3JA 2Z83A 4ZV4A 4LJ8A 1F2TB 1XDBA 4IOKA 4RD6A 2OBNA 1L8QA 1ZM7A 3K09C 1CS4C 5KPDA 3GLFB 4LWZA 4G5GA 2QP9X 2VP5A 4IOMA 4BLTA 4TZ0A 3O8RA 4M21A 1DBSA 1F3OA 2ZRNA 2J1LA 1GL9B 1IN4A 2R62A 2R8RA 4FMBB 2HT6A 4AURA 4WA7A 2WHXA 4LDJA 2QSZA 5HCNA 4P0TA 3WXMA 1E2LA 1KK3A 2ONKA 3BFXA 4NCJA 4ZKIA 1HT2E 2GAOA 5B57C 2EWVA 4YC7A 2PL3A 2GVDC 1R8SA 4LJ6A 3ND9A 4CW7A 5HZHA 2E42A 3K0EA 4I99A 3NC1C 5JLJA 2IXFA 2OLJA 2DWOA 4EUNA 2JDID 4FMCF 4D26A 1C9KA 1GU4A 3D3QA 3U4QA 1YZUA 4Q66C 2VIIA 2FOLA 1GILA 2D7CA 1FTSA 1BH2A 3QPVA 1R5BA 4FMDF 2WWYA 1R6BX 1FW6A 1NN3A 3LVQE 3BH7A 2ZS8A 2N46A 1GNRA 1R2QA 3L8ZA 1SVMA 2C99A 1DAIA 4FW9A 5C18A 2B7BA 2NPFA 1WP9A 4JLNA 1KI9A 2BWJA 3DGEA 4M3LA 4JSYA 3EC1A 2PZEA 3N2IA 4BFYA 1G17A 2C5LA 5AVVB 4BE7B 5FH9A 1G1MA 3OEHA 1W7AA 4PHTA 3A37A 4KVGA 4O0MA 4ON9A 1GFIA 4B44A 4MYCA 4MKGA 3CW2A 4B3CA 4CEJA 2ZRGA 2OO7A 3AEZA 2IX3A 1RZ3A 2GF9A 1GITA 3GFTA 4Q01A 1IOZA 1SGWA 1OPXA 5C46F 1NN0A 1N6HA 3O8BA 1B0UA 5TB5A 3T12A 1NLFA 3AV0B 1KIMA 1NLZA 3F8TA 3K70B 1KSHA 2BBTA 1JNMA 1TU3A 2OSBA 1TF2A 4QBIA 1W0KD 4NCNA 4JYBA 2GJAA 4PZZA 2YO2A 2W0MA 2XV5A 1TUEA 1ZU5A 5JJKA 4NE2A 3HR7A 3LNCA 3HE5B 2IA5A 1OE0A 5D3QA 2FN4A 1G41A 2JATA 2WOJA 3K09A 5TY0A 5C4GB 4DKXA 1VPLA 5CDFE 2WPRA 3K0CC 2C9OA 4R7ZA 3U60B 1VCNA 1JPJA 1N5JA 5A0FA 2YZ2A 5AW7B 5L3VA 4PQYA 1PLKA 4Q19A 2DBYA 4MGIR 4OKSA 1GD2E 2C96A 4GOKA 4OL0A 4RCYA 3TW4A 4NKRA 4JLKA 4QJ4A 5H70A 4GP7A 1A02F 1JBKA 4LJAA 4MYUA 4FINA 4HDQB 4LGMA 3AVPA 2DPXA 3GLGE 4GL2A 2JLXA 1KJWA 2AR7A 2NIPA 5G40A 3RAPR 4TYNA 2OG2A 3TAHA 4DEXA 2DFKB 4IXNA 4XWOA 721PA 2V9PA 3QBTA 4OQLA 4Q1DA 4D82A 3A1WA 2OZEA 2VH5R 3QBVA 4TQAA 3FTQA 2XZLA 2QEQA 4EQ6A 1M7BA 3GLHE 4BGDA 1Z6AA 2QMHA 1FMLA 1Q12A 1N25A 1XD9A 4JLPA 1VYUA 3V4RA 1X3SA 3I4LA 1XMSA 2EFEB 3LBNA 2VQSA 3FMIA 2PEZA 4MQBA 4PHGA 3RWMB 3SFZA 3P4XA 4JT4A 3TW8B 3U5ZB 1J8MF 5DN6D 4M9XA 3AQ4A 1CP2A 4URUR 1JPNA 3ZRWA 2A5DA 1CRQA 4ACAA 5BW8A 3BRWD 3CRMA 3K0FA 2WPDD 1A2KC 2FV8A 1IO4A 2F9MA 4HLCA 5EE3A 2FNAA 4G3XA 1KGDA 2FGKA 3HTKA 2XU6A 2ZRPA 3B8HA 4X8HA 3RRZA 4O2RA 3T1QA 3B60A 1WB9A 3A58B 2X8AA 3P26A 5AUOB 2ONJA 2FH5B 2JGNA 1DS6A 1FPMA 2P6NA 2RGGA 1MH1A 2QPOA 4ARZB 5L8VA 4TL7A 1KSGA 4X8LA 1R4AA 3OE7A 3QKRA 4B6FA 2XB4A 2BDTA 2NG1A 2IEZA 4DSTA 1MFZA 1XP8A 4R98A 3Q72A 4AG6A 1KO1A 4JVNA 1MABA 1CJMA 1W4RA 1D8TA 3K0CA 2ZUCA 2D3WA 2ZRCA 4NYMR 3BC1A 3MSXA 2AXPA 4A8JC 4JYCA 5APXA 3UMFA 3DKVA 3NH9A 2MSDB 2WSMA 4C7OA 2YOHA 3L0SA 3ZVRA 1OXZA 5A4JA 2V1XA 1H65A 4AYWA 1YR6A 1IXZA 1S96A 5BYKA 4K8OA 3QXJA 2VHJA 1GP2A 1UBCA 4PXAA 3TLXA 4B3DA 1CR2A 1HY3A 1S1CA 2HLDD 2Z0MA 5JEDA 1H88A 4A9AA 4F91B 1FOSE 1C4OA 4Q9JA 3A4LA 4QHTA 1GOTA 2FPMA 4URWR 3AUYA 3F3YA 4R2HA 3R9XA 2YOGA 1G3IA 2CK3A 3NEJA 3QKSB 4URVR 2LFRA 4GI7A 4MRNA 4Z8XA 1LF5A 1GTVA 3ZS9A 1KAOA 2QTVB 2XAUA 1UBFA 4LYHA 3U61B 4RZUA 5JBQA 2ODWA 2CJWB 1DVRA 4MT8A 2VSFA 4A92A 1N6PA 4PAQA 2IF2A 2J0UB 1YZQA 1A7JA 2ORIA 1CSBA 3BS4A 4JLAA 3GMTA 5JFGA 3VMZA 1U8ZA 1W4BA 2JLRA 3WNDA 4IDOA 2OEPA 5G53C 3U44A 3SC3A 2XNDA 3OFND 2G77B 4GOXA 4JL6A 1A5TA 1KNQA 2CLSA 2BKUA 4I4LA 1I4TD 2OXCA 3ZS8A 3N5CA 2WJJA 2H8KA 1P3JA 3SJCA 3GPLA 4C2UA 1R7RA 2IUUA 1OKKA 2W6JA 3CKLA 4UKDA 4A2WA 4CRWB 1GRQA 1E0AA 2IF0A 4BFWA 3AF3A 1GIAA 5EE9A 1CXZA 1P61B 4XD7D 5IDJA 3IGFA 5JRJA 2HDNB 3KQHA 1S3GA 1VCMA 1KOFA 4M4SA 2A30A 3UKDA 2D4HA 2YO3A 5D3MB 4A8JA 1E1QD 1N6RA 4EDHA 3T1VA 2ZREA 3X1WA 4CVNA 5AUPB 4KFRA 2QE7D 4V02A 4X8MA 5ANRB 3EZ9A 4ZKEA 2F1RA 4HSEA 5DI3A 2MMGA 4LY6A 3CR8A 5JCPA 3EA0A 5KO2A 1FP6A 4TQUS 2D2EA 1N5KA 4TSFA 2HYIC 3A0RA 121PA 2WKQA 3G82C 2FFAA 1I4DD 1DG3A 1MV8A 1RVDA 1T6NA 2IS4A 3R8FA 4Q7MB 1KY3A 1JR3A 3WNCA 2R6DA 3TJZA 3PCRB 3HE4A 3A4MA 1BKDR 1O87A 4OHYA 4US2R 1ZIPA 3IILA 1G8YA 4H9GA 1VIYA 1AGPA 2C78A 3KJIA 2GZAA 1Q1BA 5CJ2A 1XMIA 5J4KA 2ZXEB 1D2EA 1QVRA 1ZYUA 2QG6A 3CZQA 3DOEA 2LFSA 4X8OA 5CYOA 3T34A 1RKBA 5C93A 1XD2B 1ZU4A 4E07A 4GT1A 1LB1B 1E9DA 1E32A 2G6BA 1BYIA 2YVUA 1AZTA 3UWKA 3BBPA 1JXMA 5FR1A 1RJ9A 3NDPA 3LQRA 2YJTD 2HJGA 3EW9A 4TQ9A 3Q7PA 4IVQA 1TQDA 3T06B 2ZE8A 3ND8A 4TYYA 4NYJQ 2UZIR 4Z1MA 4EPVA 1OFHA 1S1MA 1UFQA 4KAXA 1L4YA 2AK2A 4KLZA 1XXHB 1G7RA 3C5HA 4GPTA 3RWOA 3B13B 1EFTA 4PHHA 1S0UA 2RKOA 4R9UC 2JLZA 2DWQA 3IUYA 3K0AB 3KDSE 5AVRB 4O2LA 1BO6A 2JLUA 4WIAA 1FZQA 4M53A 4BUJA 4ASUD 2IYUA 3ZQ6A 1T5IA 4BZQA 3PR1A 3IQWA 4C3ZA 5AW3B 1VMAA 2QP3A 4LK2A 1I2MA 1U0JA 4OQXA 2UVQA 3RLFA 1GKYA 1MV5A 4I1UA 4XVUA 1KY2A 3F0TA 1JB1A 5AJVB 3U2QA 4A2QA 3B9PA 2WPSA 3TUZC 1KMHA 3K53A 2IHYA 2OXRA 3FHTA 2O8CA 2J9RA 4JVMA 1PUIA 3VR6A 4AYXA 5EXXA 1P9RA 3V00A 5FL7D 1KI4A 2GTPA 3LX5A 4S35A 4G1UC 2ZSFA 4ZPXA 4QGGA 2R6AA 5CLLA 4KO8A 2OAQ1 1HUQA 1HT1E 3IBGA 2O8DA 1YZGA 4A82A 1RPZA 1ZC4A 4G0NA 2QNRA 4B2LA 2WWHA 4Q48A 3S1AA 3EX7C 4CEIB 1VDZA 4MGYR 1JEDA 3C8UA 1OJLA 1FQKA 3CF2A 3EPHA 5GJVC 1J2JA 4QRHA 2I4IA 2J7PD 3KFVA 1QBKC 3O8ZA 2IXEA 3KKQA 5G3YA 3A6PC 4W5WA 1Z3IX 4HATA 4AD8A 5FL3A 4F7WA 1NN5A 4MYTA 2J59A 4Q18A 3VFDA 4M9SA 4MKFA 4BLRA 3P32A 5IK2D 2CVFA 2PCJA 2QROA 4D4LA 3NC0C 2GJ8A 2ZI3A 5APSA 1COWA 1NKSA 4B35A 1ZM3A 1LVGA 1J99A 4GZLA 1ZMXA 2F55A 3ICEA 2EVWX 1KDRA 3H0KA 4C0BA 1P9NA 3LIDA 1XBTA 2QGZA 4KYUA 5AUNB 3CR7A 2D2FA 2FF7A 1E94E 4AKHA 1HV8A 3RSOA 1F48A 1YHNA 4FCWA 1VG0B 1ODFA 1WE2A 2BMDA 5F98A 1P5ZB 2IYVA 3BERA 4HUQB 3DVLA 4LJ9A 4MA4A 4LHYA 5FOXA 5SZJA 3T5DA 3I73A 1E2PA 1XJCA 1ZW6A 5KSPA 1T8TA 2BKEA 4JLVA 2RHMA 1X8YA 1YR9A 2GZHA 2YWGA 2ZSAA 1KNXA 1RFLA 1OWAA 4N1AA 4PQRA 1AQYA 3LD9A 3U7GA 1Z6YA 3A5TA 1T4GA 2ZRDA 2V55B 2AKAB 3GEIA 1ZCAA 1VCOA 3U3KA 4AUWA 2WIAA 4I1OA 2OBLA 3LO5A 1UAAA 3DMNA 4LC0A 4Q9HA 2WWWA 1W4CA 1CKEA 3BD9A 3OEHD 3ZLJA 2YWEA 1WA5A 3BORA 4WOPA 4PZLA 1N6KA 1NAFA 3V4FA 4F4CA 4A1FA 1S9HA 1VKJA 3D36A 2W83A 4NH0A 3VN0A 2C03A 3OZXA 1YRAA 1BIFA 1G6OA 3KB2A 4JL5A 3BK7A 2IUTA 1Q20A 3OESA 3AVYA 2C9YA 1K5GA 2VBCA 3ECCA 3EA5A 1II8B 4RESB 4LOAA 1EXMA 3SYNA 1Z63A 1W36C 5KU1A 3ADDA 1Q21A 1YR7A 5FFMA 4N0EA 3ZVNA 2FEOA 1S4QA 4AK9A 4DHEA 4C7NB 2ODEA 4Q00A 2XJ4A 3GJ3A 3SJBA 3QF4B 2QENA 5E7JA 3DMDA 5APVA 2FZLA 2YNYA 4G5OA 2VSOA 4I1VA 3OIUA 1EWQA 1HWTC 5TVKA 3GLGB 3SHWA 4AIIA 4AY2A 5L3SB 1XCPA 2ATXA 4C0AC 1FAVA 2GXSA 5KSYA 2C2HA 2JA1A 2BJWA 3QKTA 3EARA 5E7MA 4PO9A 1L4UA 3VX3A 2YC4C 4NU0A 5HE8A 3GLHB 4B48A 1IN5A 4GCZA 4EPXA 4AKGA 1E79A 3M91A 3UG6A 4DVGA 1TL7C 3A3YB 4IDPA 4TYQA 4JAVA 2UZ3A 2ZR0A 3WRYC 4DDTA 1TF7A 3FMFA 5BN3A 3TR5A 2JLYA 3BFVA 5AK0A 1E2FA 4JL8A 4BRUA 3KXLA 5EE5B 1JR3E 3GP8A 3VKGA 3I5CA 4KFSA 2RB4A 4Q1BA 2VLIA 4Q4AA 4XIGS 5CK5A 5IF9A 1M8PA 2QT0A 4UNNA 3QJYA 4TMTA 3EASA 3GLIA 3KKNA 2ZQ5A 3T61A 5BN4A 1AK2A 2I1VB 2ZI7A 5AVYB 3B9QA 3PG5A 3ZDQA 2X1VA 4K81B 3OAKA 4RVCA 3VTKA 3WP1B 4OYHA 3KJGA 1X6VA 2PLFA 4JZKA 3G0HA 1GDDA 3HU2A 1QZXA 1CZQA 3NHAA 1HE1C 2W58A 3OE7D 4LCBA 5AJXA 1AQUA 3SFVA 4DT1B 1GUAA 2ZUDA 2IYQA 3TVDA 3PITA 3QNUA 3LY5A 2Q21A 1XPUA 4U00A 5FOWA 4BQSA 3MWJA 4B34A 1ZUNB 3LBIA 2Q0HA 3RDPA 3I61A 2MSCB 5FOSA 2QAGC 5CLQA 2NGRA 2O8FA 1Q44A 2E1RA 1D2NA 3IIKA 4HAYA 1XPOA 2BIFA 4LBVA 2WTYA 5EP4A 2NZJA 4ESHA 1NSFA 2RGCA 1OB2A 3DHWC 3CNLA 3EWAA 3SN6A 4POAA 1P2SA 3UATA 3VR3A 2ZE5A 4JJKA 1W46A 2EQBA 2ECKA 1JALA 1XTRA 1G7CA 4IDQA 5B2ZA 4D0LB 1R5OA 1W47A 3ZJYA 2QN6A 1NMYA 4QPKA 2AK3A 5FOVA 3IIMA 4ESVA 3SNHA 3IIJA 4Q4LA 1AS0A 4QJ5A 4HB2A 2ODBA 3TGPA 2B8WA 1FP7A 3JZMA 3SI7A 3BB4A 2WT7B 1WF3A 1UKEA 4R71A 2IK8A 4PFSA 1ELOA 2OESA 4FCTA 2O0KA 2FGJA 4A6PA 4BFSA 1DO0A 1OB5A 1H8AA 2XZOA 3AP3A 3Q85A 2GNOA 2CK3D 2X77A 2WWIA 3M9HA 1EESA 2IPPA 521PA 1Q1ZA 5JEEA 3HP1A 3FYHA 3EZ6A 3NHBA 4DSNA 5H8WA 2CNWA 4JVLA 4A0GA 4ERNA 4E5UA 2KWIA 4JKIA 1N0UA 2FSGA 2NO1A 3PQCA 4A0HA 3ICQB 1KZ7B 3CZPA 5AJYA 1Z29A 4ZDJA 1E0KA 2GJKA 3QPWA 3O8DA 3FMOB 5FPHA 5IDVA 3NIBA 5FOTA 2HJVA 3RABA 4TYWA 1E99A 4L15A 2ZROA 4IHQA 3LW8A 4ZCMA 2GHIA 1QG2A 2WOOA 4HYYA 3I5XA 3WBJA 3GEEA 2XNDD 4DLSA 1AGRA 2XGJA 2BHRA 3RNLA 3RC3A 5LB2A 3OHMA 2ZYTX 3KX2A 4ZCLA 2QMOA 2XTNA 3TUJC 2FFBA 4IEEA 4TLEA 3AVWA 2JASA 4CF7A 3R8CA 3LX8A 1OKKD 2W6JD 4QGAA 1WBBA 4RZXA 1ZBDA 4GSYA 1Z06A 1NMZA 5JWHA 3Q8XB 2IW3A 5HZKA 3LLMA 4HLDA 1KI2A 5AW0B 2N9BA 3EPLA 5KNCA 2P2UA 4M1MA 2LKDA 2QAGA 3KKMA 1ZNWA 3BH0A 2R32A 2FX3A 2KSQA 4LJ7A 5BN5A 2ZVPX 4IKEA 2ERXA 2Q6TA 2ZRMA 2ZJ8A 5EJEA 5FTLA 1OLOA 4LHZA 3U4QB 3EWSA 3TSZA 5JHGB 2YNMA 2YV5A 2N1BA 1DAKA 1WQ1R 4AQRD 3THXA 4PTLA 4TSFD 3TH5A 5APYA 1YU9A 1JQLB 5JS8A 5E95A 1FFHA 3BOSA 3U7FB 5BQ5A 4RZ2A 1YYCA 2GBLC 4NTZA 1DPFA 1TPZA 1W4AA 2XX3A 3QF7A 1E9RA 1XB2A 1JR3D 1CJUC 2KI5A 4LBYA 3BAFA 4IRUB 1XMVA 1E4VA 2A5YB 4DC9A 4EPTA 1GNQA 4KYIB 1FX0A 2P0EA 4DCVA 1SKYE 2BMJA 3C15C 4DWJA 3MWKA 3CH5A 2CE7A 5FUWA 3VU9A 5APTA 1YJ5A 3P27A 1NG9A 4CEJB 3FKSA 3VR1A 3M0AA 4YMUA 1Y63A 2C77A 3TKLA 4J0QA 4D0GA 4JKYA 1XZQA 4B75A 3RRNA 4DLYA 3QVVA 1NRJB 4DDVA 1KI6A 2JEOA 3IHWA 1Q1QA 1KQLA 1LFDB 6Q21A 2CL0X 4JLDA 2FU5C 3K0SA 3C4JA 4MH0R 4OI2A 3X1ZA 1RE0A 4H1UA 4TN1A 4MRSA 3P4YA 2C04A 3H2YA 1G19A 1FOEB 1M6NA 3L0PA 3LXXA 2PX0A 4IOJA 4Z1MD 1E2JA 1E9FA 4JAUA 4TMKA 3B8EB 3ZYCA 2WV9A 4XVRA 3ZZ0A 4Q4HA 1D6JA 1KO4A 2FMXA 1ZUHA 1IN6A 2V54A 2WM9B 1HQCA 4OI0A 2R44A 5C1BA 4V0MA 3AH8A 4U5XA 4HLUC 1ZNZA 1F2UB 4WZ6A 1DTSA 2IYTA 2RGNA 2O8BA 1RIFA 3ADKA 1OFTA 2ZRHA 3KB1A 2XXAA 1E2NA 1TUIA 2ZVQX 4II7A 5TDHA 4DCSA 3GFOA 4M22A 4URZR 4DLVA 1P75A 1Z07A 4GKGA 4EQ6B 1QHHA 1NY6A 2OAP1 1XFAA 3LLUA 3BIFA 1YZNA 2D62A 1US8A 1EFHA 4LJ4A 2YKGA 3WYAA 4BIZA 2GBLA 4KODA 3BB3A 2A3RA 3FWYA 3L0OA 4PSAA 3QXHA 1ZVQA 3CRQA 1NBMA 1OSNA 2OILA 3CONA 1CF4A 1G3MA 5FUXA 2FPKA 4PSKA 2JLVA 4RFSA 3HJNA 3I32A 3KFXA 1XZPA 4IDNA 4NL4H 3CLVA 5FTJA 3ZRWB 4L5BA 5LD2C 4NYIR 4LUCA 3LFUA 4F4IA 3AVTA 2WVJA 3K0FB 2H7VA 4TMXA 3RS3A 1ZM4A 2XB2A 4AC9A 3L37A 5BWMA 2BJVA 2GDJA 2C9NY 5KDDA 1WBDA 2YWHA 2ZSBA 4L8GA 4DEYA 2CLDX 3GLIE 1Z0DA 1DADA 1OYWA 2ODNA 4UJ3A 3LDAA 1S3SA 4JIMA 3MUFA 4YDSA 5JRZA 3THYA 4QL3A 3QKRB 2ZETA 3LH5A 3EZFA 1ZUIA 1SVSA 3PEUA 1I4LD 5DISB 3R9IA 4IVRA 1WCV1 4B47A 2PLRA 1MABB 1COWD 1VIAA 4GOJA 1PZNA 3T35A 4KHZA 1U81A 1R0ZA 3B85A 3NXSA 3EZ2A 1NVVR 3HU1A 4M1OA 4M1KA 2J46A 2HXSA 4C7OB 2AHOA 2RGAA 5J4VA 5JWOA 2JJLA 1G64A 2FA9A 3MJRA 2IHBA 4HLUA 3AVVA 1CJKC 1NP6A 2CDNA 4Q7KA 1OYYA 4HAWA 4MITA 1Z0JA 4LV6A 2AFHE 4B43A 3X1DA 1P6XA 2ANCA 3M6AA 3PEVA 3AB3A 1AS3A 4F4JA 3TIFA 5JJLA 4P3YA 2J3EA 3IHLA 1XEWX 4V0NA 3SZRA 3CPHA 4PO8A 4OQFA 2W0SA 3QI2A 1E4YA 4B2PA 2R5BA 4C30A 2P5TB 4Q03A 2ZSDA 3W6NA 3FOZA 3OIVA 4MDEA 1W5SA 2FPLA 2HYDA 2N42A 3H1TA 4AI6A 3JVVA 4FMTA 4ABYA 4BFXA 4LV8B 3I8SA 1H8EA 5HE9A 3FKQA 1N5IA 2ZI5A 2R3CA 1HH4A 4NHOA 1CBUA 3Q5EA 1Z47A 2ORWA 4DLUA 2ZIAA 2R2AA 5B1NA 1F5NA 2EFGA 2OFWA 2J0QA 3QUSA 2F1HA 4MRRA 1AA9A 1NKTA 2OLKA 3C7KA 3PUZA 2F1IA 1EK0A 5AVUB 4P4UA 2GETA 1G4AE 2OHFA 1EX6A 3U44B 5SZHB 1OHHA 3GJ7A 1OIXA 1SVOA 5DI9A 2EFDB 3ZIAA 2O0HA 4PC2A 3HPQA 3SHFA 5JJIA 3TMKA 3DKPA 3ZRXA 3PUVA 2GK6A 1P9WA 1IONA 1F51A 2HCBA 3SDZA 3DO6A 4LI0A 1JAIA 2MMCA 3QG1A 1AS2A 2YC2C 2J0VA 1U0HC 2YOFA 4EAQA 4QHSA 2QL6A 1RRPA 1K6MA 4A8JB 5CMZA 2HUPA 2RGDA 2VYFA 3PV0A 4PR0A 5JMTA 1Z83A 2BASA 3WHLA 1OH6A 2BM1A 3QG5A 3MMPA 5AJZA 2W2TA 3BH6A 5KSZA 5DI3B 2H7HA 3B1VA 1R5NA 1XRJA 1G291 1G20E 1NIPA 1U90A 4L4UA 4QGFA 1DH3A 1E2GA 1G16A 1P4SA 3HWSA 5EZ5A 5G41A 1ESMA 3SE0A 3K9HA 3A1UA 3UIEA 4ACBA 5EQTA 1MO4A 4JBYA 3CRRA 4DDWA 2GCOA 2J0UA 4ZIRA 5JZVA 3HE4B 1MUUA 2GEVA 1ZD1A 1G8PA 1QHXA 2ZJ5A 3NBXX 3LXRA 2CCGA 1CULC 1Z6XA 1UKZA 2BBSA 2Z4SA 3B82A 4AKEA 4CT4B 2AN9A 3CX8A 2KB0A 3OEEA 1P7CA 1S2MA 2H1LA 3PIRA 3SYKA 3I5YA 3GJ6A 2CXXA 1M34E 1NMXA 5FTKA 2GXAA 1SQ5A 4QFMA 3L82B 4IXMA 1G8FA 2P67A 3KZ1E 4OHVA 1P60A 2HEIA 3MAAC 3QXSA 4M1SA 2QSYA 4CGZA 4C0HA 4MKIA 2H57A 2XSZA 2ZITA 3B1ZA 1H8HA 3RS5A 4BLPA 4LYAA 1IY0A 1RJ9B 2NO6A 4B3BA 4DSOA 3MG9A 3T15A 2ORVA 3A2AA 1ZC3A 4O25A 1U99A 3PUWA 2E43A 4PSVA 1OXTA 2ZYVX 1G5RA 1LTQA 2E9SA 2ZFCA 1NN1A 2CL7X 2QRZA 2BC9A 4RD2A 1W36D 4QBHA 1DAFA 1N6OA 1F6BA 1GU5A 2ZI9A 3EPJA 2GAAA 4XH9B 5TXGA 4TTQA 1KK0A 3W5JA 1W0JA 4UXJA 4KXFB 3ZRVA 4BASA 4LSGA 4RCZA 3W34A 1E2QA 1TF5A 4V0ME 3P20A 3THOA 2JJ8A 4IDHA 4F93B 3GJXC 5CK4A 1KAGA 1KJZA 3SWFA 4Q1CA 3PUYA 1RRCA 1EFCA 4DLRA 3M9BA 2ZYUX 1GK6A 4RJLA 3IKJA 1KMHB 5EE1A 2O8CB 4TWZA 3EXAA 4KI0A 5M04A 1G8HA 4KFUA 4QNRA 2YINC 2W6AA 4EIWA 1KMQA 5FOUA 3Q5DA 2GZDA 1G2CB 5KYKA 4B86A 5DGXA 3VHXA 1UEJA 2A5GA 1OIWA 3SQXA 5AVWB 1XEFA 3WNBA 1PV4A 3MD0A 2OBMA 2V8OA 2VRWA 3MJHA 4KBFA 2DCUA 4OI4A 3ZH9B 5HR5A 2O8DB 4HAVA 3WRXC 1L2TA 1NBME 1Z5ZA 2QTHA 1U2RA 4NZYA 5AW1B 3S1AB 2WJYA 2CNWD 1XXHA 5AW6B 1UKVY 2Q7CA 1A2BA 4QXAA 1J2JB 4EKDA 2A5FA 4LRWA 1CLUA 2F43A 2J5XA 3KTAA 3RHFA 3W9YA 2C98A 5A5GA 3M0DA 3AKDA 4DLWA 3IPXA 2LWIA 2PX3A 3BFKA 1W2GA 2FTKA 4TT3A 4XJXA 5E7IA 2QU8A 4URYR 1I2DA 1E2IA 4HEJA 4OHXA 2OT3B 3BXZA 2VP4A 4OQNA 4HDOB 1UM8A 2D74A 2QA5A 1GM5A 4EPYA 1T0JB 3VQTA 3W8RA 4Q5IA 4AYCA 2QM8A 3L35A 2O8EA 4QBGB 1YZLA 4MKHA 4M0LA 4AG5A 5AVSB 4WXRA 2ZE7A 1IBRA 4NDZA 4UNSA 1ZP6A 4Y0AA 4DIDA 5GJBA 1KI7A 2ZRAA 5EXSA 5H1YA 2ZI4A 2J0SA 1CIPA 4MTXA 2J7KA 4C2TA 3RS4A 5J4LA 2FFHA 4A4DA 3I92A 3RRMA 5CB8A 3MGNA 4LBWA 1T0HB 3SU8A 1GTWA 3NKVA 1SKYB 1M74A 2YWFA 1IN7A 1LS6A 2QP4A 1SKQA 1WMSA 3L36A 1HUCA 2RGXA 4JLMA 2MSEB 1G21E 4EPRA 1SXJC 1D9XA 4FMCB 4U02A 4B74A 3KKPA 4CDGA 1CR0A 5HKKA 4FI3C 4XWKA 3TUIC 1GKIA 5TMPA 2CE2X 3A1VA 1J8YF 4B3GA 2Y8EA 2BCGY 2XTZA 4RZ3A 4FMDB 2GF0A 3SS8A 1XEXA 4C0KA 1G3UA 2CVHA 1GL7A 1Y3AA 2Q9BA 3E70C 3FKSD 2JAQA 2IYWA 3BB1A 5K8IA 5DIFA 4BPBA 4DB2A 2VEDA 3KQKA 4G5QA 1U8YA 3DM5A 1P73A 3LAWA 4CEHA 1UF9A 4P4SA 5IRCD 4BZXA 3M4YA 1HEIA 3AF0A 2CBZA 1IXSB 3TNUB 5CIQA 5BXQC 1VYVA 3LIEA 1UPTA 1IJFA 2R6CA 2NO9A 3VTPC 1JECA 2OM2A 1UDXA 5BYJA 1UBEA 5FPSA 2HV8A 3Q9LA 4HYTB 1GVNB 3SOPA 1CR4A 4WBSA 4DLTA 4M1TA 3PVSA 1LS1A 3UANA 1V43A 2HLDA 621PA 4PPQA 2NZ8A 3VHLB 2JIZA 5DH9A 4Z8YA 2H92A 2TMKA 821PA 1TQ4A 1XJQA 5K8LA 2QM7A 5E3HA 4HB0A 2AWOA 4MYHA 5FBWB 3IR9A 2BMFA 4JMPA 3TK1A 4C4PA 5FPYA 3EPKA 3GJ5A 2QGNA 2IWHA 4EJSC 2ZJAA 3U7EB 4Q21A 2Q9AA 4AYTA 3ZGXA 2ZRKA 4LYJA 1QHSA 3BE4A 4XWAA 1H89A 5EP2A 5JHHB 1G3QA 1PLJA 3NDBB 4DB4A 4WZBE 4KP4A 1G5TA 5B58C 2QBYB 1OFIA 1TTTA 4A15A 1AM4D 4JJZA 5HCIA 3A36A 1KTVA 3H4MA 2PJZA 1EX7A 2HF9A 2VPPA 3PUXA 3TAUA 1XTQA 3LQQA 4EPWA 2XOKA 1UDWA 1AN0A 1NBMD 4Q4AB 2V7QA 1NJGA 1ZIOA 3KQUA 5L3QA 2ERYA 1SXJA 4QHYA 1TAGA 3JVUA 2J87A 1ANKA 4WW0A 3SYLA 2QT1A 3GLIB 3U3MA 5KOYA 1Z0IA 3A4NA 5KUTA 2AKYA 4NPHA 2Q5UA 4CYMA 3QF4A 1Q57A 3R20A 4US0R 5KSOA 2CMKA 5IT5A 1UJ2A 1JUNA 2QMEA 1JI0A 2Q9CA 1VHLA 2NPIA 3CWZA 1W48A 3THWA 4ZI3A 4HZUA 1E9AA 4NYJR 2Q3MA 1W36B 2Z43A 1BMFA 3PENA 3GQBA 2BMEA 1B23P 1OW3B 2ZTSA 4OJQA 3WYFA 2FE4A 5KPJA 2QZ4A 421PA 3P8MC 2I1QA 2JLWA 3NBZC 2O8FB 4RY2A 5DHAA 2AD5A 4LX0A 1NSTA 1MO6A 1ZJ6A 4U7OA 1IN8A 4V0LA 1PLLA 5AWFC 2QY9A 4B3XA 1XTSA 4LJ5A 1UKYA 3CM0A 4RKEA 2IXGA 1X86B 4I6MC 3HYTA 2Q3IA 4RKFA 4TMZA 1QG4A 1E2MA 2G1JA 3HR8A 4EJSA 1C1YA 2V4ZA 2VA8A 3N70A 4C0QC 2QORA 5DYGA 1CU1A 5KDOA 5LBIA 4OI1A 5APQA 2ZPTX 3HDTA 2OCAA 3IPYA 3UWOA 3AKEA 2LCFA 3QOFA 4AKIA 4URXR 2IS2A 4M1WA 1GRNA 5HTKA 4PANA 2GJSA 2PZFA 2HCJB 3DDCA 3FHCB 1TADA 3V4WA 3A8TA 1H8ED 1NNEA 2BBWA 3DL0A 4N3NA 2VSXA 4D4KA 2G1KA 4JT2A 2OE2A 4MGZR 3NTNA 3TSWA 2QTFA 1MT0A 5AW9B 3RS7A 5AJWA 2QMUA 1OV4A 3G5UA 1SVLA 4IJMA 4PPNA 2VHUA 1VTKA 3V9PA 1XXHE 2KE5A 2R65A 3NBFA 4FN5A 1FMJA 3WP0A 1E2EA 3JZAA 3K9NA 2FWRA 3BWDD 5EXTA 4US1R 1OHHD 1CI6B 3LVRE 3R7WA 1ZNYA 3ZIAD 3L0IB 1E1RA 3K9GA 2R9VA 1JNYA 1N0WA 2P3SA 4LHXA 4NYMQ 1YE8A 1IJEA 1E69A 1R8QA 5AW5B 2VF7A 3W6PA 3OIWA 2RMKA 1MO5A 1DEKA 5JSZA 4QM7A 3CX6A 1D5CA 3QXCA 3U3RA 3UMSA 4Q4JA 1NL3A 2QAGB 3PEWA 1XWIA 1GZLA 4OQMA 1YR8A 1D2MA 5J5CA 2RCNA 4RSGA 3HPRA 4L16A 5JCZA 3QXXA 2ZM5A 3B1XA 2IC5A 4V0KA 1XD8A 4RFVA 3IBYA 1RRGA 1LNZA 4Q1EA 5APWA 1FUKA 2KP8A 2BEKA 2WBLC 3TQCA 3VR5A 3FB4A 4KSCA 4E22A 5KHOC 3QQ5A 3THXB 5FPKA 3A7OA 3BJIC 1D9ZA 4TLCA 3L2OB 2RGNC 4RD3A 3FFAA 4OK6A 2P6UA 1U0LA 1TMKA 3B1WA 1ZM9A 2K5UA 4I81A 3VX4A 2EW1A 3D8BA 2EU8A 3AUXA 4GP6A 2I3BA 1YZTA 1FX0B 1ZNXA 2VP6A 3GCGA 1GSIA 2QPAA 4UQOA 4ZCIA 3CNNA 5IK2A 1T3LA 3W3AA 4IVPA 4QOSA 4TL9A 4YONB 2A5JA 3VU9B 3CIOA 4LV5B 1KHTA 3OEED 1N3BA 3NTUA 1TU4A 3TQFA 3K70C 1X1RA 4DZOA 4YMSA 2BCJQ 3W3ZB 1HTWA 1M1YE 3TR0A 3VKHA 1S9DA 2W27A 4Q7LA 2DFTA 4KHXA 1KI6B 2B21A 1KKMA 3MGCA 5LPNA 1V5WA 2NOAA 1F2TA 3AGPA 5AVXB 2XSZD 1H8HD 3GLFA 4CZ2A 4YXWA 2D06A 1DAMA 4HAZA 3FFBA 4IOLA 2ZJZA 2A7QA 3I72A 3MCAA 2CHQA 2B6HA 3X1XA 1E9CA 2H5EA 3ZZTA 4BFZA 2GEUA 3KQNA 4QKQA 2C9CA 4Q9KA 1P72A 1GWNA 3VYIA 1U9IC 4NP6A 4Q4HB 4RD0A 5C2JB 4O3MA 2W2XA 2ZU0C 1GNPA 4FXPA 4KBGA 4I5SA 1VCIA 2IYLD 3SBDA 1EG7A 1N5LA 1OFUX 2JJ1A 3WHKA 4D80A 4UNRA 4NCKA 3Q3JB 1KO5A 2ZXUA 3CRVA 2GXQA 1W0JD 2B92A 2FDCA 3DOFA 2F6RA 2O8BB 2XZPA 3U3OA 1ZD8A 2XXAB 1A4RA 2EYUA 4B33A 3GFPA 1HA3A 2IT1A 2Z4RA 3REGA 2NTYC 2O0JA 1QHIA 1DELA 4M1YA 1QHHB 2VF8A 2WJGA 3U7HB 5EP1A 4HDCA 1OH5A 1US8B 1R0WA 2GILA 3TVTA 5B1OA 3AF1A 3NG1A 4PZYA 2HXYA 4UXIA 5AW8B 1P2VA 5K8TA 3J81k 3CPEA 3VAAA 2DFLA 5JI3E 1L7VC 2XITA 4ZDWA 4DIEA 1A02J 3AVOA 1EGAA 3DM9B 2CCKA 1W2HA 4LYFA 4RFSB 4TLDA 5SZIA 3REFA 1MRNA 2ANBA 1VG1A 4Q7JB 4BFVA 1WRBA 1JJVA 3AF2A 4UNPA 5FUVA 3B78A 4PC1A 5EUMA 3O8CA 1SXJE 4YQFA 1IAQA 4KVAA 1M7HA 3QY0A 3SEAA 1Z0AA 3QEOA 3TBKA 4D4MA 1JEEA 5B30A 5IHPA 2EYQA 4S2EA 4CIDA 4DUGA 5DNYB 3AVQA 2FSHA 1CRPA 1DO2A 5APUA 4XVQA 3RS0A 3SJZA 4YDHB 1PJRA 5H68A 3THYB 2BBOA 3HE5A 3GJ4A 1N6LA 1II0A 1F2UA 5CIWA 3NWJA 2G0TA 1NLYA 2ZEJA 1R0YA 3QVUA 2RH5A 1U8AA 4TT3D 4W7SA 4Z51A 3CF0A 4KSBA 3GEHA 4CT5A 4JVSB 1IY1A 4Q02A 3GJ8A 4V03A 4DCTA 5F9HA 5AUQA 2ZYWX 1OXSC 1CTQA 1YKSA 2OFOA 4TMWA 1U9IA 3LV8A 4YLGA 1O3YA 2EFHB 3IEUA 2QUZA 3P7KA 4F38A 2ZANA 3ZVLA 8OHMA 4C0JA 1EFRA 4QM6A 4JLJA 2GJ9A 2P5SA 4Q9LA 2V3CC 3V5BA 4D6PA 2GXUA 3MWYW 4A2PA 1QHGA 1SHZA 1T2KC 4ITRC 4KITB 4DCNA 3N2EA 2PH1A 4LPKA 1GKUB 4WAUA 3ZD7A 1EFUA 2OV2A 1QDEA 3ZVMA 1S9KE 1AKYA 2C8VA 2G88A 4ZO4A 5C4MA 1YVDA 2EWWA 4DJTA 4A0FA 1VECA 1BS1A 5LDDC 3T1OA 2BM0A 4U7NA 2WMNB 4PC7A 5TV2A 5GJCA 4Q1FA 3KKOA 4TLAA 3AM1A 1XEWY 4HAXA 3T1TA 4D81A 1OIVA 1HQYE 1RRFA 4MGKR 1LF0A 4YMTA 2D7DA 1ESNA 2WZQA 2IL1A 4K46A 4W5JA 5HKKD 3QE0A 1R10A 5LD2B 1TNDA 2RGBA 4ZDKA 5AVQB 2W6IA 2FSFA 2WWGA 4R2IA 3AP1A 3NFQA 3WBKA 1Z0KA 3OAAA 5E4FA 3K8YA 3NMDA 1VYTA 4ARZA 4DLXA 2AXNA 4D25A 3E2IA 4DLZA 1AIPA 1Q3HA 2VP2A 5DYIA 3PFIA 1UEIA 4BECA 2C2AA 1FOSF 1TX4B 4PHFA 4PAMA 4XSHA 1SVIA 1NY5A 3QENA 3NH6A 1P62B 1N2CE 2WAXA 2WSSA 2VHQA 2FSIA 3AKCA 4WXPA 1AKEA 2P65A 4G01B 3B6EA 4EFMA 2B7CA 1MO3A 3EIEA 3VNUA 3I1FA 5FTMA 1E9EA 2JIZD 3AGQA 2JJ2A 1KO8A 3B7GA 2ZU6A 1E2HA 1GG2A 1IXRC 2X19A 2AWNA 1DE0A 3KQGA 1J90A 4KU4A 2DB3A 1BYUA 1WDTA 1XCGB 1YZKA 2ZSEA 2FZ4A 5KNBA 1E3MA 1AZSC 4NONA 4C0LA 1NVXQ 3FGNA 3EC2A 3L8YA 5CJPA 3IO5A 3PJRA 1TEXA 1IM2A 5F9FA 5FBRB 2G0NA 4M9ZA 1G7TA 1DAEA 3LRPA 3UK6A 4E03A 2GCOB 4ZIRB 5JS7A 3B1YA 2A9KA 3QKSA 2NQ2C 1RYHA 1MKYA 3KJEA 1E2DA 3W6OA 1QF9A 4BLQA 1G9XA 2W2VA 4BWYA 4Q9IA 4E09A 1E79D 4LC1A 1U98A 2CJWA 2FJUA 1E96A 3KL4A 2XOKD 1XMJA 1OXVA 4B2IA 2VP9A 3KDPB 2V7QD 3PXGA 4IFEA 4D0NA 1RW4A 1SXJD 5AVZB 1GRRA 4A0RA 2CHGA 2RHDA 5GJWC 4LPSA 1Q3TA 1XTKA 4NMMA 2GKSA 4UNQA 5FI0B 2LKCA 3D6TB 3F5FA 1X8LA 2ZJ2A 2JLQA 1SP4A 2DYKA 4ZI2A 2XEXA 1P2UA 1Z0FA 4FIDA 2P7JA 1T9HA 5HPYB 3SBEA 1ETUA 1SVWA 2ZRLA 1OH8A 3LBHA 3GLFE 2QAJA 4BFUA 5FTNA 2KJQA 3QSYA 1BMFD 3W5IA 2WWFA 2ZUBA 2C9LY 2ZS9A 1KSJA 1XTIA 5D3MA 1NWQA 1M2OB 3HYRA 2JDIA 2REXB 1KO7A 1W1WA 2Q3FA 5J4HA 3KQLA 1E2KA 1N6NA 1KK2A 3TRFA 3ASYA 5KTYA 4HZIA 4LBZA 2PMDA 3OF5A 5GVSA 5EXPA 1Z22A 2J41A 4H1VA 4EFNA 3SJAA 2IYZA 2IYXA 5DSZA 5JECA 2A78A 1T5LA 2F7SA 1S9KD 4B73A 4LZZA 4JLOA 1MR3F 4M2LA 2SHKA 2IYYA 2ZE6A 1HJBA 2X2EA 5UKDA 3WY9A 1E9BA 5FBQB 4B71A 4C46A 4MRVA 2JLSA 4A6XA 2ZR9A 3MLEA 3A1SA 4GBMA 3RANA 5KNDA 4I2LC 2W00A 2Z5FA 3DZ8A 3KUDA 1YQTA 3KUCA 3RSLA 3AVUA 4XOIA 4G5SA 2DWPA 5EE0A 4BIUA 5AW2B 3DZDA 3EIQA 4G5RA 5P21A 1RC8A 4KFTA 1XD2A 2ZRBA 1KJYA 4Q20A 2FFQA 2H18A 1HURA 4B3FX 4N0DA 4D2IA 1G3RA 1II9A 1J7KA 2PMKA 4FPPA 1QHYA 1W0KA 1GK4A 1OH7A 3W8NA 3IO3A 4PX9A 3VKWA 4QC2A 1KDPA 4XTRA 5DE3A 2AFIE 2F43B 2ATVA 3KTAB 2WMOB 3RC8A 1J70A 1E0JA 1A82A 3U6KA 5JWRA 4OBEA 3VMYA 1KI1A 1FL9A 4IFBA 4JBXA 1CJTC 3WMEA 3IEVA 2IYSA 2V1UA 3ONWA 4I1SA 1E1RD 5CITA 3K0AA 3H84A 2REBA 4JBWA 3ZZUA 2WAYA 4B76A 5EP3A 3VMXA 1Z2CA 1NVUQ 3C41J 3M0EA 2C95A 4JS0A 4F92B 5CM9C 5FPTA 2O8EB 2IWRA 1KDOA 1KKLA 1Z08A 4KCGA 3FE2A 2V6JA 5FUYA 1DARA 2XTMA 1SLQA 4NCHA 2IYRA 3ZCCA 2QQEA 3MFYA 2VHCA 1QRAA 1F60A 2VTKA 1W44A 4JASA 3V4QA 1TEVA 4ZDIA 4BFTA 5DHFA 1ZM2A 2GVZC 2RAPA 4B6EA 1NG1A 1ZRHA 4LHVA 2WJHA 4PAOA 5DLQC 5EZ6B 4YMVA 2ZJBA 2BV3A 4WZAE 1DAHA 4Q47A 2Q3HA 4PC3A 1SULA 1X8JA 2HT1A 2ZR7A 2ZAOA 3D7MA 5DN6A 2H17A 3CUEF 4DBLC 2AD1A 4DSUA 1XX6A 3SQWA 5AW4B 2OUKA 2WPDA 1G7SA 2Z5IA 3M1IA 1DOAA 2DR3A 2ZAMA 1A1VA 4CEIA 3PEYA 2GK7A 2Z6VA 2F3TA 2KBEA 4C9BA 4QGHA 1T3HA 1XEXB 1Q0UA 3AKYA 1JAHA 2QQ0A 2WKPA 3RRYA 1ONBA 1OXUA 3FHOA 4TTPA 4C0SA 2RGEA 2KBFA 2REOA 2GWHA 3VR2A 2J45A 5L3RA 2UKDA 4OK5A 2IBMA 2XZRA 3DEFA 1Q22A 2ZRFA 4CEHB 4P4SB 4QPJA 3MRSA 4FCVA 4IEIA 4M8NE 3QEJA 2HF8A 3K9LA 4HUTA 3C16C 4YXWD 2VO1A 2WJVA 4EFLA 1GL6A 3UMRA 2OCBA 4OHWA 2R6FA 3FDIA 2NO7A 3EG5A 1T91A 3VMFA 1NIJA 4TMVA 3UPUA 4GMXA 3TYYA 1LW7A 1GAJA 4TLBA 4OK3A 4UJ5A 4Q1AA 1FNNA 3WYGA 4BLOA 1GZSA 1JQJC 5EUQB 3ZQJA 4FWIB 3RS2A 4EOTA 5CM8B 5J47A 4W5HA 2JJ1D 2NO0A 2YHSA 1SVKA 4RD1A 3A1TA 2PEYA 4HUQA 1W5TA 3O47A 1XF9A 2VHTA 3KXIA 4HB3A 2O5VA 1ZCBA 4TL6A 2G83A 3ADBA 2X2FA 3W90A 3CX7A 2GRJA 1N0VC 1MOZA 2ZI6A 1TQ6A 2GCNA 4QNMA 5AVTB 2WPQA 5LB4A 3RVBA 1AJEA 2GESA 3TE6A 1NVWQ 1CJVC 2OCPA 4PQFA 1XU4A 2VRSA 2P2LA 4TYPA 5KDLA 4MUAA 4GNKA 4Y0VA 5DO9A 3VNVA 3DPUA 1K8RA 4PC6A 5F3WB 1OXXK 1QHNA 4GZMA 4M9QA 1CEEA 4DZZA 4PO1A 1ZAKA 2B8TA 4LJYA 2BEJA 5L3QB 2O52A 3TNUA 1SXJB 4KV9A 4OHZA 1E9SA 3I8XA 2ZJYA 2ZRJA 4V0OA 1G18A 1XTJA 3L43A 4MDFA 2CLCX 1FUUA 1ZD9A 3CPJB 3OFNA 1LY1A 3CRW1 3KJHA 2WICA 1FNMA 5FR2A 2BOVA 3C14C 3SR0A 2F3RA 2JCSA 3UIAA 1ZINA 4FD2A 3K70D 1QVAA 5CDFA 1II8A 4KJZA 1KSFX 2QI9C 4DUGD 4W9MC 5J40A 2XNSA 3THWB 2ZRIA 3CWQA 3TSOA 3X2SA 4C7NA 1K5DA 5AR1A 4HZUB 3CB4A 3GD7A 4XD7A 1VG9B 2IEYA 4OJKA 4BEBA 3E5HA 1R0XA 1JOYA 2ASEA 3EIHA 3P1JA 3U6BA 3ASZA 4LHWA 4YMWA 3GLGA 2GA8A 1IQPA 1E1QA 3QIAA 4DCUA 1T3SA 1NJFA 5L3SA 2H16A 4WVFA 1BOFA 1P2TA 1FTNA 2QE7A 2AL7A 3CNOA 5FI1B 2NMVA 3CO5A 4JSTA 5SZKB 2QBYA 4PPGA 3HU3A 3K1JA 1NF3A 4DXAA 4TZ6A 1E0SA 5J4YA 1JJ7A 3IDQA 4MRPA 1SZPA 1EFRD 3GLHA
chains in the Genus database with same CATH superfamily
3K8QA 1RAGA 1R9GA 5DHPA 4EJSB 4C4YA 1HE8B 4FWTA 1DJLA 1SUBA 2IOQA 3S2ZA 1XSEA 4ZJYA 2EZ8A 4QQNA 2OFXA 1M6EX 1UZMA 4B32A 2HK6A 2PZGA 2YHAA 5EESA 1X2EA 3EZXA 1K88A 3UUFA 4NYKA 1C81A 3CX5E 1R0BA 4X00A 5ARCA 1WS6A 1ZR2A 4LCJA 3IB6A 3PF9A 3FGAD 4BEJA 3EGIA 3OEHG 4K6OA 5JG7A 4Q4JB 5DSTA 1BCRB 1X9VA 3GJ0A 4WKBA 2QYHA 5DMHA 5CCHC 3K96A 4J41A 4CLHA 4XEUA 4WUVA 1NQUA 1M7GA 2ZXXA 4YI3A 5T4EA 4PYJA 1G6UA 4GFDA 5J59A 5D2CA 2GZ3A 2NRGA 2PYIA 4KTTE 1PDWA 1Z6GA 3TNFA 4QGSA 1L4EA 2Z95A 3B6JA 3T3DA 3VOTA 1X0VA 4M21A 1L0LE 2EX0A 5HCNA 2GYWA 2WLLB 4V39A 2YJNA 5SYMA 1CIJA 4GPZA 3U9LA 5EHXA 2CLEB 1CLEA 1V4VA 3BFXA 2F00A 2X0EA 2W90A 2DHQA 2HIMA 1WHSA 1FP1D 4FC7A 3PGVA 4Y2SA 2I71A 2Q62A 1A8HA 4MTCA 1FW6A 5B6PA 5L8RJ 1SVMA 3L8GA 1JHZA 4OUDA 3BL5A 3OEHA 2RG1A 3MCZA 1NTZK 2ZRGA 1SQPD 5AG2A 1B0UA 1PFIA 1ULTA 1BTOA 5EFOA 3UMGA 3EJWA 5AI4A 2W0MA 2V59A 1IDSA 1G41A 1GQSA 2BUAA 4WY4B 3EGEA 3LKDA 2HFKA 3WICA 1Z68A 4MYUA 3UAGA 1GSHA 1RRKA 1PP9D 1H05A 3UJBA 1H23A 3Q5SA 2QZPA 4Y98A 4YHBA 1ZVJA 3I05A 4Q1DA 3PP5A 1UBLS 1HGXA 3GLHE 1T5BA 2PX2A 3QYJA 2C2XA 3PR3A 2XVAA 4J16A 3SFZA 3GX1A 3P4XA 3BRWD 1NJ6A 5JMWA 3MOIA 2A1TS 2FGKA 4L28A 4X8HA 1SQVD 4EB3A 2ONJA 4ZK2A 2ODPA 2VSNA 4FHEA 3U11A 4TSFG 1W88B 3JX9A 4UHHA 1AI4A 1KUQA 1MFZA 1JG2A 1XP8A 4AG6A 2H3EA 1CJMA 1W4RA 1YNSA 4FJ2A 3BE8A 3CJHA 5APXA 5C80A 1KKUA 4GKAA 1UCFA 4HZ3A 5JVDB 1Q11A 3RIXA 3V9AA 1GP2A 1UBCA 5CLGA 2EILB 1IXYA 4P6VF 4KH0A 1BNCA 1V6AA 5FLKA 3A4LA 3QKSB 1Z26A 4RZUA 4JP8A 1WNSA 1KAEA 2IF2A 4O8CA 1KEWA 4MCHA 2RJNA 5KOJA 2XCUA 4GOXA 1GFSA 4JPZB 3SJCA 2KI7B 1DWOA 1F4PA 1WQ4A 4INJA 3OBIA 3AF3A 1GSOA 1FUIA 1V6CA 5FNVF 1C80A 3WRVA 3JAKA 3FCEA 2V6MA 3TZLA 4TQUS 4F5DA 4U3FH 3PPVA 4TSFA 4ZTZB 3LSUA 2WKQA 1J23A 2KSDA 1K9SA 4J9YB 4DM4A 2ZWMA 3MMNA 4KQ2A 1GTSA 1E92A 1LSSA 4BV9A 4E4RA 1FS6A 3UQZA 3G3ZA 1YACA 3FGOA 2G28A 4LZOA 4I4TA 2D3TA 5C93A 3HN6A 1LB1B 4NHEA 4MWSA 3WTCA 5IY5C 2F3UA 3BBPA 3DSQA 3IP8A 4MJ7A 2ZKIA 4TQ9A 3IUJA 3ZHRA 4L4XA 3GPCA 5COQA 4BUJA 3IHKA 4QOEA 2OHHA 5AW3B 3SZ3A 4Q39A 1EN4A 3TZ6A 2IEAA 2BUCA 3BWYA 3GRKA 4E5YA 3FJ1A 3SIPA 5K5GB 5FJJA 1PUIA 2FQXA 4JWTA 1BGYJ 2PH5A 1KORA 2R7AA 3SGLA 1B8UA 5EIFA 3D36C 3ANYB 4HH2A 1A9RA 2VJOA 4CEIB 3N8KA 2Y3IA 3FUWA 1OJLA 2I87A 5GJVC 1MVLA 1K1EA 1Z3IX 4O59O 4K0KB 3T1YO 1VI5A 4MYTA 1DX7A 3A2LA 2JIDA 4D4LA 1XILA 3EGDB 5IC6A 1E5WA 3GGOA 4S1OA 1XGKA 5BR7A 4JI7B 4G0QA 2D2IA 5JR3A 1CB0A 2FF7A 3ZUPA 1RWWA 4CMIB 2Z5GA 2BCEA 4C4AA 5FOXA 3SYRA 4MA4A 4LHYA 5KSPA 5LZ5A 5AM2A 4LXQA 3LD9A 5CD1A 1UXJA 2ETVA 3G79A 5A02A 3FBTA 3FPEA 3ZDBA 5JAIA 3HJBA 4NS1A 5I4BA 1JE1A 4JXJA 5ISMA 4FD3A 3WLOA 4PSUA 4L8YA 2E85A 3DMHA 2VAWA 1G6OA 5J5VA 2C9YA 3EA5A 3F6BX 1V5GA 2ODEA 1SOUA 4XA8A 4ZWNA 5AK5A 2Y1WA 4G5OA 1KJQA 3ZK7A 3ZOZA 4AY2A 5ECDA 3U3ZA 3AIKA 4Y1RA 1B15A 5B1AB 2BJWA 4OOEA 1PJQA 1TKAA 2VHXA 1A50B 3UG6A 4N5IX 5K3FA 3C3EA 1WETA 2WQZA 1VIBA 2JLYA 3DFMA 5AK0A 3DAYA 3L73D 1JR3E 1N32B 4XIGS 4PINA 1R66A 3WA7A 1PEKE 3DLIA 1PX2A 3AG2C 5FBHA 3O1JC 4BMPB 2YVLA 3KJGA 1T8PA 1Z6PA 2FWIA 1R6TA 1CUXA 3ESDA 4QNHB 3RYCB 1AHPA 5I6DA 3CX5F 2QLJA 3CNLA 1CDDA 1XTRA 4D0LB 3H1LJ 5KI6A 2JARA 4Y6OA 1EVQA 2VJQA 1J7JA 4J0CA 2GZSA 1QZZA 8ABPA 3L6UA 3SI7A 3C3DA 1S2DA 1VE6A 1MB0A 5SYNA 2O0KA 1ZCZA 3ETHA 2X77A 2WWIA 5GOZA 2KYVA 1VHJA 2KX7A 1GV1A 4CIVA 3OLZA 3TE7A 2C5BA 3DD1A 1FXVA 3E9QA 2BKAA 3S6JA 4W6ZA 3GEEA 2BD0A 3RNLA 2GO1A 2ILMA 3KOZA 1YR3A 3AVWA 2VUTA 1L0NG 1BE6A 3LX6A 4G1CA 2GTHA 2JI6A 3EFEA 2DGDA 2ZT8A 1PKEA 5JD5A 3QVOA 3RVKA 2ZJ8A 2C2ZA 1VL5A 3THXA 3WU2Z 2Q7GA 3NUGA 3BOSA 1Q1GA 4RZ2A 4W99A 4L8FA 5IJZA 1LT1A 4K6KA 3A4TA 4IRUB 1ZWIC 4KE6A 1P84H 2E4YA 1FX0A 2AXCA 4DWJA 3G13A 4ONEA 4XX1A 3H8SA 3U48A 1SFCA 5KC8A 1U63A 3DXRA 1KMMA 2RK3A 5HS6A 4AL4A 5H82A 1XZDA 1H94A 6ABPA 4MRSA 4KLCA 1FXSA 5DM1A 4TUYB 1X1QA 4R8VA 1E9FA 4JAUA 1KB9E 1Y33E 3OM8A 3H6HA 3BGIA 1KO4A 2FMXA 5KNDH 2V54A 2WM9B 3O0DA 3AH8A 2FPUA 3ZWWA 2IYTA 1KS2A 5EL0A 1TUIA 1W2BU 3ZY2A 3TZBA 2D62A 1YL6A 5EZYF 2GBCA 9GPBA 2A3RA 1O7JA 3AF5A 1ZJ5A 2FPKA 1Q90D 4RFSA 4QOHA 5ALMA 3ZRWB 1J9EA 3C1OA 3E7WA 1J07A 2C9NY 4BL5A 2CLDX 2RIRA 3T1HB 1V7QA 1LTJB 4GKVA 3K9BA 4DV5O 5E4YA 4XOUA 1A32A 1SVSA 5AKJA 3TKAA 2HW8A 3MD9A 3V2HA 4KHZA 3B85A 1NVVR 1TMYA 5JDIC 5I7EA 4I9GA 4IRXA 3OZ7A 3Q2IA 2AG5A 3RUDA 5JJLA 3GAZA 5MFPA 3GEMA 3VBCA 3M83A 3FOZA 1G21A 3FVWA 1V11A 3MQ4A 1L7DA 4M86A 1U2SA 2XYHA 4UASA 3TQSA 5ALOA 3WLTA 2ZIAA 4D9EA 1J8VA 4U7TB 4AP5A 3JAWB 2CH7A 2ZFUA 2PRIA 1ZBQA 4E31A 3ZRXA 4NULA 4JI1B 3RHSA 1T5EA 1F8GA 1M75A 2FXVA 2E76C 2O01N 3VOPA 3K6SB 3CCRP 2DHDA 2YIBD 4A8JB 4MEAA 4PR0A 3WE7A 1QLWA 1Z83A 3WHLA 2XA2A 1UBJS 1UBRS 2DJVA 4WXHA 4MULA 1M90Q 1VGQA 2DFDA 2Q1XA 4AB1A 3UW3A 3RTDA 4IWYA 4ITUA 2KLUA 1EVZA 3L06A 4N12A 1G8PA 3LXRA 3TBFA 3PIRA 3SYKA 1M56B 1S2MA 2W2PA 3KZ1E 4DZRA 4GLOA 4EG0A 1H2RS 2VQ3A 2FFDA 1B43A 1V8FA 1G5FA 4RWEA 4JQZA 2FEKA 1T15A 4DR3O 2M98A 3NJ4A 2W2MA 1EEHA 1JJBA 1W5FA 4BASA 4KQKA 1E2QA 4PJ0Z 3GJXC 1CQIA 4BWFB 5BSGA 1VL2A 1QONA 4TWZA 2QK4A 4MVJH 1D6MA 3EYAA 2BOCC 2A5GA 3IFSA 5AVWB 2NN4A 3S55A 2V7UA 3N8GA 2ZJ1A 4MR7B 5BQ3A 3OJ0A 1RM1C 2ETNA 1GTG1 1TXGA 3AG3C 1CLUA 2N75A 3P9RA 5H9WA 4OHXA 4GSKA 3EVDA 3JQ9A 1QYCA 4U2CA 4CR8A 4HTFB 3LQ2A 3K2BA 4ZI7F 2DH5A 3E8GA 5DBEX 1KI7A 2ZJ3A 1CNMA 2PRRA 2P2SA 4DFDA 4G86A 1SKBA 3HNOA 4YRTA 5DCWA 1UJ4A 3Q10A 2Q8PA 2YWFA 1U8CB 4CPDA 5EFWB 1N7SC 1YRLA 4N9WA 2B3TA 1GT91 2Q9BA 3VGPA 5J2TA 4YVFA 2Q46A 2WT4A 3AF0A 4EGJA 1FJKA 3D3NA 4HMOA 3WMRA 4ZHQB 2FEAA 3Q9LA 3FCUB 4PPQA 1FU4A 4N65A 3L84A 1XQVA 2BMFA 3PN1A 4NEHB 3UMMA 3HY6A 3URMA 1P81A 4P98A 1A72A 4YTPC 5CCBA 1YL7A 1WA8A 3D6MA 4JJZA 2EZUA 3A36A 3LP8A 2V65A 1I5OA 3AHCA 4P4LA 4EPWA 5KHJA 4ENSA 1EJBA 1ZVVA 4UVHA 2GHYA 5HCUA 3U3MA 1IBKB 1I13A 1R6DA 1JI3A 3H75A 2Q5UA 1Q57A 1JMKC 5KSOA 5IT5A 3GUYA 2Y66A 4NYJR 2EIXA 5JE8A 1IURA 2QZ4A 5KAFZ 1O2DA 4FE4A 3CB2A 2I66A 3M9QA 2CLKB 3WAKA 1LZLA 5ABPA 1VL8A 3OZGA 2V4ZA 4TWAA 4LNUA 1WEKA 5APQA 2YWJA 1S1CX 4OH1A 3G68A 3FXDA 4B6OA 2JFXA 2JGEA 3SYOA 2G04A 4D4KA 3V1LA 1PR5A 2JJ1G 5U4QA 3G5UA 2P4EA 2R66A 2R65A 1FMJA 3QTTA 3KJQA 1A4IA 3BGOS 5B7GA 4MQMA 1XWWA 1GN9A 2NP7A 1N3YA 1U7XA 2XUDA 4LQCA 2VF7A 3T7KA 2CK3H 4PV1B 2E18A 2Z3WA 5DEDA 2BFDA 2XDAA 1NL3A 3K58A 1QVWA 3OWOA 2I99A 3LUGA 1LNZA 2J48A 4YPVA 1FUKA 3Q0EA 4G07A 5KHOC 3A7OA 1D9ZA 4WMLA 1SESA 3TR6A 2OKCA 3IGAC 4FGSA 2EU8A 4NKGB 2W6JH 2XT0A 3EY4A 3QYPA 4BP1A 1Q7YQ 3L4BA 3L71J 4LXIA 1YBVA 3T7AA 3NTLA 4RDCA 4X1KB 3FB1A 3WNZA 3EOZA 1MD9A 3OA0A 3IA7A 2BFBB 3R3JA 1I0IA 2W6ZA 4Q4HB 4FXPA 2OO5C 4D80A 2JJ1A 1T9BA 3O90A 3AUFA 4CFYA 3DOFA 1Q81W 2F6RA 2XZPA 3OVMA 1RMYA 3RUIA 3PDUA 3VO1A 5B1OA 4PZYA 1QKIA 2CVPA 1QQAA 1SD1A 2XITA 4DIEA 4QWMA 1CRWG 1BS3A 1ZMTA 3BXOA 3RC2A 1RCFA 2C4VA 3E8SA 5EUMA 1SXJE 1U7TA 5HFAA 4H1HA 1VHWA 1JJ2U 4BQRA 3PEEA 1II0A 1ACMA 4Z51A 1OW8A 4ZALA 3H05A 4YJDA 3JQFC 4FSXA 2VWKA 2B9BA 2ZANA 4OMCA 3R4VA 1T2KC 2WILA 1MG5A 2FPPB 5CB4A 2WU8A 1YVRA 2R70A 1C9NA 2WKWA 1DQSA 2ZBRA 1LWUC 4I6JA 1RD4A 1KFEB 3LIPA 4PC7A 2ZWAA 1PS0A 2HMAA 5EMHA 2OWDA 4FLWA 5C7IO 1ZSVA 1BL8A 5H02A 2WLMA 2IL1A 1ETHA 1HSZA 3CCUV 4NMWA 2E21A 3AP1A 3MMXA 1KAQA 5C34B 4NMHA 2C2AA 1TX4B 4HS9A 4QTUB 3RKRA 1NY5A 1I6WA 1P62B 4D99A 2ESRA 4FDLA 1K34A 3OX2A 4IZOA 5KU7A 3VNUA 2I33A 2XUIA 1ORQC 3DAHA 2NXEA 4O1IA 3SYPA 3P0IA 3EXG1 2G0NA 4UMDA 4DUYO 4LF4O 1X1BA 4L8JA 1RYHA 1GTL1 3K72B 3DHYA 1OWLA 3JCUE 1E96A 4H77A 2ZGVA 4CLEA 1A9TA 2ZG6A 3PXGA 1GRRA 1OX4A 3RPEA 4JI5O 4FIDA 1QNMA 2P7JA 4DJGA 3TLGA 2XYRA 1U28A 4GKJB 3NW9A 2GLUA 2J4DA 1C2TA 4M55A 4L74A 3QU5A 1NWQA 4MSWC 1KO7A 3J7AC 4ZU1X 5GVSA 3WKCA 2G6TA 5JBIA 3RR2A 2IYXA 1ENPA 1ZRNA 4AHCA 5DYNA 5IJXA 2A78A 3BL6A 2CTRA 3BVOA 1R64A 1VE1A 2I8AA 5KNDA 3K31A 2IZ5A 4GBJA 3EIQA 3T38A 5BQFA 5IYZA 2C4HA 1TJ4A 1SBTA 4MVJD 3F6RA 3HCDA 3M2PA 1RXVA 4QPJC 4R9VA 1X9HA 5JWRA 4DNFA 2B4KA 3DVQX 3DQPA 2WAOA 3DE5X 4PA4A 3IBTA 1BW9B 5JCJA 1Z2CA 2M8RA 4J91A 1SCBA 4NG5A 2PSFA 3VYWA 4L85A 1SLQA 3AR5A 4BAZA 2ILTA 3W06A 1UZNA 2CUGA 4PGGA 3V2NA 2ZJBA 2VTBA 4RLQA 3D7MA 3HBFA 5IDXA 3HKBB 2E37A 1X79B 2R9AA 3DE3X 3E8FA 1JEOA 3LJKA 2VDWB 1AUOA 5FX2A 2ZAMA 2DBQA 5ENZA 1V2HE 1ONBA 2IIVA 2NXNA 2JBAB 1NU1H 3UJ3X 3QEJA 4GZ6A 5KTTA 5GV7A 4OHWA 2FMTA 4RH1A 4GMXA 4OK3A 4QTYA 2HPCB 3TDNA 5BORA 3KZXA 4BMZA 4DV1B 4EOTA 5CM8B 3NCHA 4H7EA 1HTTA 1ILWA 4TL6A 4PPYA 2D2CB 4IKOA 2NVUA 3BGDA 2JCYA 3VNVA 4UC0A 4M9QA 2CZGA 4DZZA 2VQFB 2O52A 4WN9A 4OHZA 5NULA 3SK0A 1T9GS 1NU6A 2CLCX 3FF4A 3CG0A 2WICA 1DMRA 1HZZC 4HBZA 3KPEA 2QI9C 3GC6A 2ZRIA 4GVXA 3D3KA 4RY8A 5ALSA 3E5HA 1SR8A 3BEDA 1AHNA 4MEBA 2QXYA 2VDOB 3HJFA 1V6SA 3CNHA 2R1ZA 3EHDA 1YGYA 3OT1B 3G5LA 5KTKA 1HBWA 1GHTA 1CUJA 1J39A 3AR6A 3RQIA 1NTME 2FVXA 4JGBA 2GEDA 3CU5A 4BB5A 5HJ7A 2CXPA 3DMTA 3IBSA 4RD4A 1FZTA 1XNJA 4WOBA 2XJ9A 3UG7A 5E1DA 3ASVA 5IXJA 1T8UA 1PJ4A 4EG7A 2XF2A 2OK7A 1IXMA 3U4IA 3AP2A 4Q9DA 3R7WB 4DT1A 2H2DA 1U94A 4UCSA 1K7FB 3EZ7A 3T52A 4PCUA 3M06A 1T9CA 5LYJB 1F4MA 1L4KA 2XBUA 3IXMA 1FSFA 1NTZJ 2HU5A 1INLA 3T4ZA 4H44D 3T97A 3LTNC 4ZZ1A 3NVAA 1AKWA 3ZG6A 3DV2A 1W49A 2FWBA 4QUJA 2ZPAA 1DB3A 3PI6A 1MAHA 5DGCA 1HYQA 3OD1A 4FQ7A 5GAJA 1UK7A 2XVXA 1CRPA 2YXPX 3KXKA 2XADA 3GJYA 1MIOA 2QNBA 4CM1A 2PT9A 1XPRA 2IS6A 4ILEA 1P9LA 3F67A 2Y93A 1XDBA 5CFPA 5B1IA 1DBSA 1R37A 1IN4A 4DPMA 1SK8A 2BEZF 4U2EA 1WKVA 1AVTA 4DOJA 4LJ6A 1UIIA 2E42A 2C7OA 3A31A 1T0IA 4YIHA 3D3QA 5K4HA 1G9TA 4M8SA 4CR6A 3KR2A 3C6YA 2FUG1 1GNRA 2B7BA 4JLNA 1NFFA 3OE7G 1B26A 3EC1A 3ZCPA 4U7FA 4W8GA 2OCHA 4XB1A 3A37A 1JHAA 3RVOA 3ASNB 1FUYB 1SK9A 2IX3A 2XA9A 1NN0A 1N6HA 3K8OE 3E35A 2DPGA 3F8TA 1I7NA 2GJAA 2YO2A 2YZMA 3HE5B 1EHYA 3L7CA 3TX2A 4PQYA 2WHPA 4YAOA 1WXWA 2CK3G 4UE2A 4AM8A 1BWRA 1PG0A 5H70A 3AJEA 4FNOA 1YONA 3ICPA 1L5HB 5IZ4A 4G27B 3AG7A 1VYHA 1SXQA 2EGGA 2JWDA 3G1TA 2AZMA 1K68A 2QEQA 2J58A 4MVJM 1Q12A 1E6EA 4P54A 5KWEA 2W6JG 3WLFA 5ARBA 1Y98A 2GI4A 4EB6A 3L8FA 3F98A 1H66A 3RRZA 4FLXA 1FFWA 2H3HA 5LBUA 3U1VA 3CUSA 3EY9A 1YD7A 4TL7A 2BONA 3OE7A 3QKRA 3RQSA 2WSEH 1NURA 2GEBA 4Y2TA 3VOBA 4XUDA 2O3UA 1K5QA 3W8DA 5FBKA 4EL0A 1EI9A 2JI8A 2H31A 4LE0A 4R1SA 1KYOI 1QCEA 1VQ9P 1CS0A 5BYKA 3NEPX 5FHRA 4PXAA 4FLMA 3N8NA 2WV7A 2PZBA 4LX8A 4H18A 4Q9JA 2IZZA 4ND7A 3D2LA 1R27A 2CK3A 3KYDA 3HY4A 4LYHA 1OI3A 3AL3A 1GN8A 3SR2C 3GF4A 1WZEA 4KIJA 1E5XA 3VP9A 4IDOA 3R9KA 3BCCD 2WUWE 5JCXA 3OJFA 3AJAA 3ZS8A 2DEUA 4X7MA 2A0WA 2W6JA 4UKDA 4PRKA 5EJ5A 5D7NA 2HDNB 4M4SA 1KOLA 3RD5A 2W11A 4P53A 3RC1A 1ZH6A 5AUPB 5K0GA 3TOVA 4ZKEA 4W9NA 5IUJC 2AI3A 4ZQIA 3W8FA 4BXLA 2HJDA 2WRZA 3I5UA 4ZZ0A 5AQEA 4OHYA 1I3LA 2YJ3A 1CG6A 3KJIA 2BF4A 3DSRA 1TZKA 1NDQA 2GZAA 1FLAA 4M9RA 1XOIA 4C3UA 3CRAA 3PQ6A 4RGVA 3D0RA 1B74A 3A0UA 2HJHA 1JXMA 3L1UA 1TB4A 1R4MB 3NDPA 3LWBA 2QM4A 5A3RA 1GL2D 2HJSA 4EPVA 4KAXA 3FCCA 1A5AB 3S81A 2ST1A 3KVYA 4B7AA 3FDJA 3PR1A 4XYGA 2JIRA 3LLVA 1IC2A 1ORIA 3WO0A 3U2QA 2HDOA 2IHYA 3ZE2B 2WD9A 5GY7A 2BCCD 2IIQA 4DHWA 5KIAA 2W83C 3S3WA 3CC7V 2CPSA 3CGWA 4DCGA 5G3YA 1OLSA 2Q6VA 4HATA 1U7HA 4I08A 2V45A 2CVFA 3ZMSA 3GBSA 3E8MA 1NBIA 5H3HA 3GUHA 1KDRA 3H0KA 5J2UA 2QGZA 3M6FA 4QYWA 2YMKA 1NRXA 1F6WA 4AKHA 5F3RA 4MTOA 3IR7A 4TQDA 1F48A 5ICSA 1PT8A 5EXDA 4X54A 4CS2A 3RROA 1E2PA 4JAVC 4P84A 2KMLA 4OLJA 1C1DA 2CGNA 3H3FA 3APQA 1WP8A 5LBQA 3ULKA 2CZCA 4PZLA 2H1WA 3TLZA 1QGED 3OZXA 1YRAA 1ESDA 3VQVA 2PX6A 5FFMA 1S4QA 1X39A 1P84I 5APVA 2C0CA 4J1SA 3KB6A 1QPZA 1Z35A 3R3HA 2C2HA 2JA1A 5I7WA 1XDCA 3O91A 5BN3A 1CQPA 1IUPA 1E7SA 2A9OA 2VJMB 4KFSA 3DFZA 3OFSA 2VLIA 4GPD1 2BTEA 1MH9A 2QT0A 4R69A 3ZW9A 3EASA 3JQ6A 2HA7A 5L40A 3G0HA 4M0KA 5CA0A 2FLVA 1CZQA 3NHAA 1NU1G 3LYLA 2JAOA 3RDPA 3I61A 1OBHA 1PR2A 4FM2A 2AFHA 2NZJA 4PZCA 5IG2A 4DV3O 3IDFA 5SY4A 3OZUA 5JS6A 4RWUA 1R5OA 3EGWA 3IIEA 2AE2A 4ESVA 4HB2A 1FP7A 3O6VA 3WRYA 3FZQA 1DJMA 2XYQA 3HCEA 1G9SA 3U4GA 1GAQA 3UGQA 2P4HX 1QRUA 1RYYA 2EEPA 5ER6A 4JVLA 3GT4A 1FRQA 2FSGA 4S1NA 4NB5A 3ETGA 2GJKA 3QPWA 3O8DA 2W9XA 1V35A 4M0PA 4GODA 2GHIA 5CBHA 3LK6A 4AP9A 3OHMA 5ESDA 2CLMB 3TMAA 1NMZA 2PGIA 3LRTA 4XJSA 4Y28J 4HLDA 1KI2A 3TDMA 2B4TO 3FOEC 3SF8A 1KRHA 3LYHA 3I45A 4XGRA 1AP6A 3LVBA 1Q0RA 5BQ5A 1L2PA 2GD6A 1TPZA 4PX3A 4OEHA 3TL3A 2J9XB 3PC2A 2WSIA 2WUVA 2WSYB 1VMGA 2O20A 4ZO9A 3LPNA 3BD8A 3PFNA 4JKYA 3T1YB 4IZ6A 4IKPA 3N74A 6Q21A 1QS0A 4MINA 2CL0X 4KB5A 4ZVUA 3K0SA 3TGUE 1FXKA 1REQA 1FOEB 4G36A 2HSEA 4MA5A 1QOPB 2HWKA 1EE9A 4NJOA 5EY5B 3LCMA 5BURA 3IRUA 4V0MA 4U5XA 1LC0A 5SV2A 1H8EG 1SQPH 4KXNA 4OMDA 3IAOA 1RIFA 1QE3A 4P93A 2OYIB 1YZNA 5B58T 1M2KA 3G5AA 3TRHA 2NWQA 4GE3A 3HADA 1T2AA 2PUWA 4DV6O 3JQQA 1SXPA 3K0FB 1ZM4A 2WYHA 3L37A 3AHHA 3GLIE 3UB3A 3VA7A 1HF9A 4N8SA 5EJMA 4BW5A 5KQLA 4B47A 5DKFA 4WCFB 3JSVC 3WTBA 3OQHA 1RBYA 5JNWA 3N5KA 1MAWA 1NYQA 1NP6A 4HAWA 3RK4A 4B43A 1ZCFA 4JB3A 5LZ7A 4IUCS 1XEWX 4WKOA 4ZAFA 1HORA 3CPHA 1R5LA 1M1KW 3W6NA 2Z8YA 4KR9A 4FKMA 5F5LA 3MC1A 3USES 2K7FA 1H8EA 3KXDA 4EL5A 2KK7A 1JIUA 1V7ZA 4NHOA 4JA0A 1O8BA 3P8ZA 4NNOA 3IAYA 1RIIA 4XGIA 4NR0A 3HYLA 3PEFA 1QMPA 1M2HA 5LN1A 1QLJA 3MOSA 3CRCA 3EZLA 1RWPA 2HUPA 5CFLA 3U0ZA 3VTZA 3Q2OA 4L4UA 2EW2A 2WD7A 1DH3A 2HMUA 5KC9A 3O4VA 3U4HA 4ACBA 5EQTA 4JBYA 3CRRA 2IM9A 1PNTA 1ZD1A 1OW6A 2R5NA 3BT7A 3I6YA 1Z38A 1WCXA 3EUWA 4WESB 4ENPA 3ECAA 3PFGA 1NO4A 1SQ5A 1YS2X 3EQ9A 4IO1A 1RYMA 4YMGA 4OHVA 4E5MA 4PHZA 3CC4P 4OPMA 3ZWMA 5BSWA 2Q5JA 5DB4A 1ZC3A 1JHDA 3P5SA 5K3DA 3D8NA 2A79B 2A4MA 1M5RA 3K9CA 3DEJA 3E9DA 5EHQA 3ACCA 4RCZA 4WJLA 1KJZA 4BWGA 1T35A 3PUYA 4L1KA 2O8CB 2RHGB 5DLEA 5HUQA 4N78D 1Q7BA 3ZH9B 4HAVA 3WGMA 5CA1A 2Q7CA 1DKUA 1BVYF 4CQMD 4HQRA 1PSDA 1N73C 4I4CA 4YFYA 2LWIA 4KIUA 1U6IA 4MW7A 3D5EA 3JRWA 4URYR 1XPJA 4OP3A 3WLHA 2R2GA 4J75A 4PLCA 4KQIA 1QGZA 4NDZA 3HSSA 4GOEA 2WJ6A 1BOOA 1G2IA 3E2EA 3ADOA 3CLTC 5KLVE 3TZEA 1S01A 1L5GB 3DAFA 3F9IA 2HHAA 3AFHA 1XTVA 1U2DA 1HLDA 2RGXA 1M1JA 3R3UA 1KQFA 4LOKA 2FN9A 2BSKA 4DV5B 1F0YA 2C8KA 3AG4C 4DMKA 5IRCD 3IX7A 1IJFA 2R6CA 1YDXA 1WB8A 5AKKA 1QVFU 4N0MA 1MZEA 1F51E 1JU9A 4P83A 4U7JA 3AEQB 1U97A 3SDBA 3IR9A 2P9TA 5A5VA 4KIGA 3O1LA 4OOFA 1LI5A 4L50A 3GRVA 5CDUA 4HQ0A 5L3QA 1SY7A 3LXMA 1Z0IA 3JWEA 2BSAA 2RI1A 2EARA 1CUYA 3QF4A 5ALPA 3PYLA 2QMEA 3UMVA 1W8IA 2NPIA 3PQ7A 4EMBA 1N0IA 3RRXA 1JQDA 3FY4A 1LUVA 4EF6A 2PTHA 3A26A 4LJ5A 4OYRA 4NDNE 2XNKA 2YFQA 2G1JA 3WLAA 1V47A 4N6GA 4Y7CA 2V7VA 2MW2B 5AVYA 1SH7A 2IYEA 1YF3A 4C5BA 4O4JB 2VPWA 4K1LA 2BGIA 3Q15C 3V4WA 1S8NA 2XR1A 4YRJA 2VSXA 2G1KA 1PL7A 1WAZA 4O4IA 1B0AA 1OV4A 4YFVA 3CCVV 1VTKA 4UEWA 3H1KE 1KETA 4CIXA 1AKRA 1UFOA 1E2EA 3S3XA 3WYDA 3L0IB 3K9GA 1MJ5A 4POOA 1Z39A 1OFCX 2O1XA 4ER5A 1P4JA 3BJRA 1ZXXA 3L93A 1NTKH 3TNJA 3CP1A 3BTSA 4Z0TA 2BEKA 2BOBC 4Q3OA 2X6RA 5EGNA 3D8BA 3ETCA 5A3JA 4HX5A 5KYUB 2R8YA 2QPAA 3EIWA 1T25A 1SHTX 4MMYB 3CIOA 3OEED 1N3BA 4HUJA 2GAIA 3G7NA 1T3JA 4XR9A 1MO2A 1H8HD 4K40A 4IWXA 4H13D 2NYUA 3H9CA 1VCIA 3CMCO 3SBDA 1EG7A 3H2JA 2DSNA 1L4AD 2C2WA 1C9MA 3D8UA 4B33A 1YVUA 4M1YA 2WJGA 5LCXA 5EP1A 4YV7A 3TVTA 3NG1A 4GZ3A 3A9WA 1DD3A 1DBRA 2HCFA 3OM0A 4QVKA 2IZOA 1FDTA 1K4YA 3S1LA 1Y82A 2OB1A 2QUIA 4YQFA 3OHSX 4KVAA 3ZGLA 2WF7A 4YP5A 1O1YA 2E89A 1P1HA 5EWMA 4DNQA 3QV1A 2G0TA 2NU8A 1YMQA 1FTWA 1C8VB 1VQ6P 3OT4A 2NAFA 4DCTA 1IBSA 4RA6A 3CMEV 1CTQA 5ADWA 1U9IA 1JKFA 2B9ZA 4W5QA 4MJ3A 2V3CC 2P4QA 1IG0A 1VSVA 3UYKA 2G17A 2PIAA 1JG1A 4FHFA 5JROA 1IDN1 2XVMA 5AKEA 1QQTA 3R0JA 1ZAUA 2WZQA 4K46A 3HNRA 3QITA 4NENB 2RGBA 2WWGA 3OPYB 2WMDA 2VP2A 2ZT6A 1J0AA 3AR4A 5AHRA 2PLWA 2L82A 4YCBA 5L3FA 4JI3O 2B7CA 3TXAA 3JCZA 4JN6B 4DR1B 1E9EA 5E38A 1ODSA 1SQPG 1E2HA 4LXXA 4ZEVA 1G63A 4TXNA 1B6TA 5IT9A 4NONA 4C0LA 2ID8A 2LUOA 3ELDA 3V2GA 1CCWA 5FBRB 4TS9A 4IIJF 2O6HA 5JS7A 1ZOLA 1Z4JA 2NQ2C 4AZ3B 1GRVA 1IMOA 4LJKA 2PSSA 3GLKA 1E79D 4K3VA 2B37A 2E7ZA 2XHEA 4A3SA 2IYAA 2O1EA 1PP9G 1XTKA 5K0SA 3F6EX 3PNMA 2VWJA 1Z0FA 1T36A 4XUEA 2CXOA 1H4TA 4HMQA 4PXSA 2LDXA 4ED9A 3CLUC 2KJQA 3QSYA 4P5PA 3PC8A 4O1MA 1UMCB 4DA6A 4C4TA 4H1TA 3QBEA 5A4AA 2O1WA 4H1VA 1SQVG 1PRYA 5KUMA 4KV7A 1I0ZA 1VQ8V 3LA8A 2I1JA 5J5AA 5UKDA 4LF5O 3UJ8A 3F7MA 3MGKA 4BO9A 3L8HA 4XOIA 4Q20A 4U0JA 1SVFA 1W52X 5IYCO 3IO3A 4KPGA 3VKWA 1Y74A 3KTAB 4MQ4A 3MUDA 4OBEA 2Y1KA 2VDJA 5I48A 2O3QA 4GLLA 3N2NA 3Q1KA 1XG5A 1GCUA 1X13A 1VGVA 3QLUA 1X87A 1W5BA 4ALLA 1UQUA 2VHCA 3UENA 4AS2A 4MIKA 3IBFA 4AMUA 5K3EA 1TEVA 1P18A 4PDVA 1FNBA 2WJHA 3WZLA 4IILA 4RV4A 1X8JA 2SNIE 4R31A 3BRWA 1RU3A 1EHCA 2NXCA 4CR7A 5JNSA 3ODPA 1K73Q 5F76A 1F0KA 1J25A 4PLTA 3HDVA 2K87A 1GL6A 1IX9A 2HU8A 3VMFA 3TYYA 2VQDA 4TLBA 4OFXA 2C2BA 1ZPDA 3CRNA 3MCVA 3MZWB 2XWSA 1SVKA 1A04A 2I5PO 2O5VA 2K9JB 1ITZA 2YUTA 2HIGA 4C7UA