1KYOI

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
53
structure length
53
Chain Sequence
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKAKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
total genus 17
structure length 53
sequence length 53
chains with identical sequence T
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1kyoI00
3CX5I 4PD4I 3H1IJ 1NTZJ 1SQXJ 1SQPJ 3CWBJ 4D6TJ 1NTKJ 1NU1J 3H1LJ 3CXHI 1SQVJ 3L70J 3BCCJ 3L73J 3H1JJ 3H1KJ 3L72J 1L0LJ 2FYUJ 1KB9I 1SQQJ 1NTMJ 3L71J 1P84I 3L74J 3L75J 2BCCJ 3H1HJ 1BCCJ 1BGYJ 1L0NJ 1SQBJ 1KYOI 5KLVJ 1EZVI 1PP9J 3TGUJ 4U3FJ 2IBZI 1BE3J
chains in the Genus database with same CATH superfamily
4WY4C 1SQPG 1LTBC 3ABVC 2WSEH 3KDPB 2JP3A 1ZMEC 1Y47A 4IFDK 4I6MC 1AV1A 2FYUG 5AVVB 1SQQG 3LIDA 4N6JA 1KQLA 3L72J 5AVQB 4IFMA 2BEZF 3M06A 1SQXD 1PPJE 1AJYA 1NTZD 1P84E 1N7SD 2IBZI 3RL0g 2FYNB 4EYYQ 1U7JA 2W6JH 1HGVA 2KUBA 2B9BA 2QRXA 1DIPA 1RQVA 4WVZA 4CPGA 2W6BA 1AA0A 1Y9BA 3W67A 1ZOYC 2HODA 2YMKA 1K04A 1NAFA 1SQXJ 5KLIC 3N7NA 2FFDA 3B5NB 3PP5A 2N1TA 4EDFA 5APYA 4DCKA 1L0NG 3L72E 3Q5PA 4PV1D 1SQPD 3H1HE 3CD6P 1PL5A 1RF1C 3L70D 1J1DB 4GOEA 2FY8A 2FYUD 5CJ4A 1SQQD 4DZOA 3B71A 2ZXXA 1CI6B 1JY2O 3S1KA 1R5LA 1SS1A 4IOIH 2R3SA 1GZLA 3WUUA 3RK3C 1N7SA 2LXCB 3JC22 3TYYA 3RBXA 2YIUB 1YTZI 4D6TG 3WMM0 3MUDC 3C8VA 1SQXE 1NTZE 1UIXA 3L70J 3O6QB 1VQ6P 5KAFE 1Q82Q 1K05A 1LWUB 1FC2C 2YNYA 2RN0A 3MZWB 1LTJB 4PD4H 3JCUH 1T3JA 1EQ7A 4AQRD 2ZYAA 4UB8E 1IZNB 2V4HA 5CHXA 3U1AA 3L37A 2H7HA 1S2EA 2M0BA 1RF1A 4AUWA 4RO0A 3RL0C 3CMEP 1GTWA 1U57A 1GK6A 1LP1B 3P7KA 1K8AQ 2W90A 3L70E 1P84I 1JCCA 5APSA 1SFCB 1IFNA 1L4AC 4D6TD 5APTA 3VN0A 1G2CA 4H44C 5E79E 3P32A 2AEMA 3IAOA 2ZXEB 3FWNA 2K3RA 3L71G 1NTMG 1R5SA 1ZV8A 4KJMA 4W7YA 1GU4A 2AXTH 1S5LX 3FWLA 3H6PA 1FJKA 3U59A 3SWKA 5AW5B 3HUSC 1RE3C 4PJ0H 3WUTA 1ZLLA 3WU2E 1KB9I 3O8ZA 5CCGC 1SQXK 1S1CX 1NTZK 1IFPA 3D6ZA 1URQC 1M90Q 1USEA 3L73G 1PZQA 4KT0J 2HODB 1T6AA 1LTTC 5APXA 1X79B 3HE4A 2WT7A 3LW5H 4BRYA 2ZFCA 1A02F 4K35A 3H1LJ 4QMAA 2NRGA 1NTMD 4D6TE 4WY4B 4H13C 4AYCA 2QJPC 2KS1A 3TNUA 2I1JA 2YMYA 1SQPK 3MTUE 3QH9A 4C7NB 1OW6A 4ZKPA 2KSEA 1KYOH 3HUSA 2Z4EA 1RE3A 2FYUK 1SQQK 1MFTA 2QJKC 4ZKUA 3RGUA 5AVZB 1BGYG 3CXHH 1Q90D 2WMMA 1LT9C 2WSEJ 1IK9A 2YKQA 3B4SA 1W2EA 3I55P 3KXDA 1NAYA 1OVVA 2VRSA 2I8DA 2RH0A 1S4XA 3H1JJ 3D70A 3H1LE 3AE7C 1BE3D 3KZIE 2K88A 5KLIB 2Q5UA 3B5ND 1VQNP 1S5LH 1K9MQ 5CJ0A 2V7QH 2W6AA 2HYNA 2SPZA 3AEDC 1RF1B 2KLUA 2O01J 5KJ7D 2P7JA 1BE3J 5H2FH 1Q2NA 2M3EA 2JDIH 5AVUB 2QIWA 1KMIZ 3BCCG 4N3YB 3RK3B 3ITKA 1FDIA 3H1KJ 1G2CB 2P58A 1BGYD 1VQ9P 3H1JE 2IYOA 2MKVA 2H88C 4BXLA 4DJGA 5EFWB 1FZAA 3AE8C 1J1EC 1DD3A 3P8CD 3L74J 1PGPA 3HTKA 4I1LA 3A0HH 3W68A 2HPCA 1N8RQ 1FE6A 3CX5D 3B5NA 2KYVA 2K9JB 2N9YB 4JPZB 1G1JA 1BE3E 1GDTA 5AVSB 3FGAD 2GUVA 4C7RA 4ASWA 5B5EE 5KJ7A 2G3AA 3RL0B 1CI6A 3BCCD 1X22A 2UWJE 3L72G 2IPPA 1L4AB 1SFCD 4BRYB 2JJLA 3KQGA 1JCDA 1PGOA 4H44B 4TLFA 1OVUA 2JEEA 2B89A 3HE5B 2Y9YA 3A0BH 3O6QA 1AQTA 1G1IA 2OTJP 2R3CA 3RBZA 4YXDC 1NTMK 1YITP 1PIXA 3HUSB 3IF4A 1EZVG 4GOFA 3P8CE 2QG4A 1SQXG 2Y9ZA 2E76C 4PD4E 4RJTA 2M3BA 3JCUE 1URQB 2H89C 1NHLA 1PFIA 3PH0A 2E5TA 3FX0A 4YTPC 1M1KQ 2A45H 1LP1A 2OYIC 1EDKA 1AFOA 2KNCB 2PGDA 3SWFA 1SFCA 1S9KD 1U7MA 2HFED 2L5GB 3BCCE 1PGQA 3BRVB 5AW4B 3R4YA 4OGQC 4XFJA 2ZVOB 2KOGA 4WY4D 3L70G 4H13B 2QJPB 2Q9IA 1CSBA 4WB4A 2JWAA 2AXTE 2KI7B 5DJTB 1JY2N 1KYOD 1YIJP 3LW5J 1EZVD 3IFMA 1NJIQ 1KQGB 2AXCA 3BATA 2QJKB 2QM7A 3C1LA 1NGMB 3CCMP 4PJ0E 2XZRA 1LT9B 1JB0J 3VOPA 5K5GB 1JM0A 1T2KC 2QVAA 2O1KA 5GTHH 1KILC 1T2KD 2QA4P 1H8AA 1BSHA 1PP9J 4R4MA 3VP9A 1HF9A 3AE1C 2WZ7A 4TT3H 3CC7P 2OYIA 2O01H 3HTKB 1J2JB 1VF5C 1HWTC 1FBMA 2HPCB 2XKMA 1OVRA 1M57D 1HTLC 2YO2A 3AEBC 1VQMP 1Q81Q 3OAKA 3VMXA 1S9KE 1VQ7P 3KHUA 1RH5B 2HLOA 1NU1D 3GMAA 4WY4A 1LTGC 1QL1A 3VTPC 3TSIA 1M8OB 2OYHC 2WPVB 5AW6B 4C7NA 5APQA 4GT1A 3PTZA 4YPCA 2YXQB 2Q7CA 3CX5I 1GW4A 3C9IA 3RK3D 1EDIA 1PP9E 1KYOE 2V7QJ 3CWBJ 2WWWA 1OWAA 1EZVE 3MD0A 5AVTB 4Z1MH 2H43A 1NU1J 3M0DC 2Q1KA 1KV4A 1JUNA 2FXPA 5KKZC 3CXHE 3FXEA 2YXRB 3TGUJ 1J1EB 2YKPA 1YBKA 2C9LY 1RE4C 5APWA 2BCCD 1ZP0C 2IZ1A 2XV5A 4GDOA 4EI2A 1YJNP 3BASA 3E1RA 1RHZB 3VMZA 3HRNA 2QSIA 1KC8Q 1QLED 1VPCA 1S5LE 3A5TA 1YJWP 2FXOA 3H1LG 2KZJA 4WWIA 3A2AA 4JQ0D 1ZN5A 1NU1E 1SQBD 1L0LJ 3RL0D 2BCCJ 3PHLA 3BRTB 5H2FE 1Q7YQ 3G9RA 2KLVA 2R5BA 2O3JA 3IR9A 4JBZA 1L4AD 2AEJA 4HKZH 1EXIA 5AW7B 3MUDA 4H44D 1BDDA 5B66H 1RQUA 3RK3E 2R44A 3V2NA 4A7PA 3Q3DA 3WUVA 1SQBJ 1FU1A 1ZRTD 1Z56A 2FYZA 1NVOA 1ZR2A 1IFMA 1QEXA 3V4QA 4W7ZA 2K1AA 3H1JG 2QJYC 4WBAA 5KAIH 3CCEP 1IFDA 3OW2O 3L75J 2K9JA 3A0HE 2WSCH 2E76B 2BCCE 3I5CA 5CCGD 3AE5C 1OXZA 3H1LD 1URQD 1OMIA 3SFEC 2M5AA 2L91A 3EWKA 3V6IA 2OYIB 1SP4A 2OQQA 3SWYA 4Y28J 3AEGC 1EZVI 1BE3G 4UB6E 1SQBE 1RF0C 1L4AA 3D71A 3H25A 2LR2A 3H1KG 4OGQB 2OTKE 3HE5A 3MP7B 3Q5RA 5CCHC 4L74A 3U1CA 1ZW0A 2OGUA 3L36A 1KB9H 3A0BE 4H13D 3T97B 1NU1K 2OYOA 3L4FA 1IO4A 2I1KA 1JY2P 3N4XA 4IL6X 3F5HA 4NPFX 3H1JD 5TISE 1ZRTE 3L35A 1N7LA 2WQYC 3L74G 5KLVD 2CPSA 1W2BO 3H32A 3F89A 4I7ZC 4M3LA 3V2PA 3RK2C 5CCGA 1JY3O 1WRGA 3GHGC 1FOSE 2W8ZA 1VQ4P 1URQA 4NPEA 3AE2C 1KILB 2G8YA 2ITAA 2C0WA 2PRRA 5AW8B 3M9QA 3CLQA 3PRJA 3GG2A 4HYTB 5CBOA 5KLVJ 4XE5B 1VF5B 1H0TB 2KNCA 5AW2B 1AVOA 3G6EP 2K37A 1RF0A 2R32A 4GODA 4GKGA 1NTKJ 3H1KD 3M0AA 1SQVJ 1HJ0A 1GMJA 3S4RA 1GL2C 5BVZA 1YI2P 1M1JC 1DEBA 2DW3A 1JTHB 2OYHB 1EDLA 2E74B 3H1IJ 3MIWA 1OIPA 2IDBA 1VQOP 3L74D 1NKNA 2P2UA 3M91A 1SQBK 3EFGA 2Y0DA 3D6YA 1IK7A 5AVYB 1GW3A 3CCLP 2Z5HA 4U3FJ 1OW7A 1LT9A 5KLVE 2OARA 5C39A 2W83C 1KQSO 3G4SP 5KKZB 1E79H 5AVXB 4YXWH 4BWNA 1MUUA 5GTHE 4OWFA 1FZCC 2J5UA 4PD4D 1IC2A 5TJHA 5AVWB 3Q1MA 1KFNA 1ZXGA 3H1IE 3MHVA 2OTLP 1XTCC 4LC1A 1KFMA 3A7OA 2Z5IA 4IL6H 3H1KE 1QGKB 2IFNA 1M1JA 2PFXA 2M5AB 3ZDMA 2XNDH 2JKVA 5BU5A 2P1JA 1VQKP 4H0LC 2IBZE 1LJ2A 1DEEG 3A3YB 1QX8A 2PP6A 3SFDC 2E42A 3M9BA 4XA4A 3L74E 3VYIA 2D2CC 2ZYGA 3TK1A 3B8EB 1FZFA 1AQ5A 2KSJA 2C0XA 3GW6A 2WPQA 4Y99C 1CW5A 3QWOC 1PP9G 2QJYB 1R8EA 2E75C 1NWQA 2RKLA 3H32B 5KTBA 1JO5A 2JR8A 2E76D 2GUSA 3P8MC 2JO1A 5KLVK 4KHXA 1UIIA 4B86A 2XDJA 2J59M 5BU8B 2NPSC 3AEEC 2WSCJ 1FOSF 1GD2E 3HD7C 3AE9C 1VL2A 2ZT9C 1YQ3C 3NXSA 3TF5A 4OGQD 1HVVA 3CWBG 1NU1G 1NYHA 3EQ2A 2FFDC 4EIJA 1QVFO 5B66E 1KZUB 1L2PA 3CC2P 1PP9D 1FZGA 1AVYA 1FZEA 5AVRB 2Y0CA 2WSFH 1VQ8P 3CXHD 2H8PD 4I7ZB 3RK2B 5KAIE 3IN6A 2IFMA 2CPBA 3GHGB 3CCSP 3Q2YA 1LT1A 1LGHB 2HR3A 3H1HJ 1N7SC 2IYPA 5L8RJ 3CCVP 2KP8A 2WITA 1JNMA 4DT0A 1S3JA 4U7JA 1KILD 1N86A 1W5CE 2LKMA 2J58A 1T8ZA 1QVGO 2AEFA 2KB7P 5GTIH 1YQ4C 2YO3A 1L0LG 2NPSA 1BCCD 1WT6A 1VF5D 1CZQA 2BCCG 3HD7A 1FAVA 1N73C 1VQLP 3CWBD 3BVHA 4O9BA 1NTZJ 1GL2B 1M1JB 1JMMA 1YYCA 2E74C 2P10A 3T97A 1Y8AA 1FDOA 5AW0B 4PV1C 3NTNA 2E74D 1SQBG 3TGUD 1BCCJ 1YHQP 5B5EH 1KB9E 1USDA 4PD4I 2JWDA 1EC5A 2Y0EA 4N78D 3L75G 2WTYA 2WPRA 3GLMA 3CPWO 4DOJA 2FKWB 1MV8A 3MGNA 1KILA 1OW8A 1FJPA 5APUA 1SQPJ 1M56D 4OVNF 2W27A 1FZCB 1KILE 1L0LD 3USSA 1H0TA 2FYUJ 1SQQJ 2WSSH 4W80A 1N73A 4L76A 1BCCE 2IX7C 3VMAA 1EDJA 3GF7A 2O1JA 2P67A 1HGZA 3CX5H 1FS0E 1IFJA 3CWBE 1HH0A 1JTHA 2OYHA 1L0ND 2A45G 1LTSC 4H0LB 1RY3A 2BEQD 4L75A 1GU5A 4MN4C 3TGUE 1SQPE 1XTGB 3NFQA 2D2CB 3L75D 3M0DA 4ZNCA 2ZYDA 1HJBA 1OX3A 1DD4A 2FYUE 1SQQE 2HG5D 3JSVC 1L0NJ 2QE7H 4N78E 2GA1A 4Y99B 2KXPB 3AE6C 1RE4A 1DH3A 2E75B 3CCUP 4RESB 5DJUB 1JOCA 5KLVG 3FXDA 3VMYA 1H89A 1L0LE 3NMDA 4OH8B 1JY3N 1P84H 3E1IA 4K3AA 3CCJP 1NTKG 4NPDA 1EXJA 3AEAC 4D6TJ 3CCQP 1SQVG 1QL2A 3VP8A 4IL6E 1LTAC 1KYOI 3H1IG 2ZVNB 2NPSB 5M1BA 1L0NE 4IFFA 3OA7A 3S9OA 3Q5SA 3V2QA 3HD7B 2QM8A 2N9BA 1GK4A 2ZT9B 3CXHI 1VQ5P 2BASA 1X9VA 3CMAP 5CCHD 1KQFB 3GF3A 2FFDB 4HH2A 2Q6QA 1IJDB 1N2DC 2N1TB 4U3FG 3L75E 2E5YA 2IBZG 2KIKA 4GIFA 5AW1B 2XU6A 3TDKA 3L71D 4JF7A 1WMKA 1KN7A 3KYQA 3CI9A 1KD1Q 1PV3A 2K9YA 2Q3EA 1X8YA 4EOTA 1MFZA 3RK2D 1NTKD 4ASVA 1YTZT 1SQVD 1N7SB 1D7MA 2B87A 2FYNC 3L71J 3E7KA 1NTMJ 5KAFH 2WPSA 5AW3B 1X0TA 4I2LC 3H1ID 2WSFJ 3M9HA 2R5DA 3L73D 2M8RA 1OZHA 4JYBA 1N73B 1L0LK 5CCHA 4UB8H 3G71P 4U3FD 2YKOA 3B5NC 1GL2D 2E43A 2IBZD 2MJZA 3LIEA 1MZ9A 4PV1B 1TU3F 3L73J 1L0NK 1J1DC 5KJ7C 3CL3D 1FDMA 3L71E 1KTMA 1NTME 2A06G 1NH4A 3PLNA 1MKMA 1HUCA 3GHGA 5E79H 5APVA 3KPEA 1NTKE 2YIUC 3CC4P 2LXBA 1FZBA 1SQVE 2ZAEB 2ZJSE 1H88A 1NKZB 2CK3H 1S72P 1DX7A 1OFCX 4C46A 3CCRP 1LWUC 5CMZA 3PJSK 5GTIE 3AECC 4LLHA 1PGJA 1K73Q 1PPJG 3WU2H 1LTJC 1M7LA 3L73E 5CBNA 2IZ0A 4HJGH 1GL2A 1BGYJ 1BDCA 3SSUA 3EFFK 4U3FE 4H0LD 4LGDE 3II6A 3AE3C 2A06D 2XNXA 1VDFA 3AE4C 1LNQA 2KK7A 4UB6H 1Q86Q 3OJAB 2D2CD 1HBWA 1SFCC 3HE4B 2WT7B 2POHA 4RKUJ 2A45I 3H1HG 4L73A 1YJ9P 2FXMA 1FZCA 3G3ZA 2C9NY 1BGYE 4JYCA 2WVRA 1VQPP 3AEFC 1JEKA 3V2RA 2E75D 1LWUA 2KS1B 1LTIC 2FBWC 5TISH 1T3UA 3TNUB 3BCCJ 1PPJD 1JY3P 1P84D 2NZ2A 1LTJA 1ZR4A 5AW9B 2B87B 1NTZG 1JMBA 2RMZA 1NTKK 3K5BA 1SQVK 1SLQA 3CX5E 3V5BA 1NO4A 2QEXP 2KZIA 3UIAA 2GM4A 2NPSD 1BCCG 2Q3IA 1BSNA 4R4LA 1SVFA 3KZIH 3HD7D 1NOHA 2ZT9D 3I56P 2PAJA 2A06E 1KORA 3L72D 2N1TC 1A02J 2O01N 1KB9D 2N1TD 1IFIA 3H1HD 4HB1A 1E5WA 3TGUG 4ZMDA 3V4WA 2B88A 3R2PA
chains in the Genus database with same CATH topology
3CX5I 4PD4I 3H1IJ 1NTZJ 1SQXJ 1SQPJ 3CWBJ 4D6TJ 1NTKJ 1NU1J 3H1LJ 3CXHI 1SQVJ 3L70J 3BCCJ 3L73J 3H1JJ 3H1KJ 3L72J 1L0LJ 2FYUJ 1KB9I 1SQQJ 1NTMJ 3L71J 1P84I 3L74J 3L75J 2BCCJ 3H1HJ 1BCCJ 1BGYJ 1L0NJ 1SQBJ 1KYOI 5KLVJ 1EZVI 1PP9J 3TGUJ 4U3FJ 2IBZI 1BE3J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CX5 I;  4PD4 I;  3H1I J;  1NTZ J;  1SQX J;  1SQP J;  3CWB J;  4D6T J;  1NTK J;  1NU1 J;  3H1L J;  3CXH I;  1SQV J;  3L70 J;  3BCC J;  3L73 J;  3H1J J;  3H1K J;  3L72 J;  1L0L J;  2FYU J;  1KB9 I;  1SQQ J;  1NTM J;  3L71 J;  1P84 I;  3L74 J;  3L75 J;  2BCC J;  3H1H J;  1BCC J;  1BGY J;  1L0N J;  1SQB J;  1KYO I;  5KLV J;  1EZV I;  1PP9 J;  3TGU J;  4U3F J;  2IBZ I;  1BE3 J; 
#chains in the Genus database with same CATH topology
 4WY4 C;  1SQP G;  1LTB C;  3ABV C;  2WSE H;  3KDP B;  2JP3 A;  1ZME C;  1Y47 A;  4IFD K;  4I6M C;  1AV1 A;  2FYU G;  5AVV B;  1SQQ G;  3LID A;  4N6J A;  1KQL A;  3L72 J;  5AVQ B;  4IFM A;  2BEZ F;  3M06 A;  1SQX D;  1PPJ E;  1AJY A;  1NTZ D;  1P84 E;  1N7S D;  2IBZ I;  3RL0 g;  2FYN B;  4EYY Q;  1U7J A;  2W6J H;  1HGV A;  2KUB A;  2B9B A;  2QRX A;  1DIP A;  1RQV A;  4WVZ A;  4CPG A;  2W6B A;  1AA0 A;  1Y9B A;  3W67 A;  1ZOY C;  2HOD A;  2YMK A;  1K04 A;  1NAF A;  1SQX J;  5KLI C;  3N7N A;  2FFD A;  3B5N B;  3PP5 A;  2N1T A;  4EDF A;  5APY A;  4DCK A;  1L0N G;  3L72 E;  3Q5P A;  4PV1 D;  1SQP D;  3H1H E;  3CD6 P;  1PL5 A;  1RF1 C;  3L70 D;  1J1D B;  4GOE A;  2FY8 A;  2FYU D;  5CJ4 A;  1SQQ D;  4DZO A;  3B71 A;  2ZXX A;  1CI6 B;  1JY2 O;  3S1K A;  1R5L A;  1SS1 A;  4IOI H;  2R3S A;  1GZL A;  3WUU A;  3RK3 C;  1N7S A;  2LXC B;  3JC2 2;  3TYY A;  3RBX A;  2YIU B;  1YTZ I;  4D6T G;  3WMM 0;  3MUD C;  3C8V A;  1SQX E;  1NTZ E;  1UIX A;  3L70 J;  3O6Q B;  1VQ6 P;  5KAF E;  1Q82 Q;  1K05 A;  1LWU B;  1FC2 C;  2YNY A;  2RN0 A;  3MZW B;  1LTJ B;  4PD4 H;  3JCU H;  1T3J A;  1EQ7 A;  4AQR D;  2ZYA A;  4UB8 E;  1IZN B;  2V4H A;  5CHX A;  3U1A A;  3L37 A;  2H7H A;  1S2E A;  2M0B A;  1RF1 A;  4AUW A;  4RO0 A;  3RL0 C;  3CME P;  1GTW A;  1U57 A;  1GK6 A;  1LP1 B;  3P7K A;  1K8A Q;  2W90 A;  3L70 E;  1P84 I;  1JCC A;  5APS A;  1SFC B;  1IFN A;  1L4A C;  4D6T D;  5APT A;  3VN0 A;  1G2C A;  4H44 C;  5E79 E;  3P32 A;  2AEM A;  3IAO A;  2ZXE B;  3FWN A;  2K3R A;  3L71 G;  1NTM G;  1R5S A;  1ZV8 A;  4KJM A;  4W7Y A;  1GU4 A;  2AXT H;  1S5L X;  3FWL A;  3H6P A;  1FJK A;  3U59 A;  3SWK A;  5AW5 B;  3HUS C;  1RE3 C;  4PJ0 H;  3WUT A;  1ZLL A;  3WU2 E;  1KB9 I;  3O8Z A;  5CCG C;  1SQX K;  1S1C X;  1NTZ K;  1IFP A;  3D6Z A;  1URQ C;  1M90 Q;  1USE A;  3L73 G;  1PZQ A;  4KT0 J;  2HOD B;  1T6A A;  1LTT C;  5APX A;  1X79 B;  3HE4 A;  2WT7 A;  3LW5 H;  4BRY A;  2ZFC A;  1A02 F;  4K35 A;  3H1L J;  4QMA A;  2NRG A;  1NTM D;  4D6T E;  4WY4 B;  4H13 C;  4AYC A;  2QJP C;  2KS1 A;  3TNU A;  2I1J A;  2YMY A;  1SQP K;  3MTU E;  3QH9 A;  4C7N B;  1OW6 A;  4ZKP A;  2KSE A;  1KYO H;  3HUS A;  2Z4E A;  1RE3 A;  2FYU K;  1SQQ K;  1MFT A;  2QJK C;  4ZKU A;  3RGU A;  5AVZ B;  1BGY G;  3CXH H;  1Q90 D;  2WMM A;  1LT9 C;  2WSE J;  1IK9 A;  2YKQ A;  3B4S A;  1W2E A;  3I55 P;  3KXD A;  1NAY A;  1OVV A;  2VRS A;  2I8D A;  2RH0 A;  1S4X A;  3H1J J;  3D70 A;  3H1L E;  3AE7 C;  1BE3 D;  3KZI E;  2K88 A;  5KLI B;  2Q5U A;  3B5N D;  1VQN P;  1S5L H;  1K9M Q;  5CJ0 A;  2V7Q H;  2W6A A;  2HYN A;  2SPZ A;  3AED C;  1RF1 B;  2KLU A;  2O01 J;  5KJ7 D;  2P7J A;  1BE3 J;  5H2F H;  1Q2N A;  2M3E A;  2JDI H;  5AVU B;  2QIW A;  1KMI Z;  3BCC G;  4N3Y B;  3RK3 B;  3ITK A;  1FDI A;  3H1K J;  1G2C B;  2P58 A;  1BGY D;  1VQ9 P;  3H1J E;  2IYO A;  2MKV A;  2H88 C;  4BXL A;  4DJG A;  5EFW B;  1FZA A;  3AE8 C;  1J1E C;  1DD3 A;  3P8C D;  3L74 J;  1PGP A;  3HTK A;  4I1L A;  3A0H H;  3W68 A;  2HPC A;  1N8R Q;  1FE6 A;  3CX5 D;  3B5N A;  2KYV A;  2K9J B;  2N9Y B;  4JPZ B;  1G1J A;  1BE3 E;  1GDT A;  5AVS B;  3FGA D;  2GUV A;  4C7R A;  4ASW A;  5B5E E;  5KJ7 A;  2G3A A;  3RL0 B;  1CI6 A;  3BCC D;  1X22 A;  2UWJ E;  3L72 G;  2IPP A;  1L4A B;  1SFC D;  4BRY B;  2JJL A;  3KQG A;  1JCD A;  1PGO A;  4H44 B;  4TLF A;  1OVU A;  2JEE A;  2B89 A;  3HE5 B;  2Y9Y A;  3A0B H;  3O6Q A;  1AQT A;  1G1I A;  2OTJ P;  2R3C A;  3RBZ A;  4YXD C;  1NTM K;  1YIT P;  1PIX A;  3HUS B;  3IF4 A;  1EZV G;  4GOF A;  3P8C E;  2QG4 A;  1SQX G;  2Y9Z A;  2E76 C;  4PD4 E;  4RJT A;  2M3B A;  3JCU E;  1URQ B;  2H89 C;  1NHL A;  1PFI A;  3PH0 A;  2E5T A;  3FX0 A;  4YTP C;  1M1K Q;  2A45 H;  1LP1 A;  2OYI C;  1EDK A;  1AFO A;  2KNC B;  2PGD A;  3SWF A;  1SFC A;  1S9K D;  1U7M A;  2HFE D;  2L5G B;  3BCC E;  1PGQ A;  3BRV B;  5AW4 B;  3R4Y A;  4OGQ C;  4XFJ A;  2ZVO B;  2KOG A;  4WY4 D;  3L70 G;  4H13 B;  2QJP B;  2Q9I A;  1CSB A;  4WB4 A;  2JWA A;  2AXT E;  2KI7 B;  5DJT B;  1JY2 N;  1KYO D;  1YIJ P;  3LW5 J;  1EZV D;  3IFM A;  1NJI Q;  1KQG B;  2AXC A;  3BAT A;  2QJK B;  2QM7 A;  3C1L A;  1NGM B;  3CCM P;  4PJ0 E;  2XZR A;  1LT9 B;  1JB0 J;  3VOP A;  5K5G B;  1JM0 A;  1T2K C;  2QVA A;  2O1K A;  5GTH H;  1KIL C;  1T2K D;  2QA4 P;  1H8A A;  1BSH A;  1PP9 J;  4R4M A;  3VP9 A;  1HF9 A;  3AE1 C;  2WZ7 A;  4TT3 H;  3CC7 P;  2OYI A;  2O01 H;  3HTK B;  1J2J B;  1VF5 C;  1HWT C;  1FBM A;  2HPC B;  2XKM A;  1OVR A;  1M57 D;  1HTL C;  2YO2 A;  3AEB C;  1VQM P;  1Q81 Q;  3OAK A;  3VMX A;  1S9K E;  1VQ7 P;  3KHU A;  1RH5 B;  2HLO A;  1NU1 D;  3GMA A;  4WY4 A;  1LTG C;  1QL1 A;  3VTP C;  3TSI A;  1M8O B;  2OYH C;  2WPV B;  5AW6 B;  4C7N A;  5APQ A;  4GT1 A;  3PTZ A;  4YPC A;  2YXQ B;  2Q7C A;  3CX5 I;  1GW4 A;  3C9I A;  3RK3 D;  1EDI A;  1PP9 E;  1KYO E;  2V7Q J;  3CWB J;  2WWW A;  1OWA A;  1EZV E;  3MD0 A;  5AVT B;  4Z1M H;  2H43 A;  1NU1 J;  3M0D C;  2Q1K A;  1KV4 A;  1JUN A;  2FXP A;  5KKZ C;  3CXH E;  3FXE A;  2YXR B;  3TGU J;  1J1E B;  2YKP A;  1YBK A;  2C9L Y;  1RE4 C;  5APW A;  2BCC D;  1ZP0 C;  2IZ1 A;  2XV5 A;  4GDO A;  4EI2 A;  1YJN P;  3BAS A;  3E1R A;  1RHZ B;  3VMZ A;  3HRN A;  2QSI A;  1KC8 Q;  1QLE D;  1VPC A;  1S5L E;  3A5T A;  1YJW P;  2FXO A;  3H1L G;  2KZJ A;  4WWI A;  3A2A A;  4JQ0 D;  1ZN5 A;  1NU1 E;  1SQB D;  1L0L J;  3RL0 D;  2BCC J;  3PHL A;  3BRT B;  5H2F E;  1Q7Y Q;  3G9R A;  2KLV A;  2R5B A;  2O3J A;  3IR9 A;  4JBZ A;  1L4A D;  2AEJ A;  4HKZ H;  1EXI A;  5AW7 B;  3MUD A;  4H44 D;  1BDD A;  5B66 H;  1RQU A;  3RK3 E;  2R44 A;  3V2N A;  4A7P A;  3Q3D A;  3WUV A;  1SQB J;  1FU1 A;  1ZRT D;  1Z56 A;  2FYZ A;  1NVO A;  1ZR2 A;  1IFM A;  1QEX A;  3V4Q A;  4W7Z A;  2K1A A;  3H1J G;  2QJY C;  4WBA A;  5KAI H;  3CCE P;  1IFD A;  3OW2 O;  3L75 J;  2K9J A;  3A0H E;  2WSC H;  2E76 B;  2BCC E;  3I5C A;  5CCG D;  3AE5 C;  1OXZ A;  3H1L D;  1URQ D;  1OMI A;  3SFE C;  2M5A A;  2L91 A;  3EWK A;  3V6I A;  2OYI B;  1SP4 A;  2OQQ A;  3SWY A;  4Y28 J;  3AEG C;  1EZV I;  1BE3 G;  4UB6 E;  1SQB E;  1RF0 C;  1L4A A;  3D71 A;  3H25 A;  2LR2 A;  3H1K G;  4OGQ B;  2OTK E;  3HE5 A;  3MP7 B;  3Q5R A;  5CCH C;  4L74 A;  3U1C A;  1ZW0 A;  2OGU A;  3L36 A;  1KB9 H;  3A0B E;  4H13 D;  3T97 B;  1NU1 K;  2OYO A;  3L4F A;  1IO4 A;  2I1K A;  1JY2 P;  3N4X A;  4IL6 X;  3F5H A;  4NPF X;  3H1J D;  5TIS E;  1ZRT E;  3L35 A;  1N7L A;  2WQY C;  3L74 G;  5KLV D;  2CPS A;  1W2B O;  3H32 A;  3F89 A;  4I7Z C;  4M3L A;  3V2P A;  3RK2 C;  5CCG A;  1JY3 O;  1WRG A;  3GHG C;  1FOS E;  2W8Z A;  1VQ4 P;  1URQ A;  4NPE A;  3AE2 C;  1KIL B;  2G8Y A;  2ITA A;  2C0W A;  2PRR A;  5AW8 B;  3M9Q A;  3CLQ A;  3PRJ A;  3GG2 A;  4HYT B;  5CBO A;  5KLV J;  4XE5 B;  1VF5 B;  1H0T B;  2KNC A;  5AW2 B;  1AVO A;  3G6E P;  2K37 A;  1RF0 A;  2R32 A;  4GOD A;  4GKG A;  1NTK J;  3H1K D;  3M0A A;  1SQV J;  1HJ0 A;  1GMJ A;  3S4R A;  1GL2 C;  5BVZ A;  1YI2 P;  1M1J C;  1DEB A;  2DW3 A;  1JTH B;  2OYH B;  1EDL A;  2E74 B;  3H1I J;  3MIW A;  1OIP A;  2IDB A;  1VQO P;  3L74 D;  1NKN A;  2P2U A;  3M91 A;  1SQB K;  3EFG A;  2Y0D A;  3D6Y A;  1IK7 A;  5AVY B;  1GW3 A;  3CCL P;  2Z5H A;  4U3F J;  1OW7 A;  1LT9 A;  5KLV E;  2OAR A;  5C39 A;  2W83 C;  1KQS O;  3G4S P;  5KKZ B;  1E79 H;  5AVX B;  4YXW H;  4BWN A;  1MUU A;  5GTH E;  4OWF A;  1FZC C;  2J5U A;  4PD4 D;  1IC2 A;  5TJH A;  5AVW B;  3Q1M A;  1KFN A;  1ZXG A;  3H1I E;  3MHV A;  2OTL P;  1XTC C;  4LC1 A;  1KFM A;  3A7O A;  2Z5I A;  4IL6 H;  3H1K E;  1QGK B;  2IFN A;  1M1J A;  2PFX A;  2M5A B;  3ZDM A;  2XND H;  2JKV A;  5BU5 A;  2P1J A;  1VQK P;  4H0L C;  2IBZ E;  1LJ2 A;  1DEE G;  3A3Y B;  1QX8 A;  2PP6 A;  3SFD C;  2E42 A;  3M9B A;  4XA4 A;  3L74 E;  3VYI A;  2D2C C;  2ZYG A;  3TK1 A;  3B8E B;  1FZF A;  1AQ5 A;  2KSJ A;  2C0X A;  3GW6 A;  2WPQ A;  4Y99 C;  1CW5 A;  3QWO C;  1PP9 G;  2QJY B;  1R8E A;  2E75 C;  1NWQ A;  2RKL A;  3H32 B;  5KTB A;  1JO5 A;  2JR8 A;  2E76 D;  2GUS A;  3P8M C;  2JO1 A;  5KLV K;  4KHX A;  1UII A;  4B86 A;  2XDJ A;  2J59 M;  5BU8 B;  2NPS C;  3AEE C;  2WSC J;  1FOS F;  1GD2 E;  3HD7 C;  3AE9 C;  1VL2 A;  2ZT9 C;  1YQ3 C;  3NXS A;  3TF5 A;  4OGQ D;  1HVV A;  3CWB G;  1NU1 G;  1NYH A;  3EQ2 A;  2FFD C;  4EIJ A;  1QVF O;  5B66 E;  1KZU B;  1L2P A;  3CC2 P;  1PP9 D;  1FZG A;  1AVY A;  1FZE A;  5AVR B;  2Y0C A;  2WSF H;  1VQ8 P;  3CXH D;  2H8P D;  4I7Z B;  3RK2 B;  5KAI E;  3IN6 A;  2IFM A;  2CPB A;  3GHG B;  3CCS P;  3Q2Y A;  1LT1 A;  1LGH B;  2HR3 A;  3H1H J;  1N7S C;  2IYP A;  5L8R J;  3CCV P;  2KP8 A;  2WIT A;  1JNM A;  4DT0 A;  1S3J A;  4U7J A;  1KIL D;  1N86 A;  1W5C E;  2LKM A;  2J58 A;  1T8Z A;  1QVG O;  2AEF A;  2KB7 P;  5GTI H;  1YQ4 C;  2YO3 A;  1L0L G;  2NPS A;  1BCC D;  1WT6 A;  1VF5 D;  1CZQ A;  2BCC G;  3HD7 A;  1FAV A;  1N73 C;  1VQL P;  3CWB D;  3BVH A;  4O9B A;  1NTZ J;  1GL2 B;  1M1J B;  1JMM A;  1YYC A;  2E74 C;  2P10 A;  3T97 A;  1Y8A A;  1FDO A;  5AW0 B;  4PV1 C;  3NTN A;  2E74 D;  1SQB G;  3TGU D;  1BCC J;  1YHQ P;  5B5E H;  1KB9 E;  1USD A;  4PD4 I;  2JWD A;  1EC5 A;  2Y0E A;  4N78 D;  3L75 G;  2WTY A;  2WPR A;  3GLM A;  3CPW O;  4DOJ A;  2FKW B;  1MV8 A;  3MGN A;  1KIL A;  1OW8 A;  1FJP A;  5APU A;  1SQP J;  1M56 D;  4OVN F;  2W27 A;  1FZC B;  1KIL E;  1L0L D;  3USS A;  1H0T A;  2FYU J;  1SQQ J;  2WSS H;  4W80 A;  1N73 A;  4L76 A;  1BCC E;  2IX7 C;  3VMA A;  1EDJ A;  3GF7 A;  2O1J A;  2P67 A;  1HGZ A;  3CX5 H;  1FS0 E;  1IFJ A;  3CWB E;  1HH0 A;  1JTH A;  2OYH A;  1L0N D;  2A45 G;  1LTS C;  4H0L B;  1RY3 A;  2BEQ D;  4L75 A;  1GU5 A;  4MN4 C;  3TGU E;  1SQP E;  1XTG B;  3NFQ A;  2D2C B;  3L75 D;  3M0D A;  4ZNC A;  2ZYD A;  1HJB A;  1OX3 A;  1DD4 A;  2FYU E;  1SQQ E;  2HG5 D;  3JSV C;  1L0N J;  2QE7 H;  4N78 E;  2GA1 A;  4Y99 B;  2KXP B;  3AE6 C;  1RE4 A;  1DH3 A;  2E75 B;  3CCU P;  4RES B;  5DJU B;  1JOC A;  5KLV G;  3FXD A;  3VMY A;  1H89 A;  1L0L E;  3NMD A;  4OH8 B;  1JY3 N;  1P84 H;  3E1I A;  4K3A A;  3CCJ P;  1NTK G;  4NPD A;  1EXJ A;  3AEA C;  4D6T J;  3CCQ P;  1SQV G;  1QL2 A;  3VP8 A;  4IL6 E;  1LTA C;  1KYO I;  3H1I G;  2ZVN B;  2NPS B;  5M1B A;  1L0N E;  4IFF A;  3OA7 A;  3S9O A;  3Q5S A;  3V2Q A;  3HD7 B;  2QM8 A;  2N9B A;  1GK4 A;  2ZT9 B;  3CXH I;  1VQ5 P;  2BAS A;  1X9V A;  3CMA P;  5CCH D;  1KQF B;  3GF3 A;  2FFD B;  4HH2 A;  2Q6Q A;  1IJD B;  1N2D C;  2N1T B;  4U3F G;  3L75 E;  2E5Y A;  2IBZ G;  2KIK A;  4GIF A;  5AW1 B;  2XU6 A;  3TDK A;  3L71 D;  4JF7 A;  1WMK A;  1KN7 A;  3KYQ A;  3CI9 A;  1KD1 Q;  1PV3 A;  2K9Y A;  2Q3E A;  1X8Y A;  4EOT A;  1MFZ A;  3RK2 D;  1NTK D;  4ASV A;  1YTZ T;  1SQV D;  1N7S B;  1D7M A;  2B87 A;  2FYN C;  3L71 J;  3E7K A;  1NTM J;  5KAF H;  2WPS A;  5AW3 B;  1X0T A;  4I2L C;  3H1I D;  2WSF J;  3M9H A;  2R5D A;  3L73 D;  2M8R A;  1OZH A;  4JYB A;  1N73 B;  1L0L K;  5CCH A;  4UB8 H;  3G71 P;  4U3F D;  2YKO A;  3B5N C;  1GL2 D;  2E43 A;  2IBZ D;  2MJZ A;  3LIE A;  1MZ9 A;  4PV1 B;  1TU3 F;  3L73 J;  1L0N K;  1J1D C;  5KJ7 C;  3CL3 D;  1FDM A;  3L71 E;  1KTM A;  1NTM E;  2A06 G;  1NH4 A;  3PLN A;  1MKM A;  1HUC A;  3GHG A;  5E79 H;  5APV A;  3KPE A;  1NTK E;  2YIU C;  3CC4 P;  2LXB A;  1FZB A;  1SQV E;  2ZAE B;  2ZJS E;  1H88 A;  1NKZ B;  2CK3 H;  1S72 P;  1DX7 A;  1OFC X;  4C46 A;  3CCR P;  1LWU C;  5CMZ A;  3PJS K;  5GTI E;  3AEC C;  4LLH A;  1PGJ A;  1K73 Q;  1PPJ G;  3WU2 H;  1LTJ C;  1M7L A;  3L73 E;  5CBN A;  2IZ0 A;  4HJG H;  1GL2 A;  1BGY J;  1BDC A;  3SSU A;  3EFF K;  4U3F E;  4H0L D;  4LGD E;  3II6 A;  3AE3 C;  2A06 D;  2XNX A;  1VDF A;  3AE4 C;  1LNQ A;  2KK7 A;  4UB6 H;  1Q86 Q;  3OJA B;  2D2C D;  1HBW A;  1SFC C;  3HE4 B;  2WT7 B;  2POH A;  4RKU J;  2A45 I;  3H1H G;  4L73 A;  1YJ9 P;  2FXM A;  1FZC A;  3G3Z A;  2C9N Y;  1BGY E;  4JYC A;  2WVR A;  1VQP P;  3AEF C;  1JEK A;  3V2R A;  2E75 D;  1LWU A;  2KS1 B;  1LTI C;  2FBW C;  5TIS H;  1T3U A;  3TNU B;  3BCC J;  1PPJ D;  1JY3 P;  1P84 D;  2NZ2 A;  1LTJ A;  1ZR4 A;  5AW9 B;  2B87 B;  1NTZ G;  1JMB A;  2RMZ A;  1NTK K;  3K5B A;  1SQV K;  1SLQ A;  3CX5 E;  3V5B A;  1NO4 A;  2QEX P;  2KZI A;  3UIA A;  2GM4 A;  2NPS D;  1BCC G;  2Q3I A;  1BSN A;  4R4L A;  1SVF A;  3KZI H;  3HD7 D;  1NOH A;  2ZT9 D;  3I56 P;  2PAJ A;  2A06 E;  1KOR A;  3L72 D;  2N1T C;  1A02 J;  2O01 N;  1KB9 D;  2N1T D;  1IFI A;  3H1H D;  4HB1 A;  1E5W A;  3TGU G;  4ZMD A;  3V4W A;  2B88 A;  3R2P A; 
#chains in the Genus database with same CATH homology
 3CX5 I;  4PD4 I;  3H1I J;  1NTZ J;  1SQX J;  1SQP J;  3CWB J;  4D6T J;  1NTK J;  1NU1 J;  3H1L J;  3CXH I;  1SQV J;  3L70 J;  3BCC J;  3L73 J;  3H1J J;  3H1K J;  3L72 J;  1L0L J;  2FYU J;  1KB9 I;  1SQQ J;  1NTM J;  3L71 J;  1P84 I;  3L74 J;  3L75 J;  2BCC J;  3H1H J;  1BCC J;  1BGY J;  1L0N J;  1SQB J;  1KYO I;  5KLV J;  1EZV I;  1PP9 J;  3TGU J;  4U3F J;  2IBZ I;  1BE3 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...