1KYOI

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
53
structure length
53
Chain Sequence
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKAKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
total genus 17
structure length 53
sequence length 53
chains with identical sequence T
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1kyoI00
2FYUJ 3L74J 1P84I 3H1IJ 1L0NJ 1SQPJ 3CX5I 1NTKJ 1NU1J 1PP9J 1NTMJ 4D6TJ 1BCCJ 1BGYJ 4U3FJ 1KB9I 4PD4I 1BE3J 2BCCJ 3TGUJ 1SQVJ 1EZVI 3H1HJ 1KYOI 2IBZI 1L0LJ 3CWBJ 3L70J 1SQXJ 3H1LJ 5KLVJ 3L73J 1NTZJ 3CXHI 3L75J 3BCCJ 1SQBJ 3H1JJ 3L72J 1SQQJ 3L71J 3H1KJ
chains in the Genus database with same CATH superfamily
2C0WA 1FZCC 3KPEA 1X0TA 2RN0A 3AEEC 4HYTB 1SQVJ 2QJKB 1AVOA 2PP6A 1MZ9A 2IBZG 1KB9E 1BDCA 1SQQK 1NO4A 2JJLA 2B87A 5BU8B 2IPPA 2YO2A 2N1TC 2YKQA 2YXRB 2YNYA 2IYPA 1IFMA 4L74A 3BCCE 2AXCA 2WPVB 3L72D 1PPJE 3V2PA 1H0TA 1SQVE 2K9JB 2FYUK 3OW2O 3FXEA 1EXIA 5TISE 1N73A 2BEZF 3F5HA 1FZFA 1LTSC 3PH0A 1GU5A 2ZYGA 1DD4A 1IK9A 2ZVOB 4BXLA 4YXDC 1J1DB 5AW5B 3V6IA 3HD7C 3U59A 3CX5H 4D6TJ 4WY4C 2XU6A 2NPSA 3VTPC 4BWNA 1SQPK 3L74G 2JKVA 3V2NA 2Y9YA 2KXPB 1NTKJ 2H43A 1EC5A 1N7SC 1PP9D 1VF5B 3WUTA 2YKOA 1LTTC 5APTA 1EDKA 2KZJA 4DJGA 2W6JH 2M5AA 3L74J 3WUVA 1LTAC 1ZRTE 4RESB 2RMZA 2N9YB 3VP8A 4D6TE 1XTCC 3H25A 2QG4A 2K88A 2E74B 4GODA 3AE4C 5CJ4A 1L0NJ 1S3JA 3M0DC 2R32A 1JY3O 4H0LB 1T8ZA 3M9HA 3RK3E 1LTBC 3IFMA 1KYOH 2H7HA 5APXA 4PV1B 1VQKP 3TGUD 1FZCB 1RF0A 3CXHH 2PGDA 5KAIH 2B9BA 2FXMA 3SWYA 1J1EC 1VQLP 1NJIQ 3HE4B 2KNCB 2XV5A 1PL5A 2BCCD 2QJPC 5CHXA 4GKGA 2E42A 5KJ7C 1EZVD 1HF9A 3USSA 1QVGO 4Y28J 3Q5SA 4IL6H 2ZT9D 5E79H 3Q5PA 5APWA 1L0NE 2R3SA 1R8EA 3HUSA 3P8CE 1X22A 5CBNA 2BASA 4ASVA 1JUNA 2E5TA 1A02F 1KILC 3IR9A 1PZQA 3C1LA 2HPCA 2YKPA 2YO3A 3JSVC 1LTIC 1QLED 3U1CA 1KTMA 3FWNA 3KZIH 3RL0g 5KLVJ 1YIJP 2Q5UA 4PD4D 4L76A 1T3UA 4EIJA 3VMAA 2JO1A 2HG5D 3H1IJ 1VL2A 3RL0D 2VRSA 2Q7CA 3D6ZA 1T3JA 2AXTE 2YMKA 3GHGC 2J59M 1KORA 1M90Q 1GL2C 4WY4B 2WT7B 2LR2A 1JCCA 2KSJA 1NTZD 5AW0B 3L73E 1Q81Q 5CCGD 3GG2A 2FYNB 1BGYG 1IJDB 1L0LK 1ZV8A 3TF5A 3M91A 4R4MA 4YTPC 5DJTB 4IFFA 2Y0EA 3CLQA 1SQXE 4EI2A 5KLVE 2Y0CA 1N7SB 2IBZD 4CPGA 3K5BA 4H44D 1NTMK 3CC2P 1ZP0C 3TK1A 3H1IE 1HWTC 1OX3A 5KAFE 1FOSF 2KB7P 4A7PA 1EDJA 1JY3N 4M3LA 1VQOP 1S4XA 1HJBA 1VQNP 1BCCG 1QX8A 1PV3A 4LGDE 3CCJP 1KB9H 1ZN5A 1LTJB 3MTUE 4OGQB 1USDA 2OYIA 2WSFH 3HE5B 2P67A 3H32A 1FJPA 2ZXXA 4Z1MH 1YTZI 3L72E 1GD2E 3MIWA 4HJGH 3CXHE 3WU2H 3FX0A 1NKNA 1EZVI 1JCDA 1YJ9P 1NTZK 3H1LJ 2P2UA 4GDOA 1L4AC 5AW8B 3KQGA 2QJPB 3MD0A 1PGPA 1JTHB 3AE3C 1NU1D 3AE2C 2M8RA 2ZYAA 3RK2C 5E79E 3GMAA 1HH0A 1MV8A 2W6AA 3BRTB 1LWUA 1KC8Q 2B88A 2WQYC 3HTKB 3IN6A 3L35A 1J1DC 4EOTA 1KILB 3H1HG 3CWBG 1R5SA 3EQ2A 1RE3A 1NWQA 1GDTA 4UB8H 4WWIA 4C7RA 3CCMP 1KFMA 3M9QA 1PP9E 1YJWP 3A0BE 3GW6A 1IFNA 2JWDA 1FU1A 2H88C 2GM4A 1VF5C 1AVYA 2UWJE 3RK3C 4IFMA 3H1KD 2H89C 4RJTA 3I56P 5EFWB 1S72P 1NYHA 2N1TD 1BSHA 1BE3D 5AVQB 3SFEC 1Y47A 2WSFJ 2WSCH 2NPSC 4C7NA 1NTKK 2A45I 1P84H 1JM0A 3M06A 3VOPA 2M0BA 2FYUD 4MN4C 4I7ZC 1SQVG 1JMMA 2KIKA 1PGOA 1ZLLA 3OAKA 3TGUE 4DZOA 1YHQP 2O1JA 3A3YB 4H0LC 3BCCJ 1S5LE 3AE5C 4N6JA 3L71J 1CZQA 2AEFA 2XNDH 2E76C 1M1JA 1P84I 3FGAD 4PV1C 3W67A 2HLOA 1M1KQ 5CCGA 2FXOA 2WSSH 3T97B 2QEXP 3B5NC 1K73Q 3O6QB 1DX7A 1EZVE 3CCEP 1OXZA 5AW1B 1YQ4C 3P8MC 1DD3A 3V2QA 1LGHB 3U1AA 4RKUJ 1SQPD 1KQSO 4N78D 3HD7D 3WU2E 3D70A 3B8EB 3QWOC 2KP8A 2O3JA 3FXDA 3IF4A 1OFCX 3TDKA 2C9NY 3L37A 1IK7A 3L71E 4U7JA 3CC4P 3HRNA 4BRYA 4I6MC 5B66H 5KTBA 2RKLA 2IDBA 1NOHA 5AVUB 1L4AB 3FWLA 2B87B 1ZOYC 2WPRA 1SQBJ 1OMIA 2KUBA 4I2LC 3RK2B 2N9BA 3GLMA 1VQPP 4D6TG 5AVSB 2OGUA 1BGYD 1K9MQ 2V4HA 1DEEG 2W6BA 3B71A 1ZR4A 2WSCJ 1OW6A 2HFED 4UB8E 2WPSA 1NTKG 1RF1A 3L75D 3V4WA 2AXTH 3AECC 3S9OA 3PTZA 3B4SA 2FYNC 3MHVA 1SQBE 3ITKA 1N73B 3PRJA 3AEDC 1J2JB 4XE5B 2AEMA 2NZ2A 4OWFA 2P1JA 1M8OB 1BCCD 1BSNA 1SFCD 2Z4EA 3RK3B 1AQTA 5APQA 1RY3A 1TU3F 2K9YA 1L0NG 4XFJA 5KAFH 1HJ0A 4WBAA 1QEXA 1SLQA 2NPSB 1P84E 3VMXA 3Q3DA 1Q2NA 3V2RA 1EXJA 1LTJC 1VQ5P 4I7ZB 4OGQC 5K5GB 2QM7A 1KILD 3HE4A 5KKZC 2V7QJ 3TNUA 2HODA 1N8RQ 4IFDK 2E76B 2N1TA 1DEBA 5DJUB 1FDIA 4TT3H 1OWAA 1SQQJ 3F89A 3CMAP 2M5AB 3B5NB 2M3EA 1QL1A 3Q2YA 2IX7C 1NU1E 2R44A 3L70J 1H8AA 3H1HD 3CWBD 4JQ0D 1L0LD 5GTHE 2QA4P 2XZRA 1CI6A 2OTJP 1Q90D 1IFPA 2B89A 2OYIC 1GL2D 2A06G 2NRGA 4U3FJ 1BE3J 1NGMB 1URQD 3C8VA 1LP1A 1NTMD 1SQXG 5B66E 3AE1C 5KLVG 3I55P 3L73J 2Q6QA 2KLUA 2FYUJ 3CCQP 2KK7A 3H1IG 1SQQE 4WVZA 1SS1A 5AW7B 1JY2P 2FKWB 3LIDA 2G3AA 3C9IA 2IYOA 1SQXJ 3HD7A 5AW2B 3L70E 4GOFA 1IFDA 1KFNA 1OW7A 2QVAA 2FBWC 1HVVA 3VYIA 3H1KE 4XA4A 1IFJA 3H1JD 1G1JA 3A0BH 1R5LA 2KYVA 4ZMDA 1LT9A 2HYNA 4LLHA 4U3FE 3HUSB 1BE3E 3AE8C 1LWUC 1SQVD 4R4LA 1SVFA 2P10A 1G2CA 1QL2A 4OH8B 3BATA 1JNMA 4DOJA 1LNQA 4AQRD 1USEA 5APUA 1PIXA 2CK3H 2FYUE 2MJZA 3RGUA 3EFGA 1VDFA 1VQ7P 1FZAA 2QM8A 3BRVB 2ZFCA 3BASA 5B5EH 2IFMA 1T2KC 3NMDA 2ZT9C 1RE4A 3NTNA 3GF7A 3L72J 4ASWA 3VMYA 1JOCA 3L36A 4K35A 3JC22 1L4AD 2Q9IA 1GK6A 1OVUA 1S5LH 1NKZB 3HE5A 3PLNA 3M0DA 3L4FA 3RK2D 3EWKA 2Z5IA 5AVWB 1L2PA 2FYZA 2CPBA 1SQPE 5AVRB 4N78E 3I5CA 4I1LA 4L75A 1Q82Q 2DW3A 2K3RA 3H1LG 3A5TA 2ZJSE 1KN7A 3RL0C 1PFIA 1SFCA 1RQUA 3L75J 5AVVB 2W83C 5KKZB 2E75C 2E5YA 1FS0E 1PP9G 2I1KA 1E5WA 4IL6X 1SQVK 4JYCA 1M1JC 4D6TD 3PJSK 2WTYA 1EQ7A 1RH5B 4N3YB 1AFOA 5CJ0A 1NHLA 3MZWB 2Q3IA 1FAVA 3VMZA 2KS1A 3S1KA 1PP9J 3W68A 1GW4A 1VF5D 1OZHA 1KILA 1NTKD 4HH2A 1WMKA 4H44C 2J58A 5BVZA 1FDMA 2OYIB 2P7JA 2OARA 4JF7A 3H32B 2W27A 2H8PD 3L75E 4GOEA 3L74D 2JWAA 4PD4I 4DT0A 1LT1A 3Q1MA 1QGKB 5C39A 1SQBK 2E74D 1MFZA 2JDIH 4GT1A 5CCHD 4NPFX 1X9VA 3GHGA 1D7MA 1ZW0A 1YITP 4H0LD 1JY2O 1GL2A 2WZ7A 4HB1A 1GW3A 1L0ND 2E76D 2OYHA 1BCCE 3TGUJ 4PV1D 3AE9C 1URQA 1N73C 1LTGC 4W80A 4PJ0H 1G1IA 3B5ND 4LC1A 3CCVP 1YTZT 1PGJA 3ABVC 2A45H 1KQGB 1LWUB 2QRXA 4L73A 5H2FH 2BCCJ 2MKVA 3A0HH 2XDJA 2IBZI 1L0LJ 2D2CC 1X79B 2WSEH 1RF1C 2FFDA 3NFQA 2OTLP 4AYCA 3TYYA 3BCCG 1N2DC 5B5EE 3L71G 3SFDC 3CCLP 5APSA 1PPJG 3CCRP 1M57D 3JCUE 2GUVA 1OW8A 1FC2C 1FZGA 1KQLA 2ZT9B 1NAFA 3SSUA 2KLVA 3CX5D 2ZXEB 4JYBA 5AW4B 1RHZB 3NXSA 4ZKPA 3V4QA 3H6PA 2A06D 1KD1Q 4KJMA 2BCCE 3CWBE 1AJYA 1L0LE 1KMIZ 4C7NB 4YXWH 1L0NK 1H88A 2KZIA 3AEBC 1MFTA 2QIWA 4JBZA 5CMZA 2GUSA 3H1ID 3RL0B 1PGQA 1NTME 2Y0DA 4KT0J 1N7LA 2WVRA 4H13C 1L4AA 5GTHH 2E75B 2K9JA 2O1KA 1VQ8P 4WY4D 2L5GB 1NTZJ 2WPQA 1SQBG 1M7LA 1OIPA 5GTIH 2Q3EA 2RH0A 1M1JB 3G71P 2A45G 1RF0C 5AVTB 1S9KD 2V7QH 5AVYB 2LXCB 3N4XA 3RBZA 4O9BA 1N7SD 4PD4E 2LKMA 1KYOD 1Y8AA 3S4RA 3H1JE 2PAJA 4H44B 2G8YA 3CXHD 3AE7C 1OVRA 3P7KA 1IFIA 3KXDA 3D71A 3D6YA 1VPCA 2WSEJ 2P58A 3UIAA 1JY2N 3OA7A 1NTZE 2ZAEB 3HUSC 1ZR2A 2KOGA 4GIFA 1H89A 4BRYB 1SQXK 4OGQD 1H0TB 5KLVK 3KHUA 3E1RA 1YYCA 3KDPB 5AVXB 2O01N 3V5BA 3PHLA 2IBZE 3CL3D 4PJ0E 1GTWA 1NU1G 1ZXGA 2HR3A 1GZLA 2SPZA 2W8ZA 5H2FE 3A0HE 1S2EA 1SP4A 3MUDA 3H1LD 5KLIB 1DIPA 3VN0A 2XKMA 1LT9C 2W90A 5CBOA 5CCHA 2D2CB 3CX5I 1NU1J 1RF1B 5KJ7D 3LIEA 1FDOA 2Q1KA 1KZUB 1QVFO 2I1JA 2GA1A 1FZCA 3SWKA 2O01H 1SQQG 2IFNA 3B5NA 1RE4C 3G9RA 2YMYA 3CCUP 4EYYQ 2KNCA 3L70G 4UB6E 3CI9A 2WMMA 2YXQB 1YBKA 5APYA 1Y9BA 2C0XA 3H1KG 3G6EP 3CC7P 1Q86Q 4NPEA 1ZMEC 1LJ2A 3VP9A 1W2BO 3EFFK 4U3FG 1NTKE 1BE3G 1CW5A 5AVZB 2YIUC 3PP5A 3L73G 3H1KJ 2FYUG 1U7MA 4H13B 4Y99C 3L74E 1SFCC 5GTIE 1EDLA 3G4SP 1KYOI 1IC2A 3TNUB 2HODB 1VQ9P 2N1TB 1KB9D 3CXHI 3E1IA 2R3CA 1T2KD 1RQVA 2OTKE 1U57A 5AW9B 1AA0A 1FBMA 1WT6A 4B86A 3O8ZA 3P32A 1JO5A 4WY4A 2WT7A 1CI6B 1UIIA 2M3BA 3CMEP 1JEKA 1NH4A 3BCCD 4ZKUA 1SQPG 1W5CE 3E7KA 3L71D 4DCKA 1PPJD 1IO4A 5L8RJ 1UIXA 1FJKA 5TJHA 1LP1B 3GF3A 3ZDMA 3II6A 2OYOA 2PFXA 1MKMA 1N7SA 3MGNA 2O01J 5M1BA 3L72G 1YQ3C 2HPCB 1SQPJ 1CSBA 3CD6P 1RE3C 1JB0J 2E75D 3CX5E 3HD7B 1FZEA 2KSEA 2OYHC 2QJYC 2C9LY 1URQC 3JCUH 1VQ4P 1FZBA 2J5UA 1T6AA 2QSIA 3BVHA 1HGZA 3TSIA 2A06E 1LTJA 3SWFA 4K3AA 1LT9B 1KV4A 3LW5H 3M0AA 1GU4A 3A2AA 4W7ZA 1G2CB 1HGVA 3L75G 2OQQA 3WUUA 5AW6B 2FFDC 1BDDA 1SQBD 4NPDA 1IZNB 5AW3B 1BGYJ 2WWWA 2ZVNB 1E79H 3AEAC 2K37A 1K05A 3A7OA 2AEJA 1EDIA 2FXPA 2QJKC 3CCSP 2Z5HA 1S9KE 1ZRTD 3MP7B 1JTHA 5KJ7A 4C46A 1P84D 4EDFA 1VQMP 4AUWA 1A02J 1GK4A 4IOIH 3R4YA 3R2PA 1M56D 1NAYA 1KYOE 5CCGC 2ITAA 1Z56A 1MUUA 2CPSA 5KAIE 4KHXA 1DH3A 1YI2P 1BCCJ 3HTKA 1KB9I 2R5DA 2YIUB 2PRRA 5APVA 4PD4H 2JR8A 4OVNF 1BGYE 3RK3D 3WMM0 1J1EB 1KQFB 4Y99B 3AE6C 2JEEA 1FE6A 1HBWA 1SFCB 2D2CD 3RBXA 2KI7B 4TLFA 1HUCA 2K1AA 2FY8A 2NPSD 1OVVA 1AQ5A 2POHA 3AEFC 2E43A 4IL6E 3TGUG 1S1CX 4ZNCA 3AEGC 1VQ6P 3CPWO 1WRGA 5TISH 1YJNP 1GMJA 2BEQD 2XNXA 2KS1B 2R5BA 2ZYDA 2BCCG 1L0LG 3KYQA 3QH9A 1EZVG 3Q5RA 3P8CD 3KZIE 3LW5J 3H1LE 1HTLC 3G3ZA 2I8DA 4W7YA 2IZ0A 2IZ1A 1SQQD 1NTMG 4HKZH 5KLIC 4RO0A 3N7NA 3H1HJ 3CWBJ 4YPCA 3OJAB 1S5LX 3L70D 1U7JA 4WB4A 1NVOA 4H13D 3GHGB 3M9BA 1KILE 1K04A 1NTMJ 1GL2B 1X8YA 1Q7YQ 2OYHB 3T97A 2QE7H 2QJYB 2Y9ZA 1AV1A 4U3FD 1URQB 1W2EA 3O6QA 3H1JG 1NU1K 3IAOA 3L73D 2WITA 3MUDC 1JY3P 2E74C 2LXBA 4UB6H 1XTGB 1FOSE 5CCHC 4JPZB 2L91A 2JP3A 1N86A 1JMBA 2FFDB 3H1HE 1K8AQ 5BU5A 1NTZG 1SQXD 4QMAA 3H1JJ 5KLVD
chains in the Genus database with same CATH topology
2FYUJ 3L74J 1P84I 3H1IJ 1L0NJ 1SQPJ 3CX5I 1NTKJ 1NU1J 1PP9J 1NTMJ 4D6TJ 1BCCJ 1BGYJ 4U3FJ 1KB9I 4PD4I 1BE3J 2BCCJ 3TGUJ 1SQVJ 1EZVI 3H1HJ 1KYOI 2IBZI 1L0LJ 3CWBJ 3L70J 1SQXJ 3H1LJ 5KLVJ 3L73J 1NTZJ 3CXHI 3L75J 3BCCJ 1SQBJ 3H1JJ 3L72J 1SQQJ 3L71J 3H1KJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU J;  3L74 J;  1P84 I;  3H1I J;  1L0N J;  1SQP J;  3CX5 I;  1NTK J;  1NU1 J;  1PP9 J;  1NTM J;  4D6T J;  1BCC J;  1BGY J;  4U3F J;  1KB9 I;  4PD4 I;  1BE3 J;  2BCC J;  3TGU J;  1SQV J;  1EZV I;  3H1H J;  1KYO I;  2IBZ I;  1L0L J;  3CWB J;  3L70 J;  1SQX J;  3H1L J;  5KLV J;  3L73 J;  1NTZ J;  3CXH I;  3L75 J;  3BCC J;  1SQB J;  3H1J J;  3L72 J;  1SQQ J;  3L71 J;  3H1K J; 
#chains in the Genus database with same CATH topology
 2C0W A;  1FZC C;  3KPE A;  1X0T A;  2RN0 A;  3AEE C;  4HYT B;  1SQV J;  2QJK B;  1AVO A;  2PP6 A;  1MZ9 A;  2IBZ G;  1KB9 E;  1BDC A;  1SQQ K;  1NO4 A;  2JJL A;  2B87 A;  5BU8 B;  2IPP A;  2YO2 A;  2N1T C;  2YKQ A;  2YXR B;  2YNY A;  2IYP A;  1IFM A;  4L74 A;  3BCC E;  2AXC A;  2WPV B;  3L72 D;  1PPJ E;  3V2P A;  1H0T A;  1SQV E;  2K9J B;  2FYU K;  3OW2 O;  3FXE A;  1EXI A;  5TIS E;  1N73 A;  2BEZ F;  3F5H A;  1FZF A;  1LTS C;  3PH0 A;  1GU5 A;  2ZYG A;  1DD4 A;  1IK9 A;  2ZVO B;  4BXL A;  4YXD C;  1J1D B;  5AW5 B;  3V6I A;  3HD7 C;  3U59 A;  3CX5 H;  4D6T J;  4WY4 C;  2XU6 A;  2NPS A;  3VTP C;  4BWN A;  1SQP K;  3L74 G;  2JKV A;  3V2N A;  2Y9Y A;  2KXP B;  1NTK J;  2H43 A;  1EC5 A;  1N7S C;  1PP9 D;  1VF5 B;  3WUT A;  2YKO A;  1LTT C;  5APT A;  1EDK A;  2KZJ A;  4DJG A;  2W6J H;  2M5A A;  3L74 J;  3WUV A;  1LTA C;  1ZRT E;  4RES B;  2RMZ A;  2N9Y B;  3VP8 A;  4D6T E;  1XTC C;  3H25 A;  2QG4 A;  2K88 A;  2E74 B;  4GOD A;  3AE4 C;  5CJ4 A;  1L0N J;  1S3J A;  3M0D C;  2R32 A;  1JY3 O;  4H0L B;  1T8Z A;  3M9H A;  3RK3 E;  1LTB C;  3IFM A;  1KYO H;  2H7H A;  5APX A;  4PV1 B;  1VQK P;  3TGU D;  1FZC B;  1RF0 A;  3CXH H;  2PGD A;  5KAI H;  2B9B A;  2FXM A;  3SWY A;  1J1E C;  1VQL P;  1NJI Q;  3HE4 B;  2KNC B;  2XV5 A;  1PL5 A;  2BCC D;  2QJP C;  5CHX A;  4GKG A;  2E42 A;  5KJ7 C;  1EZV D;  1HF9 A;  3USS A;  1QVG O;  4Y28 J;  3Q5S A;  4IL6 H;  2ZT9 D;  5E79 H;  3Q5P A;  5APW A;  1L0N E;  2R3S A;  1R8E A;  3HUS A;  3P8C E;  1X22 A;  5CBN A;  2BAS A;  4ASV A;  1JUN A;  2E5T A;  1A02 F;  1KIL C;  3IR9 A;  1PZQ A;  3C1L A;  2HPC A;  2YKP A;  2YO3 A;  3JSV C;  1LTI C;  1QLE D;  3U1C A;  1KTM A;  3FWN A;  3KZI H;  3RL0 g;  5KLV J;  1YIJ P;  2Q5U A;  4PD4 D;  4L76 A;  1T3U A;  4EIJ A;  3VMA A;  2JO1 A;  2HG5 D;  3H1I J;  1VL2 A;  3RL0 D;  2VRS A;  2Q7C A;  3D6Z A;  1T3J A;  2AXT E;  2YMK A;  3GHG C;  2J59 M;  1KOR A;  1M90 Q;  1GL2 C;  4WY4 B;  2WT7 B;  2LR2 A;  1JCC A;  2KSJ A;  1NTZ D;  5AW0 B;  3L73 E;  1Q81 Q;  5CCG D;  3GG2 A;  2FYN B;  1BGY G;  1IJD B;  1L0L K;  1ZV8 A;  3TF5 A;  3M91 A;  4R4M A;  4YTP C;  5DJT B;  4IFF A;  2Y0E A;  3CLQ A;  1SQX E;  4EI2 A;  5KLV E;  2Y0C A;  1N7S B;  2IBZ D;  4CPG A;  3K5B A;  4H44 D;  1NTM K;  3CC2 P;  1ZP0 C;  3TK1 A;  3H1I E;  1HWT C;  1OX3 A;  5KAF E;  1FOS F;  2KB7 P;  4A7P A;  1EDJ A;  1JY3 N;  4M3L A;  1VQO P;  1S4X A;  1HJB A;  1VQN P;  1BCC G;  1QX8 A;  1PV3 A;  4LGD E;  3CCJ P;  1KB9 H;  1ZN5 A;  1LTJ B;  3MTU E;  4OGQ B;  1USD A;  2OYI A;  2WSF H;  3HE5 B;  2P67 A;  3H32 A;  1FJP A;  2ZXX A;  4Z1M H;  1YTZ I;  3L72 E;  1GD2 E;  3MIW A;  4HJG H;  3CXH E;  3WU2 H;  3FX0 A;  1NKN A;  1EZV I;  1JCD A;  1YJ9 P;  1NTZ K;  3H1L J;  2P2U A;  4GDO A;  1L4A C;  5AW8 B;  3KQG A;  2QJP B;  3MD0 A;  1PGP A;  1JTH B;  3AE3 C;  1NU1 D;  3AE2 C;  2M8R A;  2ZYA A;  3RK2 C;  5E79 E;  3GMA A;  1HH0 A;  1MV8 A;  2W6A A;  3BRT B;  1LWU A;  1KC8 Q;  2B88 A;  2WQY C;  3HTK B;  3IN6 A;  3L35 A;  1J1D C;  4EOT A;  1KIL B;  3H1H G;  3CWB G;  1R5S A;  3EQ2 A;  1RE3 A;  1NWQ A;  1GDT A;  4UB8 H;  4WWI A;  4C7R A;  3CCM P;  1KFM A;  3M9Q A;  1PP9 E;  1YJW P;  3A0B E;  3GW6 A;  1IFN A;  2JWD A;  1FU1 A;  2H88 C;  2GM4 A;  1VF5 C;  1AVY A;  2UWJ E;  3RK3 C;  4IFM A;  3H1K D;  2H89 C;  4RJT A;  3I56 P;  5EFW B;  1S72 P;  1NYH A;  2N1T D;  1BSH A;  1BE3 D;  5AVQ B;  3SFE C;  1Y47 A;  2WSF J;  2WSC H;  2NPS C;  4C7N A;  1NTK K;  2A45 I;  1P84 H;  1JM0 A;  3M06 A;  3VOP A;  2M0B A;  2FYU D;  4MN4 C;  4I7Z C;  1SQV G;  1JMM A;  2KIK A;  1PGO A;  1ZLL A;  3OAK A;  3TGU E;  4DZO A;  1YHQ P;  2O1J A;  3A3Y B;  4H0L C;  3BCC J;  1S5L E;  3AE5 C;  4N6J A;  3L71 J;  1CZQ A;  2AEF A;  2XND H;  2E76 C;  1M1J A;  1P84 I;  3FGA D;  4PV1 C;  3W67 A;  2HLO A;  1M1K Q;  5CCG A;  2FXO A;  2WSS H;  3T97 B;  2QEX P;  3B5N C;  1K73 Q;  3O6Q B;  1DX7 A;  1EZV E;  3CCE P;  1OXZ A;  5AW1 B;  1YQ4 C;  3P8M C;  1DD3 A;  3V2Q A;  1LGH B;  3U1A A;  4RKU J;  1SQP D;  1KQS O;  4N78 D;  3HD7 D;  3WU2 E;  3D70 A;  3B8E B;  3QWO C;  2KP8 A;  2O3J A;  3FXD A;  3IF4 A;  1OFC X;  3TDK A;  2C9N Y;  3L37 A;  1IK7 A;  3L71 E;  4U7J A;  3CC4 P;  3HRN A;  4BRY A;  4I6M C;  5B66 H;  5KTB A;  2RKL A;  2IDB A;  1NOH A;  5AVU B;  1L4A B;  3FWL A;  2B87 B;  1ZOY C;  2WPR A;  1SQB J;  1OMI A;  2KUB A;  4I2L C;  3RK2 B;  2N9B A;  3GLM A;  1VQP P;  4D6T G;  5AVS B;  2OGU A;  1BGY D;  1K9M Q;  2V4H A;  1DEE G;  2W6B A;  3B71 A;  1ZR4 A;  2WSC J;  1OW6 A;  2HFE D;  4UB8 E;  2WPS A;  1NTK G;  1RF1 A;  3L75 D;  3V4W A;  2AXT H;  3AEC C;  3S9O A;  3PTZ A;  3B4S A;  2FYN C;  3MHV A;  1SQB E;  3ITK A;  1N73 B;  3PRJ A;  3AED C;  1J2J B;  4XE5 B;  2AEM A;  2NZ2 A;  4OWF A;  2P1J A;  1M8O B;  1BCC D;  1BSN A;  1SFC D;  2Z4E A;  3RK3 B;  1AQT A;  5APQ A;  1RY3 A;  1TU3 F;  2K9Y A;  1L0N G;  4XFJ A;  5KAF H;  1HJ0 A;  4WBA A;  1QEX A;  1SLQ A;  2NPS B;  1P84 E;  3VMX A;  3Q3D A;  1Q2N A;  3V2R A;  1EXJ A;  1LTJ C;  1VQ5 P;  4I7Z B;  4OGQ C;  5K5G B;  2QM7 A;  1KIL D;  3HE4 A;  5KKZ C;  2V7Q J;  3TNU A;  2HOD A;  1N8R Q;  4IFD K;  2E76 B;  2N1T A;  1DEB A;  5DJU B;  1FDI A;  4TT3 H;  1OWA A;  1SQQ J;  3F89 A;  3CMA P;  2M5A B;  3B5N B;  2M3E A;  1QL1 A;  3Q2Y A;  2IX7 C;  1NU1 E;  2R44 A;  3L70 J;  1H8A A;  3H1H D;  3CWB D;  4JQ0 D;  1L0L D;  5GTH E;  2QA4 P;  2XZR A;  1CI6 A;  2OTJ P;  1Q90 D;  1IFP A;  2B89 A;  2OYI C;  1GL2 D;  2A06 G;  2NRG A;  4U3F J;  1BE3 J;  1NGM B;  1URQ D;  3C8V A;  1LP1 A;  1NTM D;  1SQX G;  5B66 E;  3AE1 C;  5KLV G;  3I55 P;  3L73 J;  2Q6Q A;  2KLU A;  2FYU J;  3CCQ P;  2KK7 A;  3H1I G;  1SQQ E;  4WVZ A;  1SS1 A;  5AW7 B;  1JY2 P;  2FKW B;  3LID A;  2G3A A;  3C9I A;  2IYO A;  1SQX J;  3HD7 A;  5AW2 B;  3L70 E;  4GOF A;  1IFD A;  1KFN A;  1OW7 A;  2QVA A;  2FBW C;  1HVV A;  3VYI A;  3H1K E;  4XA4 A;  1IFJ A;  3H1J D;  1G1J A;  3A0B H;  1R5L A;  2KYV A;  4ZMD A;  1LT9 A;  2HYN A;  4LLH A;  4U3F E;  3HUS B;  1BE3 E;  3AE8 C;  1LWU C;  1SQV D;  4R4L A;  1SVF A;  2P10 A;  1G2C A;  1QL2 A;  4OH8 B;  3BAT A;  1JNM A;  4DOJ A;  1LNQ A;  4AQR D;  1USE A;  5APU A;  1PIX A;  2CK3 H;  2FYU E;  2MJZ A;  3RGU A;  3EFG A;  1VDF A;  1VQ7 P;  1FZA A;  2QM8 A;  3BRV B;  2ZFC A;  3BAS A;  5B5E H;  2IFM A;  1T2K C;  3NMD A;  2ZT9 C;  1RE4 A;  3NTN A;  3GF7 A;  3L72 J;  4ASW A;  3VMY A;  1JOC A;  3L36 A;  4K35 A;  3JC2 2;  1L4A D;  2Q9I A;  1GK6 A;  1OVU A;  1S5L H;  1NKZ B;  3HE5 A;  3PLN A;  3M0D A;  3L4F A;  3RK2 D;  3EWK A;  2Z5I A;  5AVW B;  1L2P A;  2FYZ A;  2CPB A;  1SQP E;  5AVR B;  4N78 E;  3I5C A;  4I1L A;  4L75 A;  1Q82 Q;  2DW3 A;  2K3R A;  3H1L G;  3A5T A;  2ZJS E;  1KN7 A;  3RL0 C;  1PFI A;  1SFC A;  1RQU A;  3L75 J;  5AVV B;  2W83 C;  5KKZ B;  2E75 C;  2E5Y A;  1FS0 E;  1PP9 G;  2I1K A;  1E5W A;  4IL6 X;  1SQV K;  4JYC A;  1M1J C;  4D6T D;  3PJS K;  2WTY A;  1EQ7 A;  1RH5 B;  4N3Y B;  1AFO A;  5CJ0 A;  1NHL A;  3MZW B;  2Q3I A;  1FAV A;  3VMZ A;  2KS1 A;  3S1K A;  1PP9 J;  3W68 A;  1GW4 A;  1VF5 D;  1OZH A;  1KIL A;  1NTK D;  4HH2 A;  1WMK A;  4H44 C;  2J58 A;  5BVZ A;  1FDM A;  2OYI B;  2P7J A;  2OAR A;  4JF7 A;  3H32 B;  2W27 A;  2H8P D;  3L75 E;  4GOE A;  3L74 D;  2JWA A;  4PD4 I;  4DT0 A;  1LT1 A;  3Q1M A;  1QGK B;  5C39 A;  1SQB K;  2E74 D;  1MFZ A;  2JDI H;  4GT1 A;  5CCH D;  4NPF X;  1X9V A;  3GHG A;  1D7M A;  1ZW0 A;  1YIT P;  4H0L D;  1JY2 O;  1GL2 A;  2WZ7 A;  4HB1 A;  1GW3 A;  1L0N D;  2E76 D;  2OYH A;  1BCC E;  3TGU J;  4PV1 D;  3AE9 C;  1URQ A;  1N73 C;  1LTG C;  4W80 A;  4PJ0 H;  1G1I A;  3B5N D;  4LC1 A;  3CCV P;  1YTZ T;  1PGJ A;  3ABV C;  2A45 H;  1KQG B;  1LWU B;  2QRX A;  4L73 A;  5H2F H;  2BCC J;  2MKV A;  3A0H H;  2XDJ A;  2IBZ I;  1L0L J;  2D2C C;  1X79 B;  2WSE H;  1RF1 C;  2FFD A;  3NFQ A;  2OTL P;  4AYC A;  3TYY A;  3BCC G;  1N2D C;  5B5E E;  3L71 G;  3SFD C;  3CCL P;  5APS A;  1PPJ G;  3CCR P;  1M57 D;  3JCU E;  2GUV A;  1OW8 A;  1FC2 C;  1FZG A;  1KQL A;  2ZT9 B;  1NAF A;  3SSU A;  2KLV A;  3CX5 D;  2ZXE B;  4JYB A;  5AW4 B;  1RHZ B;  3NXS A;  4ZKP A;  3V4Q A;  3H6P A;  2A06 D;  1KD1 Q;  4KJM A;  2BCC E;  3CWB E;  1AJY A;  1L0L E;  1KMI Z;  4C7N B;  4YXW H;  1L0N K;  1H88 A;  2KZI A;  3AEB C;  1MFT A;  2QIW A;  4JBZ A;  5CMZ A;  2GUS A;  3H1I D;  3RL0 B;  1PGQ A;  1NTM E;  2Y0D A;  4KT0 J;  1N7L A;  2WVR A;  4H13 C;  1L4A A;  5GTH H;  2E75 B;  2K9J A;  2O1K A;  1VQ8 P;  4WY4 D;  2L5G B;  1NTZ J;  2WPQ A;  1SQB G;  1M7L A;  1OIP A;  5GTI H;  2Q3E A;  2RH0 A;  1M1J B;  3G71 P;  2A45 G;  1RF0 C;  5AVT B;  1S9K D;  2V7Q H;  5AVY B;  2LXC B;  3N4X A;  3RBZ A;  4O9B A;  1N7S D;  4PD4 E;  2LKM A;  1KYO D;  1Y8A A;  3S4R A;  3H1J E;  2PAJ A;  4H44 B;  2G8Y A;  3CXH D;  3AE7 C;  1OVR A;  3P7K A;  1IFI A;  3KXD A;  3D71 A;  3D6Y A;  1VPC A;  2WSE J;  2P58 A;  3UIA A;  1JY2 N;  3OA7 A;  1NTZ E;  2ZAE B;  3HUS C;  1ZR2 A;  2KOG A;  4GIF A;  1H89 A;  4BRY B;  1SQX K;  4OGQ D;  1H0T B;  5KLV K;  3KHU A;  3E1R A;  1YYC A;  3KDP B;  5AVX B;  2O01 N;  3V5B A;  3PHL A;  2IBZ E;  3CL3 D;  4PJ0 E;  1GTW A;  1NU1 G;  1ZXG A;  2HR3 A;  1GZL A;  2SPZ A;  2W8Z A;  5H2F E;  3A0H E;  1S2E A;  1SP4 A;  3MUD A;  3H1L D;  5KLI B;  1DIP A;  3VN0 A;  2XKM A;  1LT9 C;  2W90 A;  5CBO A;  5CCH A;  2D2C B;  3CX5 I;  1NU1 J;  1RF1 B;  5KJ7 D;  3LIE A;  1FDO A;  2Q1K A;  1KZU B;  1QVF O;  2I1J A;  2GA1 A;  1FZC A;  3SWK A;  2O01 H;  1SQQ G;  2IFN A;  3B5N A;  1RE4 C;  3G9R A;  2YMY A;  3CCU P;  4EYY Q;  2KNC A;  3L70 G;  4UB6 E;  3CI9 A;  2WMM A;  2YXQ B;  1YBK A;  5APY A;  1Y9B A;  2C0X A;  3H1K G;  3G6E P;  3CC7 P;  1Q86 Q;  4NPE A;  1ZME C;  1LJ2 A;  3VP9 A;  1W2B O;  3EFF K;  4U3F G;  1NTK E;  1BE3 G;  1CW5 A;  5AVZ B;  2YIU C;  3PP5 A;  3L73 G;  3H1K J;  2FYU G;  1U7M A;  4H13 B;  4Y99 C;  3L74 E;  1SFC C;  5GTI E;  1EDL A;  3G4S P;  1KYO I;  1IC2 A;  3TNU B;  2HOD B;  1VQ9 P;  2N1T B;  1KB9 D;  3CXH I;  3E1I A;  2R3C A;  1T2K D;  1RQV A;  2OTK E;  1U57 A;  5AW9 B;  1AA0 A;  1FBM A;  1WT6 A;  4B86 A;  3O8Z A;  3P32 A;  1JO5 A;  4WY4 A;  2WT7 A;  1CI6 B;  1UII A;  2M3B A;  3CME P;  1JEK A;  1NH4 A;  3BCC D;  4ZKU A;  1SQP G;  1W5C E;  3E7K A;  3L71 D;  4DCK A;  1PPJ D;  1IO4 A;  5L8R J;  1UIX A;  1FJK A;  5TJH A;  1LP1 B;  3GF3 A;  3ZDM A;  3II6 A;  2OYO A;  2PFX A;  1MKM A;  1N7S A;  3MGN A;  2O01 J;  5M1B A;  3L72 G;  1YQ3 C;  2HPC B;  1SQP J;  1CSB A;  3CD6 P;  1RE3 C;  1JB0 J;  2E75 D;  3CX5 E;  3HD7 B;  1FZE A;  2KSE A;  2OYH C;  2QJY C;  2C9L Y;  1URQ C;  3JCU H;  1VQ4 P;  1FZB A;  2J5U A;  1T6A A;  2QSI A;  3BVH A;  1HGZ A;  3TSI A;  2A06 E;  1LTJ A;  3SWF A;  4K3A A;  1LT9 B;  1KV4 A;  3LW5 H;  3M0A A;  1GU4 A;  3A2A A;  4W7Z A;  1G2C B;  1HGV A;  3L75 G;  2OQQ A;  3WUU A;  5AW6 B;  2FFD C;  1BDD A;  1SQB D;  4NPD A;  1IZN B;  5AW3 B;  1BGY J;  2WWW A;  2ZVN B;  1E79 H;  3AEA C;  2K37 A;  1K05 A;  3A7O A;  2AEJ A;  1EDI A;  2FXP A;  2QJK C;  3CCS P;  2Z5H A;  1S9K E;  1ZRT D;  3MP7 B;  1JTH A;  5KJ7 A;  4C46 A;  1P84 D;  4EDF A;  1VQM P;  4AUW A;  1A02 J;  1GK4 A;  4IOI H;  3R4Y A;  3R2P A;  1M56 D;  1NAY A;  1KYO E;  5CCG C;  2ITA A;  1Z56 A;  1MUU A;  2CPS A;  5KAI E;  4KHX A;  1DH3 A;  1YI2 P;  1BCC J;  3HTK A;  1KB9 I;  2R5D A;  2YIU B;  2PRR A;  5APV A;  4PD4 H;  2JR8 A;  4OVN F;  1BGY E;  3RK3 D;  3WMM 0;  1J1E B;  1KQF B;  4Y99 B;  3AE6 C;  2JEE A;  1FE6 A;  1HBW A;  1SFC B;  2D2C D;  3RBX A;  2KI7 B;  4TLF A;  1HUC A;  2K1A A;  2FY8 A;  2NPS D;  1OVV A;  1AQ5 A;  2POH A;  3AEF C;  2E43 A;  4IL6 E;  3TGU G;  1S1C X;  4ZNC A;  3AEG C;  1VQ6 P;  3CPW O;  1WRG A;  5TIS H;  1YJN P;  1GMJ A;  2BEQ D;  2XNX A;  2KS1 B;  2R5B A;  2ZYD A;  2BCC G;  1L0L G;  3KYQ A;  3QH9 A;  1EZV G;  3Q5R A;  3P8C D;  3KZI E;  3LW5 J;  3H1L E;  1HTL C;  3G3Z A;  2I8D A;  4W7Y A;  2IZ0 A;  2IZ1 A;  1SQQ D;  1NTM G;  4HKZ H;  5KLI C;  4RO0 A;  3N7N A;  3H1H J;  3CWB J;  4YPC A;  3OJA B;  1S5L X;  3L70 D;  1U7J A;  4WB4 A;  1NVO A;  4H13 D;  3GHG B;  3M9B A;  1KIL E;  1K04 A;  1NTM J;  1GL2 B;  1X8Y A;  1Q7Y Q;  2OYH B;  3T97 A;  2QE7 H;  2QJY B;  2Y9Z A;  1AV1 A;  4U3F D;  1URQ B;  1W2E A;  3O6Q A;  3H1J G;  1NU1 K;  3IAO A;  3L73 D;  2WIT A;  3MUD C;  1JY3 P;  2E74 C;  2LXB A;  4UB6 H;  1XTG B;  1FOS E;  5CCH C;  4JPZ B;  2L91 A;  2JP3 A;  1N86 A;  1JMB A;  2FFD B;  3H1H E;  1K8A Q;  5BU5 A;  1NTZ G;  1SQX D;  4QMA A;  3H1J J;  5KLV D; 
#chains in the Genus database with same CATH homology
 2FYU J;  3L74 J;  1P84 I;  3H1I J;  1L0N J;  1SQP J;  3CX5 I;  1NTK J;  1NU1 J;  1PP9 J;  1NTM J;  4D6T J;  1BCC J;  1BGY J;  4U3F J;  1KB9 I;  4PD4 I;  1BE3 J;  2BCC J;  3TGU J;  1SQV J;  1EZV I;  3H1H J;  1KYO I;  2IBZ I;  1L0L J;  3CWB J;  3L70 J;  1SQX J;  3H1L J;  5KLV J;  3L73 J;  1NTZ J;  3CXH I;  3L75 J;  3BCC J;  1SQB J;  3H1J J;  3L72 J;  1SQQ J;  3L71 J;  3H1K J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...