1KYOI

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
53
structure length
53
Chain Sequence
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKAKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
total genus 17
structure length 53
sequence length 53
chains with identical sequence T
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1kyoI00
1NTKJ 1SQBJ 3L75J 1NTZJ 1BCCJ 1BE3J 1KYOI 3CWBJ 1EZVI 2BCCJ 1L0LJ 2FYUJ 1SQQJ 1NTMJ 3TGUJ 3H1IJ 1L0NJ 3H1HJ 3H1JJ 4U3FJ 1SQPJ 1KB9I 4PD4I 3L74J 1P84I 3L71J 1NU1J 5KLVJ 4D6TJ 3CXHI 3BCCJ 3L72J 3H1KJ 1PP9J 1BGYJ 1SQVJ 3H1LJ 3L70J 3L73J 3CX5I 1SQXJ 2IBZI
chains in the Genus database with same CATH superfamily
2KS1A 1QL2A 3M06A 1Q7YQ 1M1KQ 1NU1D 2P7JA 4IOIH 1UIIA 5CCHA 1LTGC 1L0NK 4UB6E 3FXEA 3HUSB 1FDMA 1LNQA 4U3FD 1T3UA 1YBKA 2WWWA 3CL3D 1JY2P 2XDJA 1HH0A 1UIXA 1GU5A 3BCCJ 1S9KE 1E5WA 3L70J 1RY3A 1JY3N 2Z5IA 1SQQD 1BGYE 4UB8E 5AVZB 1QL1A 3SWYA 2JKVA 1NTKK 2MKVA 4Y28J 3RK3D 2KXPB 3A0BH 3CWBD 5APYA 3CCQP 3I5CA 2RH0A 1Q86Q 1T6AA 2A45H 1SQVE 2ZYDA 5BVZA 1S5LH 1LTJA 2E74B 2WPVB 1FZAA 2K9JB 1EZVG 1NKZB 1YITP 4I7ZC 2QA4P 1M1JB 3CCEP 2FXPA 2OQQA 1K05A 2GA1A 2GUVA 5EFWB 3HD7B 2OTKE 3MIWA 4KJMA 3VMYA 2QJPC 1SQQK 2ZXEB 1VQMP 1VQ7P 5KAFH 3L74E 1SVFA 1OX3A 3WUUA 3T97B 1N86A 1Y47A 1IFDA 1L0NG 1KYOH 3KYQA 5AVQB 2WT7A 1J1EC 1ZN5A 1OVRA 2QM8A 3V2PA 1JTHB 3CC7P 2KOGA 4BWNA 1KMIZ 4H44B 1NTMG 3VMXA 1W5CE 3L75J 5KLIB 4DCKA 1URQD 4D6TD 1YTZT 3HE4B 1HTLC 1L0LE 2NPSA 1ZXGA 2HODB 1NOHA 2KS1B 1NTKG 2OARA 2YMKA 1HF9A 2KSEA 5B5EH 2L91A 2OYHB 4GOEA 1NU1G 3BCCD 3CCJP 3L70D 1FC2C 4AQRD 1HUCA 1K8AQ 2YO2A 4GOFA 1IFJA 3PJSK 2L5GB 5KTBA 1J1DC 4ASWA 1QX8A 3GW6A 1JCCA 3H1HJ 2AXCA 3IN6A 2BCCE 3RK2D 1BDDA 5AVRB 4M3LA 1KTMA 2C9LY 5AW5B 1AVOA 2HG5D 2P1JA 4WY4D 3CX5I 3RL0C 3B5NC 1SQQG 4RKUJ 3QH9A 2FFDA 3CCMP 3Q5PA 2LR2A 1JMBA 2E76D 2KZIA 2M5AA 2B87A 4TLFA 1KD1Q 1FZCA 4HYTB 2R44A 3MTUE 3H1KJ 4IL6E 3CWBG 3D6YA 1LTJB 2K1AA 2ZYGA 4LGDE 4JYBA 1SQXE 2IYOA 3H1JJ 2GM4A 3TNUA 2ZFCA 1NAYA 1RE3A 2JR8A 4W80A 3W67A 1EZVE 1X9VA 5B66H 3O6QA 3RBXA 1SP4A 3NMDA 1U7JA 2QM7A 5CJ4A 1RF1C 2OTJP 3RL0g 1M7LA 4PV1B 1VF5C 1G1JA 3M91A 1EDJA 1VQNP 3A0HH 1SQPD 1BE3J 2AEMA 2WT7B 1W2EA 1L4AD 1M90Q 3AE2C 1HGVA 1ZW0A 1GU4A 3QWOC 1LWUA 3L73D 2PRRA 1L0NE 1YTZI 5KLVJ 3CCVP 5KAIE 2Q3IA 2W6AA 5AW9B 3CX5D 3U1CA 2Z4EA 2E5TA 1JY2O 2NPSB 4R4LA 1GL2B 4D6TG 2HPCA 1P84I 1LTIC 2FYNB 3AE4C 1IJDB 1NH4A 3PLNA 1PP9J 3CCUP 3AEEC 5DJTB 2XNDH 3JC22 2W8ZA 2IZ1A 1URQA 5APXA 2XV5A 3WMM0 3TGUJ 3KHUA 2V4HA 5L8RJ 1NTKE 2UWJE 3V6IA 3D6ZA 3BCCG 3KXDA 3SFDC 3L70G 5KKZC 1SQBD 3BRTB 1ZRTD 2YXRB 1JNMA 2E75C 1HJBA 3L36A 2M3BA 3AEDC 1K04A 1LT1A 3H25A 3R2PA 4U3FE 1CI6A 3SFEC 2KIKA 2JJLA 2PP6A 3WU2E 1PPJD 2VRSA 2FFDB 1VQPP 3H1JD 2DW3A 2FYZA 2Y9ZA 2QRXA 1HVVA 2O1JA 4C7NA 2B87B 2J58A 1FZCB 2XNXA 4WY4A 1SQQE 2ZT9D 2XZRA 2YKOA 3FWLA 1MKMA 1SFCD 3TF5A 3RGUA 3PRJA 2KI7B 4LC1A 4YXWH 3RK3B 1JOCA 1RF0A 3RK3E 1YQ3C 3KQGA 3CWBE 3AEGC 3L71J 4OGQB 1P84D 1KQLA 3Q2YA 1BE3D 1KFMA 2K37A 1JO5A 2P58A 3V2RA 5AVWB 3IAOA 1PV3A 1N2DC 3F89A 4AUWA 2P67A 1USEA 3EFGA 4H0LD 3HE5B 4I1LA 3EWKA 3L72J 2KZJA 3NFQA 1AFOA 4N6JA 2WSEH 3FGAD 3OJAB 2AXTH 5APTA 4H13C 1SQPG 1VQ5P 1LWUB 2R3CA 1PP9D 5APQA 1FS0E 3L73G 2YIUC 1VQ8P 3MD0A 1AV1A 4I2LC 1LT9C 3TGUD 1NTMD 1L4AA 1DIPA 1LTSC 1T8ZA 2I1KA 2HPCB 2R5BA 2CPBA 1IFNA 4PD4I 4K35A 3D70A 3W68A 1TU3F 3CI9A 2IDBA 1RHZB 4OH8B 2D2CD 1URQB 2N9YB 1N7SD 1N7LA 4D6TE 3G3ZA 1GW3A 1ZMEC 2PGDA 1ZP0C 2ITAA 1VQ4P 3VTPC 5AVTB 2WSEJ 2C0XA 3PP5A 4EIJA 1U57A 3M0DC 1FJPA 5AW6B 1U7MA 1SQBG 2QJKB 4EDFA 3HRNA 3BCCE 2KP8A 3PTZA 4HB1A 3GF7A 3L70E 3SSUA 1NTZJ 1BCCJ 4UB8H 2FYUJ 3H1IJ 3S1KA 1KB9I 2Q6QA 1CI6B 3H1LD 1NTMK 1T3JA 1S1CX 1Q82Q 1X79B 1Q2NA 1GTWA 1LTAC 1ZR4A 3Q1MA 1PPJG 3RK2B 3H1JG 4GKGA 4C7NB 2D2CC 3L71D 3G4SP 1DX7A 1FAVA 2JEEA 4WY4B 2AEJA 1N7SC 3LIDA 3GHGC 1MV8A 1HBWA 2H8PD 1JM0A 1JB0J 4QMAA 5TISH 2E76B 3OAKA 1NU1K 1PZQA 2FXOA 2W27A 1LP1A 4HJGH 2RMZA 3U1AA 5CMZA 3H32A 1JEKA 1SFCA 2XKMA 3K5BA 4PD4D 2N1TB 1S2EA 1R5SA 1EDKA 3GMAA 1BE3G 5GTIE 2ZVNB 3CLQA 1R5LA 3MP7B 1A02J 3B4SA 2WVRA 1CZQA 1EDIA 2OYIC 2Q7CA 1NO4A 2P10A 4W7ZA 1KZUB 1SQVJ 1FDOA 1D7MA 3A3YB 1SS1A 3CC2P 1LTTC 4B86A 1CSBA 1BSHA 1Y8AA 1PP9G 1KB9D 4NPDA 1SQPE 1YI2P 1L4AB 2IZ0A 2WZ7A 3F5HA 3P7KA 2O01H 1RQVA 3OW2O 3TGUG 1AQTA 2KUBA 3V2NA 1HGZA 3L73E 3NXSA 2OTLP 1H8AA 2Y0EA 3L74J 1H88A 1QVFO 3RL0D 3B5ND 1H0TA 5GTHE 3CX5E 1BCCD 2QJYB 1KQSO 3BASA 3TSIA 1N73C 1S5LX 2A45I 4YTPC 2Y9YA 2WSFH 4K3AA 2Y0CA 3CPWO 1N7SA 1S4XA 3I55P 1KORA 4JBZA 1GDTA 2RN0A 4WVZA 1L0LJ 2B9BA 1KILC 1AJYA 1SQBE 1Y9BA 1DEBA 1ZRTE 2O01J 2KK7A 1KN7A 2YNYA 3H1LG 5TJHA 1FZFA 3CCRP 5B5EE 1FZEA 1KYOI 2O1KA 2YXQB 3BRVB 3CCSP 3VP8A 3L71G 1JY3P 1VDFA 1VF5D 1PPJE 1ZV8A 3H1JE 3C9IA 3V2QA 1NKNA 4PJ0E 1LP1B 3HTKA 2WSFJ 2OYOA 3H32B 2ZT9B 4N78D 2BCCJ 4DT0A 5APVA 1SFCB 3P8CD 1FBMA 1OXZA 1YIJP 1CW5A 4JYCA 3HUSC 4YPCA 5DJUB 4Y99B 2AEFA 1GZLA 4L76A 2V7QH 4C7RA 1P84E 1YJ9P 4NPFX 1BE3E 2LXBA 3C8VA 3P8MC 3MUDC 2NZ2A 4ZMDA 4DZOA 2FBWC 2B88A 3L75D 2W90A 1EXJA 1USDA 3U59A 1SQXJ 5KAIH 4H0LB 5AVVB 3LIEA 1LJ2A 2KYVA 4LLHA 3VMAA 1OVVA 3JCUE 3M9QA 2BEZF 1PGPA 3TK1A 5M1BA 2E75D 4DJGA 2HYNA 3A2AA 5B66E 5CCGD 2E5YA 1PP9E 2WPQA 1KC8Q 2E74C 4O9BA 2WPSA 1OZHA 1KYOD 5E79E 3KZIE 1VQ9P 1H0TB 3VN0A 1M1JC 3TGUE 1NTME 2FKWB 2XU6A 3GF3A 2V7QJ 1L0LD 4GDOA 1BCCG 3CC4P 3H1HD 2YKQA 2WSCH 2Q1KA 5BU8B 3HD7C 1L0NJ 3B5NA 4RESB 2OGUA 4DOJA 1SQPK 1FZBA 2R5DA 2Q3EA 1NU1E 4A7PA 3WU2H 2Z5HA 2CPSA 2KLVA 1RE4C 5CCGC 1QEXA 3M0AA 3H1KD 1IK9A 3RBZA 2QSIA 4I7ZB 1W2BO 4EOTA 4H44C 2WQYC 1NTKJ 1FDIA 1FOSE 3H1LE 2YMYA 1Z56A 3PH0A 2M5AB 1IFIA 2HFED 1IFPA 3MGNA 1VQKP 2QJPB 2WSCJ 2JWAA 1RF1A 3HTKB 3CXHH 3MUDA 4H13D 3L71E 3N7NA 4RO0A 1OWAA 2B89A 2OYHC 4KT0J 3FWNA 4U3FJ 5H2FH 1SQBK 3TNUB 1J1EB 1SQVG 2RKLA 2IFMA 3SWKA 2YKPA 3GG2A 1VQOP 2O01N 4GIFA 2PFXA 3O6QB 1G2CA 2A06D 1SQQJ 4PD4E 5KLVD 4BXLA 2A45G 4YXDC 2J59M 3AEFC 2R3SA 2G3AA 3L75G 3VOPA 3CWBJ 3FXDA 2ZVOB 3G9RA 3ITKA 3I56P 3AECC 1FOSF 1GW4A 1PIXA 1LTJC 2IBZI 3E1RA 4RJTA 1PGJA 2W6JH 3USSA 4L74A 1MUUA 1KB9E 2H89C 4C46A 2J5UA 1J1DB 3B8EB 1JMMA 1VL2A 1E79H 3GLMA 4ASVA 1RE4A 5CCGA 3CXHI 1JTHA 2JP3A 4UB6H 5KJ7D 1GL2D 1FZGA 1L0LG 1NHLA 1RH5B 3RL0B 3B5NB 3H1HG 5AVXB 3Q5SA 1BCCE 1JY3O 3S9OA 2P2UA 3ZDMA 4PV1C 3VYIA 3M9HA 4BRYA 1KQGB 5AVYB 3UIAA 2H88C 1HJ0A 4IFMA 3TYYA 1X8YA 3Q5RA 5APWA 4HH2A 3AEAC 2OYHA 1QLED 3JSVC 3E1IA 3H1KG 1DD3A 4ZKUA 4D6TJ 4MN4C 2WITA 2BCCG 1GK4A 1EQ7A 3AE9C 4TT3H 2NPSC 5KJ7C 3AE6C 5AW2B 1GL2C 2C0WA 3AE5C 3AE7C 4EI2A 1RF1B 1FJKA 2FYNC 1DD4A 4U7JA 1VF5B 3II6A 5GTIH 5CHXA 2IBZD 1YQ4C 4Z1MH 1OMIA 1Q81Q 1QVGO 3V5BA 5K5GB 3L72D 1MFTA 2O3JA 1VQ6P 3D71A 3B71A 1R8EA 1NJIQ 1MFZA 1SQXG 3CD6P 4N78E 1BGYJ 3CXHD 3P8CE 1G2CB 4OGQD 1DEEG 5APSA 2LKMA 1LT9A 3M9BA 5AW7B 2A06G 1OIPA 5KLVG 1IO4A 3A0BE 5TISE 4GT1A 3TDKA 1IFMA 2FFDC 2Q5UA 1S5LE 1ZOYC 2ZYAA 3WUTA 1OVUA 1FZCC 3L75E 1M8OB 2K9YA 2FY8A 5AVUB 1WMKA 1GMJA 2PAJA 5KKZB 5GTHH 3M0DA 3A5TA 3CX5H 1OFCX 1KILD 3AE1C 3RK3C 2LXCB 1OW7A 2IFNA 3H6PA 2E75B 2KNCA 2JO1A 2MJZA 1SLQA 1RE3C 3G71P 4OGQC 4JQ0D 5KAFE 5CBOA 2WSSH 1S72P 1OW8A 1NTZD 1NVOA 2I1JA 3CCLP 1K9MQ 2FYUD 1KYOE 1A02F 3H1ID 2KLUA 2KSJA 4ZNCA 1SQPJ 4BRYB 5KJ7A 4NPEA 3MZWB 3FX0A 1GL2A 3H1HE 3GHGA 1IC2A 3L73J 3WUVA 1NAFA 2W83C 1LTBC 1LWUC 3N4XA 1NGMB 1JCDA 4L73A 2G8YA 2IYPA 4IL6H 4PJ0H 1L2PA 3H1KE 4U3FG 3AE8C 1S9KD 1WRGA 1T2KD 1KQFB 1NTZK 1BGYD 2FYUK 1G1IA 2OYIA 1URQC 3L35A 2SPZA 4GODA 1J2JB 1SQBJ 1BSNA 3MHVA 4H13B 2K3RA 1NYHA 2IBZG 1IK7A 2GUSA 4WWIA 2HLOA 1OW6A 1P84H 1SQVD 3L72G 4HKZH 3VMZA 2QJKC 4W7YA 2E74D 3CMEP 2YIUB 1LT9B 3L4FA 2M0BA 3S4RA 2IX7C 2E42A 2N1TD 1K73Q 1AVYA 1BDCA 1NWQA 2ZAEB 2QEXP 2ZXXA 2BASA 3JCUH 2N9BA 1T2KC 1YYCA 2I8DA 2A06E 3HD7D 3RK2C 5KLVE 2E43A 3L74D 3EFFK 1N73A 1GK6A 4WY4C 2IPPA 3C1LA 5E79H 3KZIH 2YO3A 2C9NY 1S3JA 1ZR2A 2E76C 4IL6X 1FU1A 3KPEA 3HE5A 1WT6A 1RF0C 2WPRA 4JF7A 5C39A 5AW1B 1SQVK 2KNCB 5AVSB 3OA7A 1M56D 2WTYA 3IFMA 4H44D 4OVNF 1KILA 3E7KA 2N1TC 2M8RA 2QE7H 1DH3A 1JUNA 3A0HE 1NTZG 1QGKB 3A7OA 3KDPB 2FYUG 4EYYQ 3EQ2A 3H1IG 1EZVI 5CJ0A 3G6EP 4N3YB 2D2CB 1YJWP 1N7SB 3GHGB 5AW3B 2Q9IA 2FXMA 4R4MA 3SWFA 2QVAA 3ABVC 5CCHD 2W6BA 3Q3DA 2QIWA 1HWTC 4XE5B 1NTMJ 3O8ZA 1MZ9A 3V4QA 5CBNA 1L4AC 1XTCC 4AYCA 1Q90D 1AQ5A 1LGHB 1JY2N 2BCCD 3V4WA 1GD2E 1KFNA 3HUSA 3LW5H 4XA4A 5KLIC 1H89A 2POHA 3IR9A 4IFDK 3VP9A 1L0LK 2OYIB 1BGYG 2JDIH 1NU1J 2CK3H 2QJYC 1PGOA 1PL5A 1M57D 3P32A 3R4YA 1N8RQ 3AEBC 5CCHC 2H43A 4WBAA 4PD4H 5AW4B 1SQXD 1PGQA 4L75A 2IBZE 3H1LJ 3L37A 1EDLA 3BATA 4I6MC 3NTNA 3L72E 2M3EA 1XTGB 2HR3A 5APUA 4IFFA 1EZVD 3IF4A 3CXHE 2K9JA 1X22A 3LW5J 1VQLP 1M1JA 2N1TA 5AW8B 2R32A 1YJNP 1N73B 5H2FE 1RQUA 4PV1D 3L74G 1KB9H 1AA0A 4ZKPA 3HD7A 3BVHA 2QG4A 3CMAP 1FE6A 2BEQD 1L0ND 2ZT9C 1ZLLA 1IZNB 1SFCC 3T97A 3AE3C 1EXIA 1SQXK 1X0TA 1VPCA 1KILB 2NRGA 2ZJSE 4CPGA 1KILE 1PFIA 1KV4A 2K88A 4KHXA 2NPSD 2AXTE 4Y99C 5KLVK 4JPZB 1YHQP 4OWFA 4WB4A 1NTZE 1EC5A 5BU5A 2Y0DA 2FYUE 2KB7P 3H1IE 3HE4A 5AW0B 2JWDA 3PHLA 2H7HA 1NTKD 2WMMA 4XFJA 2HODA 4H0LC
chains in the Genus database with same CATH topology
1NTKJ 1SQBJ 3L75J 1NTZJ 1BCCJ 1BE3J 1KYOI 3CWBJ 1EZVI 2BCCJ 1L0LJ 2FYUJ 1SQQJ 1NTMJ 3TGUJ 3H1IJ 1L0NJ 3H1HJ 3H1JJ 4U3FJ 1SQPJ 1KB9I 4PD4I 3L74J 1P84I 3L71J 1NU1J 5KLVJ 4D6TJ 3CXHI 3BCCJ 3L72J 3H1KJ 1PP9J 1BGYJ 1SQVJ 3H1LJ 3L70J 3L73J 3CX5I 1SQXJ 2IBZI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTK J;  1SQB J;  3L75 J;  1NTZ J;  1BCC J;  1BE3 J;  1KYO I;  3CWB J;  1EZV I;  2BCC J;  1L0L J;  2FYU J;  1SQQ J;  1NTM J;  3TGU J;  3H1I J;  1L0N J;  3H1H J;  3H1J J;  4U3F J;  1SQP J;  1KB9 I;  4PD4 I;  3L74 J;  1P84 I;  3L71 J;  1NU1 J;  5KLV J;  4D6T J;  3CXH I;  3BCC J;  3L72 J;  3H1K J;  1PP9 J;  1BGY J;  1SQV J;  3H1L J;  3L70 J;  3L73 J;  3CX5 I;  1SQX J;  2IBZ I; 
#chains in the Genus database with same CATH topology
 2KS1 A;  1QL2 A;  3M06 A;  1Q7Y Q;  1M1K Q;  1NU1 D;  2P7J A;  4IOI H;  1UII A;  5CCH A;  1LTG C;  1L0N K;  4UB6 E;  3FXE A;  3HUS B;  1FDM A;  1LNQ A;  4U3F D;  1T3U A;  1YBK A;  2WWW A;  3CL3 D;  1JY2 P;  2XDJ A;  1HH0 A;  1UIX A;  1GU5 A;  3BCC J;  1S9K E;  1E5W A;  3L70 J;  1RY3 A;  1JY3 N;  2Z5I A;  1SQQ D;  1BGY E;  4UB8 E;  5AVZ B;  1QL1 A;  3SWY A;  2JKV A;  1NTK K;  2MKV A;  4Y28 J;  3RK3 D;  2KXP B;  3A0B H;  3CWB D;  5APY A;  3CCQ P;  3I5C A;  2RH0 A;  1Q86 Q;  1T6A A;  2A45 H;  1SQV E;  2ZYD A;  5BVZ A;  1S5L H;  1LTJ A;  2E74 B;  2WPV B;  1FZA A;  2K9J B;  1EZV G;  1NKZ B;  1YIT P;  4I7Z C;  2QA4 P;  1M1J B;  3CCE P;  2FXP A;  2OQQ A;  1K05 A;  2GA1 A;  2GUV A;  5EFW B;  3HD7 B;  2OTK E;  3MIW A;  4KJM A;  3VMY A;  2QJP C;  1SQQ K;  2ZXE B;  1VQM P;  1VQ7 P;  5KAF H;  3L74 E;  1SVF A;  1OX3 A;  3WUU A;  3T97 B;  1N86 A;  1Y47 A;  1IFD A;  1L0N G;  1KYO H;  3KYQ A;  5AVQ B;  2WT7 A;  1J1E C;  1ZN5 A;  1OVR A;  2QM8 A;  3V2P A;  1JTH B;  3CC7 P;  2KOG A;  4BWN A;  1KMI Z;  4H44 B;  1NTM G;  3VMX A;  1W5C E;  3L75 J;  5KLI B;  4DCK A;  1URQ D;  4D6T D;  1YTZ T;  3HE4 B;  1HTL C;  1L0L E;  2NPS A;  1ZXG A;  2HOD B;  1NOH A;  2KS1 B;  1NTK G;  2OAR A;  2YMK A;  1HF9 A;  2KSE A;  5B5E H;  2L91 A;  2OYH B;  4GOE A;  1NU1 G;  3BCC D;  3CCJ P;  3L70 D;  1FC2 C;  4AQR D;  1HUC A;  1K8A Q;  2YO2 A;  4GOF A;  1IFJ A;  3PJS K;  2L5G B;  5KTB A;  1J1D C;  4ASW A;  1QX8 A;  3GW6 A;  1JCC A;  3H1H J;  2AXC A;  3IN6 A;  2BCC E;  3RK2 D;  1BDD A;  5AVR B;  4M3L A;  1KTM A;  2C9L Y;  5AW5 B;  1AVO A;  2HG5 D;  2P1J A;  4WY4 D;  3CX5 I;  3RL0 C;  3B5N C;  1SQQ G;  4RKU J;  3QH9 A;  2FFD A;  3CCM P;  3Q5P A;  2LR2 A;  1JMB A;  2E76 D;  2KZI A;  2M5A A;  2B87 A;  4TLF A;  1KD1 Q;  1FZC A;  4HYT B;  2R44 A;  3MTU E;  3H1K J;  4IL6 E;  3CWB G;  3D6Y A;  1LTJ B;  2K1A A;  2ZYG A;  4LGD E;  4JYB A;  1SQX E;  2IYO A;  3H1J J;  2GM4 A;  3TNU A;  2ZFC A;  1NAY A;  1RE3 A;  2JR8 A;  4W80 A;  3W67 A;  1EZV E;  1X9V A;  5B66 H;  3O6Q A;  3RBX A;  1SP4 A;  3NMD A;  1U7J A;  2QM7 A;  5CJ4 A;  1RF1 C;  2OTJ P;  3RL0 g;  1M7L A;  4PV1 B;  1VF5 C;  1G1J A;  3M91 A;  1EDJ A;  1VQN P;  3A0H H;  1SQP D;  1BE3 J;  2AEM A;  2WT7 B;  1W2E A;  1L4A D;  1M90 Q;  3AE2 C;  1HGV A;  1ZW0 A;  1GU4 A;  3QWO C;  1LWU A;  3L73 D;  2PRR A;  1L0N E;  1YTZ I;  5KLV J;  3CCV P;  5KAI E;  2Q3I A;  2W6A A;  5AW9 B;  3CX5 D;  3U1C A;  2Z4E A;  2E5T A;  1JY2 O;  2NPS B;  4R4L A;  1GL2 B;  4D6T G;  2HPC A;  1P84 I;  1LTI C;  2FYN B;  3AE4 C;  1IJD B;  1NH4 A;  3PLN A;  1PP9 J;  3CCU P;  3AEE C;  5DJT B;  2XND H;  3JC2 2;  2W8Z A;  2IZ1 A;  1URQ A;  5APX A;  2XV5 A;  3WMM 0;  3TGU J;  3KHU A;  2V4H A;  5L8R J;  1NTK E;  2UWJ E;  3V6I A;  3D6Z A;  3BCC G;  3KXD A;  3SFD C;  3L70 G;  5KKZ C;  1SQB D;  3BRT B;  1ZRT D;  2YXR B;  1JNM A;  2E75 C;  1HJB A;  3L36 A;  2M3B A;  3AED C;  1K04 A;  1LT1 A;  3H25 A;  3R2P A;  4U3F E;  1CI6 A;  3SFE C;  2KIK A;  2JJL A;  2PP6 A;  3WU2 E;  1PPJ D;  2VRS A;  2FFD B;  1VQP P;  3H1J D;  2DW3 A;  2FYZ A;  2Y9Z A;  2QRX A;  1HVV A;  2O1J A;  4C7N A;  2B87 B;  2J58 A;  1FZC B;  2XNX A;  4WY4 A;  1SQQ E;  2ZT9 D;  2XZR A;  2YKO A;  3FWL A;  1MKM A;  1SFC D;  3TF5 A;  3RGU A;  3PRJ A;  2KI7 B;  4LC1 A;  4YXW H;  3RK3 B;  1JOC A;  1RF0 A;  3RK3 E;  1YQ3 C;  3KQG A;  3CWB E;  3AEG C;  3L71 J;  4OGQ B;  1P84 D;  1KQL A;  3Q2Y A;  1BE3 D;  1KFM A;  2K37 A;  1JO5 A;  2P58 A;  3V2R A;  5AVW B;  3IAO A;  1PV3 A;  1N2D C;  3F89 A;  4AUW A;  2P67 A;  1USE A;  3EFG A;  4H0L D;  3HE5 B;  4I1L A;  3EWK A;  3L72 J;  2KZJ A;  3NFQ A;  1AFO A;  4N6J A;  2WSE H;  3FGA D;  3OJA B;  2AXT H;  5APT A;  4H13 C;  1SQP G;  1VQ5 P;  1LWU B;  2R3C A;  1PP9 D;  5APQ A;  1FS0 E;  3L73 G;  2YIU C;  1VQ8 P;  3MD0 A;  1AV1 A;  4I2L C;  1LT9 C;  3TGU D;  1NTM D;  1L4A A;  1DIP A;  1LTS C;  1T8Z A;  2I1K A;  2HPC B;  2R5B A;  2CPB A;  1IFN A;  4PD4 I;  4K35 A;  3D70 A;  3W68 A;  1TU3 F;  3CI9 A;  2IDB A;  1RHZ B;  4OH8 B;  2D2C D;  1URQ B;  2N9Y B;  1N7S D;  1N7L A;  4D6T E;  3G3Z A;  1GW3 A;  1ZME C;  2PGD A;  1ZP0 C;  2ITA A;  1VQ4 P;  3VTP C;  5AVT B;  2WSE J;  2C0X A;  3PP5 A;  4EIJ A;  1U57 A;  3M0D C;  1FJP A;  5AW6 B;  1U7M A;  1SQB G;  2QJK B;  4EDF A;  3HRN A;  3BCC E;  2KP8 A;  3PTZ A;  4HB1 A;  3GF7 A;  3L70 E;  3SSU A;  1NTZ J;  1BCC J;  4UB8 H;  2FYU J;  3H1I J;  3S1K A;  1KB9 I;  2Q6Q A;  1CI6 B;  3H1L D;  1NTM K;  1T3J A;  1S1C X;  1Q82 Q;  1X79 B;  1Q2N A;  1GTW A;  1LTA C;  1ZR4 A;  3Q1M A;  1PPJ G;  3RK2 B;  3H1J G;  4GKG A;  4C7N B;  2D2C C;  3L71 D;  3G4S P;  1DX7 A;  1FAV A;  2JEE A;  4WY4 B;  2AEJ A;  1N7S C;  3LID A;  3GHG C;  1MV8 A;  1HBW A;  2H8P D;  1JM0 A;  1JB0 J;  4QMA A;  5TIS H;  2E76 B;  3OAK A;  1NU1 K;  1PZQ A;  2FXO A;  2W27 A;  1LP1 A;  4HJG H;  2RMZ A;  3U1A A;  5CMZ A;  3H32 A;  1JEK A;  1SFC A;  2XKM A;  3K5B A;  4PD4 D;  2N1T B;  1S2E A;  1R5S A;  1EDK A;  3GMA A;  1BE3 G;  5GTI E;  2ZVN B;  3CLQ A;  1R5L A;  3MP7 B;  1A02 J;  3B4S A;  2WVR A;  1CZQ A;  1EDI A;  2OYI C;  2Q7C A;  1NO4 A;  2P10 A;  4W7Z A;  1KZU B;  1SQV J;  1FDO A;  1D7M A;  3A3Y B;  1SS1 A;  3CC2 P;  1LTT C;  4B86 A;  1CSB A;  1BSH A;  1Y8A A;  1PP9 G;  1KB9 D;  4NPD A;  1SQP E;  1YI2 P;  1L4A B;  2IZ0 A;  2WZ7 A;  3F5H A;  3P7K A;  2O01 H;  1RQV A;  3OW2 O;  3TGU G;  1AQT A;  2KUB A;  3V2N A;  1HGZ A;  3L73 E;  3NXS A;  2OTL P;  1H8A A;  2Y0E A;  3L74 J;  1H88 A;  1QVF O;  3RL0 D;  3B5N D;  1H0T A;  5GTH E;  3CX5 E;  1BCC D;  2QJY B;  1KQS O;  3BAS A;  3TSI A;  1N73 C;  1S5L X;  2A45 I;  4YTP C;  2Y9Y A;  2WSF H;  4K3A A;  2Y0C A;  3CPW O;  1N7S A;  1S4X A;  3I55 P;  1KOR A;  4JBZ A;  1GDT A;  2RN0 A;  4WVZ A;  1L0L J;  2B9B A;  1KIL C;  1AJY A;  1SQB E;  1Y9B A;  1DEB A;  1ZRT E;  2O01 J;  2KK7 A;  1KN7 A;  2YNY A;  3H1L G;  5TJH A;  1FZF A;  3CCR P;  5B5E E;  1FZE A;  1KYO I;  2O1K A;  2YXQ B;  3BRV B;  3CCS P;  3VP8 A;  3L71 G;  1JY3 P;  1VDF A;  1VF5 D;  1PPJ E;  1ZV8 A;  3H1J E;  3C9I A;  3V2Q A;  1NKN A;  4PJ0 E;  1LP1 B;  3HTK A;  2WSF J;  2OYO A;  3H32 B;  2ZT9 B;  4N78 D;  2BCC J;  4DT0 A;  5APV A;  1SFC B;  3P8C D;  1FBM A;  1OXZ A;  1YIJ P;  1CW5 A;  4JYC A;  3HUS C;  4YPC A;  5DJU B;  4Y99 B;  2AEF A;  1GZL A;  4L76 A;  2V7Q H;  4C7R A;  1P84 E;  1YJ9 P;  4NPF X;  1BE3 E;  2LXB A;  3C8V A;  3P8M C;  3MUD C;  2NZ2 A;  4ZMD A;  4DZO A;  2FBW C;  2B88 A;  3L75 D;  2W90 A;  1EXJ A;  1USD A;  3U59 A;  1SQX J;  5KAI H;  4H0L B;  5AVV B;  3LIE A;  1LJ2 A;  2KYV A;  4LLH A;  3VMA A;  1OVV A;  3JCU E;  3M9Q A;  2BEZ F;  1PGP A;  3TK1 A;  5M1B A;  2E75 D;  4DJG A;  2HYN A;  3A2A A;  5B66 E;  5CCG D;  2E5Y A;  1PP9 E;  2WPQ A;  1KC8 Q;  2E74 C;  4O9B A;  2WPS A;  1OZH A;  1KYO D;  5E79 E;  3KZI E;  1VQ9 P;  1H0T B;  3VN0 A;  1M1J C;  3TGU E;  1NTM E;  2FKW B;  2XU6 A;  3GF3 A;  2V7Q J;  1L0L D;  4GDO A;  1BCC G;  3CC4 P;  3H1H D;  2YKQ A;  2WSC H;  2Q1K A;  5BU8 B;  3HD7 C;  1L0N J;  3B5N A;  4RES B;  2OGU A;  4DOJ A;  1SQP K;  1FZB A;  2R5D A;  2Q3E A;  1NU1 E;  4A7P A;  3WU2 H;  2Z5H A;  2CPS A;  2KLV A;  1RE4 C;  5CCG C;  1QEX A;  3M0A A;  3H1K D;  1IK9 A;  3RBZ A;  2QSI A;  4I7Z B;  1W2B O;  4EOT A;  4H44 C;  2WQY C;  1NTK J;  1FDI A;  1FOS E;  3H1L E;  2YMY A;  1Z56 A;  3PH0 A;  2M5A B;  1IFI A;  2HFE D;  1IFP A;  3MGN A;  1VQK P;  2QJP B;  2WSC J;  2JWA A;  1RF1 A;  3HTK B;  3CXH H;  3MUD A;  4H13 D;  3L71 E;  3N7N A;  4RO0 A;  1OWA A;  2B89 A;  2OYH C;  4KT0 J;  3FWN A;  4U3F J;  5H2F H;  1SQB K;  3TNU B;  1J1E B;  1SQV G;  2RKL A;  2IFM A;  3SWK A;  2YKP A;  3GG2 A;  1VQO P;  2O01 N;  4GIF A;  2PFX A;  3O6Q B;  1G2C A;  2A06 D;  1SQQ J;  4PD4 E;  5KLV D;  4BXL A;  2A45 G;  4YXD C;  2J59 M;  3AEF C;  2R3S A;  2G3A A;  3L75 G;  3VOP A;  3CWB J;  3FXD A;  2ZVO B;  3G9R A;  3ITK A;  3I56 P;  3AEC C;  1FOS F;  1GW4 A;  1PIX A;  1LTJ C;  2IBZ I;  3E1R A;  4RJT A;  1PGJ A;  2W6J H;  3USS A;  4L74 A;  1MUU A;  1KB9 E;  2H89 C;  4C46 A;  2J5U A;  1J1D B;  3B8E B;  1JMM A;  1VL2 A;  1E79 H;  3GLM A;  4ASV A;  1RE4 A;  5CCG A;  3CXH I;  1JTH A;  2JP3 A;  4UB6 H;  5KJ7 D;  1GL2 D;  1FZG A;  1L0L G;  1NHL A;  1RH5 B;  3RL0 B;  3B5N B;  3H1H G;  5AVX B;  3Q5S A;  1BCC E;  1JY3 O;  3S9O A;  2P2U A;  3ZDM A;  4PV1 C;  3VYI A;  3M9H A;  4BRY A;  1KQG B;  5AVY B;  3UIA A;  2H88 C;  1HJ0 A;  4IFM A;  3TYY A;  1X8Y A;  3Q5R A;  5APW A;  4HH2 A;  3AEA C;  2OYH A;  1QLE D;  3JSV C;  3E1I A;  3H1K G;  1DD3 A;  4ZKU A;  4D6T J;  4MN4 C;  2WIT A;  2BCC G;  1GK4 A;  1EQ7 A;  3AE9 C;  4TT3 H;  2NPS C;  5KJ7 C;  3AE6 C;  5AW2 B;  1GL2 C;  2C0W A;  3AE5 C;  3AE7 C;  4EI2 A;  1RF1 B;  1FJK A;  2FYN C;  1DD4 A;  4U7J A;  1VF5 B;  3II6 A;  5GTI H;  5CHX A;  2IBZ D;  1YQ4 C;  4Z1M H;  1OMI A;  1Q81 Q;  1QVG O;  3V5B A;  5K5G B;  3L72 D;  1MFT A;  2O3J A;  1VQ6 P;  3D71 A;  3B71 A;  1R8E A;  1NJI Q;  1MFZ A;  1SQX G;  3CD6 P;  4N78 E;  1BGY J;  3CXH D;  3P8C E;  1G2C B;  4OGQ D;  1DEE G;  5APS A;  2LKM A;  1LT9 A;  3M9B A;  5AW7 B;  2A06 G;  1OIP A;  5KLV G;  1IO4 A;  3A0B E;  5TIS E;  4GT1 A;  3TDK A;  1IFM A;  2FFD C;  2Q5U A;  1S5L E;  1ZOY C;  2ZYA A;  3WUT A;  1OVU A;  1FZC C;  3L75 E;  1M8O B;  2K9Y A;  2FY8 A;  5AVU B;  1WMK A;  1GMJ A;  2PAJ A;  5KKZ B;  5GTH H;  3M0D A;  3A5T A;  3CX5 H;  1OFC X;  1KIL D;  3AE1 C;  3RK3 C;  2LXC B;  1OW7 A;  2IFN A;  3H6P A;  2E75 B;  2KNC A;  2JO1 A;  2MJZ A;  1SLQ A;  1RE3 C;  3G71 P;  4OGQ C;  4JQ0 D;  5KAF E;  5CBO A;  2WSS H;  1S72 P;  1OW8 A;  1NTZ D;  1NVO A;  2I1J A;  3CCL P;  1K9M Q;  2FYU D;  1KYO E;  1A02 F;  3H1I D;  2KLU A;  2KSJ A;  4ZNC A;  1SQP J;  4BRY B;  5KJ7 A;  4NPE A;  3MZW B;  3FX0 A;  1GL2 A;  3H1H E;  3GHG A;  1IC2 A;  3L73 J;  3WUV A;  1NAF A;  2W83 C;  1LTB C;  1LWU C;  3N4X A;  1NGM B;  1JCD A;  4L73 A;  2G8Y A;  2IYP A;  4IL6 H;  4PJ0 H;  1L2P A;  3H1K E;  4U3F G;  3AE8 C;  1S9K D;  1WRG A;  1T2K D;  1KQF B;  1NTZ K;  1BGY D;  2FYU K;  1G1I A;  2OYI A;  1URQ C;  3L35 A;  2SPZ A;  4GOD A;  1J2J B;  1SQB J;  1BSN A;  3MHV A;  4H13 B;  2K3R A;  1NYH A;  2IBZ G;  1IK7 A;  2GUS A;  4WWI A;  2HLO A;  1OW6 A;  1P84 H;  1SQV D;  3L72 G;  4HKZ H;  3VMZ A;  2QJK C;  4W7Y A;  2E74 D;  3CME P;  2YIU B;  1LT9 B;  3L4F A;  2M0B A;  3S4R A;  2IX7 C;  2E42 A;  2N1T D;  1K73 Q;  1AVY A;  1BDC A;  1NWQ A;  2ZAE B;  2QEX P;  2ZXX A;  2BAS A;  3JCU H;  2N9B A;  1T2K C;  1YYC A;  2I8D A;  2A06 E;  3HD7 D;  3RK2 C;  5KLV E;  2E43 A;  3L74 D;  3EFF K;  1N73 A;  1GK6 A;  4WY4 C;  2IPP A;  3C1L A;  5E79 H;  3KZI H;  2YO3 A;  2C9N Y;  1S3J A;  1ZR2 A;  2E76 C;  4IL6 X;  1FU1 A;  3KPE A;  3HE5 A;  1WT6 A;  1RF0 C;  2WPR A;  4JF7 A;  5C39 A;  5AW1 B;  1SQV K;  2KNC B;  5AVS B;  3OA7 A;  1M56 D;  2WTY A;  3IFM A;  4H44 D;  4OVN F;  1KIL A;  3E7K A;  2N1T C;  2M8R A;  2QE7 H;  1DH3 A;  1JUN A;  3A0H E;  1NTZ G;  1QGK B;  3A7O A;  3KDP B;  2FYU G;  4EYY Q;  3EQ2 A;  3H1I G;  1EZV I;  5CJ0 A;  3G6E P;  4N3Y B;  2D2C B;  1YJW P;  1N7S B;  3GHG B;  5AW3 B;  2Q9I A;  2FXM A;  4R4M A;  3SWF A;  2QVA A;  3ABV C;  5CCH D;  2W6B A;  3Q3D A;  2QIW A;  1HWT C;  4XE5 B;  1NTM J;  3O8Z A;  1MZ9 A;  3V4Q A;  5CBN A;  1L4A C;  1XTC C;  4AYC A;  1Q90 D;  1AQ5 A;  1LGH B;  1JY2 N;  2BCC D;  3V4W A;  1GD2 E;  1KFN A;  3HUS A;  3LW5 H;  4XA4 A;  5KLI C;  1H89 A;  2POH A;  3IR9 A;  4IFD K;  3VP9 A;  1L0L K;  2OYI B;  1BGY G;  2JDI H;  1NU1 J;  2CK3 H;  2QJY C;  1PGO A;  1PL5 A;  1M57 D;  3P32 A;  3R4Y A;  1N8R Q;  3AEB C;  5CCH C;  2H43 A;  4WBA A;  4PD4 H;  5AW4 B;  1SQX D;  1PGQ A;  4L75 A;  2IBZ E;  3H1L J;  3L37 A;  1EDL A;  3BAT A;  4I6M C;  3NTN A;  3L72 E;  2M3E A;  1XTG B;  2HR3 A;  5APU A;  4IFF A;  1EZV D;  3IF4 A;  3CXH E;  2K9J A;  1X22 A;  3LW5 J;  1VQL P;  1M1J A;  2N1T A;  5AW8 B;  2R32 A;  1YJN P;  1N73 B;  5H2F E;  1RQU A;  4PV1 D;  3L74 G;  1KB9 H;  1AA0 A;  4ZKP A;  3HD7 A;  3BVH A;  2QG4 A;  3CMA P;  1FE6 A;  2BEQ D;  1L0N D;  2ZT9 C;  1ZLL A;  1IZN B;  1SFC C;  3T97 A;  3AE3 C;  1EXI A;  1SQX K;  1X0T A;  1VPC A;  1KIL B;  2NRG A;  2ZJS E;  4CPG A;  1KIL E;  1PFI A;  1KV4 A;  2K88 A;  4KHX A;  2NPS D;  2AXT E;  4Y99 C;  5KLV K;  4JPZ B;  1YHQ P;  4OWF A;  4WB4 A;  1NTZ E;  1EC5 A;  5BU5 A;  2Y0D A;  2FYU E;  2KB7 P;  3H1I E;  3HE4 A;  5AW0 B;  2JWD A;  3PHL A;  2H7H A;  1NTK D;  2WMM A;  4XFJ A;  2HOD A;  4H0L C; 
#chains in the Genus database with same CATH homology
 1NTK J;  1SQB J;  3L75 J;  1NTZ J;  1BCC J;  1BE3 J;  1KYO I;  3CWB J;  1EZV I;  2BCC J;  1L0L J;  2FYU J;  1SQQ J;  1NTM J;  3TGU J;  3H1I J;  1L0N J;  3H1H J;  3H1J J;  4U3F J;  1SQP J;  1KB9 I;  4PD4 I;  3L74 J;  1P84 I;  3L71 J;  1NU1 J;  5KLV J;  4D6T J;  3CXH I;  3BCC J;  3L72 J;  3H1K J;  1PP9 J;  1BGY J;  1SQV J;  3H1L J;  3L70 J;  3L73 J;  3CX5 I;  1SQX J;  2IBZ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...