4UB8E

Native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
b'TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 19
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 4ub8E00
1W5CE 4PJ0E 5GTIE 5TISE 3A0HE 5E79E 5GTHE 5B66E 5KAFE 3WU2E 3JCUE 4UB6E 5H2FE 5B5EE 5KAIE 4IL6E 1S5LE 2AXTE 3A0BE 3KZIE 4UB8E
chains in the Genus database with same CATH superfamily
2KZJA 2KS1B 2QVAA 2JDIH 2W90A 2WSEH 5E79E 1QLED 1JNMA 3FX0A 3U1CA 1R8EA 1KB9E 4IFDK 1RE4A 1M1JA 2ZVOB 4I2LC 2WT7A 5AVXB 1MKMA 2PGDA 2E74C 1BSNA 1M56D 1RE3C 3V5BA 1PZQA 4U7JA 1FZEA 1SQQJ 1NTKK 2IFNA 1PPJD 4I6MC 1NTMG 3GLMA 2IBZG 2ZJSE 1NVOA 1IFJA 1BE3E 1NWQA 1SQQD 1HGVA 1KQFB 2XKMA 2N9YB 2Q5UA 1BGYG 3V4WA 3SWYA 1LT9B 1J1DB 4XFJA 1OW6A 3IN6A 3FXEA 3PHLA 1SLQA 3L71J 1H89A 4RJTA 1R5SA 3NMDA 5GTHH 5CCHD 2Q9IA 4AQRD 2NRGA 5CBOA 3L71D 2OYHC 1GD2E 3BVHA 5B5EH 3Q5RA 4OGQB 1UIIA 1KILD 2ZYAA 1RY3A 2ZXXA 3H1KE 4W80A 1LTBC 2Y9ZA 4PV1D 1YQ4C 1U57A 2KUBA 2QJYB 2KK7A 3S1KA 2WSFJ 1FDMA 3MIWA 3CWBJ 2FYNC 2YIUB 1L0LJ 1LT9C 2FBWC 3I5CA 3ITKA 3W68A 4DT0A 3MGNA 3CWBD 5KLVJ 3L74J 1PPJG 1L0LD 3P32A 5CHXA 5AW1B 1LWUA 3KHUA 1T8ZA 1SFCD 1SQQG 3ZDMA 5CJ0A 2M3BA 3M9QA 5KLVD 3L74D 1JUNA 4OGQC 3RL0D 2B9BA 1P84D 4DOJA 3AE7C 1IFPA 2Q6QA 5KJ7C 1OW7A 2ZT9D 3L71G 1IK9A 5APSA 1L0NE 1MFTA 2YMYA 3BATA 3FWLA 4N78D 5GTIE 1SQBJ 2OYIA 3HTKB 3H1LE 5CCGA 1S1CX 3B5NB 2CPBA 2PRRA 1NAFA 2AXTH 1G2CB 2ZFCA 2L91A 4LC1A 4D6TJ 1SQBD 2B87A 1KYOE 2BEQD 4NPFX 1AA0A 1E79H 2K88A 3BRTB 2CPSA 3HUSA 3RK3E 1M57D 4EYYQ 4EDFA 1WMKA 1NYHA 1X79B 1IFDA 4I7ZB 3CWBG 1D7MA 4D6TD 2VRSA 1GL2B 1L0LG 1JY2P 1JO5A 1GTWA 4N3YB 4H0LB 3AEEC 1URQA 5APTA 1H0TA 2I1KA 3HD7B 4RESB 2N1TA 2HPCA 3V2PA 1M90Q 2HG5D 3UIAA 3WUTA 5KLVG 3L74G 2WSFH 4KT0J 2WTYA 4ZKPA 1LGHB 5EFWB 2XDJA 1PIXA 1ZN5A 4H13B 3O6QA 2D2CD 4L76A 1Q90D 4UB8E 1RF1B 3B5NC 1NKZB 1FBMA 2E42A 3G71P 1LWUC 1L4AA 3U1AA 1GDTA 2UWJE 3H6PA 1N7SB 1S5LE 1URQD 2PP6A 4C7NA 2H43A 1P84H 2KXPB 5CBNA 4YXWH 3II6A 1GW3A 2HODA 1GL2C 3L4FA 3TK1A 2BCCJ 2WVRA 3FGAD 5AW2B 1PP9E 2E5YA 3N4XA 1FZFA 1KV4A 2YO2A 5K5GB 1VF5D 2NPSB 1BCCJ 4DJGA 2FFDB 5KAFH 4UB6H 1SQBG 1SQPJ 1HBWA 2BCCD 5H2FH 1VPCA 3S4RA 2DW3A 2QIWA 4H13C 5BU5A 2OQQA 3EFFK 4YTPC 2PAJA 4RO0A 2YKQA 1LTJB 5APWA 1BCCD 3A0BE 1JY2O 4D6TG 1JOCA 1SQPD 1HJ0A 2WSEJ 4IOIH 1HF9A 4K35A 2O1KA 3CXHE 1N7SC 2QG4A 5AW8B 1OMIA 2M3EA 2C9NY 4NPDA 2N9BA 3HUSC 5AVTB 3M0DC 1FJKA 2KSEA 1VQ6P 3USSA 1SQQE 2Y0EA 1R5LA 4JPZB 2K9JA 2Q1KA 2WWWA 4GOEA 3KXDA 2LXBA 1DD4A 1RE3A 2N1TC 2WSCH 2ZAEB 2B89A 1CI6A 1LP1B 3JSVC 1JCCA 4KJMA 2A45I 4GODA 3JC22 1K9MQ 2XV5A 2WPVB 3CX5E 4U3FJ 3TNUB 2FYUK 3L71E 2AEMA 3VMAA 2H8PD 5AVYB 2BEZF 2E74D 1NTMJ 2KS1A 3CI9A 2OGUA 2JR8A 4U3FD 4HYTB 2BCCG 2G3AA 1Q82Q 1GK6A 3N7NA 2ZYDA 1BCCG 3Q1MA 1JEKA 5KTBA 5DJTB 1SQPG 1N86A 1FC2C 1KC8Q 1Q86Q 1MV8A 1QL1A 5KAIE 3RK3B 1NTZE 5AVRB 2OYHA 3P8CD 3CXHI 3CWBE 1W5CE 3CC2P 1VQPP 4PD4I 4HH2A 1FZCC 4EIJA 3L75J 4H44B 1XTCC 1IFNA 3NXSA 2G8YA 3GF3A 1EDKA 1HTLC 1M1KQ 1S5LX 2E76C 3L75D 4M3LA 1SQQK 4WY4B 1LT9A 2NZ2A 3LIDA 4AYCA 3NTNA 3RK2B 2Y9YA 4DZOA 1GMJA 2V7QH 5AW5B 5AVZB 3L37A 3L73E 5AW3B 3RGUA 3IFMA 1J1EB 1J2JB 5B66H 1M7LA 1QGKB 3KYQA 1FOSF 2AEJA 3D6YA 3HE4A 4N78E 4U3FG 3VTPC 4PJ0H 2JJLA 1ZMEC 2KYVA 3KZIE 1JTHB 2KLVA 5APVA 1AJYA 2RN0A 1YJWP 1NO4A 4BXLA 3T97B 3CCJP 1SQXD 2W6JH 4JQ0D 1ZR4A 5KJ7A 2P10A 1ZV8A 3CL3D 3VMYA 1YTZT 1EXJA 2FKWB 1JY3N 1EXIA 4OGQD 1EZVI 1EDIA 1IC2A 1NTZK 1FU1A 1OW8A 1J1EC 3U59A 2IZ1A 1WT6A 4C46A 3L75G 1DIPA 3VYIA 4HJGH 3B8EB 1NTKJ 2R32A 1M1JB 2V4HA 2WT7B 2Z5IA 1OFCX 1S9KD 3C1LA 3GMAA 3L35A 4JF7A 5APYA 1PGJA 5KLIB 4W7ZA 4DCKA 2ZYGA 1KB9I 2SPZA 1LT1A 1NTKD 2A45H 4IL6H 3EFGA 2I1JA 1YYCA 1FDIA 3Q2YA 1J1DC 3C8VA 1TU3F 3L36A 4Y99B 3BCCD 3D70A 3HTKA 1NKNA 4BWNA 3AE8C 3B5NA 4HB1A 1W2BO 1KILB 2FXMA 2XZRA 2PFXA 1DX7A 2WPQA 2W83C 1USDA 2I8DA 4PV1B 3WU2H 3JCUH 3WUVA 5AVUB 1ZP0C 1OXZA 2YXRB 1QL2A 2MKVA 1BCCE 4ZKUA 1SQPE 4WWIA 2HFED 1G1JA 3H1IE 1GL2A 1E5WA 2M5AB 2IYPA 2QJYC 4PD4H 3CCLP 3EWKA 5TISE 4ASVA 1AQTA 1KQGB 4BRYB 2YIUC 3PH0A 3S9OA 2KIKA 1T3JA 1QEXA 3B4SA 2GUVA 2A06E 1BDCA 3CCQP 1PGQA 2FY8A 4Y99C 3R4YA 1OVRA 1SFCB 2O01N 3IAOA 2XNXA 1RF1A 3TDKA 3FWNA 2QJPB 1X0TA 1VQ8P 3VOPA 3RL0B 2OTKE 2OTJP 1NTKG 3CMAP 3AEGC 1N7SA 3A0HH 3QWOC 1XTGB 4EI2A 1GU5A 4EOTA 1SQVJ 4ASWA 2FYZA 1MFZA 3M0DA 1ZR2A 3H1JJ 1DEBA 1Y8AA 2IFMA 2ZT9B 3RBXA 1PV3A 1SQVD 2WSCJ 5CCGD 2M0BA 4U3FE 2NPSA 1HUCA 2Z5HA 2FFDA 2R3SA 3CC7P 3H1JD 3MHVA 2QEXP 5CJ4A 1USEA 3PJSK 1MUUA 1AFOA 4JBZA 1NTME 1FOSE 1CZQA 3V2NA 3IR9A 2IBZE 4RKUJ 1KTMA 4YPCA 2QA4P 1LTJA 2Y0DA 2KSJA 1FJPA 5GTHE 3G4SP 4ZMDA 1BGYE 3V2QA 1Q2NA 1ZRTE 1VQ9P 2YNYA 5B5EE 4IFMA 3OJAB 1T3UA 3Q5PA 2N1TD 3A3YB 2OYIB 2JWDA 3H1KD 5AVVB 1EQ7A 2CK3H 2C0WA 4I7ZC 2ZT9C 1N7LA 1YBKA 1RHZB 1GK4A 3L75E 4A7PA 4H0LC 2B87B 1AV1A 1S3JA 1L0NK 5E79H 3V2RA 3SFDC 3HD7C 1L4AD 1K04A 2D2CB 3L70J 2QSIA 1WRGA 3K5BA 1KB9H 1LP1A 2KP8A 3MUDC 1IO4A 4I1LA 1FZCA 5DJUB 1KYOI 1RF1C 2ZXEB 3L70D 4LGDE 1S2EA 1VQNP 1URQB 4CPGA 1H0TB 1SQVG 1VQ4P 2W8ZA 4YXDC 2V7QJ 1M8OB 3H1JG 3O6QB 2QM8A 1PPJE 3SWFA 1FZBA 1T2KC 3GHGB 4GOFA 2JEEA 4GDOA 3EQ2A 1Y9BA 2P67A 3W67A 5APQA 3HE5A 1VF5B 1OX3A 3P8MC 1SVFA 2E75D 1A02J 1RQUA 1KN7A 1NTMK 1L2PA 3MD0A 1KMIZ 2WSSH 4GIFA 3CCSP 3VP9A 2NPSC 2FFDC 2Z4EA 2P1JA 3TGUJ 3NFQA 2E76D 3TF5A 1VQLP 3H1KG 1LTJC 3TGUD 3H1LD 2O01H 1Q81Q 2XU6A 2AXTE 1X9VA 3H32B 2AEFA 2LR2A 2JKVA 1LTGC 1VDFA 4LLHA 4WY4A 1KILE 1N73B 2L5GB 4GT1A 1S9KE 1X8YA 3SSUA 3LW5H 2KI7B 3SWKA 2O1JA 5AW0B 3L70G 3H25A 2GA1A 1PL5A 2IPPA 1LTSC 4KHXA 3AEFC 3CD6P 1RF0A 2R44A 3F5HA 1LTAC 2WITA 2B88A 1JB0J 1L0LE 1H88A 3V6IA 1QX8A 2E74B 1A02F 2FYUJ 3T97A 3GG2A 4WVZA 1OWAA 5KLVE 3L74E 2QM7A 3HRNA 1RH5B 2FXPA 1P84E 1PP9J 2FYUD 5AW4B 2R5BA 1S72P 1QVFO 2K37A 2Q3EA 3Q5SA 3H1HJ 4IL6X 2Q7CA 4OH8B 3TGUG 3H1LG 3AEAC 3M06A 1VQ5P 1PP9D 1ZLLA 1NU1J 1NH4A 3CX5I 3H1HD 1PGOA 5KAFE 3RK3C 4UB6E 1Y47A 5H2FE 1JY3P 2BASA 5L8RJ 5GTIH 1FZGA 3AECC 3M9HA 1KFNA 1SQXJ 4H44C 1NU1D 3BRVB 1N8RQ 3GF7A 3TSIA 1AQ5A 3PRJA 5BU8B 2K1AA 3RL0g 3CXHD 1QVGO 2OYHB 1SQBE 3AE9C 1S4XA 1KYOH 2KNCB 1OZHA 4PD4D 2W6BA 4L73A 4WY4C 2H89C 2IYOA 3RK2C 2WPSA 1IZNB 2POHA 5CCHA 4D6TE 1U7JA 1SQVE 5AW9B 1IJDB 3H1JE 2FYNB 1KILA 4HKZH 1L0LK 3L72J 1YJNP 1YI2P 5AW6B 2QE7H 1U7MA 1RF0C 1IFIA 2A45G 1FDOA 2E5TA 5KJ7D 2WZ7A 3KPEA 2FYUG 4UB8H 1GZLA 5KLVK 3A2AA 3L72D 4ZNCA 1P84I 3CX5D 3KDPB 2JP3A 2M5AA 2R3CA 1PP9G 3AEDC 1LJ2A 1S5LH 3HE4B 4BRYA 2JWAA 5AW7B 3H1HG 3BCCJ 1JY3O 2YO3A 1FAVA 1ZOYC 1NOHA 2O3JA 1SFCA 4Z1MH 1NTZJ 1NU1G 3F89A 1LTTC 1GU4A 3R2PA 1JMBA 1KQSO 3CLQA 4W7YA 3CPWO 3CCRP 1G2CA 4TLFA 1YJ9P 1FE6A 3CCMP 3OAKA 1ZW0A 1RQVA 1SQXG 1YHQP 2BCCE 5APXA 1YTZI 1EZVD 3AE3C 1DH3A 1NTZD 2HR3A 3VMZA 2KB7P 1RE4C 1M1JC 4N6JA 1PFIA 3L70E 1GW4A 1KFMA 1SQBK 3M91A 3A0BH 4XE5B 3AE2C 5AVSB 3VMXA 5KLIC 1KZUB 2FXOA 3AE6C 1KQLA 3P7KA 3CXHH 1KORA 3E1IA 1DEEG 2J5UA 2QRXA 1VQMP 3L73J 3B5ND 1YIJP 4JYBA 3KQGA 4XA4A 1SQVK 3HD7A 3CMEP 1OIPA 2WPRA 1NAYA 1SS1A 5CCHC 3L73D 3MUDA 3MZWB 1KB9D 2OARA 3OW2O 1BDDA 3L72G 2IZ0A 3Q3DA 1NGMB 1FS0E 4R4MA 1ZXGA 3ABVC 3FXDA 5B66E 2JO1A 3CCUP 1KILC 1GL2D 1YITP 2IX7C 4MN4C 4NPEA 4H0LD 4PV1C 1KD1Q 3HD7D 4PJ0E 1BE3J 2H7HA 2KOGA 3TGUE 3CX5H 2MJZA 3O8ZA 1LWUB 4H13D 3PP5A 3BCCG 5M1BA 1BE3D 2YXQB 1OVVA 4WBAA 4JYCA 2E43A 4WB4A 3TYYA 5C39A 2H88C 1EZVG 3G9RA 1NTZG 3PTZA 4AUWA 3B71A 3MP7B 4IFFA 3WMM0 1N7SD 2O01J 1SFCC 2R5DA 2QJPC 3G6EP 5APUA 1T2KD 1Z56A 1VQOP 1K05A 3RL0C 3H1KJ 1CSBA 5KAIH 1IK7A 1EDJA 3CCEP 2AXCA 3P8CE 1SQPK 4L74A 2HLOA 2WQYC 3LW5J 2NPSD 3GW6A 1LNQA 2HYNA 3LIEA 2P2UA 2Y0CA 3VN0A 3CCVP 3GHGA 3IF4A 3L73G 1JY2N 2XNDH 1VQ7P 3I55P 1JM0A 4O9BA 3MTUE 1FZAA 2W6AA 4IL6E 4C7RA 2FYUE 2YKOA 2GM4A 3AE1C 1X22A 3HUSB 1VQKP 3SFEC 3I56P 1HVVA 1K8AQ 3RBZA 1JMMA 2J58A 1T6AA 2C9LY 3TNUA 3D71A 1VL2A 3H1HE 2ITAA 3H32A 2N1TB 5KKZB 2HPCB 1BE3G 4GKGA 3H1IJ 4R4LA 3AE4C 2QJKB 1N73A 3WU2E 3JCUE 2LKMA 2IDBA 2J59M 3KZIH 1NU1E 2W27A 2KLUA 1CW5A 2OYIC 5AVWB 5CCGC 3AEBC 1DD3A 3H1ID 4OVNF 1EDLA 1HGZA 1LTIC 3VP8A 1L4AB 1N2DC 1SQXE 2IBZI 4PD4E 1L0NJ 1NHLA 2GUSA 4C7NB 2OYOA 2P58A 2D2CC 1K73Q 2M8RA 1SP4A 3H1LJ 2Q3IA 2A06D 4TT3H 1PGPA 2HODB 3PLNA 1L0ND 1JCDA 5AVQB 3WUUA 2LXCB 1OVUA 2RMZA 1URQC 5KKZC 2KZIA 3A5TA 2QJKC 3A0HE 1KYOD 1NJIQ 1BSHA 2YMKA 3L72E 2E75B 1FZCB 1HJBA 4B86A 3RK3D 3OA7A 3GHGC 1AVOA 1L4AC 1VF5C 3V4QA 3CC4P 4H44D 1AVYA 1NTKE 2E76B 3D6ZA 2P7JA 4OWFA 3AE5C 1IFMA 2RKLA 3A7OA 1H8AA 1G1IA 1NTMD 1BGYJ 5TJHA 4WY4D 3HE5B 2IBZD 2RH0A 2C0XA 3BCCE 3C9IA 4Y28J 1W2EA 3G3ZA 3RK2D 1JTHA 2K9JB 3H1IG 1NU1K 1HWTC 2K3RA 1BGYD 1EZVE 2KNCA 1ZRTD 3QH9A 1CI6B 1UIXA 1YQ3C 1MZ9A 1HH0A 2YKPA 3BASA 1N73C 4L75A 2E75C 1SQXK 3E7KA 4QMAA 1Q7YQ 2A06G 2K9YA 5CMZA 5BVZA 3M0AA 1L0NG 4K3AA 1EC5A 2OTLP 2WMMA 3E1RA 5TISH 2ZVNB 3M9BA
chains in the Genus database with same CATH topology
1W5CE 4PJ0E 5GTIE 5TISE 3A0HE 5E79E 5GTHE 5B66E 5KAFE 3WU2E 3JCUE 4UB6E 5H2FE 5B5EE 5KAIE 4IL6E 1S5LE 2AXTE 3A0BE 3KZIE 4UB8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W5C E;  4PJ0 E;  5GTI E;  5TIS E;  3A0H E;  5E79 E;  5GTH E;  5B66 E;  5KAF E;  3WU2 E;  3JCU E;  4UB6 E;  5H2F E;  5B5E E;  5KAI E;  4IL6 E;  1S5L E;  2AXT E;  3A0B E;  3KZI E;  4UB8 E; 
#chains in the Genus database with same CATH topology
 2KZJ A;  2KS1 B;  2QVA A;  2JDI H;  2W90 A;  2WSE H;  5E79 E;  1QLE D;  1JNM A;  3FX0 A;  3U1C A;  1R8E A;  1KB9 E;  4IFD K;  1RE4 A;  1M1J A;  2ZVO B;  4I2L C;  2WT7 A;  5AVX B;  1MKM A;  2PGD A;  2E74 C;  1BSN A;  1M56 D;  1RE3 C;  3V5B A;  1PZQ A;  4U7J A;  1FZE A;  1SQQ J;  1NTK K;  2IFN A;  1PPJ D;  4I6M C;  1NTM G;  3GLM A;  2IBZ G;  2ZJS E;  1NVO A;  1IFJ A;  1BE3 E;  1NWQ A;  1SQQ D;  1HGV A;  1KQF B;  2XKM A;  2N9Y B;  2Q5U A;  1BGY G;  3V4W A;  3SWY A;  1LT9 B;  1J1D B;  4XFJ A;  1OW6 A;  3IN6 A;  3FXE A;  3PHL A;  1SLQ A;  3L71 J;  1H89 A;  4RJT A;  1R5S A;  3NMD A;  5GTH H;  5CCH D;  2Q9I A;  4AQR D;  2NRG A;  5CBO A;  3L71 D;  2OYH C;  1GD2 E;  3BVH A;  5B5E H;  3Q5R A;  4OGQ B;  1UII A;  1KIL D;  2ZYA A;  1RY3 A;  2ZXX A;  3H1K E;  4W80 A;  1LTB C;  2Y9Z A;  4PV1 D;  1YQ4 C;  1U57 A;  2KUB A;  2QJY B;  2KK7 A;  3S1K A;  2WSF J;  1FDM A;  3MIW A;  3CWB J;  2FYN C;  2YIU B;  1L0L J;  1LT9 C;  2FBW C;  3I5C A;  3ITK A;  3W68 A;  4DT0 A;  3MGN A;  3CWB D;  5KLV J;  3L74 J;  1PPJ G;  1L0L D;  3P32 A;  5CHX A;  5AW1 B;  1LWU A;  3KHU A;  1T8Z A;  1SFC D;  1SQQ G;  3ZDM A;  5CJ0 A;  2M3B A;  3M9Q A;  5KLV D;  3L74 D;  1JUN A;  4OGQ C;  3RL0 D;  2B9B A;  1P84 D;  4DOJ A;  3AE7 C;  1IFP A;  2Q6Q A;  5KJ7 C;  1OW7 A;  2ZT9 D;  3L71 G;  1IK9 A;  5APS A;  1L0N E;  1MFT A;  2YMY A;  3BAT A;  3FWL A;  4N78 D;  5GTI E;  1SQB J;  2OYI A;  3HTK B;  3H1L E;  5CCG A;  1S1C X;  3B5N B;  2CPB A;  2PRR A;  1NAF A;  2AXT H;  1G2C B;  2ZFC A;  2L91 A;  4LC1 A;  4D6T J;  1SQB D;  2B87 A;  1KYO E;  2BEQ D;  4NPF X;  1AA0 A;  1E79 H;  2K88 A;  3BRT B;  2CPS A;  3HUS A;  3RK3 E;  1M57 D;  4EYY Q;  4EDF A;  1WMK A;  1NYH A;  1X79 B;  1IFD A;  4I7Z B;  3CWB G;  1D7M A;  4D6T D;  2VRS A;  1GL2 B;  1L0L G;  1JY2 P;  1JO5 A;  1GTW A;  4N3Y B;  4H0L B;  3AEE C;  1URQ A;  5APT A;  1H0T A;  2I1K A;  3HD7 B;  4RES B;  2N1T A;  2HPC A;  3V2P A;  1M90 Q;  2HG5 D;  3UIA A;  3WUT A;  5KLV G;  3L74 G;  2WSF H;  4KT0 J;  2WTY A;  4ZKP A;  1LGH B;  5EFW B;  2XDJ A;  1PIX A;  1ZN5 A;  4H13 B;  3O6Q A;  2D2C D;  4L76 A;  1Q90 D;  4UB8 E;  1RF1 B;  3B5N C;  1NKZ B;  1FBM A;  2E42 A;  3G71 P;  1LWU C;  1L4A A;  3U1A A;  1GDT A;  2UWJ E;  3H6P A;  1N7S B;  1S5L E;  1URQ D;  2PP6 A;  4C7N A;  2H43 A;  1P84 H;  2KXP B;  5CBN A;  4YXW H;  3II6 A;  1GW3 A;  2HOD A;  1GL2 C;  3L4F A;  3TK1 A;  2BCC J;  2WVR A;  3FGA D;  5AW2 B;  1PP9 E;  2E5Y A;  3N4X A;  1FZF A;  1KV4 A;  2YO2 A;  5K5G B;  1VF5 D;  2NPS B;  1BCC J;  4DJG A;  2FFD B;  5KAF H;  4UB6 H;  1SQB G;  1SQP J;  1HBW A;  2BCC D;  5H2F H;  1VPC A;  3S4R A;  2DW3 A;  2QIW A;  4H13 C;  5BU5 A;  2OQQ A;  3EFF K;  4YTP C;  2PAJ A;  4RO0 A;  2YKQ A;  1LTJ B;  5APW A;  1BCC D;  3A0B E;  1JY2 O;  4D6T G;  1JOC A;  1SQP D;  1HJ0 A;  2WSE J;  4IOI H;  1HF9 A;  4K35 A;  2O1K A;  3CXH E;  1N7S C;  2QG4 A;  5AW8 B;  1OMI A;  2M3E A;  2C9N Y;  4NPD A;  2N9B A;  3HUS C;  5AVT B;  3M0D C;  1FJK A;  2KSE A;  1VQ6 P;  3USS A;  1SQQ E;  2Y0E A;  1R5L A;  4JPZ B;  2K9J A;  2Q1K A;  2WWW A;  4GOE A;  3KXD A;  2LXB A;  1DD4 A;  1RE3 A;  2N1T C;  2WSC H;  2ZAE B;  2B89 A;  1CI6 A;  1LP1 B;  3JSV C;  1JCC A;  4KJM A;  2A45 I;  4GOD A;  3JC2 2;  1K9M Q;  2XV5 A;  2WPV B;  3CX5 E;  4U3F J;  3TNU B;  2FYU K;  3L71 E;  2AEM A;  3VMA A;  2H8P D;  5AVY B;  2BEZ F;  2E74 D;  1NTM J;  2KS1 A;  3CI9 A;  2OGU A;  2JR8 A;  4U3F D;  4HYT B;  2BCC G;  2G3A A;  1Q82 Q;  1GK6 A;  3N7N A;  2ZYD A;  1BCC G;  3Q1M A;  1JEK A;  5KTB A;  5DJT B;  1SQP G;  1N86 A;  1FC2 C;  1KC8 Q;  1Q86 Q;  1MV8 A;  1QL1 A;  5KAI E;  3RK3 B;  1NTZ E;  5AVR B;  2OYH A;  3P8C D;  3CXH I;  3CWB E;  1W5C E;  3CC2 P;  1VQP P;  4PD4 I;  4HH2 A;  1FZC C;  4EIJ A;  3L75 J;  4H44 B;  1XTC C;  1IFN A;  3NXS A;  2G8Y A;  3GF3 A;  1EDK A;  1HTL C;  1M1K Q;  1S5L X;  2E76 C;  3L75 D;  4M3L A;  1SQQ K;  4WY4 B;  1LT9 A;  2NZ2 A;  3LID A;  4AYC A;  3NTN A;  3RK2 B;  2Y9Y A;  4DZO A;  1GMJ A;  2V7Q H;  5AW5 B;  5AVZ B;  3L37 A;  3L73 E;  5AW3 B;  3RGU A;  3IFM A;  1J1E B;  1J2J B;  5B66 H;  1M7L A;  1QGK B;  3KYQ A;  1FOS F;  2AEJ A;  3D6Y A;  3HE4 A;  4N78 E;  4U3F G;  3VTP C;  4PJ0 H;  2JJL A;  1ZME C;  2KYV A;  3KZI E;  1JTH B;  2KLV A;  5APV A;  1AJY A;  2RN0 A;  1YJW P;  1NO4 A;  4BXL A;  3T97 B;  3CCJ P;  1SQX D;  2W6J H;  4JQ0 D;  1ZR4 A;  5KJ7 A;  2P10 A;  1ZV8 A;  3CL3 D;  3VMY A;  1YTZ T;  1EXJ A;  2FKW B;  1JY3 N;  1EXI A;  4OGQ D;  1EZV I;  1EDI A;  1IC2 A;  1NTZ K;  1FU1 A;  1OW8 A;  1J1E C;  3U59 A;  2IZ1 A;  1WT6 A;  4C46 A;  3L75 G;  1DIP A;  3VYI A;  4HJG H;  3B8E B;  1NTK J;  2R32 A;  1M1J B;  2V4H A;  2WT7 B;  2Z5I A;  1OFC X;  1S9K D;  3C1L A;  3GMA A;  3L35 A;  4JF7 A;  5APY A;  1PGJ A;  5KLI B;  4W7Z A;  4DCK A;  2ZYG A;  1KB9 I;  2SPZ A;  1LT1 A;  1NTK D;  2A45 H;  4IL6 H;  3EFG A;  2I1J A;  1YYC A;  1FDI A;  3Q2Y A;  1J1D C;  3C8V A;  1TU3 F;  3L36 A;  4Y99 B;  3BCC D;  3D70 A;  3HTK A;  1NKN A;  4BWN A;  3AE8 C;  3B5N A;  4HB1 A;  1W2B O;  1KIL B;  2FXM A;  2XZR A;  2PFX A;  1DX7 A;  2WPQ A;  2W83 C;  1USD A;  2I8D A;  4PV1 B;  3WU2 H;  3JCU H;  3WUV A;  5AVU B;  1ZP0 C;  1OXZ A;  2YXR B;  1QL2 A;  2MKV A;  1BCC E;  4ZKU A;  1SQP E;  4WWI A;  2HFE D;  1G1J A;  3H1I E;  1GL2 A;  1E5W A;  2M5A B;  2IYP A;  2QJY C;  4PD4 H;  3CCL P;  3EWK A;  5TIS E;  4ASV A;  1AQT A;  1KQG B;  4BRY B;  2YIU C;  3PH0 A;  3S9O A;  2KIK A;  1T3J A;  1QEX A;  3B4S A;  2GUV A;  2A06 E;  1BDC A;  3CCQ P;  1PGQ A;  2FY8 A;  4Y99 C;  3R4Y A;  1OVR A;  1SFC B;  2O01 N;  3IAO A;  2XNX A;  1RF1 A;  3TDK A;  3FWN A;  2QJP B;  1X0T A;  1VQ8 P;  3VOP A;  3RL0 B;  2OTK E;  2OTJ P;  1NTK G;  3CMA P;  3AEG C;  1N7S A;  3A0H H;  3QWO C;  1XTG B;  4EI2 A;  1GU5 A;  4EOT A;  1SQV J;  4ASW A;  2FYZ A;  1MFZ A;  3M0D A;  1ZR2 A;  3H1J J;  1DEB A;  1Y8A A;  2IFM A;  2ZT9 B;  3RBX A;  1PV3 A;  1SQV D;  2WSC J;  5CCG D;  2M0B A;  4U3F E;  2NPS A;  1HUC A;  2Z5H A;  2FFD A;  2R3S A;  3CC7 P;  3H1J D;  3MHV A;  2QEX P;  5CJ4 A;  1USE A;  3PJS K;  1MUU A;  1AFO A;  4JBZ A;  1NTM E;  1FOS E;  1CZQ A;  3V2N A;  3IR9 A;  2IBZ E;  4RKU J;  1KTM A;  4YPC A;  2QA4 P;  1LTJ A;  2Y0D A;  2KSJ A;  1FJP A;  5GTH E;  3G4S P;  4ZMD A;  1BGY E;  3V2Q A;  1Q2N A;  1ZRT E;  1VQ9 P;  2YNY A;  5B5E E;  4IFM A;  3OJA B;  1T3U A;  3Q5P A;  2N1T D;  3A3Y B;  2OYI B;  2JWD A;  3H1K D;  5AVV B;  1EQ7 A;  2CK3 H;  2C0W A;  4I7Z C;  2ZT9 C;  1N7L A;  1YBK A;  1RHZ B;  1GK4 A;  3L75 E;  4A7P A;  4H0L C;  2B87 B;  1AV1 A;  1S3J A;  1L0N K;  5E79 H;  3V2R A;  3SFD C;  3HD7 C;  1L4A D;  1K04 A;  2D2C B;  3L70 J;  2QSI A;  1WRG A;  3K5B A;  1KB9 H;  1LP1 A;  2KP8 A;  3MUD C;  1IO4 A;  4I1L A;  1FZC A;  5DJU B;  1KYO I;  1RF1 C;  2ZXE B;  3L70 D;  4LGD E;  1S2E A;  1VQN P;  1URQ B;  4CPG A;  1H0T B;  1SQV G;  1VQ4 P;  2W8Z A;  4YXD C;  2V7Q J;  1M8O B;  3H1J G;  3O6Q B;  2QM8 A;  1PPJ E;  3SWF A;  1FZB A;  1T2K C;  3GHG B;  4GOF A;  2JEE A;  4GDO A;  3EQ2 A;  1Y9B A;  2P67 A;  3W67 A;  5APQ A;  3HE5 A;  1VF5 B;  1OX3 A;  3P8M C;  1SVF A;  2E75 D;  1A02 J;  1RQU A;  1KN7 A;  1NTM K;  1L2P A;  3MD0 A;  1KMI Z;  2WSS H;  4GIF A;  3CCS P;  3VP9 A;  2NPS C;  2FFD C;  2Z4E A;  2P1J A;  3TGU J;  3NFQ A;  2E76 D;  3TF5 A;  1VQL P;  3H1K G;  1LTJ C;  3TGU D;  3H1L D;  2O01 H;  1Q81 Q;  2XU6 A;  2AXT E;  1X9V A;  3H32 B;  2AEF A;  2LR2 A;  2JKV A;  1LTG C;  1VDF A;  4LLH A;  4WY4 A;  1KIL E;  1N73 B;  2L5G B;  4GT1 A;  1S9K E;  1X8Y A;  3SSU A;  3LW5 H;  2KI7 B;  3SWK A;  2O1J A;  5AW0 B;  3L70 G;  3H25 A;  2GA1 A;  1PL5 A;  2IPP A;  1LTS C;  4KHX A;  3AEF C;  3CD6 P;  1RF0 A;  2R44 A;  3F5H A;  1LTA C;  2WIT A;  2B88 A;  1JB0 J;  1L0L E;  1H88 A;  3V6I A;  1QX8 A;  2E74 B;  1A02 F;  2FYU J;  3T97 A;  3GG2 A;  4WVZ A;  1OWA A;  5KLV E;  3L74 E;  2QM7 A;  3HRN A;  1RH5 B;  2FXP A;  1P84 E;  1PP9 J;  2FYU D;  5AW4 B;  2R5B A;  1S72 P;  1QVF O;  2K37 A;  2Q3E A;  3Q5S A;  3H1H J;  4IL6 X;  2Q7C A;  4OH8 B;  3TGU G;  3H1L G;  3AEA C;  3M06 A;  1VQ5 P;  1PP9 D;  1ZLL A;  1NU1 J;  1NH4 A;  3CX5 I;  3H1H D;  1PGO A;  5KAF E;  3RK3 C;  4UB6 E;  1Y47 A;  5H2F E;  1JY3 P;  2BAS A;  5L8R J;  5GTI H;  1FZG A;  3AEC C;  3M9H A;  1KFN A;  1SQX J;  4H44 C;  1NU1 D;  3BRV B;  1N8R Q;  3GF7 A;  3TSI A;  1AQ5 A;  3PRJ A;  5BU8 B;  2K1A A;  3RL0 g;  3CXH D;  1QVG O;  2OYH B;  1SQB E;  3AE9 C;  1S4X A;  1KYO H;  2KNC B;  1OZH A;  4PD4 D;  2W6B A;  4L73 A;  4WY4 C;  2H89 C;  2IYO A;  3RK2 C;  2WPS A;  1IZN B;  2POH A;  5CCH A;  4D6T E;  1U7J A;  1SQV E;  5AW9 B;  1IJD B;  3H1J E;  2FYN B;  1KIL A;  4HKZ H;  1L0L K;  3L72 J;  1YJN P;  1YI2 P;  5AW6 B;  2QE7 H;  1U7M A;  1RF0 C;  1IFI A;  2A45 G;  1FDO A;  2E5T A;  5KJ7 D;  2WZ7 A;  3KPE A;  2FYU G;  4UB8 H;  1GZL A;  5KLV K;  3A2A A;  3L72 D;  4ZNC A;  1P84 I;  3CX5 D;  3KDP B;  2JP3 A;  2M5A A;  2R3C A;  1PP9 G;  3AED C;  1LJ2 A;  1S5L H;  3HE4 B;  4BRY A;  2JWA A;  5AW7 B;  3H1H G;  3BCC J;  1JY3 O;  2YO3 A;  1FAV A;  1ZOY C;  1NOH A;  2O3J A;  1SFC A;  4Z1M H;  1NTZ J;  1NU1 G;  3F89 A;  1LTT C;  1GU4 A;  3R2P A;  1JMB A;  1KQS O;  3CLQ A;  4W7Y A;  3CPW O;  3CCR P;  1G2C A;  4TLF A;  1YJ9 P;  1FE6 A;  3CCM P;  3OAK A;  1ZW0 A;  1RQV A;  1SQX G;  1YHQ P;  2BCC E;  5APX A;  1YTZ I;  1EZV D;  3AE3 C;  1DH3 A;  1NTZ D;  2HR3 A;  3VMZ A;  2KB7 P;  1RE4 C;  1M1J C;  4N6J A;  1PFI A;  3L70 E;  1GW4 A;  1KFM A;  1SQB K;  3M91 A;  3A0B H;  4XE5 B;  3AE2 C;  5AVS B;  3VMX A;  5KLI C;  1KZU B;  2FXO A;  3AE6 C;  1KQL A;  3P7K A;  3CXH H;  1KOR A;  3E1I A;  1DEE G;  2J5U A;  2QRX A;  1VQM P;  3L73 J;  3B5N D;  1YIJ P;  4JYB A;  3KQG A;  4XA4 A;  1SQV K;  3HD7 A;  3CME P;  1OIP A;  2WPR A;  1NAY A;  1SS1 A;  5CCH C;  3L73 D;  3MUD A;  3MZW B;  1KB9 D;  2OAR A;  3OW2 O;  1BDD A;  3L72 G;  2IZ0 A;  3Q3D A;  1NGM B;  1FS0 E;  4R4M A;  1ZXG A;  3ABV C;  3FXD A;  5B66 E;  2JO1 A;  3CCU P;  1KIL C;  1GL2 D;  1YIT P;  2IX7 C;  4MN4 C;  4NPE A;  4H0L D;  4PV1 C;  1KD1 Q;  3HD7 D;  4PJ0 E;  1BE3 J;  2H7H A;  2KOG A;  3TGU E;  3CX5 H;  2MJZ A;  3O8Z A;  1LWU B;  4H13 D;  3PP5 A;  3BCC G;  5M1B A;  1BE3 D;  2YXQ B;  1OVV A;  4WBA A;  4JYC A;  2E43 A;  4WB4 A;  3TYY A;  5C39 A;  2H88 C;  1EZV G;  3G9R A;  1NTZ G;  3PTZ A;  4AUW A;  3B71 A;  3MP7 B;  4IFF A;  3WMM 0;  1N7S D;  2O01 J;  1SFC C;  2R5D A;  2QJP C;  3G6E P;  5APU A;  1T2K D;  1Z56 A;  1VQO P;  1K05 A;  3RL0 C;  3H1K J;  1CSB A;  5KAI H;  1IK7 A;  1EDJ A;  3CCE P;  2AXC A;  3P8C E;  1SQP K;  4L74 A;  2HLO A;  2WQY C;  3LW5 J;  2NPS D;  3GW6 A;  1LNQ A;  2HYN A;  3LIE A;  2P2U A;  2Y0C A;  3VN0 A;  3CCV P;  3GHG A;  3IF4 A;  3L73 G;  1JY2 N;  2XND H;  1VQ7 P;  3I55 P;  1JM0 A;  4O9B A;  3MTU E;  1FZA A;  2W6A A;  4IL6 E;  4C7R A;  2FYU E;  2YKO A;  2GM4 A;  3AE1 C;  1X22 A;  3HUS B;  1VQK P;  3SFE C;  3I56 P;  1HVV A;  1K8A Q;  3RBZ A;  1JMM A;  2J58 A;  1T6A A;  2C9L Y;  3TNU A;  3D71 A;  1VL2 A;  3H1H E;  2ITA A;  3H32 A;  2N1T B;  5KKZ B;  2HPC B;  1BE3 G;  4GKG A;  3H1I J;  4R4L A;  3AE4 C;  2QJK B;  1N73 A;  3WU2 E;  3JCU E;  2LKM A;  2IDB A;  2J59 M;  3KZI H;  1NU1 E;  2W27 A;  2KLU A;  1CW5 A;  2OYI C;  5AVW B;  5CCG C;  3AEB C;  1DD3 A;  3H1I D;  4OVN F;  1EDL A;  1HGZ A;  1LTI C;  3VP8 A;  1L4A B;  1N2D C;  1SQX E;  2IBZ I;  4PD4 E;  1L0N J;  1NHL A;  2GUS A;  4C7N B;  2OYO A;  2P58 A;  2D2C C;  1K73 Q;  2M8R A;  1SP4 A;  3H1L J;  2Q3I A;  2A06 D;  4TT3 H;  1PGP A;  2HOD B;  3PLN A;  1L0N D;  1JCD A;  5AVQ B;  3WUU A;  2LXC B;  1OVU A;  2RMZ A;  1URQ C;  5KKZ C;  2KZI A;  3A5T A;  2QJK C;  3A0H E;  1KYO D;  1NJI Q;  1BSH A;  2YMK A;  3L72 E;  2E75 B;  1FZC B;  1HJB A;  4B86 A;  3RK3 D;  3OA7 A;  3GHG C;  1AVO A;  1L4A C;  1VF5 C;  3V4Q A;  3CC4 P;  4H44 D;  1AVY A;  1NTK E;  2E76 B;  3D6Z A;  2P7J A;  4OWF A;  3AE5 C;  1IFM A;  2RKL A;  3A7O A;  1H8A A;  1G1I A;  1NTM D;  1BGY J;  5TJH A;  4WY4 D;  3HE5 B;  2IBZ D;  2RH0 A;  2C0X A;  3BCC E;  3C9I A;  4Y28 J;  1W2E A;  3G3Z A;  3RK2 D;  1JTH A;  2K9J B;  3H1I G;  1NU1 K;  1HWT C;  2K3R A;  1BGY D;  1EZV E;  2KNC A;  1ZRT D;  3QH9 A;  1CI6 B;  1UIX A;  1YQ3 C;  1MZ9 A;  1HH0 A;  2YKP A;  3BAS A;  1N73 C;  4L75 A;  2E75 C;  1SQX K;  3E7K A;  4QMA A;  1Q7Y Q;  2A06 G;  2K9Y A;  5CMZ A;  5BVZ A;  3M0A A;  1L0N G;  4K3A A;  1EC5 A;  2OTL P;  2WMM A;  3E1R A;  5TIS H;  2ZVN B;  3M9B A; 
#chains in the Genus database with same CATH homology
 1W5C E;  4PJ0 E;  5GTI E;  5TIS E;  3A0H E;  5E79 E;  5GTH E;  5B66 E;  5KAF E;  3WU2 E;  3JCU E;  4UB6 E;  5H2F E;  5B5E E;  5KAI E;  4IL6 E;  1S5L E;  2AXT E;  3A0B E;  3KZI E;  4UB8 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...