1KYOI

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
53
structure length
53
Chain Sequence
b'SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKAKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
molecule tags Oxidoreductase/electron transport
source organism Mus musculus
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
total genus 17
structure length 53
sequence length 53
chains with identical sequence T
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1kyoI00
3BCCJ 4PD4I 3H1LJ 4D6TJ 2BCCJ 1EZVI 1L0LJ 1KB9I 1NU1J 3L70J 3L74J 1NTZJ 1SQBJ 3H1IJ 3L75J 3L73J 5KLVJ 1P84I 1NTMJ 1KYOI 1BCCJ 1SQVJ 4U3FJ 3H1KJ 1SQXJ 2FYUJ 3L71J 3L72J 1PP9J 3H1JJ 1SQQJ 3CX5I 1NTKJ 3TGUJ 1BGYJ 2IBZI 1BE3J 1SQPJ 3CWBJ 3H1HJ 3CXHI 1L0NJ
chains in the Genus database with same CATH superfamily
4IL6E 2IZ0A 1EZVI 2O1JA 2XNXA 4W7YA 1FOSE 3AECC 4IFDK 1KMIZ 2KS1A 5KAFE 2OTJP 3KXDA 1JO5A 3GF3A 4WY4C 2BCCG 1L0LG 1OW6A 2YKPA 2FYZA 3FXEA 2SPZA 4ZMDA 2OQQA 2YKOA 3PH0A 2G8YA 3H1LG 2KOGA 5AW7B 1NKNA 4H13B 1NU1D 2Z5HA 2NPSC 1Y9BA 3FXDA 1FZBA 3HD7A 3IR9A 2KSEA 3V5BA 3AEDC 3H1LE 3KPEA 3SWKA 3HD7B 2ZYDA 2KB7P 2XV5A 2NRGA 2GA1A 1VQOP 3MTUE 3PTZA 2N1TD 2NPSB 1GK6A 1EZVG 1FZEA 1BCCG 1NAFA 1GU5A 3BCCG 2H88C 4GOEA 1FJPA 1N2DC 3CXHD 1A02F 1JTHA 4U7JA 1AVYA 2O01H 2W27A 2W8ZA 4YXDC 1ZR2A 3BCCE 4WY4A 1J1EB 5KJ7A 2KS1B 2H43A 1IK9A 2XDJA 3TF5A 2YNYA 3Q5PA 1M1JC 1KYOH 3B8EB 3CWBD 5CJ4A 3GF7A 3Q5SA 3ABVC 4XFJA 1IC2A 1M8OB 1X0TA 2AXCA 1M57D 1DD3A 1G2CB 5AVUB 3IN6A 1T8ZA 1FBMA 3CCVP 4ZKPA 1BE3G 1NHLA 3HE4A 1AV1A 3H1KG 3L71J 3LW5J 5CHXA 2K1AA 2V4HA 2J58A 1HVVA 3P32A 4LC1A 4H44B 3AE9C 2LXCB 4OVNF 3B4SA 1JEKA 3AE2C 5KAIE 5DJUB 5E79H 1FZFA 4OH8B 3NXSA 3KDPB 1KILA 3CI9A 4N6JA 1SQXD 2BCCJ 2ZYAA 1KC8Q 3P8CD 4DJGA 3CC7P 1L2PA 1Q90D 2YIUB 3L75E 3RL0g 2CK3H 2WSCH 3V4WA 2KLUA 2KUBA 5KLVE 2IZ1A 3HE4B 2JR8A 1SQPD 1JM0A 1N8RQ 3HTKB 4H0LB 1R8EA 1QVFO 3A2AA 1BGYD 1H0TA 5M1BA 2K9JA 4YXWH 2OYIB 5AW1B 1VF5C 1LTJC 2E76B 4WWIA 3KHUA 1JOCA 2R5BA 2JEEA 3CX5D 3H1HE 1X22A 5AVRB 5L8RJ 2D2CC 4OGQD 1SQXJ 1GD2E 3L72J 1JTHB 5AVSB 4D6TG 1G1IA 1N7SA 1NH4A 1NTMG 3A0BH 1SQVE 1JY3P 1M1JB 2Q6QA 2PAJA 1Z56A 4U3FE 2NPSA 3HUSB 4HKZH 4N3YB 2HLOA 1OZHA 2CPBA 5CCGA 3VP9A 1AQ5A 1GZLA 3CC2P 3WU2H 1YYCA 3IAOA 1FZAA 1X79B 2N9BA 1YI2P 1W2BO 3LIEA 3BVHA 4GOFA 1Q81Q 1SQBK 1HJBA 3MGNA 4L76A 3BRTB 1RQUA 2BEQD 4GODA 4Y28J 4WB4A 1SQQD 3VYIA 2JDIH 1FS0E 4AUWA 1KFNA 3CXHE 1EXJA 3HD7C 5B66E 3L70E 4H0LD 3H1HD 3GLMA 4XA4A 4C7RA 5B5EH 3H1JE 1FDMA 1M7LA 1WMKA 2AXTH 2DW3A 2L5GB 2PRRA 2KZJA 3USSA 5KJ7C 3ITKA 4U3FJ 1K04A 2H89C 3CCMP 3SFDC 4HH2A 2IFMA 1OVVA 2KK7A 2YMYA 3H1ID 3C8VA 1J2JB 5AW9B 2ZAEB 2QJKB 1TU3F 3MUDA 1NU1E 1N86A 1EXIA 1KTMA 1FAVA 3AE7C 1LT9B 2ZJSE 5AW5B 1SQXE 1VQ8P 1KV4A 3MD0A 1FZGA 4BRYB 2ZVNB 4LLHA 1U7MA 2Q7CA 2A45I 5APVA 2KZIA 1PP9D 2K88A 2KIKA 3QWOC 4O9BA 1NTKD 4L73A 5GTHE 3CCQP 3GG2A 5GTIE 2HODA 2E5TA 3A0BE 3AE1C 1ZN5A 4JPZB 4OWFA 5BU5A 3H1IJ 5KKZB 1VQ6P 5AVXB 4JYCA 1VQKP 3VMZA 3C9IA 1P84I 1NTMJ 2B88A 4IFFA 4IL6H 1L0ND 1Y47A 3RK2C 2WSEH 3RK2D 3CWBE 1HUCA 3GHGB 1J1DC 2FYNC 1SQQG 3AEBC 1NTZD 1SQVK 3O6QA 4NPEA 2I1JA 3SWFA 1KORA 1NTZG 3E7KA 3Q1MA 1QLED 2M3BA 2IBZI 2Z5IA 3L35A 3B5NB 1VQ5P 3RK3B 2H7HA 3LW5H 5B5EE 3V2PA 3A7OA 1YTZT 3L72E 1N7SC 2Q3EA 3M9QA 5CBOA 2A45G 2B89A 2LR2A 1BE3E 3H32A 1EDLA 1JUNA 3CCEP 1NTMD 2M5AB 3NFQA 1UIIA 3L72G 2R5DA 3PLNA 1NAYA 1SLQA 4OGQC 2D2CB 5CCGC 1K73Q 3IF4A 1PP9G 1LTBC 1FDIA 2N1TC 1NTZJ 2FBWC 2JKVA 1IFJA 2KLVA 1PL5A 2ZVOB 5CMZA 1MFTA 1PFIA 3CCLP 1KN7A 1KZUB 4UB8H 1PP9E 1FDOA 2N9YB 1YHQP 2QRXA 4N78E 2AEJA 1QVGO 2OYIC 1IJDB 2R44A 3QH9A 3AE8C 2WPVB 3A5TA 1VQ9P 3HE5A 3GHGC 2FXOA 1L4AC 1PV3A 4ASVA 2JO1A 2YIUC 4KHXA 3WUUA 4ZKUA 1Q7YQ 1AQTA 1USEA 1LNQA 3HD7D 2FYUK 1Q82Q 3NTNA 5KLVD 2L91A 1IO4A 3CPWO 3OJAB 3CCRP 4IOIH 2GUVA 4H44C 4GDOA 4PD4I 4D6TJ 5DJTB 5KLVG 4NPFX 3U1AA 1S9KD 1ZW0A 4NPDA 1NVOA 3SSUA 3F89A 3H1JD 1KB9H 1T2KD 4EI2A 2W83C 4YPCA 1HGZA 2E75C 1USDA 5KAIH 2ZYGA 1ZRTE 3CMAP 2IBZE 5E79E 1S4XA 2A06D 2M0BA 2VRSA 1RF0A 4I2LC 4PV1B 4WY4D 3TNUA 2WSFH 2P1JA 1LWUB 5APXA 3MHVA 1OWAA 1ZLLA 2H8PD 1NO4A 2NZ2A 1ZMEC 4EDFA 2QJYC 3V6IA 2RN0A 4LGDE 4PV1D 1AA0A 2Y9YA 3TK1A 3UIAA 4D6TD 5BU8B 3AE4C 1URQD 4MN4C 4UB6E 1FC2C 2A06E 3VMYA 4HB1A 1VQ4P 1JY2N 1X9VA 1T3JA 5KLIB 2HPCA 3U59A 2IDBA 3JSVC 1XTCC 3P7KA 4UB8E 2B87B 3FWNA 2A06G 2A45H 2KNCA 2KYVA 3AEEC 2O3JA 5C39A 2I1KA 3S4RA 3I5CA 2QEXP 1SQBE 3L74J 1K05A 1DEEG 2NPSD 5AW3B 2JJLA 4H13C 2QJKC 1PZQA 3IFMA 2RMZA 3H1JG 1NU1G 4K35A 3G6EP 1DIPA 1N73A 1IFPA 1SFCA 1XTGB 3L4FA 2FXMA 1RHZB 3H1LD 1SQXG 1S5LE 2YXQB 4TT3H 3L73J 3SWYA 5KJ7D 4I1LA 1OW8A 2ZT9B 3FWLA 1FU1A 1L0LD 3FGAD 5APQA 1KFMA 5AW8B 3WU2E 2BCCD 3I55P 1YTZI 3V2QA 3PRJA 4GT1A 2XU6A 1BDDA 1HTLC 1KQFB 2KP8A 1KB9E 1OMIA 5AW2B 3VP8A 1GL2B 4N78D 1VL2A 2BCCE 3D6ZA 3CCJP 1IFMA 1SQPJ 1L0LE 3L74E 1Q2NA 3M0DA 1LTJB 2E76C 3G3ZA 5B66H 2OARA 1FZCA 1WRGA 4JF7A 3FX0A 1R5SA 1VQLP 2AXTE 1MZ9A 3H1LJ 3CWBG 3KYQA 4HJGH 3N7NA 2FFDA 3M91A 2GM4A 1SS1A 4ASWA 3BRVB 3M0DC 1HBWA 1KILD 3H1IG 1RQVA 2N1TB 4Z1MH 2Y0EA 4W80A 2OYHA 1LTGC 3L72D 2WT7A 1N73C 2LXBA 1SVFA 3KZIE 4DCKA 3PHLA 3BCCD 2P67A 1EZVD 1YQ3C 3T97B 2WVRA 1NTKK 1SQQE 1EZVE 3BASA 1YBKA 4KT0J 1WT6A 1NTZE 1VF5D 1VF5B 1PPJG 1S3JA 3B5NC 3KQGA 5GTHH 1SP4A 1L0NE 4AQRD 4PJ0H 4R4LA 5GTIH 1L0NK 5TISE 2HYNA 1PIXA 2E75D 1IFIA 1S72P 5APWA 1L0NG 1ZP0C 1NTZK 1RE3C 1SQVD 3GW6A 4PD4H 4Y99C 4B86A 3CCSP 1YJWP 3BCCJ 1NTKE 1SQQK 2KSJA 2WZ7A 1CI6A 2YO3A 3RGUA 1GU4A 1NGMB 3CC4P 1BSHA 1OIPA 2BEZF 1YJ9P 1HWTC 2W6JH 2WT7B 4C7NA 4DOJA 1VQPP 1NTKG 3JCUH 2N1TA 3ZDMA 2ZXXA 2WSEJ 3RBZA 2JWAA 3PP5A 1HJ0A 1SQBJ 2WSCJ 1M90Q 1E5WA 1AFOA 2YKQA 4CPGA 4I6MC 2FFDB 5APUA 2IFNA 3AE5C 3P8MC 1SQVJ 5AW4B 1LTJA 3MP7B 3H1KJ 2QG4A 4KJMA 2Y0CA 1QEXA 1SQPG 2K9YA 4W7ZA 1VQMP 3B71A 1VPCA 1P84D 1PP9J 2E76D 1IZNB 2WSFJ 1NTKJ 3L70G 3RK3C 3AEGC 3RL0C 5AVZB 1G1JA 2IBZG 1GW4A 3F5HA 5AVWB 1R5LA 2QSIA 1GL2C 3H32B 2O1KA 2KXPB 4I7ZB 2IPPA 3TSIA 2AEMA 3H1HG 3VOPA 1J1DB 1S1CX 1T3UA 2FYNB 5H2FH 4RJTA 1SFCD 2E74B 3M9BA 2FYUD 2GUSA 1ZV8A 1OXZA 1YQ4C 3LIDA 1MUUA 1NTME 4PJ0E 3H1KD 3VN0A 1T2KC 2Q1KA 1BE3D 1IK7A 2K3RA 3TGUG 5TISH 3TYYA 1DX7A 1IFNA 2HG5D 1HGVA 2MJZA 3AE3C 3RL0B 1E79H 3E1IA 1CSBA 2WITA 3M9HA 4RKUJ 4RO0A 1URQA 1ZRTD 2QJYB 2W6BA 4EYYQ 3TGUE 1SQBG 2QA4P 3MIWA 4EOTA 1K9MQ 3V2NA 3U1CA 3PJSK 3EWKA 4GIFA 4PV1C 3L75G 4ZNCA 1LWUC 3II6A 5EFWB 4C7NB 1JMBA 3A0HH 3Q5RA 4TLFA 1URQC 1W2EA 3B5ND 3H25A 1CI6B 1D7MA 2ZXEB 1S9KE 1BCCD 5CCHD 1NTMK 1YJNP 1X8YA 2WQYC 2YO2A 1JY3O 2Q9IA 3L73G 1JCCA 2ITAA 2V7QJ 3TNUB 4BRYA 3A3YB 2ZFCA 3JC22 1OVUA 1BGYG 2QE7H 1NU1J 1GW3A 3L73E 1OW7A 1LP1B 5AW6B 1LP1A 1JB0J 3CL3D 3L74G 4UB6H 2Q3IA 1LTSC 4Y99B 3Q3DA 1NKZB 2XZRA 1Y8AA 2E75B 1P84H 1VDFA 3WMM0 1OX3A 4JYBA 3T97A 5KLVJ 1BCCJ 3AEAC 5H2FE 1EC5A 4YTPC 1RE4C 5APTA 2P10A 3H1IE 3MZWB 3OA7A 4OGQB 5KLVK 2OYHB 2WTYA 3H1JJ 3EFFK 4H0LC 3SFEC 3D70A 3HE5B 3OAKA 1JY3N 1AJYA 2MKVA 1ZOYC 2C9LY 3CWBJ 4H44D 2E42A 1URQB 1GK4A 2QM8A 1S5LH 2B9BA 3CXHI 5CJ0A 4BXLA 1RE4A 4QMAA 3L71E 3D71A 2K37A 1GDTA 5BVZA 1FZCB 1LTTC 2AEFA 3HRNA 3HUSA 3WUVA 1FOSF 3CMEP 2O01N 3L71D 1GL2A 5AVYB 1M1JA 5KKZC 2P7JA 1J1EC 2Y0DA 1JNMA 3OW2O 3N4XA 1KQSO 3A0HE 1EDKA 1SQXK 2M5AA 3BATA 2Y9ZA 3RK3D 1Q86Q 1LGHB 2I8DA 2WWWA 5K5GB 5AW0B 1UIXA 1NU1K 2WPSA 4HYTB 2WSSH 1ZR4A 2O01J 1PPJE 3G71P 2D2CD 4DT0A 4IL6X 2RH0A 5TJHA 2FXPA 3R2PA 5APYA 1N73B 2K9JB 3B5NA 2OYIA 4K3AA 3L74D 3GMAA 5CCHA 1H0TB 4A7PA 2IYPA 1JMMA 1BGYJ 1KB9D 1RY3A 3O6QB 3KZIH 3GHGA 3CX5H 4BWNA 1RE3A 3M0AA 2HFED 2UWJE 1A02J 1KYOE 1LJ2A 3W68A 3CCUP 3L73D 2HR3A 1U7JA 1YIJP 2HPCB 2R3CA 3S1KA 1VQ7P 1OVRA 2OTKE 1L0LJ 1SQPE 1KB9I 1W5CE 1M56D 3RK2B 1IFDA 1KD1Q 1QX8A 2E74C 1VQNP 5KLIC 4JQ0D 1BCCE 3AE6C 2POHA 5AVVB 2FFDC 1L0LK 1FZCC 3L37A 2C9NY 2ZT9C 2Q5UA 4I7ZC 1LWUA 1ZXGA 4C46A 1KQGB 2PFXA 4PD4E 3TDKA 2FKWB 3CD6P 1HF9A 3L70D 3E1RA 3NMDA 2JWDA 1LT9A 3VMAA 5AVQB 1FJKA 1JCDA 5AVTB 1GMJA 4GKGA 2BASA 3VMXA 4IFMA 1T6AA 2ZT9D 1SQQJ 2M3EA 3JCUE 4WY4B 2FYUG 3EFGA 1M1KQ 2CPSA 2QVAA 3V4QA 1H88A 1K8AQ 3H1HJ 3H1KE 2LKMA 1EQ7A 1GL2D 3MUDC 2FYUE 2E5YA 3S9OA 1NWQA 4EIJA 1SQPK 4U3FD 1KILC 3G9RA 1AVOA 1L4AD 4L74A 3L70J 3RBXA 1N7LA 2J59M 2V7QH 4M3LA 1DEBA 3WUTA 4XE5B 5KTBA 3VTPC 1GTWA 4PD4D 1OFCX 3CX5E 2OTLP 3CLQA 3V2RA 3O8ZA 3W67A 1LT1A 2G3AA 2QM7A 1S5LX 1SFCC 4RESB 1N7SD 2RKLA 1HH0A 1KYOI 1BGYE 4R4MA 1RF1C 1DH3A 1KQLA 5CCGD 5KAFH 2QJPB 1N7SB 2C0WA 3AEFC 2OYOA 1BDCA 1U57A 3HUSC 3L75D 2PGDA 3P8CE 1QGKB 1KYOD 2IX7C 2QJPC 3CXHH 3EQ2A 3I56P 1MFZA 1QL2A 1BSNA 1PGOA 1SQBD 1PGQA 5CCHC 5CBNA 1NJIQ 1L0NJ 2FY8A 3H6PA 1NYHA 1SQVG 2P2UA 1MV8A 1SFCB 2E74D 2JP3A 2PP6A 1LTAC 2W6AA 3M06A 1QL1A 4WVZA 3Q2YA 1RH5B 3R4YA 1L4AB 3HTKA 2R32A 3K5BA 5APSA 2R3SA 3TGUD 2E43A 3D6YA 4JBZA 1CW5A 1PPJD 1FE6A 1JY2P 2XKMA 1CZQA 1RF0C 2W90A 2YMKA 2KNCB 3RL0D 2C0XA 2WPQA 2B87A 3L75J 2OYHC 1EDIA 2M8RA 2XNDH 4U3FG 3RK3E 1KILB 3C1LA 2KI7B 2OGUA 1S2EA 1RF1B 1RF1A 2J5UA 4H13D 4D6TE 2IBZD 4AYCA 2WMMA 2HODB 3L36A 2IYOA 1LTIC 2FYUJ 1DD4A 4L75A 1H89A 1JY2O 1NOHA 2QIWA 1PGJA 1LT9C 3CX5I 4WBAA 3L71G 3TGUJ 2Z4EA 1BE3J 4DZOA 1L4AA 1MKMA 1H8AA 1EDJA 1G2CA 1P84E 1PGPA 1KILE 2P58A 2WPRA 2YXRB 3G4SP 1YITP
chains in the Genus database with same CATH topology
3BCCJ 4PD4I 3H1LJ 4D6TJ 2BCCJ 1EZVI 1L0LJ 1KB9I 1NU1J 3L70J 3L74J 1NTZJ 1SQBJ 3H1IJ 3L75J 3L73J 5KLVJ 1P84I 1NTMJ 1KYOI 1BCCJ 1SQVJ 4U3FJ 3H1KJ 1SQXJ 2FYUJ 3L71J 3L72J 1PP9J 3H1JJ 1SQQJ 3CX5I 1NTKJ 3TGUJ 1BGYJ 2IBZI 1BE3J 1SQPJ 3CWBJ 3H1HJ 3CXHI 1L0NJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCC J;  4PD4 I;  3H1L J;  4D6T J;  2BCC J;  1EZV I;  1L0L J;  1KB9 I;  1NU1 J;  3L70 J;  3L74 J;  1NTZ J;  1SQB J;  3H1I J;  3L75 J;  3L73 J;  5KLV J;  1P84 I;  1NTM J;  1KYO I;  1BCC J;  1SQV J;  4U3F J;  3H1K J;  1SQX J;  2FYU J;  3L71 J;  3L72 J;  1PP9 J;  3H1J J;  1SQQ J;  3CX5 I;  1NTK J;  3TGU J;  1BGY J;  2IBZ I;  1BE3 J;  1SQP J;  3CWB J;  3H1H J;  3CXH I;  1L0N J; 
#chains in the Genus database with same CATH topology
 4IL6 E;  2IZ0 A;  1EZV I;  2O1J A;  2XNX A;  4W7Y A;  1FOS E;  3AEC C;  4IFD K;  1KMI Z;  2KS1 A;  5KAF E;  2OTJ P;  3KXD A;  1JO5 A;  3GF3 A;  4WY4 C;  2BCC G;  1L0L G;  1OW6 A;  2YKP A;  2FYZ A;  3FXE A;  2SPZ A;  4ZMD A;  2OQQ A;  2YKO A;  3PH0 A;  2G8Y A;  3H1L G;  2KOG A;  5AW7 B;  1NKN A;  4H13 B;  1NU1 D;  2Z5H A;  2NPS C;  1Y9B A;  3FXD A;  1FZB A;  3HD7 A;  3IR9 A;  2KSE A;  3V5B A;  3AED C;  3H1L E;  3KPE A;  3SWK A;  3HD7 B;  2ZYD A;  2KB7 P;  2XV5 A;  2NRG A;  2GA1 A;  1VQO P;  3MTU E;  3PTZ A;  2N1T D;  2NPS B;  1GK6 A;  1EZV G;  1FZE A;  1BCC G;  1NAF A;  1GU5 A;  3BCC G;  2H88 C;  4GOE A;  1FJP A;  1N2D C;  3CXH D;  1A02 F;  1JTH A;  4U7J A;  1AVY A;  2O01 H;  2W27 A;  2W8Z A;  4YXD C;  1ZR2 A;  3BCC E;  4WY4 A;  1J1E B;  5KJ7 A;  2KS1 B;  2H43 A;  1IK9 A;  2XDJ A;  3TF5 A;  2YNY A;  3Q5P A;  1M1J C;  1KYO H;  3B8E B;  3CWB D;  5CJ4 A;  3GF7 A;  3Q5S A;  3ABV C;  4XFJ A;  1IC2 A;  1M8O B;  1X0T A;  2AXC A;  1M57 D;  1DD3 A;  1G2C B;  5AVU B;  3IN6 A;  1T8Z A;  1FBM A;  3CCV P;  4ZKP A;  1BE3 G;  1NHL A;  3HE4 A;  1AV1 A;  3H1K G;  3L71 J;  3LW5 J;  5CHX A;  2K1A A;  2V4H A;  2J58 A;  1HVV A;  3P32 A;  4LC1 A;  4H44 B;  3AE9 C;  2LXC B;  4OVN F;  3B4S A;  1JEK A;  3AE2 C;  5KAI E;  5DJU B;  5E79 H;  1FZF A;  4OH8 B;  3NXS A;  3KDP B;  1KIL A;  3CI9 A;  4N6J A;  1SQX D;  2BCC J;  2ZYA A;  1KC8 Q;  3P8C D;  4DJG A;  3CC7 P;  1L2P A;  1Q90 D;  2YIU B;  3L75 E;  3RL0 g;  2CK3 H;  2WSC H;  3V4W A;  2KLU A;  2KUB A;  5KLV E;  2IZ1 A;  3HE4 B;  2JR8 A;  1SQP D;  1JM0 A;  1N8R Q;  3HTK B;  4H0L B;  1R8E A;  1QVF O;  3A2A A;  1BGY D;  1H0T A;  5M1B A;  2K9J A;  4YXW H;  2OYI B;  5AW1 B;  1VF5 C;  1LTJ C;  2E76 B;  4WWI A;  3KHU A;  1JOC A;  2R5B A;  2JEE A;  3CX5 D;  3H1H E;  1X22 A;  5AVR B;  5L8R J;  2D2C C;  4OGQ D;  1SQX J;  1GD2 E;  3L72 J;  1JTH B;  5AVS B;  4D6T G;  1G1I A;  1N7S A;  1NH4 A;  1NTM G;  3A0B H;  1SQV E;  1JY3 P;  1M1J B;  2Q6Q A;  2PAJ A;  1Z56 A;  4U3F E;  2NPS A;  3HUS B;  4HKZ H;  4N3Y B;  2HLO A;  1OZH A;  2CPB A;  5CCG A;  3VP9 A;  1AQ5 A;  1GZL A;  3CC2 P;  3WU2 H;  1YYC A;  3IAO A;  1FZA A;  1X79 B;  2N9B A;  1YI2 P;  1W2B O;  3LIE A;  3BVH A;  4GOF A;  1Q81 Q;  1SQB K;  1HJB A;  3MGN A;  4L76 A;  3BRT B;  1RQU A;  2BEQ D;  4GOD A;  4Y28 J;  4WB4 A;  1SQQ D;  3VYI A;  2JDI H;  1FS0 E;  4AUW A;  1KFN A;  3CXH E;  1EXJ A;  3HD7 C;  5B66 E;  3L70 E;  4H0L D;  3H1H D;  3GLM A;  4XA4 A;  4C7R A;  5B5E H;  3H1J E;  1FDM A;  1M7L A;  1WMK A;  2AXT H;  2DW3 A;  2L5G B;  2PRR A;  2KZJ A;  3USS A;  5KJ7 C;  3ITK A;  4U3F J;  1K04 A;  2H89 C;  3CCM P;  3SFD C;  4HH2 A;  2IFM A;  1OVV A;  2KK7 A;  2YMY A;  3H1I D;  3C8V A;  1J2J B;  5AW9 B;  2ZAE B;  2QJK B;  1TU3 F;  3MUD A;  1NU1 E;  1N86 A;  1EXI A;  1KTM A;  1FAV A;  3AE7 C;  1LT9 B;  2ZJS E;  5AW5 B;  1SQX E;  1VQ8 P;  1KV4 A;  3MD0 A;  1FZG A;  4BRY B;  2ZVN B;  4LLH A;  1U7M A;  2Q7C A;  2A45 I;  5APV A;  2KZI A;  1PP9 D;  2K88 A;  2KIK A;  3QWO C;  4O9B A;  1NTK D;  4L73 A;  5GTH E;  3CCQ P;  3GG2 A;  5GTI E;  2HOD A;  2E5T A;  3A0B E;  3AE1 C;  1ZN5 A;  4JPZ B;  4OWF A;  5BU5 A;  3H1I J;  5KKZ B;  1VQ6 P;  5AVX B;  4JYC A;  1VQK P;  3VMZ A;  3C9I A;  1P84 I;  1NTM J;  2B88 A;  4IFF A;  4IL6 H;  1L0N D;  1Y47 A;  3RK2 C;  2WSE H;  3RK2 D;  3CWB E;  1HUC A;  3GHG B;  1J1D C;  2FYN C;  1SQQ G;  3AEB C;  1NTZ D;  1SQV K;  3O6Q A;  4NPE A;  2I1J A;  3SWF A;  1KOR A;  1NTZ G;  3E7K A;  3Q1M A;  1QLE D;  2M3B A;  2IBZ I;  2Z5I A;  3L35 A;  3B5N B;  1VQ5 P;  3RK3 B;  2H7H A;  3LW5 H;  5B5E E;  3V2P A;  3A7O A;  1YTZ T;  3L72 E;  1N7S C;  2Q3E A;  3M9Q A;  5CBO A;  2A45 G;  2B89 A;  2LR2 A;  1BE3 E;  3H32 A;  1EDL A;  1JUN A;  3CCE P;  1NTM D;  2M5A B;  3NFQ A;  1UII A;  3L72 G;  2R5D A;  3PLN A;  1NAY A;  1SLQ A;  4OGQ C;  2D2C B;  5CCG C;  1K73 Q;  3IF4 A;  1PP9 G;  1LTB C;  1FDI A;  2N1T C;  1NTZ J;  2FBW C;  2JKV A;  1IFJ A;  2KLV A;  1PL5 A;  2ZVO B;  5CMZ A;  1MFT A;  1PFI A;  3CCL P;  1KN7 A;  1KZU B;  4UB8 H;  1PP9 E;  1FDO A;  2N9Y B;  1YHQ P;  2QRX A;  4N78 E;  2AEJ A;  1QVG O;  2OYI C;  1IJD B;  2R44 A;  3QH9 A;  3AE8 C;  2WPV B;  3A5T A;  1VQ9 P;  3HE5 A;  3GHG C;  2FXO A;  1L4A C;  1PV3 A;  4ASV A;  2JO1 A;  2YIU C;  4KHX A;  3WUU A;  4ZKU A;  1Q7Y Q;  1AQT A;  1USE A;  1LNQ A;  3HD7 D;  2FYU K;  1Q82 Q;  3NTN A;  5KLV D;  2L91 A;  1IO4 A;  3CPW O;  3OJA B;  3CCR P;  4IOI H;  2GUV A;  4H44 C;  4GDO A;  4PD4 I;  4D6T J;  5DJT B;  5KLV G;  4NPF X;  3U1A A;  1S9K D;  1ZW0 A;  4NPD A;  1NVO A;  3SSU A;  3F89 A;  3H1J D;  1KB9 H;  1T2K D;  4EI2 A;  2W83 C;  4YPC A;  1HGZ A;  2E75 C;  1USD A;  5KAI H;  2ZYG A;  1ZRT E;  3CMA P;  2IBZ E;  5E79 E;  1S4X A;  2A06 D;  2M0B A;  2VRS A;  1RF0 A;  4I2L C;  4PV1 B;  4WY4 D;  3TNU A;  2WSF H;  2P1J A;  1LWU B;  5APX A;  3MHV A;  1OWA A;  1ZLL A;  2H8P D;  1NO4 A;  2NZ2 A;  1ZME C;  4EDF A;  2QJY C;  3V6I A;  2RN0 A;  4LGD E;  4PV1 D;  1AA0 A;  2Y9Y A;  3TK1 A;  3UIA A;  4D6T D;  5BU8 B;  3AE4 C;  1URQ D;  4MN4 C;  4UB6 E;  1FC2 C;  2A06 E;  3VMY A;  4HB1 A;  1VQ4 P;  1JY2 N;  1X9V A;  1T3J A;  5KLI B;  2HPC A;  3U59 A;  2IDB A;  3JSV C;  1XTC C;  3P7K A;  4UB8 E;  2B87 B;  3FWN A;  2A06 G;  2A45 H;  2KNC A;  2KYV A;  3AEE C;  2O3J A;  5C39 A;  2I1K A;  3S4R A;  3I5C A;  2QEX P;  1SQB E;  3L74 J;  1K05 A;  1DEE G;  2NPS D;  5AW3 B;  2JJL A;  4H13 C;  2QJK C;  1PZQ A;  3IFM A;  2RMZ A;  3H1J G;  1NU1 G;  4K35 A;  3G6E P;  1DIP A;  1N73 A;  1IFP A;  1SFC A;  1XTG B;  3L4F A;  2FXM A;  1RHZ B;  3H1L D;  1SQX G;  1S5L E;  2YXQ B;  4TT3 H;  3L73 J;  3SWY A;  5KJ7 D;  4I1L A;  1OW8 A;  2ZT9 B;  3FWL A;  1FU1 A;  1L0L D;  3FGA D;  5APQ A;  1KFM A;  5AW8 B;  3WU2 E;  2BCC D;  3I55 P;  1YTZ I;  3V2Q A;  3PRJ A;  4GT1 A;  2XU6 A;  1BDD A;  1HTL C;  1KQF B;  2KP8 A;  1KB9 E;  1OMI A;  5AW2 B;  3VP8 A;  1GL2 B;  4N78 D;  1VL2 A;  2BCC E;  3D6Z A;  3CCJ P;  1IFM A;  1SQP J;  1L0L E;  3L74 E;  1Q2N A;  3M0D A;  1LTJ B;  2E76 C;  3G3Z A;  5B66 H;  2OAR A;  1FZC A;  1WRG A;  4JF7 A;  3FX0 A;  1R5S A;  1VQL P;  2AXT E;  1MZ9 A;  3H1L J;  3CWB G;  3KYQ A;  4HJG H;  3N7N A;  2FFD A;  3M91 A;  2GM4 A;  1SS1 A;  4ASW A;  3BRV B;  3M0D C;  1HBW A;  1KIL D;  3H1I G;  1RQV A;  2N1T B;  4Z1M H;  2Y0E A;  4W80 A;  2OYH A;  1LTG C;  3L72 D;  2WT7 A;  1N73 C;  2LXB A;  1SVF A;  3KZI E;  4DCK A;  3PHL A;  3BCC D;  2P67 A;  1EZV D;  1YQ3 C;  3T97 B;  2WVR A;  1NTK K;  1SQQ E;  1EZV E;  3BAS A;  1YBK A;  4KT0 J;  1WT6 A;  1NTZ E;  1VF5 D;  1VF5 B;  1PPJ G;  1S3J A;  3B5N C;  3KQG A;  5GTH H;  1SP4 A;  1L0N E;  4AQR D;  4PJ0 H;  4R4L A;  5GTI H;  1L0N K;  5TIS E;  2HYN A;  1PIX A;  2E75 D;  1IFI A;  1S72 P;  5APW A;  1L0N G;  1ZP0 C;  1NTZ K;  1RE3 C;  1SQV D;  3GW6 A;  4PD4 H;  4Y99 C;  4B86 A;  3CCS P;  1YJW P;  3BCC J;  1NTK E;  1SQQ K;  2KSJ A;  2WZ7 A;  1CI6 A;  2YO3 A;  3RGU A;  1GU4 A;  1NGM B;  3CC4 P;  1BSH A;  1OIP A;  2BEZ F;  1YJ9 P;  1HWT C;  2W6J H;  2WT7 B;  4C7N A;  4DOJ A;  1VQP P;  1NTK G;  3JCU H;  2N1T A;  3ZDM A;  2ZXX A;  2WSE J;  3RBZ A;  2JWA A;  3PP5 A;  1HJ0 A;  1SQB J;  2WSC J;  1M90 Q;  1E5W A;  1AFO A;  2YKQ A;  4CPG A;  4I6M C;  2FFD B;  5APU A;  2IFN A;  3AE5 C;  3P8M C;  1SQV J;  5AW4 B;  1LTJ A;  3MP7 B;  3H1K J;  2QG4 A;  4KJM A;  2Y0C A;  1QEX A;  1SQP G;  2K9Y A;  4W7Z A;  1VQM P;  3B71 A;  1VPC A;  1P84 D;  1PP9 J;  2E76 D;  1IZN B;  2WSF J;  1NTK J;  3L70 G;  3RK3 C;  3AEG C;  3RL0 C;  5AVZ B;  1G1J A;  2IBZ G;  1GW4 A;  3F5H A;  5AVW B;  1R5L A;  2QSI A;  1GL2 C;  3H32 B;  2O1K A;  2KXP B;  4I7Z B;  2IPP A;  3TSI A;  2AEM A;  3H1H G;  3VOP A;  1J1D B;  1S1C X;  1T3U A;  2FYN B;  5H2F H;  4RJT A;  1SFC D;  2E74 B;  3M9B A;  2FYU D;  2GUS A;  1ZV8 A;  1OXZ A;  1YQ4 C;  3LID A;  1MUU A;  1NTM E;  4PJ0 E;  3H1K D;  3VN0 A;  1T2K C;  2Q1K A;  1BE3 D;  1IK7 A;  2K3R A;  3TGU G;  5TIS H;  3TYY A;  1DX7 A;  1IFN A;  2HG5 D;  1HGV A;  2MJZ A;  3AE3 C;  3RL0 B;  1E79 H;  3E1I A;  1CSB A;  2WIT A;  3M9H A;  4RKU J;  4RO0 A;  1URQ A;  1ZRT D;  2QJY B;  2W6B A;  4EYY Q;  3TGU E;  1SQB G;  2QA4 P;  3MIW A;  4EOT A;  1K9M Q;  3V2N A;  3U1C A;  3PJS K;  3EWK A;  4GIF A;  4PV1 C;  3L75 G;  4ZNC A;  1LWU C;  3II6 A;  5EFW B;  4C7N B;  1JMB A;  3A0H H;  3Q5R A;  4TLF A;  1URQ C;  1W2E A;  3B5N D;  3H25 A;  1CI6 B;  1D7M A;  2ZXE B;  1S9K E;  1BCC D;  5CCH D;  1NTM K;  1YJN P;  1X8Y A;  2WQY C;  2YO2 A;  1JY3 O;  2Q9I A;  3L73 G;  1JCC A;  2ITA A;  2V7Q J;  3TNU B;  4BRY A;  3A3Y B;  2ZFC A;  3JC2 2;  1OVU A;  1BGY G;  2QE7 H;  1NU1 J;  1GW3 A;  3L73 E;  1OW7 A;  1LP1 B;  5AW6 B;  1LP1 A;  1JB0 J;  3CL3 D;  3L74 G;  4UB6 H;  2Q3I A;  1LTS C;  4Y99 B;  3Q3D A;  1NKZ B;  2XZR A;  1Y8A A;  2E75 B;  1P84 H;  1VDF A;  3WMM 0;  1OX3 A;  4JYB A;  3T97 A;  5KLV J;  1BCC J;  3AEA C;  5H2F E;  1EC5 A;  4YTP C;  1RE4 C;  5APT A;  2P10 A;  3H1I E;  3MZW B;  3OA7 A;  4OGQ B;  5KLV K;  2OYH B;  2WTY A;  3H1J J;  3EFF K;  4H0L C;  3SFE C;  3D70 A;  3HE5 B;  3OAK A;  1JY3 N;  1AJY A;  2MKV A;  1ZOY C;  2C9L Y;  3CWB J;  4H44 D;  2E42 A;  1URQ B;  1GK4 A;  2QM8 A;  1S5L H;  2B9B A;  3CXH I;  5CJ0 A;  4BXL A;  1RE4 A;  4QMA A;  3L71 E;  3D71 A;  2K37 A;  1GDT A;  5BVZ A;  1FZC B;  1LTT C;  2AEF A;  3HRN A;  3HUS A;  3WUV A;  1FOS F;  3CME P;  2O01 N;  3L71 D;  1GL2 A;  5AVY B;  1M1J A;  5KKZ C;  2P7J A;  1J1E C;  2Y0D A;  1JNM A;  3OW2 O;  3N4X A;  1KQS O;  3A0H E;  1EDK A;  1SQX K;  2M5A A;  3BAT A;  2Y9Z A;  3RK3 D;  1Q86 Q;  1LGH B;  2I8D A;  2WWW A;  5K5G B;  5AW0 B;  1UIX A;  1NU1 K;  2WPS A;  4HYT B;  2WSS H;  1ZR4 A;  2O01 J;  1PPJ E;  3G71 P;  2D2C D;  4DT0 A;  4IL6 X;  2RH0 A;  5TJH A;  2FXP A;  3R2P A;  5APY A;  1N73 B;  2K9J B;  3B5N A;  2OYI A;  4K3A A;  3L74 D;  3GMA A;  5CCH A;  1H0T B;  4A7P A;  2IYP A;  1JMM A;  1BGY J;  1KB9 D;  1RY3 A;  3O6Q B;  3KZI H;  3GHG A;  3CX5 H;  4BWN A;  1RE3 A;  3M0A A;  2HFE D;  2UWJ E;  1A02 J;  1KYO E;  1LJ2 A;  3W68 A;  3CCU P;  3L73 D;  2HR3 A;  1U7J A;  1YIJ P;  2HPC B;  2R3C A;  3S1K A;  1VQ7 P;  1OVR A;  2OTK E;  1L0L J;  1SQP E;  1KB9 I;  1W5C E;  1M56 D;  3RK2 B;  1IFD A;  1KD1 Q;  1QX8 A;  2E74 C;  1VQN P;  5KLI C;  4JQ0 D;  1BCC E;  3AE6 C;  2POH A;  5AVV B;  2FFD C;  1L0L K;  1FZC C;  3L37 A;  2C9N Y;  2ZT9 C;  2Q5U A;  4I7Z C;  1LWU A;  1ZXG A;  4C46 A;  1KQG B;  2PFX A;  4PD4 E;  3TDK A;  2FKW B;  3CD6 P;  1HF9 A;  3L70 D;  3E1R A;  3NMD A;  2JWD A;  1LT9 A;  3VMA A;  5AVQ B;  1FJK A;  1JCD A;  5AVT B;  1GMJ A;  4GKG A;  2BAS A;  3VMX A;  4IFM A;  1T6A A;  2ZT9 D;  1SQQ J;  2M3E A;  3JCU E;  4WY4 B;  2FYU G;  3EFG A;  1M1K Q;  2CPS A;  2QVA A;  3V4Q A;  1H88 A;  1K8A Q;  3H1H J;  3H1K E;  2LKM A;  1EQ7 A;  1GL2 D;  3MUD C;  2FYU E;  2E5Y A;  3S9O A;  1NWQ A;  4EIJ A;  1SQP K;  4U3F D;  1KIL C;  3G9R A;  1AVO A;  1L4A D;  4L74 A;  3L70 J;  3RBX A;  1N7L A;  2J59 M;  2V7Q H;  4M3L A;  1DEB A;  3WUT A;  4XE5 B;  5KTB A;  3VTP C;  1GTW A;  4PD4 D;  1OFC X;  3CX5 E;  2OTL P;  3CLQ A;  3V2R A;  3O8Z A;  3W67 A;  1LT1 A;  2G3A A;  2QM7 A;  1S5L X;  1SFC C;  4RES B;  1N7S D;  2RKL A;  1HH0 A;  1KYO I;  1BGY E;  4R4M A;  1RF1 C;  1DH3 A;  1KQL A;  5CCG D;  5KAF H;  2QJP B;  1N7S B;  2C0W A;  3AEF C;  2OYO A;  1BDC A;  1U57 A;  3HUS C;  3L75 D;  2PGD A;  3P8C E;  1QGK B;  1KYO D;  2IX7 C;  2QJP C;  3CXH H;  3EQ2 A;  3I56 P;  1MFZ A;  1QL2 A;  1BSN A;  1PGO A;  1SQB D;  1PGQ A;  5CCH C;  5CBN A;  1NJI Q;  1L0N J;  2FY8 A;  3H6P A;  1NYH A;  1SQV G;  2P2U A;  1MV8 A;  1SFC B;  2E74 D;  2JP3 A;  2PP6 A;  1LTA C;  2W6A A;  3M06 A;  1QL1 A;  4WVZ A;  3Q2Y A;  1RH5 B;  3R4Y A;  1L4A B;  3HTK A;  2R32 A;  3K5B A;  5APS A;  2R3S A;  3TGU D;  2E43 A;  3D6Y A;  4JBZ A;  1CW5 A;  1PPJ D;  1FE6 A;  1JY2 P;  2XKM A;  1CZQ A;  1RF0 C;  2W90 A;  2YMK A;  2KNC B;  3RL0 D;  2C0X A;  2WPQ A;  2B87 A;  3L75 J;  2OYH C;  1EDI A;  2M8R A;  2XND H;  4U3F G;  3RK3 E;  1KIL B;  3C1L A;  2KI7 B;  2OGU A;  1S2E A;  1RF1 B;  1RF1 A;  2J5U A;  4H13 D;  4D6T E;  2IBZ D;  4AYC A;  2WMM A;  2HOD B;  3L36 A;  2IYO A;  1LTI C;  2FYU J;  1DD4 A;  4L75 A;  1H89 A;  1JY2 O;  1NOH A;  2QIW A;  1PGJ A;  1LT9 C;  3CX5 I;  4WBA A;  3L71 G;  3TGU J;  2Z4E A;  1BE3 J;  4DZO A;  1L4A A;  1MKM A;  1H8A A;  1EDJ A;  1G2C A;  1P84 E;  1PGP A;  1KIL E;  2P58 A;  2WPR A;  2YXR B;  3G4S P;  1YIT P; 
#chains in the Genus database with same CATH homology
 3BCC J;  4PD4 I;  3H1L J;  4D6T J;  2BCC J;  1EZV I;  1L0L J;  1KB9 I;  1NU1 J;  3L70 J;  3L74 J;  1NTZ J;  1SQB J;  3H1I J;  3L75 J;  3L73 J;  5KLV J;  1P84 I;  1NTM J;  1KYO I;  1BCC J;  1SQV J;  4U3F J;  3H1K J;  1SQX J;  2FYU J;  3L71 J;  3L72 J;  1PP9 J;  3H1J J;  1SQQ J;  3CX5 I;  1NTK J;  3TGU J;  1BGY J;  2IBZ I;  1BE3 J;  1SQP J;  3CWB J;  3H1H J;  3CXH I;  1L0N J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...