1KYOI

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
53
structure length
53
Chain Sequence
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKAKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 17
structure length 53
sequence length 53
chains with identical sequence T
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1kyoI00
1P84I 3CWBJ 1NTZJ 1SQVJ 3H1KJ 3L74J 1BGYJ 1KYOI 3L72J 1BE3J 3H1IJ 3BCCJ 3L70J 4U3FJ 4D6TJ 2BCCJ 1EZVI 3TGUJ 3CXHI 3H1LJ 1L0LJ 4PD4I 1SQPJ 2IBZI 1NTKJ 1BCCJ 1NU1J 3L75J 3L73J 3H1HJ 5KLVJ 1NTMJ 1SQXJ 1L0NJ 2FYUJ 3CX5I 3H1JJ 1PP9J 1SQQJ 1SQBJ 1KB9I 3L71J
chains in the Genus database with same CATH superfamily
1KMIZ 1SQBK 2QJKB 4NPDA 2Z5HA 2FKWB 2Q3EA 1L0LK 1JCCA 1KB9H 1LNQA 1TU3F 2CPBA 4N78E 4TLFA 2JP3A 3CX5E 3L72J 3N4XA 1VL2A 2K9JA 1RF0A 1SFCB 3VMYA 3Q3DA 1K73Q 1SQXK 2JO1A 4GKGA 4WB4A 3M06A 3CCEP 1R5LA 2YXQB 1KILE 3L35A 5KLVE 3G71P 5AW8B 3CMAP 4N3YB 1VQOP 1Y8AA 3A5TA 1GDTA 2M8RA 1BE3G 1YQ4C 3CD6P 3BRTB 1N73A 1JY2O 1PP9E 2JDIH 1L0ND 3L73G 1SQVK 4O9BA 3TDKA 5AW4B 1NWQA 2IYOA 3V5BA 4DJGA 2M3EA 3FWLA 2WT7B 2OYIB 3LIEA 1LWUB 1N7SC 1SQXD 5K5GB 1LJ2A 1KORA 2FYZA 2IPPA 3AE3C 2FYUK 2ZYDA 3BCCE 4Y28J 1AA0A 1X0TA 4KHXA 3CC2P 1HJBA 1SQBG 1IFIA 1OVRA 1T8ZA 4WY4C 4ZMDA 2WSCH 1YTZI 2N1TC 1NYHA 1S5LE 2ZFCA 3AEFC 1PPJD 2G3AA 3RBXA 2KSEA 4JYCA 1FDMA 2IX7C 1Q86Q 5GTIE 1URQC 2FYNB 3RK3B 5E79E 1M1JB 1NKNA 1KYOD 4I7ZC 3RK2B 3JC22 2YO2A 5M1BA 2PRRA 2W6AA 1XTGB 1KYOH 2P2UA 4WVZA 2R44A 1T2KD 1GK4A 2QRXA 2WSFJ 5AW5B 3ZDMA 4XE5B 3SWFA 5AVYB 2Y0EA 1J1DB 1FZAA 4I1LA 1JB0J 1K9MQ 2ZYGA 1AQ5A 3H32A 1Q7YQ 3KZIE 1IJDB 3CWBD 3I5CA 4ASVA 2OTLP 2HODB 3IN6A 1JY3O 1KQGB 2YKPA 4R4LA 1SQQJ 5CMZA 1S5LX 2FFDC 1QVGO 2KNCA 2QE7H 2AXCA 4OGQD 2HYNA 5APTA 3WUTA 2C9LY 3RGUA 5APXA 1EC5A 3L70G 3TNUA 1GZLA 1NTZE 1RE3C 1R5SA 2M0BA 3HUSB 4D6TD 1X9VA 3D6ZA 1KQLA 3CI9A 1S5LH 1VQ4P 1BSNA 1RE4C 5C39A 2K37A 4GIFA 1KB9D 1FDIA 3AE9C 3CXHI 1VDFA 2POHA 1W2EA 2AXTH 2JR8A 3L37A 5AVUB 2YIUC 5TISE 3RK2D 1DEEG 3VN0A 4EOTA 1NU1G 3A2AA 3VMZA 1NO4A 1VF5D 1NU1J 1JY2N 5KKZB 3RBZA 1U7MA 1NTMJ 3BCCG 3M0DC 1J2JB 2WWWA 3S1KA 1D7MA 2WSCJ 4K35A 2OTKE 1X22A 3G6EP 1KD1Q 4RO0A 1QVFO 1CW5A 3G4SP 1IC2A 2KIKA 1Z56A 2KLUA 3L75E 3G9RA 1FBMA 1NTZJ 1RE4A 1JTHA 1RQUA 2E74D 2M5AA 2OGUA 3C8VA 4WWIA 3C1LA 1AQTA 1LWUA 4U3FG 1DH3A 5KAFH 1W2BO 5AVXB 1YQ3C 2QJYB 1L2PA 3PH0A 4ASWA 1FJPA 1EXIA 2SPZA 5H2FE 2ZXEB 3H1LJ 3HD7B 1H89A 5KAFE 1FZFA 5CCGC 1P84D 5E79H 1GU5A 1NTZG 2H7HA 2E5YA 3L75J 4JQ0D 2ZXXA 3H1HD 3L73J 1SFCD 3VP8A 3CCRP 3D70A 1RH5B 2IZ0A 4Z1MH 1RQVA 2HG5D 1RF1B 1KZUB 1KQFB 1QGKB 3M9BA 2ZAEB 2IBZD 3WMM0 4HYTB 1A02J 4DOJA 2WSSH 3CXHD 3O8ZA 5GTIH 2FXOA 3MZWB 4IL6E 1PV3A 5CCHA 1BCCG 3L4FA 1EZVD 3FGAD 5KTBA 1NTKG 4AYCA 4C7NA 3H1ID 3H1HG 4H0LB 1SQPE 3M0AA 4OH8B 1OW6A 2N1TA 2KOGA 3H1LE 3L74E 2YIUB 1ZV8A 2B9BA 3RL0B 4L76A 2ZT9B 4LGDE 3SWKA 1EZVI 3VTPC 2K1AA 1N7LA 2KNCB 1L0NE 5APSA 3VOPA 2Q7CA 1JTHB 1SLQA 2M5AB 4W7ZA 5B5EE 1GU4A 1AVOA 1OVVA 1ZP0C 3VMAA 3VYIA 2AXTE 2KZIA 2YKQA 3AEGC 1HTLC 1NTMD 5APQA 1K04A 1GL2C 2PFXA 3NMDA 1ZN5A 3HTKB 4MN4C 5APUA 1KYOE 2ITAA 3QH9A 4AQRD 4UB8H 1JM0A 2OYHA 2BEZF 1EDKA 2E76B 4IFDK 1MKMA 3L73D 3H1KE 5AVSB 1N86A 3BRVB 1RF1C 2DW3A 2NZ2A 1AV1A 2FYUD 2LR2A 2OQQA 3FWNA 3K5BA 3L72G 3LW5J 4GOEA 4H13D 4RKUJ 3WU2H 3GHGB 5BU5A 1FZCB 4IFMA 4GDOA 1JOCA 2Q9IA 1RY3A 3L36A 3AE7C 1URQB 3II6A 5GTHE 1YHQP 1IFPA 1BE3E 5DJUB 3E7KA 3L71E 3TGUG 2WTYA 3R2PA 1IFMA 3L72E 1N2DC 2FYNC 2P67A 4OGQB 3FX0A 1N73B 2NPSC 3L75G 5AW1B 3F5HA 1SQVG 2HLOA 2XZRA 1VPCA 2O1KA 5AW6B 4H0LD 1WT6A 3CWBE 1FDOA 2N1TB 3IR9A 4C7NB 3MHVA 2XKMA 4W7YA 1JO5A 1IFNA 2Q6QA 3Q5PA 3HRNA 2N1TD 5KAIE 4I6MC 3CX5H 1UIXA 3OW2O 3IAOA 3RL0C 1IK9A 1PL5A 3CC4P 2E42A 1NH4A 1W5CE 3EWKA 3L71J 1OIPA 1Q90D 1GMJA 2Q5UA 1WRGA 3H1IE 1HGZA 3A7OA 3AECC 3CWBG 4RJTA 1RF1A 2OYIC 1M1JA 4N78D 4U3FD 4IL6H 2Y9YA 3BCCJ 3GF3A 3JSVC 4IL6X 1NTMK 4HKZH 1YI2P 2IYPA 1KV4A 2QA4P 3PTZA 1S3JA 4L75A 4H44C 4UB6E 2H88C 3H6PA 2YO3A 4ZKPA 4AUWA 1KFNA 2I1JA 1VQ7P 3SFDC 3A0BH 3H1LG 1H8AA 4TT3H 1WMKA 2QSIA 3AE4C 3MD0A 3RL0g 1P84E 1IO4A 1FU1A 1NTKK 1H0TA 3AE2C 2HR3A 3H1HJ 3P8MC 1EQ7A 3OA7A 5BU8B 1DIPA 2WSEJ 4C46A 2E74B 1NTZD 1FZGA 1DX7A 1NU1D 2E75C 3AE6C 3TK1A 3I56P 1H0TB 3UIAA 1ZW0A 4DT0A 1AFOA 1R8EA 1AJYA 4NPEA 2J59M 1DD3A 2KYVA 1VQKP 1J1DC 1XTCC 4YPCA 5BVZA 1KYOI 1ZMEC 2QJPC 4HB1A 2AEFA 3JCUH 2O3JA 1L0NG 5AW9B 1N73C 2VRSA 4PJ0E 3RK3C 1FC2C 1H88A 2E43A 2N9YB 2WZ7A 1G2CB 2I8DA 3KXDA 5KJ7C 1HWTC 1VQLP 1EXJA 3H1HE 3TGUE 2WPVB 2QJPB 2BASA 4N6JA 4YXDC 2IDBA 4PJ0H 3HUSA 1SFCA 1FZCA 2CK3H 1EDIA 1S9KE 5B5EH 1PGPA 4GOFA 2A06E 5AVZB 3CMEP 1GW3A 1GTWA 3H1JJ 3D71A 4M3LA 2P10A 2P7JA 3P32A 4OWFA 2C0XA 1SQBJ 1VF5C 2A45I 3CL3D 1SS1A 1NU1E 2FBWC 3HE5B 3E1IA 3B4SA 4JPZB 4EI2A 3P8CE 5CCHD 1M1KQ 1NTME 2ZVNB 1KQSO 1MUUA 4UB8E 3KYQA 1OVUA 5CCGA 1FOSE 1NHLA 2ZVOB 2HFED 3H32B 1EZVE 2B88A 1BGYE 1PGQA 2C0WA 1QEXA 5B66E 3HUSC 1YJNP 1LTJA 4PV1B 1SQPD 2E74C 3TGUJ 4K3AA 3VMXA 3CPWO 3CCMP 3H1LD 1NJIQ 1G1IA 1LGHB 1T3UA 1FZBA 2M3BA 2XV5A 4U7JA 3H25A 1VQ8P 2OTJP 2KI7B 3V6IA 2BCCE 2FFDA 3GLMA 1SQBE 4U3FE 1X8YA 3S4RA 3GF7A 3AE1C 1FE6A 1SQQD 2XU6A 2IBZE 2LXBA 3G3ZA 1BCCE 2W6JH 3IF4A 1NTMG 1SQVD 1LTGC 1M90Q 1OFCX 2XNDH 3MUDA 1RE3A 2KLVA 3HD7C 2A45G 5CCHC 2KK7A 2KP8A 3AE8C 4L73A 2E76D 3L73E 4B86A 1VQPP 2CPSA 2OYHB 1PFIA 1HGVA 1K8AQ 3L74J 2A06G 1L4AC 1YYCA 2FY8A 3GMAA 5KLVK 3LW5H 3RL0D 1JCDA 2WT7A 3C9IA 2QM7A 4U3FJ 4KJMA 1MZ9A 1JY3P 1ZXGA 1IK7A 1PGJA 1ZRTD 3BCCD 3PP5A 1OX3A 1S2EA 1ZOYC 2Q3IA 3L72D 3AEDC 2H43A 1BDCA 3CLQA 4Y99C 4JBZA 3FXDA 3PJSK 2WQYC 1YTZT 2FXPA 2JWDA 2K88A 5AW0B 2R5BA 1S9KD 1SQPJ 2IBZI 3H1KG 1BCCJ 2MKVA 3L74G 2O1JA 3BATA 2QG4A 3GHGC 3LIDA 1FZEA 1HJ0A 2E75D 2K9JB 3GG2A 3KPEA 3MP7B 4LLHA 3TYYA 1L0NJ 4EDFA 2R5DA 2Y9ZA 1LWUC 4W80A 3I55P 1L0NK 4PD4H 5AVQB 2XDJA 3AEBC 1BE3D 1T6AA 3GW6A 5CBOA 1KC8Q 2YMKA 2BEQD 2K9YA 3NTNA 2IZ1A 2O01J 4BXLA 1CZQA 3HD7A 2RH0A 3MGNA 2QVAA 1IZNB 3NXSA 1M8OB 1QLED 1USDA 5KLVG 3PHLA 3PLNA 1HF9A 1T3JA 3MUDC 4PV1C 1M56D 3L70J 3HTKA 3H1KD 3WU2E 4EYYQ 4H0LC 3L74D 3B5NB 2WSEH 3M9HA 3MIWA 1MFZA 1ZRTE 2ZYAA 3L71G 2ZT9C 1L4AA 1QL2A 2E5TA 2P58A 2YXRB 5L8RJ 1IFDA 3W68A 3WUVA 2QM8A 1KN7A 1VQNP 2N9BA 5CCGD 5CHXA 3B5NC 4PD4E 4OVNF 2V7QH 1CSBA 1KILD 5KLVD 1LTTC 3H1IG 3KHUA 5AVRB 1LTAC 1NTKD 1YJ9P 3V2NA 2KS1B 2QJYC 1PP9D 2HPCB 5GTHH 1JMBA 1NAYA 2Z5IA 4Y99B 3Q5RA 3BVHA 1HBWA 3CWBJ 1M57D 1K05A 4YXWH 1SQQE 2J58A 1SVFA 2JKVA 4H44D 1Y9BA 3SFEC 3V2PA 4KT0J 3WUUA 4BRYA 2BCCD 5APWA 1FZCC 1SQXG 2Y0DA 4C7RA 1VF5B 2KXPB 5AW2B 1USEA 1VQ5P 1HVVA 4I7ZB 1NVOA 3QWOC 3RK2C 3V2RA 1GD2E 5AVTB 2WPQA 2KSJA 3CCJP 2HPCA 5AW7B 5AVVB 1NKZB 1YITP 1SQPG 1RF0C 2G8YA 2P1JA 4PD4I 2WSFH 1PPJE 4XA4A 3SSUA 2GM4A 1KILC 3U1CA 2PGDA 5H2FH 1GL2B 4HH2A 3U59A 3TNUB 5CJ4A 3R4YA 1J1EB 2W8ZA 4JYBA 3S9OA 5EFWB 1LTBC 2FYUJ 1SQQG 2O01N 2B87A 1L0LE 3HE4B 5KLIB 1GL2D 1GL2A 1NOHA 2FYUG 3M9QA 4YTPC 3CC7P 1PIXA 1MFTA 1KB9I 1FOSF 1BSHA 2IFMA 1P84I 1Y47A 2H89C 2W83C 3B5NA 3B8EB 4WBAA 3T97B 1LP1A 1JUNA 2AEJA 5KJ7A 1PGOA 1QL1A 1HH0A 4H13C 3CCVP 3TGUD 1SQVE 4WY4A 3CX5D 1KILA 3OAKA 2WMMA 1OZHA 2A06D 1NAFA 1P84H 1LT1A 3GHGA 4IOIH 5AVWB 4H44B 1BDDA 2L5GB 3NFQA 3JCUE 1L0LJ 2R32A 4H13B 2D2CD 3RK3D 3CCQP 1CI6A 1E5WA 1OWAA 4JF7A 2RN0A 2FYUE 5TJHA 3V2QA 1YIJP 3D6YA 4OGQC 1MV8A 2NRGA 4QMAA 1DEBA 4D6TG 1KILB 3H1JD 1KB9E 1ZR2A 1M1JC 3IFMA 3OJAB 3KQGA 1SQQK 5APYA 3V4QA 3V4WA 1UIIA 2QIWA 2NPSA 3Q5SA 1J1EC 1LTSC 2B89A 1GK6A 2LXCB 4R4MA 4CPGA 5KLIC 4ZNCA 1IFJA 1SP4A 2IBZG 3B71A 3O6QB 1LTJB 1SQVJ 1L4AB 2PAJA 3MTUE 4NPFX 4PD4D 1YJWP 2RKLA 2ZT9D 3F89A 1YBKA 2YMYA 3H1JE 4L74A 2HODA 1NGMB 2J5UA 3M91A 4EIJA 4D6TJ 1S4XA 2W90A 1AVYA 2FXMA 2IFNA 1M7LA 2KB7P 1EZVG 2WPRA 2D2CC 1BCCD 1LT9B 1N7SA 1N7SD 2A45H 3EFFK 4DCKA 3HE5A 2R3SA 2Y0CA 3B5ND 1NU1K 2WITA 3FXEA 3TSIA 3Q2YA 1KTMA 2E76C 1E79H 1JY2P 3ABVC 4WY4B 4WY4D 2ZJSE 2GA1A 2E75B 3CX5I 3TF5A 3Q1MA 2KZJA 1OW8A 2L91A 3A0HH 4A7PA 1DD4A 2GUVA 1G1JA 3M0DA 1BGYD 1GW4A 2KUBA 2W6BA 3AE5C 1G2CA 3KDPB 1SQBD 1FJKA 1PP9G 5KAIH 1FS0E 2RMZA 1EDJA 1JMMA 1SQPK 3HD7D 5AW3B 1OW7A 3H1KJ 1LT9A 1N7SB 5CJ0A 5B66H 5DJTB 4D6TE 1A02F 2B87B 3P8CD 2QJKC 4UB6H 1T2KC 1S72P 1JY3N 2H8PD 2BCCG 3CXHH 3A0BE 4HJGH 1Q2NA 3U1AA 5APVA 2NPSD 2OYOA 1L4AD 1L0LD 1OXZA 3O6QA 1Q82Q 1VQ9P 1X79B 3PRJA 3AEEC 3W67A 1BGYG 3CXHE 1NTZK 5KJ7D 1NTKJ 1PZQA 3USSA 1URQD 2GUSA 3A0HE 1URQA 3VP9A 2UWJE 1EDLA 1RHZB 1N8RQ 1U57A 1LTIC 1SQXJ 1JNMA 2V7QJ 1U7JA 2WPSA 3CCSP 1VQMP 2WVRA 4BRYB 1QX8A 2Z4EA 3RK3E 1OMIA 4XFJA 2D2CB 2FFDB 4I2LC 3P7KA 1SFCC 2XNXA 1L0LG 5CBNA 1VQ6P 3KZIH 2YKOA 3AEAC 2O01H 2KS1A 1BGYJ 2Q1KA 1HUCA 4IFFA 1FAVA 5TISH 1ZLLA 3L70D 1LT9C 3H1IJ 2JWAA 2OYIA 4ZKUA 1PPJG 2PP6A 4LC1A 4BWNA 2BCCJ 1LP1B 1Q81Q 2W27A 1JEKA 1NTKE 2NPSB 2V4HA 4RESB 3T97A 1KFMA 4PV1D 3CCLP 5KKZC 1ZR4A 3E1RA 3A3YB 3EFGA 1S1CX 3HE4A 3L70E 1SQXE 2I1KA 2QEXP 4GODA 4DZOA 3ITKA 3SWYA 1LTJC 3H1JG 5KLVJ 3CCUP 2C9NY 2K3RA 2YNYA 1CI6B 2AEMA 2R3CA 2OARA 3L75D 3EQ2A 2LKMA 4GT1A 1PP9J 2JJLA 3N7NA 1BE3J 3L71D 3BASA 2OYHC 2MJZA 2JEEA
chains in the Genus database with same CATH topology
1P84I 3CWBJ 1NTZJ 1SQVJ 3H1KJ 3L74J 1BGYJ 1KYOI 3L72J 1BE3J 3H1IJ 3BCCJ 3L70J 4U3FJ 4D6TJ 2BCCJ 1EZVI 3TGUJ 3CXHI 3H1LJ 1L0LJ 4PD4I 1SQPJ 2IBZI 1NTKJ 1BCCJ 1NU1J 3L75J 3L73J 3H1HJ 5KLVJ 1NTMJ 1SQXJ 1L0NJ 2FYUJ 3CX5I 3H1JJ 1PP9J 1SQQJ 1SQBJ 1KB9I 3L71J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P84 I;  3CWB J;  1NTZ J;  1SQV J;  3H1K J;  3L74 J;  1BGY J;  1KYO I;  3L72 J;  1BE3 J;  3H1I J;  3BCC J;  3L70 J;  4U3F J;  4D6T J;  2BCC J;  1EZV I;  3TGU J;  3CXH I;  3H1L J;  1L0L J;  4PD4 I;  1SQP J;  2IBZ I;  1NTK J;  1BCC J;  1NU1 J;  3L75 J;  3L73 J;  3H1H J;  5KLV J;  1NTM J;  1SQX J;  1L0N J;  2FYU J;  3CX5 I;  3H1J J;  1PP9 J;  1SQQ J;  1SQB J;  1KB9 I;  3L71 J; 
#chains in the Genus database with same CATH topology
 1KMI Z;  1SQB K;  2QJK B;  4NPD A;  2Z5H A;  2FKW B;  2Q3E A;  1L0L K;  1JCC A;  1KB9 H;  1LNQ A;  1TU3 F;  2CPB A;  4N78 E;  4TLF A;  2JP3 A;  3CX5 E;  3L72 J;  3N4X A;  1VL2 A;  2K9J A;  1RF0 A;  1SFC B;  3VMY A;  3Q3D A;  1K73 Q;  1SQX K;  2JO1 A;  4GKG A;  4WB4 A;  3M06 A;  3CCE P;  1R5L A;  2YXQ B;  1KIL E;  3L35 A;  5KLV E;  3G71 P;  5AW8 B;  3CMA P;  4N3Y B;  1VQO P;  1Y8A A;  3A5T A;  1GDT A;  2M8R A;  1BE3 G;  1YQ4 C;  3CD6 P;  3BRT B;  1N73 A;  1JY2 O;  1PP9 E;  2JDI H;  1L0N D;  3L73 G;  1SQV K;  4O9B A;  3TDK A;  5AW4 B;  1NWQ A;  2IYO A;  3V5B A;  4DJG A;  2M3E A;  3FWL A;  2WT7 B;  2OYI B;  3LIE A;  1LWU B;  1N7S C;  1SQX D;  5K5G B;  1LJ2 A;  1KOR A;  2FYZ A;  2IPP A;  3AE3 C;  2FYU K;  2ZYD A;  3BCC E;  4Y28 J;  1AA0 A;  1X0T A;  4KHX A;  3CC2 P;  1HJB A;  1SQB G;  1IFI A;  1OVR A;  1T8Z A;  4WY4 C;  4ZMD A;  2WSC H;  1YTZ I;  2N1T C;  1NYH A;  1S5L E;  2ZFC A;  3AEF C;  1PPJ D;  2G3A A;  3RBX A;  2KSE A;  4JYC A;  1FDM A;  2IX7 C;  1Q86 Q;  5GTI E;  1URQ C;  2FYN B;  3RK3 B;  5E79 E;  1M1J B;  1NKN A;  1KYO D;  4I7Z C;  3RK2 B;  3JC2 2;  2YO2 A;  5M1B A;  2PRR A;  2W6A A;  1XTG B;  1KYO H;  2P2U A;  4WVZ A;  2R44 A;  1T2K D;  1GK4 A;  2QRX A;  2WSF J;  5AW5 B;  3ZDM A;  4XE5 B;  3SWF A;  5AVY B;  2Y0E A;  1J1D B;  1FZA A;  4I1L A;  1JB0 J;  1K9M Q;  2ZYG A;  1AQ5 A;  3H32 A;  1Q7Y Q;  3KZI E;  1IJD B;  3CWB D;  3I5C A;  4ASV A;  2OTL P;  2HOD B;  3IN6 A;  1JY3 O;  1KQG B;  2YKP A;  4R4L A;  1SQQ J;  5CMZ A;  1S5L X;  2FFD C;  1QVG O;  2KNC A;  2QE7 H;  2AXC A;  4OGQ D;  2HYN A;  5APT A;  3WUT A;  2C9L Y;  3RGU A;  5APX A;  1EC5 A;  3L70 G;  3TNU A;  1GZL A;  1NTZ E;  1RE3 C;  1R5S A;  2M0B A;  3HUS B;  4D6T D;  1X9V A;  3D6Z A;  1KQL A;  3CI9 A;  1S5L H;  1VQ4 P;  1BSN A;  1RE4 C;  5C39 A;  2K37 A;  4GIF A;  1KB9 D;  1FDI A;  3AE9 C;  3CXH I;  1VDF A;  2POH A;  1W2E A;  2AXT H;  2JR8 A;  3L37 A;  5AVU B;  2YIU C;  5TIS E;  3RK2 D;  1DEE G;  3VN0 A;  4EOT A;  1NU1 G;  3A2A A;  3VMZ A;  1NO4 A;  1VF5 D;  1NU1 J;  1JY2 N;  5KKZ B;  3RBZ A;  1U7M A;  1NTM J;  3BCC G;  3M0D C;  1J2J B;  2WWW A;  3S1K A;  1D7M A;  2WSC J;  4K35 A;  2OTK E;  1X22 A;  3G6E P;  1KD1 Q;  4RO0 A;  1QVF O;  1CW5 A;  3G4S P;  1IC2 A;  2KIK A;  1Z56 A;  2KLU A;  3L75 E;  3G9R A;  1FBM A;  1NTZ J;  1RE4 A;  1JTH A;  1RQU A;  2E74 D;  2M5A A;  2OGU A;  3C8V A;  4WWI A;  3C1L A;  1AQT A;  1LWU A;  4U3F G;  1DH3 A;  5KAF H;  1W2B O;  5AVX B;  1YQ3 C;  2QJY B;  1L2P A;  3PH0 A;  4ASW A;  1FJP A;  1EXI A;  2SPZ A;  5H2F E;  2ZXE B;  3H1L J;  3HD7 B;  1H89 A;  5KAF E;  1FZF A;  5CCG C;  1P84 D;  5E79 H;  1GU5 A;  1NTZ G;  2H7H A;  2E5Y A;  3L75 J;  4JQ0 D;  2ZXX A;  3H1H D;  3L73 J;  1SFC D;  3VP8 A;  3CCR P;  3D70 A;  1RH5 B;  2IZ0 A;  4Z1M H;  1RQV A;  2HG5 D;  1RF1 B;  1KZU B;  1KQF B;  1QGK B;  3M9B A;  2ZAE B;  2IBZ D;  3WMM 0;  4HYT B;  1A02 J;  4DOJ A;  2WSS H;  3CXH D;  3O8Z A;  5GTI H;  2FXO A;  3MZW B;  4IL6 E;  1PV3 A;  5CCH A;  1BCC G;  3L4F A;  1EZV D;  3FGA D;  5KTB A;  1NTK G;  4AYC A;  4C7N A;  3H1I D;  3H1H G;  4H0L B;  1SQP E;  3M0A A;  4OH8 B;  1OW6 A;  2N1T A;  2KOG A;  3H1L E;  3L74 E;  2YIU B;  1ZV8 A;  2B9B A;  3RL0 B;  4L76 A;  2ZT9 B;  4LGD E;  3SWK A;  1EZV I;  3VTP C;  2K1A A;  1N7L A;  2KNC B;  1L0N E;  5APS A;  3VOP A;  2Q7C A;  1JTH B;  1SLQ A;  2M5A B;  4W7Z A;  5B5E E;  1GU4 A;  1AVO A;  1OVV A;  1ZP0 C;  3VMA A;  3VYI A;  2AXT E;  2KZI A;  2YKQ A;  3AEG C;  1HTL C;  1NTM D;  5APQ A;  1K04 A;  1GL2 C;  2PFX A;  3NMD A;  1ZN5 A;  3HTK B;  4MN4 C;  5APU A;  1KYO E;  2ITA A;  3QH9 A;  4AQR D;  4UB8 H;  1JM0 A;  2OYH A;  2BEZ F;  1EDK A;  2E76 B;  4IFD K;  1MKM A;  3L73 D;  3H1K E;  5AVS B;  1N86 A;  3BRV B;  1RF1 C;  2DW3 A;  2NZ2 A;  1AV1 A;  2FYU D;  2LR2 A;  2OQQ A;  3FWN A;  3K5B A;  3L72 G;  3LW5 J;  4GOE A;  4H13 D;  4RKU J;  3WU2 H;  3GHG B;  5BU5 A;  1FZC B;  4IFM A;  4GDO A;  1JOC A;  2Q9I A;  1RY3 A;  3L36 A;  3AE7 C;  1URQ B;  3II6 A;  5GTH E;  1YHQ P;  1IFP A;  1BE3 E;  5DJU B;  3E7K A;  3L71 E;  3TGU G;  2WTY A;  3R2P A;  1IFM A;  3L72 E;  1N2D C;  2FYN C;  2P67 A;  4OGQ B;  3FX0 A;  1N73 B;  2NPS C;  3L75 G;  5AW1 B;  3F5H A;  1SQV G;  2HLO A;  2XZR A;  1VPC A;  2O1K A;  5AW6 B;  4H0L D;  1WT6 A;  3CWB E;  1FDO A;  2N1T B;  3IR9 A;  4C7N B;  3MHV A;  2XKM A;  4W7Y A;  1JO5 A;  1IFN A;  2Q6Q A;  3Q5P A;  3HRN A;  2N1T D;  5KAI E;  4I6M C;  3CX5 H;  1UIX A;  3OW2 O;  3IAO A;  3RL0 C;  1IK9 A;  1PL5 A;  3CC4 P;  2E42 A;  1NH4 A;  1W5C E;  3EWK A;  3L71 J;  1OIP A;  1Q90 D;  1GMJ A;  2Q5U A;  1WRG A;  3H1I E;  1HGZ A;  3A7O A;  3AEC C;  3CWB G;  4RJT A;  1RF1 A;  2OYI C;  1M1J A;  4N78 D;  4U3F D;  4IL6 H;  2Y9Y A;  3BCC J;  3GF3 A;  3JSV C;  4IL6 X;  1NTM K;  4HKZ H;  1YI2 P;  2IYP A;  1KV4 A;  2QA4 P;  3PTZ A;  1S3J A;  4L75 A;  4H44 C;  4UB6 E;  2H88 C;  3H6P A;  2YO3 A;  4ZKP A;  4AUW A;  1KFN A;  2I1J A;  1VQ7 P;  3SFD C;  3A0B H;  3H1L G;  1H8A A;  4TT3 H;  1WMK A;  2QSI A;  3AE4 C;  3MD0 A;  3RL0 g;  1P84 E;  1IO4 A;  1FU1 A;  1NTK K;  1H0T A;  3AE2 C;  2HR3 A;  3H1H J;  3P8M C;  1EQ7 A;  3OA7 A;  5BU8 B;  1DIP A;  2WSE J;  4C46 A;  2E74 B;  1NTZ D;  1FZG A;  1DX7 A;  1NU1 D;  2E75 C;  3AE6 C;  3TK1 A;  3I56 P;  1H0T B;  3UIA A;  1ZW0 A;  4DT0 A;  1AFO A;  1R8E A;  1AJY A;  4NPE A;  2J59 M;  1DD3 A;  2KYV A;  1VQK P;  1J1D C;  1XTC C;  4YPC A;  5BVZ A;  1KYO I;  1ZME C;  2QJP C;  4HB1 A;  2AEF A;  3JCU H;  2O3J A;  1L0N G;  5AW9 B;  1N73 C;  2VRS A;  4PJ0 E;  3RK3 C;  1FC2 C;  1H88 A;  2E43 A;  2N9Y B;  2WZ7 A;  1G2C B;  2I8D A;  3KXD A;  5KJ7 C;  1HWT C;  1VQL P;  1EXJ A;  3H1H E;  3TGU E;  2WPV B;  2QJP B;  2BAS A;  4N6J A;  4YXD C;  2IDB A;  4PJ0 H;  3HUS A;  1SFC A;  1FZC A;  2CK3 H;  1EDI A;  1S9K E;  5B5E H;  1PGP A;  4GOF A;  2A06 E;  5AVZ B;  3CME P;  1GW3 A;  1GTW A;  3H1J J;  3D71 A;  4M3L A;  2P10 A;  2P7J A;  3P32 A;  4OWF A;  2C0X A;  1SQB J;  1VF5 C;  2A45 I;  3CL3 D;  1SS1 A;  1NU1 E;  2FBW C;  3HE5 B;  3E1I A;  3B4S A;  4JPZ B;  4EI2 A;  3P8C E;  5CCH D;  1M1K Q;  1NTM E;  2ZVN B;  1KQS O;  1MUU A;  4UB8 E;  3KYQ A;  1OVU A;  5CCG A;  1FOS E;  1NHL A;  2ZVO B;  2HFE D;  3H32 B;  1EZV E;  2B88 A;  1BGY E;  1PGQ A;  2C0W A;  1QEX A;  5B66 E;  3HUS C;  1YJN P;  1LTJ A;  4PV1 B;  1SQP D;  2E74 C;  3TGU J;  4K3A A;  3VMX A;  3CPW O;  3CCM P;  3H1L D;  1NJI Q;  1G1I A;  1LGH B;  1T3U A;  1FZB A;  2M3B A;  2XV5 A;  4U7J A;  3H25 A;  1VQ8 P;  2OTJ P;  2KI7 B;  3V6I A;  2BCC E;  2FFD A;  3GLM A;  1SQB E;  4U3F E;  1X8Y A;  3S4R A;  3GF7 A;  3AE1 C;  1FE6 A;  1SQQ D;  2XU6 A;  2IBZ E;  2LXB A;  3G3Z A;  1BCC E;  2W6J H;  3IF4 A;  1NTM G;  1SQV D;  1LTG C;  1M90 Q;  1OFC X;  2XND H;  3MUD A;  1RE3 A;  2KLV A;  3HD7 C;  2A45 G;  5CCH C;  2KK7 A;  2KP8 A;  3AE8 C;  4L73 A;  2E76 D;  3L73 E;  4B86 A;  1VQP P;  2CPS A;  2OYH B;  1PFI A;  1HGV A;  1K8A Q;  3L74 J;  2A06 G;  1L4A C;  1YYC A;  2FY8 A;  3GMA A;  5KLV K;  3LW5 H;  3RL0 D;  1JCD A;  2WT7 A;  3C9I A;  2QM7 A;  4U3F J;  4KJM A;  1MZ9 A;  1JY3 P;  1ZXG A;  1IK7 A;  1PGJ A;  1ZRT D;  3BCC D;  3PP5 A;  1OX3 A;  1S2E A;  1ZOY C;  2Q3I A;  3L72 D;  3AED C;  2H43 A;  1BDC A;  3CLQ A;  4Y99 C;  4JBZ A;  3FXD A;  3PJS K;  2WQY C;  1YTZ T;  2FXP A;  2JWD A;  2K88 A;  5AW0 B;  2R5B A;  1S9K D;  1SQP J;  2IBZ I;  3H1K G;  1BCC J;  2MKV A;  3L74 G;  2O1J A;  3BAT A;  2QG4 A;  3GHG C;  3LID A;  1FZE A;  1HJ0 A;  2E75 D;  2K9J B;  3GG2 A;  3KPE A;  3MP7 B;  4LLH A;  3TYY A;  1L0N J;  4EDF A;  2R5D A;  2Y9Z A;  1LWU C;  4W80 A;  3I55 P;  1L0N K;  4PD4 H;  5AVQ B;  2XDJ A;  3AEB C;  1BE3 D;  1T6A A;  3GW6 A;  5CBO A;  1KC8 Q;  2YMK A;  2BEQ D;  2K9Y A;  3NTN A;  2IZ1 A;  2O01 J;  4BXL A;  1CZQ A;  3HD7 A;  2RH0 A;  3MGN A;  2QVA A;  1IZN B;  3NXS A;  1M8O B;  1QLE D;  1USD A;  5KLV G;  3PHL A;  3PLN A;  1HF9 A;  1T3J A;  3MUD C;  4PV1 C;  1M56 D;  3L70 J;  3HTK A;  3H1K D;  3WU2 E;  4EYY Q;  4H0L C;  3L74 D;  3B5N B;  2WSE H;  3M9H A;  3MIW A;  1MFZ A;  1ZRT E;  2ZYA A;  3L71 G;  2ZT9 C;  1L4A A;  1QL2 A;  2E5T A;  2P58 A;  2YXR B;  5L8R J;  1IFD A;  3W68 A;  3WUV A;  2QM8 A;  1KN7 A;  1VQN P;  2N9B A;  5CCG D;  5CHX A;  3B5N C;  4PD4 E;  4OVN F;  2V7Q H;  1CSB A;  1KIL D;  5KLV D;  1LTT C;  3H1I G;  3KHU A;  5AVR B;  1LTA C;  1NTK D;  1YJ9 P;  3V2N A;  2KS1 B;  2QJY C;  1PP9 D;  2HPC B;  5GTH H;  1JMB A;  1NAY A;  2Z5I A;  4Y99 B;  3Q5R A;  3BVH A;  1HBW A;  3CWB J;  1M57 D;  1K05 A;  4YXW H;  1SQQ E;  2J58 A;  1SVF A;  2JKV A;  4H44 D;  1Y9B A;  3SFE C;  3V2P A;  4KT0 J;  3WUU A;  4BRY A;  2BCC D;  5APW A;  1FZC C;  1SQX G;  2Y0D A;  4C7R A;  1VF5 B;  2KXP B;  5AW2 B;  1USE A;  1VQ5 P;  1HVV A;  4I7Z B;  1NVO A;  3QWO C;  3RK2 C;  3V2R A;  1GD2 E;  5AVT B;  2WPQ A;  2KSJ A;  3CCJ P;  2HPC A;  5AW7 B;  5AVV B;  1NKZ B;  1YIT P;  1SQP G;  1RF0 C;  2G8Y A;  2P1J A;  4PD4 I;  2WSF H;  1PPJ E;  4XA4 A;  3SSU A;  2GM4 A;  1KIL C;  3U1C A;  2PGD A;  5H2F H;  1GL2 B;  4HH2 A;  3U59 A;  3TNU B;  5CJ4 A;  3R4Y A;  1J1E B;  2W8Z A;  4JYB A;  3S9O A;  5EFW B;  1LTB C;  2FYU J;  1SQQ G;  2O01 N;  2B87 A;  1L0L E;  3HE4 B;  5KLI B;  1GL2 D;  1GL2 A;  1NOH A;  2FYU G;  3M9Q A;  4YTP C;  3CC7 P;  1PIX A;  1MFT A;  1KB9 I;  1FOS F;  1BSH A;  2IFM A;  1P84 I;  1Y47 A;  2H89 C;  2W83 C;  3B5N A;  3B8E B;  4WBA A;  3T97 B;  1LP1 A;  1JUN A;  2AEJ A;  5KJ7 A;  1PGO A;  1QL1 A;  1HH0 A;  4H13 C;  3CCV P;  3TGU D;  1SQV E;  4WY4 A;  3CX5 D;  1KIL A;  3OAK A;  2WMM A;  1OZH A;  2A06 D;  1NAF A;  1P84 H;  1LT1 A;  3GHG A;  4IOI H;  5AVW B;  4H44 B;  1BDD A;  2L5G B;  3NFQ A;  3JCU E;  1L0L J;  2R32 A;  4H13 B;  2D2C D;  3RK3 D;  3CCQ P;  1CI6 A;  1E5W A;  1OWA A;  4JF7 A;  2RN0 A;  2FYU E;  5TJH A;  3V2Q A;  1YIJ P;  3D6Y A;  4OGQ C;  1MV8 A;  2NRG A;  4QMA A;  1DEB A;  4D6T G;  1KIL B;  3H1J D;  1KB9 E;  1ZR2 A;  1M1J C;  3IFM A;  3OJA B;  3KQG A;  1SQQ K;  5APY A;  3V4Q A;  3V4W A;  1UII A;  2QIW A;  2NPS A;  3Q5S A;  1J1E C;  1LTS C;  2B89 A;  1GK6 A;  2LXC B;  4R4M A;  4CPG A;  5KLI C;  4ZNC A;  1IFJ A;  1SP4 A;  2IBZ G;  3B71 A;  3O6Q B;  1LTJ B;  1SQV J;  1L4A B;  2PAJ A;  3MTU E;  4NPF X;  4PD4 D;  1YJW P;  2RKL A;  2ZT9 D;  3F89 A;  1YBK A;  2YMY A;  3H1J E;  4L74 A;  2HOD A;  1NGM B;  2J5U A;  3M91 A;  4EIJ A;  4D6T J;  1S4X A;  2W90 A;  1AVY A;  2FXM A;  2IFN A;  1M7L A;  2KB7 P;  1EZV G;  2WPR A;  2D2C C;  1BCC D;  1LT9 B;  1N7S A;  1N7S D;  2A45 H;  3EFF K;  4DCK A;  3HE5 A;  2R3S A;  2Y0C A;  3B5N D;  1NU1 K;  2WIT A;  3FXE A;  3TSI A;  3Q2Y A;  1KTM A;  2E76 C;  1E79 H;  1JY2 P;  3ABV C;  4WY4 B;  4WY4 D;  2ZJS E;  2GA1 A;  2E75 B;  3CX5 I;  3TF5 A;  3Q1M A;  2KZJ A;  1OW8 A;  2L91 A;  3A0H H;  4A7P A;  1DD4 A;  2GUV A;  1G1J A;  3M0D A;  1BGY D;  1GW4 A;  2KUB A;  2W6B A;  3AE5 C;  1G2C A;  3KDP B;  1SQB D;  1FJK A;  1PP9 G;  5KAI H;  1FS0 E;  2RMZ A;  1EDJ A;  1JMM A;  1SQP K;  3HD7 D;  5AW3 B;  1OW7 A;  3H1K J;  1LT9 A;  1N7S B;  5CJ0 A;  5B66 H;  5DJT B;  4D6T E;  1A02 F;  2B87 B;  3P8C D;  2QJK C;  4UB6 H;  1T2K C;  1S72 P;  1JY3 N;  2H8P D;  2BCC G;  3CXH H;  3A0B E;  4HJG H;  1Q2N A;  3U1A A;  5APV A;  2NPS D;  2OYO A;  1L4A D;  1L0L D;  1OXZ A;  3O6Q A;  1Q82 Q;  1VQ9 P;  1X79 B;  3PRJ A;  3AEE C;  3W67 A;  1BGY G;  3CXH E;  1NTZ K;  5KJ7 D;  1NTK J;  1PZQ A;  3USS A;  1URQ D;  2GUS A;  3A0H E;  1URQ A;  3VP9 A;  2UWJ E;  1EDL A;  1RHZ B;  1N8R Q;  1U57 A;  1LTI C;  1SQX J;  1JNM A;  2V7Q J;  1U7J A;  2WPS A;  3CCS P;  1VQM P;  2WVR A;  4BRY B;  1QX8 A;  2Z4E A;  3RK3 E;  1OMI A;  4XFJ A;  2D2C B;  2FFD B;  4I2L C;  3P7K A;  1SFC C;  2XNX A;  1L0L G;  5CBN A;  1VQ6 P;  3KZI H;  2YKO A;  3AEA C;  2O01 H;  2KS1 A;  1BGY J;  2Q1K A;  1HUC A;  4IFF A;  1FAV A;  5TIS H;  1ZLL A;  3L70 D;  1LT9 C;  3H1I J;  2JWA A;  2OYI A;  4ZKU A;  1PPJ G;  2PP6 A;  4LC1 A;  4BWN A;  2BCC J;  1LP1 B;  1Q81 Q;  2W27 A;  1JEK A;  1NTK E;  2NPS B;  2V4H A;  4RES B;  3T97 A;  1KFM A;  4PV1 D;  3CCL P;  5KKZ C;  1ZR4 A;  3E1R A;  3A3Y B;  3EFG A;  1S1C X;  3HE4 A;  3L70 E;  1SQX E;  2I1K A;  2QEX P;  4GOD A;  4DZO A;  3ITK A;  3SWY A;  1LTJ C;  3H1J G;  5KLV J;  3CCU P;  2C9N Y;  2K3R A;  2YNY A;  1CI6 B;  2AEM A;  2R3C A;  2OAR A;  3L75 D;  3EQ2 A;  2LKM A;  4GT1 A;  1PP9 J;  2JJL A;  3N7N A;  1BE3 J;  3L71 D;  3BAS A;  2OYH C;  2MJZ A;  2JEE A; 
#chains in the Genus database with same CATH homology
 1P84 I;  3CWB J;  1NTZ J;  1SQV J;  3H1K J;  3L74 J;  1BGY J;  1KYO I;  3L72 J;  1BE3 J;  3H1I J;  3BCC J;  3L70 J;  4U3F J;  4D6T J;  2BCC J;  1EZV I;  3TGU J;  3CXH I;  3H1L J;  1L0L J;  4PD4 I;  1SQP J;  2IBZ I;  1NTK J;  1BCC J;  1NU1 J;  3L75 J;  3L73 J;  3H1H J;  5KLV J;  1NTM J;  1SQX J;  1L0N J;  2FYU J;  3CX5 I;  3H1J J;  1PP9 J;  1SQQ J;  1SQB J;  1KB9 I;  3L71 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...