1KYOI

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
53
structure length
53
Chain Sequence
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKAKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 17
structure length 53
sequence length 53
chains with identical sequence T
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1kyoI00
3H1LJ 1SQBJ 1P84I 1BCCJ 3BCCJ 1KB9I 1SQPJ 3L70J 1BE3J 3H1KJ 1SQQJ 3CX5I 3L74J 1SQXJ 2IBZI 3L73J 1KYOI 1NTMJ 1PP9J 1NTZJ 4U3FJ 5KLVJ 3CWBJ 3H1JJ 3L72J 3TGUJ 3CXHI 3H1IJ 4PD4I 1L0LJ 3L75J 1BGYJ 1EZVI 3H1HJ 2FYUJ 1SQVJ 2BCCJ 4D6TJ 3L71J 1L0NJ 1NU1J 1NTKJ
chains in the Genus database with same CATH superfamily
3MD0A 3B8EB 3SSUA 3CCMP 1Q90D 1M56D 3H1LJ 5KTBA 3BCCJ 2WSEH 3CMEP 1PGQA 2E76D 2W83C 1T3JA 3LW5J 3L74J 4Y99B 1HJ0A 2V7QJ 4NPEA 4R4LA 4U3FD 1KN7A 3QH9A 2BASA 1HJBA 1NTMG 1URQB 1GL2C 1NTZG 3CWBJ 3RL0D 4EOTA 3H1IE 3AECC 3TGUE 1GMJA 3BATA 3VN0A 1JCDA 2C0WA 1HTLC 1MFTA 3L75D 2I8DA 1RQVA 2Q1KA 3HUSA 4HB1A 4KJMA 4O9BA 3L71D 3TYYA 4LLHA 3G4SP 3H1HE 2BCCJ 4YPCA 3L71E 2IBZD 1GU4A 2A45G 2E5TA 3N7NA 3NMDA 3B5NA 1LTSC 3JCUH 2H7HA 2QVAA 1H0TB 1KQSO 2W6BA 4KT0J 4PJ0E 1KTMA 1KQLA 3LIEA 1KILD 2PRRA 1S3JA 3B4SA 1ZLLA 1M1JA 2KP8A 3KHUA 1VQ7P 3H1LD 1RF1C 2WITA 3L74E 1USDA 1DD4A 4RJTA 2AXTH 3CX5I 2KYVA 1W5CE 1SQQE 2KXPB 4HH2A 2Z5HA 1QL2A 1SVFA 2K88A 2QM8A 4YTPC 3BRTB 5AVQB 1VDFA 3SWKA 2YMKA 4OGQC 2WSCJ 1ZOYC 2KLVA 3U1AA 1NWQA 2D2CD 2YKQA 3AE6C 3Q2YA 2CPBA 1ZR4A 1SFCC 5KKZC 1LTJB 2FYUK 2IFMA 1N7LA 3MP7B 2CPSA 2HFED 2OYIA 1PGOA 1W2EA 1M57D 1SQVJ 2J59M 1Z56A 2ZVOB 1ZRTD 3O8ZA 4H0LB 3G6EP 1G2CA 3MIWA 5KKZB 1L0LD 5KAFH 1URQC 2WPQA 1JTHA 1MZ9A 2KIKA 1RHZB 3HE4A 1BCCE 1IFDA 1N2DC 2P67A 3RK2C 3CCVP 3Q5PA 1YBKA 2WSSH 3F5HA 1UIXA 3BCCE 1N7SC 3L70E 4PD4H 1NGMB 3H1KG 1WRGA 1SQPE 4H44D 1R5SA 1GL2A 5KJ7C 1L4AC 1N8RQ 2N1TC 1SFCD 2NPSC 3H1KE 1RE4A 1VQ6P 1Y9BA 2E74D 1PL5A 2E75C 4PJ0H 1PP9E 2O01N 1NTMD 2HLOA 2QJYC 3NFQA 3SFEC 2KB7P 2KUBA 1JUNA 1ZRTE 4C7RA 3CWBE 1KFMA 1LTBC 3L73G 3H1IJ 4HYTB 2KSEA 1FC2C 3H6PA 1LTJA 1QEXA 4I2LC 4WB4A 1L0NG 2AEMA 1NTKD 1NYHA 1RQUA 3L73D 4I1LA 4C46A 3IFMA 2H8PD 2IZ1A 1KILC 1L0LK 1IO4A 2ZFCA 3H1LG 4EYYQ 2H88C 3HRNA 5AW8B 1FZCA 4R4MA 3PH0A 1GZLA 1NKZB 2E75D 2O1KA 2ZYAA 4HJGH 2QJPC 5CJ4A 1VQMP 3VOPA 3L71G 1NAFA 1VPCA 2GUVA 1L4AD 2UWJE 1KB9D 2E5YA 2FKWB 3KZIE 5AVRB 2WPVB 5AVUB 4Y99C 1BE3J 1SQPK 5APVA 4EDFA 2WQYC 4H44B 1FU1A 2PFXA 2FFDA 1OX3A 4RKUJ 4AYCA 2HR3A 2DW3A 3RK3B 1URQD 3CI9A 3M9HA 4ZNCA 3E7KA 5APSA 3M9BA 5GTIH 2C9NY 3AEBC 3TF5A 1P84E 1H8AA 2KK7A 4A7PA 3BASA 2QJKC 3LW5H 3M06A 1E79H 2PP6A 3PLNA 2Y0EA 2BCCG 5C39A 2BEZF 3CC7P 5H2FE 3RK3E 5AW7B 2LR2A 2V4HA 3AEAC 1BGYD 4H13D 1NTKK 4IOIH 2E43A 2GUSA 1ZP0C 5AW9B 1X0TA 3G3ZA 2B88A 1YJ9P 3JSVC 3CXHE 4OH8B 1SQBE 5CBOA 3S4RA 2QE7H 3IF4A 5BU8B 3TGUD 1SQXE 1EDIA 2Q7CA 1DX7A 2E74B 2IBZI 3RK2B 1T6AA 5CCGC 1BDDA 5H2FH 3L70G 1LTAC 1NOHA 1NAYA 2A06G 2KOGA 4BWNA 4DJGA 3H1JG 2D2CB 5KLVJ 3OW2O 2GM4A 3L72J 1FE6A 4GIFA 2FYUG 1G1JA 2JP3A 1L0LJ 1P84H 2JEEA 1BGYJ 3HD7C 4GT1A 1VL2A 5APXA 1K8AQ 5CCHC 2OGUA 2YO3A 1IK7A 1AVOA 1HH0A 2N9BA 2WPRA 4TT3H 2K9JA 1KV4A 2FXMA 2Q6QA 1ZXGA 3IAOA 3IN6A 1VQ8P 3O6QB 4MN4C 3KDPB 2P1JA 4BRYA 2WT7B 3HE5B 2Y9ZA 1YHQP 3V4WA 4M3LA 2YIUB 1BSHA 4I6MC 5M1BA 2IPPA 4I7ZC 1LP1A 2XZRA 3V4QA 2A45I 1S72P 1FDIA 1JY2O 3GMAA 1SQQG 2M0BA 1BE3E 2ZT9B 2JDIH 2E76B 2QG4A 2W6AA 2ZXXA 4LC1A 1LNQA 1Y47A 3H1IG 3HD7D 2HG5D 1JY3O 1PP9J 2YKPA 4IFDK 1A02J 1GK6A 4BXLA 3B71A 2Y0CA 3S9OA 2FYZA 1L0NK 1L0LE 2J5UA 2R5BA 1XTGB 3C9IA 1SQVK 3RBXA 3L75E 1QVFO 2P10A 1KZUB 1PGJA 3FWLA 1GW3A 3H1HG 1XTCC 2WWWA 1Q2NA 3L71J 3BVHA 1L0NJ 1S5LH 2C0XA 4H13B 3CCQP 1JY2P 1NTKJ 5AVVB 1PV3A 2NZ2A 3GF3A 2WSFH 1ZW0A 2RMZA 1EDJA 1IFNA 3CL3D 2HYNA 4JF7A 1OVRA 1GK4A 3A5TA 1CW5A 5KAFE 5CCGA 1S9KE 1SQPG 1LJ2A 3VP9A 2B9BA 2I1JA 1N7SB 3G9RA 2JKVA 2LKMA 1IFPA 3L74D 4CPGA 2SPZA 2PAJA 4N78D 1SQQD 4KHXA 4N78E 3M0DA 5KLIC 5KJ7A 1NTZJ 3CWBG 1L4AA 3BCCD 2KNCB 1CZQA 3KQGA 3W68A 3Q3DA 1NJIQ 1QVGO 1HBWA 3H25A 3G71P 3GHGC 2YMYA 3KZIH 3TNUA 1AQ5A 1EZVI 3L75G 4ASWA 1EXIA 1RF0A 2HPCB 1DIPA 2KNCA 2IX7C 1X8YA 1EDKA 4XA4A 2IZ0A 2FYUE 3GLMA 3CX5H 2J58A 1A02F 2W6JH 2MKVA 1BCCG 3D70A 1FJPA 4JYCA 1AJYA 2M3EA 1YTZI 4JQ0D 5CCGD 2QA4P 1DEBA 4EIJA 2G3AA 3CXHD 1JY3N 2KS1B 1BCCJ 3PRJA 1BCCD 5APTA 3TNUB 3VMXA 3L70J 2JWDA 2KLUA 3SWFA 1YQ3C 1VQPP 1LTGC 2WPSA 1FZFA 2BEQD 2OYOA 3FXEA 3B5ND 1NKNA 3MHVA 3MTUE 2YIUC 2WSCH 3CX5D 2L5GB 1M1KQ 1LTIC 1K73Q 2JJLA 1VF5B 2K3RA 3L37A 1FOSF 2R3CA 1N73A 2FFDC 2B87A 1X9VA 2RKLA 4NPFX 1N7SA 1CI6A 1OW7A 3CWBD 3VMAA 1G1IA 1KB9H 1LWUA 4GKGA 1PIXA 4YXDC 5B5EE 3K5BA 3R4YA 5APWA 3I56P 1EXJA 4W80A 1H89A 3P8CE 1YIJP 1PFIA 1H88A 5APQA 2WMMA 3CMAP 1SQVD 3IR9A 3GW6A 4K35A 1DD3A 1VQKP 1L0LG 1KORA 1KYOD 2NRGA 2K9YA 3AE1C 2W8ZA 1Q7YQ 2Q9IA 3L36A 4L73A 3TK1A 2XV5A 3EQ2A 5AVWB 2HPCA 3CLQA 4IFFA 3E1IA 1J1EC 4B86A 3A0BE 2E75B 1JM0A 3AEDC 2Q3EA 1VQ9P 2G8YA 5AW5B 3V5BA 1NVOA 1KMIZ 5B66H 2QJKB 2IYOA 2FBWC 2GA1A 3L73J 4OGQD 3P8CD 4U3FE 5BVZA 2FXPA 1SQBD 4U3FG 1LT9C 2D2CC 3M9QA 1Q81Q 5KLIB 3JCUE 1LWUB 1JTHB 1PP9G 1JY3P 2IFNA 3SWYA 2JR8A 3WMM0 3D71A 3CCLP 1SQXK 1QGKB 2BCCE 3B5NC 2FXOA 3EFFK 4OWFA 5GTHH 4D6TG 2BCCD 1USEA 2IDBA 3FWNA 1N73B 2ZAEB 4IL6E 5KLVD 1FZCB 3ITKA 3UIAA 3AE7C 5DJTB 1GL2B 5CCHA 4ZKPA 2OYHC 5KAIH 4IFMA 1Q86Q 4WBAA 1KQFB 4DZOA 2HODA 1EQ7A 3HTKA 1KILE 3H1LE 1QX8A 3MGNA 3MUDA 4H44C 1HGZA 5GTHE 1N7SD 1FOSE 1FBMA 1LTTC 4IL6H 2ZT9C 4WVZA 1N73C 3S1KA 1H0TA 3OA7A 3AE2C 3FGAD 1LTJC 2K9JB 4C7NB 3MZWB 3RL0C 3V6IA 2N9YB 3F89A 5BU5A 2OYHB 1EDLA 3H1JE 3P8MC 3RK2D 3W67A 5KLVK 3KXDA 1OFCX 2IBZE 2OYIB 4OVNF 5CHXA 1NU1K 3PP5A 5KLVE 1BE3D 3LIDA 1E5WA 2QM7A 1KC8Q 1IK9A 1LT1A 1M1JB 1CI6B 2C9LY 1KILA 3CCEP 4H0LD 3L35A 1EC5A 1RE3C 4NPDA 4D6TE 2LXCB 3EFGA 3CD6P 1URQA 4WY4B 3E1RA 5APYA 1JMMA 3R2PA 1L0NE 2ZXEB 5AW3B 4D6TD 3A0HH 4DT0A 1L0ND 1OVUA 3RBZA 1NTZK 3N4XA 4RESB 3HUSC 4ZKUA 1J2JB 1M90Q 4ASVA 4WY4C 4UB6E 3NTNA 4PV1B 3II6A 4H0LC 1YYCA 1R5LA 5K5GB 3VYIA 1GD2E 1FDMA 1S4XA 1BE3G 1BSNA 1FZBA 3AE3C 2AEJA 1FS0E 3B5NB 3P32A 5B5EH 1AQTA 2B87B 4C7NA 2MJZA 3H1KD 2FYNC 3A2AA 5KAIE 3V2QA 2ZJSE 4N3YB 1KB9E 3GG2A 4GODA 5APUA 3HUSB 2H43A 3L72G 2IBZG 2VRSA 1FZAA 2YKOA 1RF1A 1IFIA 3GF7A 3L72E 4XFJA 1T8ZA 2Z5IA 3NXSA 1N86A 5AVZB 1PPJE 2A45H 4GOEA 2OTLP 2OARA 1SQVG 2OYHA 5GTIE 1PPJG 1W2BO 1NTZD 1GL2D 1LWUC 3CC2P 2L91A 1SFCA 3KYQA 1RF0C 2QSIA 3CXHI 1NU1G 1QL1A 2Q3IA 1JNMA 3ABVC 3CX5E 1NH4A 3BRVB 3CCJP 1YTZT 1JEKA 1KQGB 1VQ5P 1FDOA 1SLQA 4LGDE 2E76C 1BDCA 2H89C 3OAKA 4BRYB 2XDJA 3V2PA 4U7JA 3TDKA 4XE5B 3M0AA 1SQBG 2O1JA 1KYOI 1LT9B 1J1EB 2N1TA 2NPSA 1RE4C 2AEFA 3AE5C 3L73E 4TLFA 4U3FJ 3H1JJ 1NTZE 1HWTC 3TGUJ 2FFDB 2PGDA 4UB8H 3I5CA 3CXHH 5TJHA 1S2EA 1UIIA 2A06E 1OMIA 1RY3A 2P58A 3WUUA 4AQRD 2A06D 4YXWH 1ZR2A 3Q5SA 1MKMA 4HKZH 5AW6B 1AFOA 3GHGB 1M1JC 2FY8A 2Y0DA 3C1LA 3D6ZA 3QWOC 1OXZA 2E42A 2KZIA 1G2CB 3D6YA 2YXQB 1S5LE 1GW4A 3VMYA 1KYOH 2JO1A 1QLED 2JWAA 2YXRB 3GHGA 4PD4E 1K05A 1M7LA 2AXTE 2RN0A 1LP1B 2R32A 3HE4B 1IFJA 2ZT9D 1S5LX 5CMZA 4L75A 3CPWO 2R5DA 3AE9C 3H32B 4N6JA 1HF9A 3H1ID 3HD7B 3L74G 3V2NA 1OWAA 2KI7B 4PV1C 1U7JA 3CC4P 1SQXJ 3AEEC 1SQXD 4JPZB 3P7KA 2K1AA 3Q1MA 2Z4EA 5CBNA 1NTMJ 1NO4A 3Q5RA 4JBZA 2V7QH 2IYPA 1YJWP 5AW4B 1SP4A 1VF5C 3RK3D 2XKMA 3VP8A 2QJYB 1Y8AA 4GOFA 2WSFJ 4PD4I 1BGYE 1T2KD 1AV1A 3AEFC 3L75J 4UB8E 3RL0B 5TISH 1YJNP 1FZGA 2ZYGA 4PD4D 3HE5A 1GU5A 1FZEA 4I7ZB 1FJKA 2KSJA 3WUVA 5CCHD 5TISE 2WTYA 2YNYA 3M91A 4EI2A 1HUCA 1RE3A 1GDTA 1MV8A 1M8OB 2KS1A 2WVRA 4JYBA 2Q5UA 1JO5A 3H1HD 1WT6A 3H1JD 1L4AB 3RL0g 1KB9I 1SQPJ 1SS1A 1HVVA 2LXBA 3A0HE 3M0DC 3TSIA 1JCCA 1DEEG 1VF5D 3BCCG 1ZMEC 4WY4A 2RH0A 3FX0A 5AW0B 1EZVG 1VQNP 2W27A 1JB0J 2B89A 2M3BA 2WZ7A 3L4FA 1OIPA 1YI2P 1EZVE 4W7YA 1MFZA 1NTMK 1U7MA 2HODB 3HTKB 1U57A 4OGQB 2O01H 5CJ0A 3RK3C 2OTKE 4H13C 1ZV8A 4Y28J 1FZCC 2XNDH 1RH5B 1AA0A 4L76A 3RGUA 3CCSP 2XNXA 3A3YB 4AUWA 3JC22 1K04A 2POHA 1L2PA 2K37A 1HGVA 4QMAA 1SQPD 2O3JA 4UB6H 1NU1J 3SFDC 3H32A 2WSEJ 3HD7A 2M5AB 1YQ4C 3VMZA 2ITAA 3CCRP 5AVYB 2OQQA 3VTPC 2R44A 1KILB 1SQBJ 2CK3H 2KZJA 1X79B 3C8VA 1EZVD 3USSA 4DCKA 1S9KD 1LT9A 2N1TB 2NPSB 2YO2A 1SQBK 1OZHA 3TGUG 5L8RJ 2OTJP 5AVXB 1LGHB 1WMKA 3KPEA 3L70D 5KLVG 2Y9YA 4GDOA 5DJUB 3WU2H 3PJSK 2I1KA 1PZQA 1X22A 1SQQK 1PP9D 5AW2B 2R3SA 3H1HJ 3OJAB 1AVYA 2FYUJ 3WU2E 3V2RA 1GTWA 1FAVA 1JMBA 1T3UA 1TU3F 1NU1D 3AE4C 3MUDC 5E79H 3T97B 3U1CA 4K3AA 1NU1E 1BGYG 2P2UA 1NTKG 4DOJA 1T2KC 5AW1B 2QJPB 1JOCA 1NTKE 1ZN5A 1IJDB 1PPJD 2FYNB 3ZDMA 1J1DB 1OW8A 5AVTB 1P84I 3U59A 2QEXP 1D7MA 2E74C 3AE8C 4Z1MH 3H1KJ 1P84D 1SQQJ 2N1TD 1SQXG 1IFMA 2NPSD 2W90A 4PV1D 4RO0A 5AVSB 1SFCB 2P7JA 1IZNB 2AXCA 3A7OA 5KJ7D 3T97A 5E79E 3FXDA 1J1DC 1OVVA 1VQLP 1NTME 1VQOP 2ZVNB 1CSBA 1JY2N 1MUUA 2FYUD 3PTZA 2ZYDA 1KD1Q 2M8RA 4WWIA 4L74A 3L72D 1PGPA 3PHLA 3I55P 3CCUP 1YITP 1KFNA 1K9MQ 2XU6A 1RF1B 2O01J 1SQVE 1NHLA 4WY4D 5EFWB 3WUTA 2M5AA 4D6TJ 2QIWA 1Q82Q 3O6QA 2QRXA 2WT7A 1KYOE 4W7ZA 4ZMDA 1IC2A 1S1CX 5B66E 1R8EA 3AEGC 3A0BH 1OW6A 3EWKA 4IL6X 2OYIC 1DH3A 1VQ4P
chains in the Genus database with same CATH topology
3H1LJ 1SQBJ 1P84I 1BCCJ 3BCCJ 1KB9I 1SQPJ 3L70J 1BE3J 3H1KJ 1SQQJ 3CX5I 3L74J 1SQXJ 2IBZI 3L73J 1KYOI 1NTMJ 1PP9J 1NTZJ 4U3FJ 5KLVJ 3CWBJ 3H1JJ 3L72J 3TGUJ 3CXHI 3H1IJ 4PD4I 1L0LJ 3L75J 1BGYJ 1EZVI 3H1HJ 2FYUJ 1SQVJ 2BCCJ 4D6TJ 3L71J 1L0NJ 1NU1J 1NTKJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1L J;  1SQB J;  1P84 I;  1BCC J;  3BCC J;  1KB9 I;  1SQP J;  3L70 J;  1BE3 J;  3H1K J;  1SQQ J;  3CX5 I;  3L74 J;  1SQX J;  2IBZ I;  3L73 J;  1KYO I;  1NTM J;  1PP9 J;  1NTZ J;  4U3F J;  5KLV J;  3CWB J;  3H1J J;  3L72 J;  3TGU J;  3CXH I;  3H1I J;  4PD4 I;  1L0L J;  3L75 J;  1BGY J;  1EZV I;  3H1H J;  2FYU J;  1SQV J;  2BCC J;  4D6T J;  3L71 J;  1L0N J;  1NU1 J;  1NTK J; 
#chains in the Genus database with same CATH topology
 3MD0 A;  3B8E B;  3SSU A;  3CCM P;  1Q90 D;  1M56 D;  3H1L J;  5KTB A;  3BCC J;  2WSE H;  3CME P;  1PGQ A;  2E76 D;  2W83 C;  1T3J A;  3LW5 J;  3L74 J;  4Y99 B;  1HJ0 A;  2V7Q J;  4NPE A;  4R4L A;  4U3F D;  1KN7 A;  3QH9 A;  2BAS A;  1HJB A;  1NTM G;  1URQ B;  1GL2 C;  1NTZ G;  3CWB J;  3RL0 D;  4EOT A;  3H1I E;  3AEC C;  3TGU E;  1GMJ A;  3BAT A;  3VN0 A;  1JCD A;  2C0W A;  1HTL C;  1MFT A;  3L75 D;  2I8D A;  1RQV A;  2Q1K A;  3HUS A;  4HB1 A;  4KJM A;  4O9B A;  3L71 D;  3TYY A;  4LLH A;  3G4S P;  3H1H E;  2BCC J;  4YPC A;  3L71 E;  2IBZ D;  1GU4 A;  2A45 G;  2E5T A;  3N7N A;  3NMD A;  3B5N A;  1LTS C;  3JCU H;  2H7H A;  2QVA A;  1H0T B;  1KQS O;  2W6B A;  4KT0 J;  4PJ0 E;  1KTM A;  1KQL A;  3LIE A;  1KIL D;  2PRR A;  1S3J A;  3B4S A;  1ZLL A;  1M1J A;  2KP8 A;  3KHU A;  1VQ7 P;  3H1L D;  1RF1 C;  2WIT A;  3L74 E;  1USD A;  1DD4 A;  4RJT A;  2AXT H;  3CX5 I;  2KYV A;  1W5C E;  1SQQ E;  2KXP B;  4HH2 A;  2Z5H A;  1QL2 A;  1SVF A;  2K88 A;  2QM8 A;  4YTP C;  3BRT B;  5AVQ B;  1VDF A;  3SWK A;  2YMK A;  4OGQ C;  2WSC J;  1ZOY C;  2KLV A;  3U1A A;  1NWQ A;  2D2C D;  2YKQ A;  3AE6 C;  3Q2Y A;  2CPB A;  1ZR4 A;  1SFC C;  5KKZ C;  1LTJ B;  2FYU K;  2IFM A;  1N7L A;  3MP7 B;  2CPS A;  2HFE D;  2OYI A;  1PGO A;  1W2E A;  1M57 D;  1SQV J;  2J59 M;  1Z56 A;  2ZVO B;  1ZRT D;  3O8Z A;  4H0L B;  3G6E P;  1G2C A;  3MIW A;  5KKZ B;  1L0L D;  5KAF H;  1URQ C;  2WPQ A;  1JTH A;  1MZ9 A;  2KIK A;  1RHZ B;  3HE4 A;  1BCC E;  1IFD A;  1N2D C;  2P67 A;  3RK2 C;  3CCV P;  3Q5P A;  1YBK A;  2WSS H;  3F5H A;  1UIX A;  3BCC E;  1N7S C;  3L70 E;  4PD4 H;  1NGM B;  3H1K G;  1WRG A;  1SQP E;  4H44 D;  1R5S A;  1GL2 A;  5KJ7 C;  1L4A C;  1N8R Q;  2N1T C;  1SFC D;  2NPS C;  3H1K E;  1RE4 A;  1VQ6 P;  1Y9B A;  2E74 D;  1PL5 A;  2E75 C;  4PJ0 H;  1PP9 E;  2O01 N;  1NTM D;  2HLO A;  2QJY C;  3NFQ A;  3SFE C;  2KB7 P;  2KUB A;  1JUN A;  1ZRT E;  4C7R A;  3CWB E;  1KFM A;  1LTB C;  3L73 G;  3H1I J;  4HYT B;  2KSE A;  1FC2 C;  3H6P A;  1LTJ A;  1QEX A;  4I2L C;  4WB4 A;  1L0N G;  2AEM A;  1NTK D;  1NYH A;  1RQU A;  3L73 D;  4I1L A;  4C46 A;  3IFM A;  2H8P D;  2IZ1 A;  1KIL C;  1L0L K;  1IO4 A;  2ZFC A;  3H1L G;  4EYY Q;  2H88 C;  3HRN A;  5AW8 B;  1FZC A;  4R4M A;  3PH0 A;  1GZL A;  1NKZ B;  2E75 D;  2O1K A;  2ZYA A;  4HJG H;  2QJP C;  5CJ4 A;  1VQM P;  3VOP A;  3L71 G;  1NAF A;  1VPC A;  2GUV A;  1L4A D;  2UWJ E;  1KB9 D;  2E5Y A;  2FKW B;  3KZI E;  5AVR B;  2WPV B;  5AVU B;  4Y99 C;  1BE3 J;  1SQP K;  5APV A;  4EDF A;  2WQY C;  4H44 B;  1FU1 A;  2PFX A;  2FFD A;  1OX3 A;  4RKU J;  4AYC A;  2HR3 A;  2DW3 A;  3RK3 B;  1URQ D;  3CI9 A;  3M9H A;  4ZNC A;  3E7K A;  5APS A;  3M9B A;  5GTI H;  2C9N Y;  3AEB C;  3TF5 A;  1P84 E;  1H8A A;  2KK7 A;  4A7P A;  3BAS A;  2QJK C;  3LW5 H;  3M06 A;  1E79 H;  2PP6 A;  3PLN A;  2Y0E A;  2BCC G;  5C39 A;  2BEZ F;  3CC7 P;  5H2F E;  3RK3 E;  5AW7 B;  2LR2 A;  2V4H A;  3AEA C;  1BGY D;  4H13 D;  1NTK K;  4IOI H;  2E43 A;  2GUS A;  1ZP0 C;  5AW9 B;  1X0T A;  3G3Z A;  2B88 A;  1YJ9 P;  3JSV C;  3CXH E;  4OH8 B;  1SQB E;  5CBO A;  3S4R A;  2QE7 H;  3IF4 A;  5BU8 B;  3TGU D;  1SQX E;  1EDI A;  2Q7C A;  1DX7 A;  2E74 B;  2IBZ I;  3RK2 B;  1T6A A;  5CCG C;  1BDD A;  5H2F H;  3L70 G;  1LTA C;  1NOH A;  1NAY A;  2A06 G;  2KOG A;  4BWN A;  4DJG A;  3H1J G;  2D2C B;  5KLV J;  3OW2 O;  2GM4 A;  3L72 J;  1FE6 A;  4GIF A;  2FYU G;  1G1J A;  2JP3 A;  1L0L J;  1P84 H;  2JEE A;  1BGY J;  3HD7 C;  4GT1 A;  1VL2 A;  5APX A;  1K8A Q;  5CCH C;  2OGU A;  2YO3 A;  1IK7 A;  1AVO A;  1HH0 A;  2N9B A;  2WPR A;  4TT3 H;  2K9J A;  1KV4 A;  2FXM A;  2Q6Q A;  1ZXG A;  3IAO A;  3IN6 A;  1VQ8 P;  3O6Q B;  4MN4 C;  3KDP B;  2P1J A;  4BRY A;  2WT7 B;  3HE5 B;  2Y9Z A;  1YHQ P;  3V4W A;  4M3L A;  2YIU B;  1BSH A;  4I6M C;  5M1B A;  2IPP A;  4I7Z C;  1LP1 A;  2XZR A;  3V4Q A;  2A45 I;  1S72 P;  1FDI A;  1JY2 O;  3GMA A;  1SQQ G;  2M0B A;  1BE3 E;  2ZT9 B;  2JDI H;  2E76 B;  2QG4 A;  2W6A A;  2ZXX A;  4LC1 A;  1LNQ A;  1Y47 A;  3H1I G;  3HD7 D;  2HG5 D;  1JY3 O;  1PP9 J;  2YKP A;  4IFD K;  1A02 J;  1GK6 A;  4BXL A;  3B71 A;  2Y0C A;  3S9O A;  2FYZ A;  1L0N K;  1L0L E;  2J5U A;  2R5B A;  1XTG B;  3C9I A;  1SQV K;  3RBX A;  3L75 E;  1QVF O;  2P10 A;  1KZU B;  1PGJ A;  3FWL A;  1GW3 A;  3H1H G;  1XTC C;  2WWW A;  1Q2N A;  3L71 J;  3BVH A;  1L0N J;  1S5L H;  2C0X A;  4H13 B;  3CCQ P;  1JY2 P;  1NTK J;  5AVV B;  1PV3 A;  2NZ2 A;  3GF3 A;  2WSF H;  1ZW0 A;  2RMZ A;  1EDJ A;  1IFN A;  3CL3 D;  2HYN A;  4JF7 A;  1OVR A;  1GK4 A;  3A5T A;  1CW5 A;  5KAF E;  5CCG A;  1S9K E;  1SQP G;  1LJ2 A;  3VP9 A;  2B9B A;  2I1J A;  1N7S B;  3G9R A;  2JKV A;  2LKM A;  1IFP A;  3L74 D;  4CPG A;  2SPZ A;  2PAJ A;  4N78 D;  1SQQ D;  4KHX A;  4N78 E;  3M0D A;  5KLI C;  5KJ7 A;  1NTZ J;  3CWB G;  1L4A A;  3BCC D;  2KNC B;  1CZQ A;  3KQG A;  3W68 A;  3Q3D A;  1NJI Q;  1QVG O;  1HBW A;  3H25 A;  3G71 P;  3GHG C;  2YMY A;  3KZI H;  3TNU A;  1AQ5 A;  1EZV I;  3L75 G;  4ASW A;  1EXI A;  1RF0 A;  2HPC B;  1DIP A;  2KNC A;  2IX7 C;  1X8Y A;  1EDK A;  4XA4 A;  2IZ0 A;  2FYU E;  3GLM A;  3CX5 H;  2J58 A;  1A02 F;  2W6J H;  2MKV A;  1BCC G;  3D70 A;  1FJP A;  4JYC A;  1AJY A;  2M3E A;  1YTZ I;  4JQ0 D;  5CCG D;  2QA4 P;  1DEB A;  4EIJ A;  2G3A A;  3CXH D;  1JY3 N;  2KS1 B;  1BCC J;  3PRJ A;  1BCC D;  5APT A;  3TNU B;  3VMX A;  3L70 J;  2JWD A;  2KLU A;  3SWF A;  1YQ3 C;  1VQP P;  1LTG C;  2WPS A;  1FZF A;  2BEQ D;  2OYO A;  3FXE A;  3B5N D;  1NKN A;  3MHV A;  3MTU E;  2YIU C;  2WSC H;  3CX5 D;  2L5G B;  1M1K Q;  1LTI C;  1K73 Q;  2JJL A;  1VF5 B;  2K3R A;  3L37 A;  1FOS F;  2R3C A;  1N73 A;  2FFD C;  2B87 A;  1X9V A;  2RKL A;  4NPF X;  1N7S A;  1CI6 A;  1OW7 A;  3CWB D;  3VMA A;  1G1I A;  1KB9 H;  1LWU A;  4GKG A;  1PIX A;  4YXD C;  5B5E E;  3K5B A;  3R4Y A;  5APW A;  3I56 P;  1EXJ A;  4W80 A;  1H89 A;  3P8C E;  1YIJ P;  1PFI A;  1H88 A;  5APQ A;  2WMM A;  3CMA P;  1SQV D;  3IR9 A;  3GW6 A;  4K35 A;  1DD3 A;  1VQK P;  1L0L G;  1KOR A;  1KYO D;  2NRG A;  2K9Y A;  3AE1 C;  2W8Z A;  1Q7Y Q;  2Q9I A;  3L36 A;  4L73 A;  3TK1 A;  2XV5 A;  3EQ2 A;  5AVW B;  2HPC A;  3CLQ A;  4IFF A;  3E1I A;  1J1E C;  4B86 A;  3A0B E;  2E75 B;  1JM0 A;  3AED C;  2Q3E A;  1VQ9 P;  2G8Y A;  5AW5 B;  3V5B A;  1NVO A;  1KMI Z;  5B66 H;  2QJK B;  2IYO A;  2FBW C;  2GA1 A;  3L73 J;  4OGQ D;  3P8C D;  4U3F E;  5BVZ A;  2FXP A;  1SQB D;  4U3F G;  1LT9 C;  2D2C C;  3M9Q A;  1Q81 Q;  5KLI B;  3JCU E;  1LWU B;  1JTH B;  1PP9 G;  1JY3 P;  2IFN A;  3SWY A;  2JR8 A;  3WMM 0;  3D71 A;  3CCL P;  1SQX K;  1QGK B;  2BCC E;  3B5N C;  2FXO A;  3EFF K;  4OWF A;  5GTH H;  4D6T G;  2BCC D;  1USE A;  2IDB A;  3FWN A;  1N73 B;  2ZAE B;  4IL6 E;  5KLV D;  1FZC B;  3ITK A;  3UIA A;  3AE7 C;  5DJT B;  1GL2 B;  5CCH A;  4ZKP A;  2OYH C;  5KAI H;  4IFM A;  1Q86 Q;  4WBA A;  1KQF B;  4DZO A;  2HOD A;  1EQ7 A;  3HTK A;  1KIL E;  3H1L E;  1QX8 A;  3MGN A;  3MUD A;  4H44 C;  1HGZ A;  5GTH E;  1N7S D;  1FOS E;  1FBM A;  1LTT C;  4IL6 H;  2ZT9 C;  4WVZ A;  1N73 C;  3S1K A;  1H0T A;  3OA7 A;  3AE2 C;  3FGA D;  1LTJ C;  2K9J B;  4C7N B;  3MZW B;  3RL0 C;  3V6I A;  2N9Y B;  3F89 A;  5BU5 A;  2OYH B;  1EDL A;  3H1J E;  3P8M C;  3RK2 D;  3W67 A;  5KLV K;  3KXD A;  1OFC X;  2IBZ E;  2OYI B;  4OVN F;  5CHX A;  1NU1 K;  3PP5 A;  5KLV E;  1BE3 D;  3LID A;  1E5W A;  2QM7 A;  1KC8 Q;  1IK9 A;  1LT1 A;  1M1J B;  1CI6 B;  2C9L Y;  1KIL A;  3CCE P;  4H0L D;  3L35 A;  1EC5 A;  1RE3 C;  4NPD A;  4D6T E;  2LXC B;  3EFG A;  3CD6 P;  1URQ A;  4WY4 B;  3E1R A;  5APY A;  1JMM A;  3R2P A;  1L0N E;  2ZXE B;  5AW3 B;  4D6T D;  3A0H H;  4DT0 A;  1L0N D;  1OVU A;  3RBZ A;  1NTZ K;  3N4X A;  4RES B;  3HUS C;  4ZKU A;  1J2J B;  1M90 Q;  4ASV A;  4WY4 C;  4UB6 E;  3NTN A;  4PV1 B;  3II6 A;  4H0L C;  1YYC A;  1R5L A;  5K5G B;  3VYI A;  1GD2 E;  1FDM A;  1S4X A;  1BE3 G;  1BSN A;  1FZB A;  3AE3 C;  2AEJ A;  1FS0 E;  3B5N B;  3P32 A;  5B5E H;  1AQT A;  2B87 B;  4C7N A;  2MJZ A;  3H1K D;  2FYN C;  3A2A A;  5KAI E;  3V2Q A;  2ZJS E;  4N3Y B;  1KB9 E;  3GG2 A;  4GOD A;  5APU A;  3HUS B;  2H43 A;  3L72 G;  2IBZ G;  2VRS A;  1FZA A;  2YKO A;  1RF1 A;  1IFI A;  3GF7 A;  3L72 E;  4XFJ A;  1T8Z A;  2Z5I A;  3NXS A;  1N86 A;  5AVZ B;  1PPJ E;  2A45 H;  4GOE A;  2OTL P;  2OAR A;  1SQV G;  2OYH A;  5GTI E;  1PPJ G;  1W2B O;  1NTZ D;  1GL2 D;  1LWU C;  3CC2 P;  2L91 A;  1SFC A;  3KYQ A;  1RF0 C;  2QSI A;  3CXH I;  1NU1 G;  1QL1 A;  2Q3I A;  1JNM A;  3ABV C;  3CX5 E;  1NH4 A;  3BRV B;  3CCJ P;  1YTZ T;  1JEK A;  1KQG B;  1VQ5 P;  1FDO A;  1SLQ A;  4LGD E;  2E76 C;  1BDC A;  2H89 C;  3OAK A;  4BRY B;  2XDJ A;  3V2P A;  4U7J A;  3TDK A;  4XE5 B;  3M0A A;  1SQB G;  2O1J A;  1KYO I;  1LT9 B;  1J1E B;  2N1T A;  2NPS A;  1RE4 C;  2AEF A;  3AE5 C;  3L73 E;  4TLF A;  4U3F J;  3H1J J;  1NTZ E;  1HWT C;  3TGU J;  2FFD B;  2PGD A;  4UB8 H;  3I5C A;  3CXH H;  5TJH A;  1S2E A;  1UII A;  2A06 E;  1OMI A;  1RY3 A;  2P58 A;  3WUU A;  4AQR D;  2A06 D;  4YXW H;  1ZR2 A;  3Q5S A;  1MKM A;  4HKZ H;  5AW6 B;  1AFO A;  3GHG B;  1M1J C;  2FY8 A;  2Y0D A;  3C1L A;  3D6Z A;  3QWO C;  1OXZ A;  2E42 A;  2KZI A;  1G2C B;  3D6Y A;  2YXQ B;  1S5L E;  1GW4 A;  3VMY A;  1KYO H;  2JO1 A;  1QLE D;  2JWA A;  2YXR B;  3GHG A;  4PD4 E;  1K05 A;  1M7L A;  2AXT E;  2RN0 A;  1LP1 B;  2R32 A;  3HE4 B;  1IFJ A;  2ZT9 D;  1S5L X;  5CMZ A;  4L75 A;  3CPW O;  2R5D A;  3AE9 C;  3H32 B;  4N6J A;  1HF9 A;  3H1I D;  3HD7 B;  3L74 G;  3V2N A;  1OWA A;  2KI7 B;  4PV1 C;  1U7J A;  3CC4 P;  1SQX J;  3AEE C;  1SQX D;  4JPZ B;  3P7K A;  2K1A A;  3Q1M A;  2Z4E A;  5CBN A;  1NTM J;  1NO4 A;  3Q5R A;  4JBZ A;  2V7Q H;  2IYP A;  1YJW P;  5AW4 B;  1SP4 A;  1VF5 C;  3RK3 D;  2XKM A;  3VP8 A;  2QJY B;  1Y8A A;  4GOF A;  2WSF J;  4PD4 I;  1BGY E;  1T2K D;  1AV1 A;  3AEF C;  3L75 J;  4UB8 E;  3RL0 B;  5TIS H;  1YJN P;  1FZG A;  2ZYG A;  4PD4 D;  3HE5 A;  1GU5 A;  1FZE A;  4I7Z B;  1FJK A;  2KSJ A;  3WUV A;  5CCH D;  5TIS E;  2WTY A;  2YNY A;  3M91 A;  4EI2 A;  1HUC A;  1RE3 A;  1GDT A;  1MV8 A;  1M8O B;  2KS1 A;  2WVR A;  4JYB A;  2Q5U A;  1JO5 A;  3H1H D;  1WT6 A;  3H1J D;  1L4A B;  3RL0 g;  1KB9 I;  1SQP J;  1SS1 A;  1HVV A;  2LXB A;  3A0H E;  3M0D C;  3TSI A;  1JCC A;  1DEE G;  1VF5 D;  3BCC G;  1ZME C;  4WY4 A;  2RH0 A;  3FX0 A;  5AW0 B;  1EZV G;  1VQN P;  2W27 A;  1JB0 J;  2B89 A;  2M3B A;  2WZ7 A;  3L4F A;  1OIP A;  1YI2 P;  1EZV E;  4W7Y A;  1MFZ A;  1NTM K;  1U7M A;  2HOD B;  3HTK B;  1U57 A;  4OGQ B;  2O01 H;  5CJ0 A;  3RK3 C;  2OTK E;  4H13 C;  1ZV8 A;  4Y28 J;  1FZC C;  2XND H;  1RH5 B;  1AA0 A;  4L76 A;  3RGU A;  3CCS P;  2XNX A;  3A3Y B;  4AUW A;  3JC2 2;  1K04 A;  2POH A;  1L2P A;  2K37 A;  1HGV A;  4QMA A;  1SQP D;  2O3J A;  4UB6 H;  1NU1 J;  3SFD C;  3H32 A;  2WSE J;  3HD7 A;  2M5A B;  1YQ4 C;  3VMZ A;  2ITA A;  3CCR P;  5AVY B;  2OQQ A;  3VTP C;  2R44 A;  1KIL B;  1SQB J;  2CK3 H;  2KZJ A;  1X79 B;  3C8V A;  1EZV D;  3USS A;  4DCK A;  1S9K D;  1LT9 A;  2N1T B;  2NPS B;  2YO2 A;  1SQB K;  1OZH A;  3TGU G;  5L8R J;  2OTJ P;  5AVX B;  1LGH B;  1WMK A;  3KPE A;  3L70 D;  5KLV G;  2Y9Y A;  4GDO A;  5DJU B;  3WU2 H;  3PJS K;  2I1K A;  1PZQ A;  1X22 A;  1SQQ K;  1PP9 D;  5AW2 B;  2R3S A;  3H1H J;  3OJA B;  1AVY A;  2FYU J;  3WU2 E;  3V2R A;  1GTW A;  1FAV A;  1JMB A;  1T3U A;  1TU3 F;  1NU1 D;  3AE4 C;  3MUD C;  5E79 H;  3T97 B;  3U1C A;  4K3A A;  1NU1 E;  1BGY G;  2P2U A;  1NTK G;  4DOJ A;  1T2K C;  5AW1 B;  2QJP B;  1JOC A;  1NTK E;  1ZN5 A;  1IJD B;  1PPJ D;  2FYN B;  3ZDM A;  1J1D B;  1OW8 A;  5AVT B;  1P84 I;  3U59 A;  2QEX P;  1D7M A;  2E74 C;  3AE8 C;  4Z1M H;  3H1K J;  1P84 D;  1SQQ J;  2N1T D;  1SQX G;  1IFM A;  2NPS D;  2W90 A;  4PV1 D;  4RO0 A;  5AVS B;  1SFC B;  2P7J A;  1IZN B;  2AXC A;  3A7O A;  5KJ7 D;  3T97 A;  5E79 E;  3FXD A;  1J1D C;  1OVV A;  1VQL P;  1NTM E;  1VQO P;  2ZVN B;  1CSB A;  1JY2 N;  1MUU A;  2FYU D;  3PTZ A;  2ZYD A;  1KD1 Q;  2M8R A;  4WWI A;  4L74 A;  3L72 D;  1PGP A;  3PHL A;  3I55 P;  3CCU P;  1YIT P;  1KFN A;  1K9M Q;  2XU6 A;  1RF1 B;  2O01 J;  1SQV E;  1NHL A;  4WY4 D;  5EFW B;  3WUT A;  2M5A A;  4D6T J;  2QIW A;  1Q82 Q;  3O6Q A;  2QRX A;  2WT7 A;  1KYO E;  4W7Z A;  4ZMD A;  1IC2 A;  1S1C X;  5B66 E;  1R8E A;  3AEG C;  3A0B H;  1OW6 A;  3EWK A;  4IL6 X;  2OYI C;  1DH3 A;  1VQ4 P; 
#chains in the Genus database with same CATH homology
 3H1L J;  1SQB J;  1P84 I;  1BCC J;  3BCC J;  1KB9 I;  1SQP J;  3L70 J;  1BE3 J;  3H1K J;  1SQQ J;  3CX5 I;  3L74 J;  1SQX J;  2IBZ I;  3L73 J;  1KYO I;  1NTM J;  1PP9 J;  1NTZ J;  4U3F J;  5KLV J;  3CWB J;  3H1J J;  3L72 J;  3TGU J;  3CXH I;  3H1I J;  4PD4 I;  1L0L J;  3L75 J;  1BGY J;  1EZV I;  3H1H J;  2FYU J;  1SQV J;  2BCC J;  4D6T J;  3L71 J;  1L0N J;  1NU1 J;  1NTK J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...