4UB8E

Native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
total genus 19
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 4ub8E00
5B66E 4UB8E 5KAFE 1W5CE 5TISE 4IL6E 3A0BE 5GTIE 3WU2E 3JCUE 5KAIE 3KZIE 4PJ0E 5H2FE 5B5EE 5E79E 4UB6E 2AXTE 3A0HE 5GTHE 1S5LE
chains in the Genus database with same CATH superfamily
5C39A 3WU2H 2KNCB 4GKGA 1VQ8P 2FFDB 4IFFA 1VQNP 2KI7B 3RL0g 2QA4P 3WU2E 5KTBA 3CC4P 1R5LA 1OW6A 1AJYA 3MIWA 2IX7C 1GK6A 3CCSP 2G8YA 4W7YA 4NPDA 3L73J 1USEA 1BDCA 1W5CE 3CWBD 2FKWB 5AVUB 3B4SA 5APYA 3FX0A 2LR2A 2GA1A 4JPZB 1RY3A 5TJHA 3QH9A 3L73E 1OVVA 5APUA 3H1LJ 4MN4C 1AQ5A 1VQ4P 4HJGH 5AW6B 1L0LG 2E75C 2W6AA 2WTYA 2IBZI 2K9JB 5CJ4A 1SQQJ 2JWAA 2KZJA 1CI6A 1Y47A 1JY2P 1AVOA 1EZVI 1JY3O 3N4XA 3L74G 3GW6A 2B87B 3B71A 1L4AB 1JY3P 5AVQB 1KFMA 1SQQE 2NZ2A 2AEJA 3H1HD 2QJPC 2P2UA 1BE3J 4BWNA 3EFFK 2O01J 4C7RA 1YQ3C 2N9YB 4UB6E 1K8AQ 4TLFA 3JSVC 3CX5E 1HTLC 3RL0C 1PGQA 1IFDA 3CI9A 1SQXJ 2YNYA 3H1JD 1YJ9P 3TGUJ 4RKUJ 1M56D 1GU4A 1ZR2A 4I1LA 1KILB 4GOFA 1MFTA 4JBZA 1BE3E 1LT1A 1N7SC 3L72D 1JM0A 2KXPB 4GT1A 2E5TA 4YTPC 5B66E 5KAFE 3T97B 5AVWB 1YIJP 2A06D 1SQBG 2FYUK 4N3YB 2A45I 1SQXE 1DD3A 3VOPA 3TGUE 3BASA 2WSCH 4HYTB 5CHXA 4I2LC 1H89A 3AE4C 4EIJA 1LTSC 1RF0A 3TYYA 2B9BA 2YMKA 3I5CA 5KJ7A 2WSSH 3B5NC 2OGUA 1SS1A 3IFMA 3HD7B 1PP9J 2JDIH 1YITP 1WMKA 2ITAA 1LJ2A 2AEFA 5AW3B 3CCUP 3G9RA 2Y0CA 1NKNA 3HE5A 3BCCD 3HUSA 1PP9E 1ZOYC 1YHQP 2ZXXA 3PHLA 2YMYA 1X8YA 1HWTC 1AVYA 1PZQA 1FZCC 3O6QB 3P8MC 1NTZD 1EQ7A 2QG4A 1VQ9P 2Y0EA 1H88A 1X9VA 3GHGB 3LIDA 1NU1K 3V6IA 1NTKD 2FYUJ 3R2PA 3PTZA 2UWJE 1IJDB 5E79H 2OYIA 1IK9A 1SQPD 3CWBG 2P58A 1VQ6P 5AVTB 3HTKA 1LP1B 1AQTA 1LTAC 1JTHA 2FYZA 3AE3C 3A0BH 1S5LE 2J5UA 2E75B 3RBXA 2OYHB 1S2EA 3V4WA 3H6PA 2ZYAA 1RE4C 2FYUE 4PV1D 3A0BE 1Q81Q 1L2PA 2KB7P 1OVUA 1HUCA 2Q3IA 2Y9YA 3M9QA 2IFNA 3WUTA 2I8DA 3H32B 4IL6X 2E42A 1PIXA 1IFNA 3G3ZA 3V2RA 2YIUB 1YJNP 1N7LA 2FBWC 2N9BA 4C7NB 5M1BA 3AE6C 1KQFB 2PFXA 2Q7CA 1TU3F 2KSJA 3WUUA 1P84I 1PPJG 3H1KD 3O8ZA 2B88A 4O9BA 1L4AD 1OWAA 3BATA 1RF1A 1K05A 3OJAB 4WY4B 2IBZE 1KB9I 3RL0B 1M8OB 1YI2P 1HVVA 1GL2C 4U3FG 1YTZI 1NKZB 1PGJA 1EZVE 3KHUA 1Q82Q 3NXSA 3P32A 2XDJA 1SP4A 3M9BA 1NU1J 3AECC 2H7HA 1N7SB 4PD4D 3E1IA 3A5TA 1BGYG 3OW2O 1FZGA 5AW0B 5AW7B 3I55P 1SFCA 4I7ZC 1NU1E 3H1IJ 5AVVB 4W80A 1M57D 5KLVK 1RH5B 2A06G 2R5BA 3B5NB 3S9OA 3CXHI 3L74D 1JUNA 3AEFC 5DJUB 2KLVA 1KYOI 3W67A 2E76D 1G1JA 1M7LA 1VQ5P 1G2CB 2Q9IA 2AEMA 2KS1A 2A45H 1ZLLA 1Y8AA 2FYNC 4NPEA 1FZCA 5APTA 3H1IE 2XNXA 4N78D 3WUVA 1S3JA 1FS0E 5CCHD 3HD7D 1ZXGA 2YO3A 5KLIC 3EWKA 3A7OA 1L0NJ 2SPZA 4GDOA 2KK7A 1IZNB 1XTGB 3H1LD 1FBMA 4JF7A 3BVHA 1EXIA 1EC5A 1URQA 2YXRB 1J2JB 1ZW0A 2H88C 3S4RA 4DZOA 1VQOP 1L0NE 4XA4A 3G6EP 3NFQA 1PFIA 1GW4A 2G3AA 4Y99C 3G4SP 3VMXA 2HODA 1A02J 2K9YA 1NO4A 1U57A 1FZFA 2VRSA 5BU5A 2CPBA 1T3UA 1JMMA 1SLQA 1N2DC 5AW5B 2P67A 4M3LA 1VQ7P 5CMZA 3EQ2A 5AVXB 4DJGA 2Q1KA 3L70J 2E75D 3AE2C 1N73A 1SQQK 1SQVJ 4KJMA 1CW5A 3F89A 1ZRTE 2JKVA 1JY3N 1RF0C 2ZYGA 1GD2E 5GTIH 2C9LY 5AVZB 1BSHA 5AW4B 1LWUB 2KNCA 1HGZA 1M1JB 4LLHA 5KJ7C 2QJYC 3L70E 5L8RJ 2JJLA 1JO5A 2H8PD 1LTTC 1GL2B 1SQVE 4GOEA 3N7NA 1KN7A 3L71J 2N1TB 5AW1B 2M5AB 1VF5C 2PGDA 5AW8B 1DEEG 2I1KA 3H1KG 5KLVG 1DD4A 1U7MA 3L75G 4WY4D 3HUSC 1BCCJ 3RL0D 3AEAC 1SQXK 1P84H 3VMZA 1DX7A 1GMJA 2NRGA 3L71E 3FXDA 3M9HA 1E79H 1JCDA 2JO1A 1KB9H 2WPQA 1N7SD 4WBAA 5CCGA 3Q5PA 4I7ZB 4PV1B 3P8CD 1BCCE 2IDBA 3IR9A 2FY8A 1Q86Q 2OTLP 3D6YA 3FGAD 3GF7A 3USSA 3RK3E 2OYIC 3F5HA 4OGQC 2JEEA 4RESB 1H0TA 2YO2A 1NWQA 4JQ0D 3B5ND 1PPJD 4ZMDA 1IFMA 2LXCB 1Q90D 5KLIB 2FYUD 2LKMA 3L73G 1CI6B 3CXHH 4U3FD 1KYOH 1T3JA 3A2AA 1NVOA 1UIXA 3CXHE 3D6ZA 1OMIA 1MV8A 1NJIQ 1QX8A 1A02F 4NPFX 2OQQA 2ZXEB 3E1RA 1BGYD 1OW8A 3MGNA 2HPCA 2IZ1A 3H1LG 1ZP0C 1KILA 2Z5HA 2HR3A 4D6TJ 2WSCJ 3V5BA 4Y99B 3V2NA 1RF1C 3T97A 4HB1A 1LTIC 3M0DA 4Y28J 1SQQG 1S5LX 4TT3H 3JC22 1KV4A 2CK3H 3MUDA 3CMEP 2E76B 1FDIA 3K5BA 4D6TE 2YKQA 1S9KE 3SSUA 1NOHA 3M91A 3PJSK 1S72P 2NPSA 1EXJA 2JP3A 5CCHA 4AYCA 2QSIA 2D2CB 2J58A 4EYYQ 2W27A 2FXMA 3TK1A 2H43A 4ZKPA 1BE3G 4K3AA 1X0TA 1NU1D 3KQGA 1SFCC 2WQYC 1ZR4A 5AW9B 2K3RA 4LC1A 2WPVB 3NTNA 2GUSA 3D71A 1SQXG 2QJYB 3TGUG 2YXQB 3SFEC 4ZKUA 1YBKA 3MHVA 1JNMA 1NAYA 1QGKB 1X22A 3HE4A 3H25A 2R44A 2L5GB 2PAJA 3O6QA 1M1KQ 3KYQA 2Z4EA 2E43A 2KSEA 1OZHA 3HUSB 2KZIA 3CWBE 4L73A 1FJPA 1GTWA 1GL2D 1IK7A 1VQPP 2IFMA 2H89C 2N1TD 2BASA 2KOGA 2KYVA 1Q2NA 1URQC 1LT9A 1PP9G 1H8AA 4XE5B 3CCJP 2WSFH 5APQA 2KIKA 5E79E 1T2KC 2J59M 4H44C 5CJ0A 2GUVA 5CBNA 2OYHA 5AVYB 2DW3A 3AE1C 2XZRA 4K35A 2R3SA 2OYIB 2HFED 4OGQB 1S4XA 3H1HJ 4BRYA 4JYCA 3VN0A 1JTHB 1T6AA 3OA7A 1GU5A 4I6MC 1JOCA 4H0LC 2R5DA 4PD4I 1R8EA 3RK2C 1VPCA 3H1JJ 2QIWA 4L76A 1X79B 3TNUB 3V2PA 1R5SA 3H1HE 2QJPB 1M90Q 3L72J 5KLVD 4WY4A 4KHXA 3L75D 1N73C 1RQVA 2FYUG 1L0NK 4XFJA 2IPPA 2K88A 3H1JE 4WVZA 1HF9A 1EDKA 1YJWP 1PV3A 2WT7A 2XU6A 2P10A 3L72E 1ZN5A 1NTMK 3FXEA 1OFCX 1RF1B 3C1LA 2QJKC 1RQUA 2BCCJ 3CPWO 2YKOA 2ZJSE 2QM7A 3CD6P 4W7ZA 1U7JA 3QWOC 2Q3EA 5TISH 2XKMA 4HH2A 2IBZG 3AEBC 5TISE 4U7JA 1OVRA 2WPRA 2BCCE 1K9MQ 1EZVG 3L71D 1FOSE 3BCCJ 1LTJA 4UB8H 3GMAA 3ITKA 1SFCB 3L73D 5CCGC 1N86A 1IFIA 3CC7P 4UB8E 3VYIA 1BCCD 1NTZJ 3LIEA 3P7KA 2D2CD 2C9NY 2HLOA 1SQVK 1EDJA 1VQLP 3BCCE 4OWFA 5AW2B 2WSEH 2R3CA 3CX5I 4IL6H 1NU1G 2RMZA 3AEEC 4WB4A 1NTKJ 4IL6E 1FZCB 1NTZE 4N6JA 1LGHB 1SQPJ 1AA0A 2QVAA 1LNQA 2ZVNB 1L0LK 1NTMJ 1BDDA 2IZ0A 4AUWA 1SQQD 2WPSA 3H1IG 4ZNCA 1VF5D 1NTKE 1N8RQ 1FDOA 3V2QA 1FZBA 1URQB 1SQPE 3CX5D 5CBOA 2O1KA 4H44B 3R4YA 1KQGB 1NTME 3AEGC 1MUUA 3E7KA 5H2FH 1KILC 1FDMA 1BE3D 1HGVA 1W2EA 5H2FE 1OXZA 2HODB 2M3BA 2C0XA 3M0DC 1L0NG 4H0LB 1SQXD 1HJBA 5APVA 1DEBA 3TGUD 2OYOA 3RK2B 1GW3A 2AXTH 3U59A 3MUDC 3G71P 4OGQD 3RK3C 1DIPA 2Q6QA 3RBZA 3AE5C 1LWUA 3BRVB 1M1JA 3CL3D 1XTCC 2FFDA 2NPSC 5CCHC 3HD7C 3SWKA 2E74C 1SQBK 2KUBA 3KDPB 4A7PA 1N73B 2ZT9C 5GTIE 1FOSF 2QRXA 1L0LJ 1OX3A 4R4LA 4PD4H 5DJTB 1VQKP 4ASVA 1KORA 4IFMA 2RH0A 1Y9BA 1QLED 4PD4E 2QE7H 3KXDA 4HKZH 1PP9D 4QMAA 2QJKB 4OH8B 2C0WA 4Z1MH 3KPEA 3L74J 2O3JA 1VL2A 1OW7A 1L0LE 1KC8Q 1P84E 1GZLA 1KILE 4H13C 4L75A 2IYPA 3L70G 1KB9E 3CLQA 3GG2A 3D70A 1SQVG 3GHGC 1IO4A 3L74E 5AVRB 1JMBA 2K9JA 3BRTB 2IYOA 1AV1A 1KTMA 1LT9C 3Q5SA 2FYNB 3II6A 4N78E 2Y0DA 1JY2O 3CCEP 2GM4A 3L71G 2B87A 1L4AA 1ZMEC 2OYHC 4WWIA 3MTUE 2ZYDA 1SFCD 2RKLA 1SQBJ 1EDLA 4GODA 3VMYA 3W68A 4AQRD 1H0TB 2W8ZA 2OTKE 1BCCG 3H1LE 3IF4A 3ABVC 3B8EB 5GTHH 1QEXA 1KYOE 1YTZT 2W90A 3CCLP 4GIFA 2YIUC 5GTHE 3CMAP 3MZWB 2WVRA 1SQBE 3AEDC 1NH4A 3L4FA 4UB6H 2P7JA 2JWDA 3CX5H 1LTBC 2L91A 2IBZD 4WY4C 1FJKA 3L35A 1KFNA 5AVSB 2LXBA 2OTJP 4RO0A 2FXPA 3L37A 2HPCB 1EZVD 2M8RA 2O01H 2KLUA 2QM8A 1IC2A 1MZ9A 5B66H 5KAFH 2WITA 1URQD 3PH0A 4EDFA 1T2KD 1MFZA 4H44D 1AFOA 2YKPA 3HD7A 4EOTA 1HBWA 3AE7C 1GK4A 3RK3B 3ZDMA 2HYNA 1T8ZA 2PRRA 3VP9A 3M0AA 1RE3C 2BCCD 2PP6A 2NPSB 1NYHA 1QL1A 4C46A 4H0LD 4PJ0H 2E74B 1LTJC 3CWBJ 2ZT9B 4YPCA 5APXA 4OVNF 3RK2D 1QVFO 2MJZA 4PJ0E 4D6TG 5KKZC 1KQLA 1CSBA 1PGOA 3A3YB 4L74A 3VP8A 1LTGC 3CCVP 3H1ID 1NGMB 3HRNA 1VF5B 3TSIA 2K37A 1FU1A 2Q5UA 2MKVA 1VQMP 2HG5D 2O1JA 3V4QA 1FZEA 3HE5B 1D7MA 3CCRP 3GHGA 3HE4B 5APSA 2WMMA 3Q2YA 1NAFA 2WSFJ 4H13B 1Q7YQ 1K73Q 3M06A 3CCQP 3P8CE 1LP1A 3VMAA 2V7QJ 4CPGA 2M0BA 1IFPA 1L0ND 3UIAA 4IFDK 4EI2A 2AXCA 2Y9ZA 5B5EH 1J1DC 4U3FJ 2V7QH 1K04A 3LW5J 1LT9B 1S5LH 1WRGA 2XV5A 3H32A 2M3EA 5B5EE 3HTKB 1HJ0A 1FE6A 3PP5A 1NTMD 1PPJE 1KD1Q 5EFWB 1G1IA 1BGYJ 3LW5H 4C7NA 5CCGD 3TNUA 3MP7B 4U3FE 1NTZK 4BRYB 2OARA 2W6BA 2B89A 2QEXP 1MKMA 1ZV8A 3TDKA 1IFJA 4YXDC 3JCUH 3Q1MA 1BGYE 1ZRTD 1NTKK 3JCUE 1J1EC 2R32A 2W6JH 1LWUC 5BU8B 1M1JC 1SQPK 1N7SA 2FFDC 4DT0A 3WMM0 3L70D 2E5YA 3VTPC 3EFGA 4LGDE 1SQVD 3Q3DA 2A06E 3IN6A 2BEQD 2N1TC 3H1HG 1JCCA 1HH0A 2I1JA 4DOJA 3NMDA 4JYBA 2WT7B 3C8VA 3C9IA 2WWWA 1JEKA 4BXLA 3GLMA 3Q5RA 1RE3A 3PLNA 3B5NA 3H1JG 5K5GB 1QVGO 2RN0A 1EDIA 1L0LD 1P84D 1KMIZ 1KILD 1FAVA 3OAKA 1JB0J 3SWFA 4PV1C 2BEZF 3L72G 1G2CA 1KB9D 3I56P 2WSEJ 2ZFCA 1FZAA 1QL2A 1DH3A 1FC2C 2P1JA 2FXOA 2W83C 3CC2P 3A0HH 1LTJB 1NHLA 2ZVOB 5KKZB 3AE9C 3A0HE 3RK3D 2CPSA 4ASWA 1YQ4C 3RGUA 2KS1B 2POHA 2BCCG 1UIIA 2NPSD 5KJ7D 2E74D 3IAOA 2ZT9D 1L4AC 1E5WA 1YYCA 3U1CA 4YXWH 3PRJA 3CXHD 3AE8C 2A45G 1KYOD 3BCCG 3SFDC 1SQBD 3MD0A 4DCKA 3U1AA 2KP8A 5BVZA 4H13D 1NTZG 1RE4A 1J1DB 3L36A 2K1AA 2XNDH 3GF3A 1Z56A 4KT0J 1KZUB 2JR8A 1KQSO 3SWYA 3H1KJ 5KLVJ 4RJTA 2ZAEB 5KAIH 3L75J 1VDFA 1NTKG 1WT6A 3FWLA 1RHZB 1CZQA 2WZ7A 2E76C 3TF5A 5KAIE 4D6TD 3S1KA 1S9KD 1SQPG 5APWA 2V4HA 2AXTE 1JY2N 1NTMG 2D2CC 3KZIH 3H1KE 5KLVE 2Z5IA 1W2BO 1SVFA 4B86A 4R4MA 1OIPA 3L75E 4IOIH 1GL2A 1USDA 3KZIE 1S1CX 3FWNA 1GDTA 1PL5A 1BSNA 1J1EB 1PGPA 2N1TA 3CCMP 2O01N 2M5AA
chains in the Genus database with same CATH topology
5B66E 4UB8E 5KAFE 1W5CE 5TISE 4IL6E 3A0BE 5GTIE 3WU2E 3JCUE 5KAIE 3KZIE 4PJ0E 5H2FE 5B5EE 5E79E 4UB6E 2AXTE 3A0HE 5GTHE 1S5LE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B66 E;  4UB8 E;  5KAF E;  1W5C E;  5TIS E;  4IL6 E;  3A0B E;  5GTI E;  3WU2 E;  3JCU E;  5KAI E;  3KZI E;  4PJ0 E;  5H2F E;  5B5E E;  5E79 E;  4UB6 E;  2AXT E;  3A0H E;  5GTH E;  1S5L E; 
#chains in the Genus database with same CATH topology
 5C39 A;  3WU2 H;  2KNC B;  4GKG A;  1VQ8 P;  2FFD B;  4IFF A;  1VQN P;  2KI7 B;  3RL0 g;  2QA4 P;  3WU2 E;  5KTB A;  3CC4 P;  1R5L A;  1OW6 A;  1AJY A;  3MIW A;  2IX7 C;  1GK6 A;  3CCS P;  2G8Y A;  4W7Y A;  4NPD A;  3L73 J;  1USE A;  1BDC A;  1W5C E;  3CWB D;  2FKW B;  5AVU B;  3B4S A;  5APY A;  3FX0 A;  2LR2 A;  2GA1 A;  4JPZ B;  1RY3 A;  5TJH A;  3QH9 A;  3L73 E;  1OVV A;  5APU A;  3H1L J;  4MN4 C;  1AQ5 A;  1VQ4 P;  4HJG H;  5AW6 B;  1L0L G;  2E75 C;  2W6A A;  2WTY A;  2IBZ I;  2K9J B;  5CJ4 A;  1SQQ J;  2JWA A;  2KZJ A;  1CI6 A;  1Y47 A;  1JY2 P;  1AVO A;  1EZV I;  1JY3 O;  3N4X A;  3L74 G;  3GW6 A;  2B87 B;  3B71 A;  1L4A B;  1JY3 P;  5AVQ B;  1KFM A;  1SQQ E;  2NZ2 A;  2AEJ A;  3H1H D;  2QJP C;  2P2U A;  1BE3 J;  4BWN A;  3EFF K;  2O01 J;  4C7R A;  1YQ3 C;  2N9Y B;  4UB6 E;  1K8A Q;  4TLF A;  3JSV C;  3CX5 E;  1HTL C;  3RL0 C;  1PGQ A;  1IFD A;  3CI9 A;  1SQX J;  2YNY A;  3H1J D;  1YJ9 P;  3TGU J;  4RKU J;  1M56 D;  1GU4 A;  1ZR2 A;  4I1L A;  1KIL B;  4GOF A;  1MFT A;  4JBZ A;  1BE3 E;  1LT1 A;  1N7S C;  3L72 D;  1JM0 A;  2KXP B;  4GT1 A;  2E5T A;  4YTP C;  5B66 E;  5KAF E;  3T97 B;  5AVW B;  1YIJ P;  2A06 D;  1SQB G;  2FYU K;  4N3Y B;  2A45 I;  1SQX E;  1DD3 A;  3VOP A;  3TGU E;  3BAS A;  2WSC H;  4HYT B;  5CHX A;  4I2L C;  1H89 A;  3AE4 C;  4EIJ A;  1LTS C;  1RF0 A;  3TYY A;  2B9B A;  2YMK A;  3I5C A;  5KJ7 A;  2WSS H;  3B5N C;  2OGU A;  1SS1 A;  3IFM A;  3HD7 B;  1PP9 J;  2JDI H;  1YIT P;  1WMK A;  2ITA A;  1LJ2 A;  2AEF A;  5AW3 B;  3CCU P;  3G9R A;  2Y0C A;  1NKN A;  3HE5 A;  3BCC D;  3HUS A;  1PP9 E;  1ZOY C;  1YHQ P;  2ZXX A;  3PHL A;  2YMY A;  1X8Y A;  1HWT C;  1AVY A;  1PZQ A;  1FZC C;  3O6Q B;  3P8M C;  1NTZ D;  1EQ7 A;  2QG4 A;  1VQ9 P;  2Y0E A;  1H88 A;  1X9V A;  3GHG B;  3LID A;  1NU1 K;  3V6I A;  1NTK D;  2FYU J;  3R2P A;  3PTZ A;  2UWJ E;  1IJD B;  5E79 H;  2OYI A;  1IK9 A;  1SQP D;  3CWB G;  2P58 A;  1VQ6 P;  5AVT B;  3HTK A;  1LP1 B;  1AQT A;  1LTA C;  1JTH A;  2FYZ A;  3AE3 C;  3A0B H;  1S5L E;  2J5U A;  2E75 B;  3RBX A;  2OYH B;  1S2E A;  3V4W A;  3H6P A;  2ZYA A;  1RE4 C;  2FYU E;  4PV1 D;  3A0B E;  1Q81 Q;  1L2P A;  2KB7 P;  1OVU A;  1HUC A;  2Q3I A;  2Y9Y A;  3M9Q A;  2IFN A;  3WUT A;  2I8D A;  3H32 B;  4IL6 X;  2E42 A;  1PIX A;  1IFN A;  3G3Z A;  3V2R A;  2YIU B;  1YJN P;  1N7L A;  2FBW C;  2N9B A;  4C7N B;  5M1B A;  3AE6 C;  1KQF B;  2PFX A;  2Q7C A;  1TU3 F;  2KSJ A;  3WUU A;  1P84 I;  1PPJ G;  3H1K D;  3O8Z A;  2B88 A;  4O9B A;  1L4A D;  1OWA A;  3BAT A;  1RF1 A;  1K05 A;  3OJA B;  4WY4 B;  2IBZ E;  1KB9 I;  3RL0 B;  1M8O B;  1YI2 P;  1HVV A;  1GL2 C;  4U3F G;  1YTZ I;  1NKZ B;  1PGJ A;  1EZV E;  3KHU A;  1Q82 Q;  3NXS A;  3P32 A;  2XDJ A;  1SP4 A;  3M9B A;  1NU1 J;  3AEC C;  2H7H A;  1N7S B;  4PD4 D;  3E1I A;  3A5T A;  1BGY G;  3OW2 O;  1FZG A;  5AW0 B;  5AW7 B;  3I55 P;  1SFC A;  4I7Z C;  1NU1 E;  3H1I J;  5AVV B;  4W80 A;  1M57 D;  5KLV K;  1RH5 B;  2A06 G;  2R5B A;  3B5N B;  3S9O A;  3CXH I;  3L74 D;  1JUN A;  3AEF C;  5DJU B;  2KLV A;  1KYO I;  3W67 A;  2E76 D;  1G1J A;  1M7L A;  1VQ5 P;  1G2C B;  2Q9I A;  2AEM A;  2KS1 A;  2A45 H;  1ZLL A;  1Y8A A;  2FYN C;  4NPE A;  1FZC A;  5APT A;  3H1I E;  2XNX A;  4N78 D;  3WUV A;  1S3J A;  1FS0 E;  5CCH D;  3HD7 D;  1ZXG A;  2YO3 A;  5KLI C;  3EWK A;  3A7O A;  1L0N J;  2SPZ A;  4GDO A;  2KK7 A;  1IZN B;  1XTG B;  3H1L D;  1FBM A;  4JF7 A;  3BVH A;  1EXI A;  1EC5 A;  1URQ A;  2YXR B;  1J2J B;  1ZW0 A;  2H88 C;  3S4R A;  4DZO A;  1VQO P;  1L0N E;  4XA4 A;  3G6E P;  3NFQ A;  1PFI A;  1GW4 A;  2G3A A;  4Y99 C;  3G4S P;  3VMX A;  2HOD A;  1A02 J;  2K9Y A;  1NO4 A;  1U57 A;  1FZF A;  2VRS A;  5BU5 A;  2CPB A;  1T3U A;  1JMM A;  1SLQ A;  1N2D C;  5AW5 B;  2P67 A;  4M3L A;  1VQ7 P;  5CMZ A;  3EQ2 A;  5AVX B;  4DJG A;  2Q1K A;  3L70 J;  2E75 D;  3AE2 C;  1N73 A;  1SQQ K;  1SQV J;  4KJM A;  1CW5 A;  3F89 A;  1ZRT E;  2JKV A;  1JY3 N;  1RF0 C;  2ZYG A;  1GD2 E;  5GTI H;  2C9L Y;  5AVZ B;  1BSH A;  5AW4 B;  1LWU B;  2KNC A;  1HGZ A;  1M1J B;  4LLH A;  5KJ7 C;  2QJY C;  3L70 E;  5L8R J;  2JJL A;  1JO5 A;  2H8P D;  1LTT C;  1GL2 B;  1SQV E;  4GOE A;  3N7N A;  1KN7 A;  3L71 J;  2N1T B;  5AW1 B;  2M5A B;  1VF5 C;  2PGD A;  5AW8 B;  1DEE G;  2I1K A;  3H1K G;  5KLV G;  1DD4 A;  1U7M A;  3L75 G;  4WY4 D;  3HUS C;  1BCC J;  3RL0 D;  3AEA C;  1SQX K;  1P84 H;  3VMZ A;  1DX7 A;  1GMJ A;  2NRG A;  3L71 E;  3FXD A;  3M9H A;  1E79 H;  1JCD A;  2JO1 A;  1KB9 H;  2WPQ A;  1N7S D;  4WBA A;  5CCG A;  3Q5P A;  4I7Z B;  4PV1 B;  3P8C D;  1BCC E;  2IDB A;  3IR9 A;  2FY8 A;  1Q86 Q;  2OTL P;  3D6Y A;  3FGA D;  3GF7 A;  3USS A;  3RK3 E;  2OYI C;  3F5H A;  4OGQ C;  2JEE A;  4RES B;  1H0T A;  2YO2 A;  1NWQ A;  4JQ0 D;  3B5N D;  1PPJ D;  4ZMD A;  1IFM A;  2LXC B;  1Q90 D;  5KLI B;  2FYU D;  2LKM A;  3L73 G;  1CI6 B;  3CXH H;  4U3F D;  1KYO H;  1T3J A;  3A2A A;  1NVO A;  1UIX A;  3CXH E;  3D6Z A;  1OMI A;  1MV8 A;  1NJI Q;  1QX8 A;  1A02 F;  4NPF X;  2OQQ A;  2ZXE B;  3E1R A;  1BGY D;  1OW8 A;  3MGN A;  2HPC A;  2IZ1 A;  3H1L G;  1ZP0 C;  1KIL A;  2Z5H A;  2HR3 A;  4D6T J;  2WSC J;  3V5B A;  4Y99 B;  3V2N A;  1RF1 C;  3T97 A;  4HB1 A;  1LTI C;  3M0D A;  4Y28 J;  1SQQ G;  1S5L X;  4TT3 H;  3JC2 2;  1KV4 A;  2CK3 H;  3MUD A;  3CME P;  2E76 B;  1FDI A;  3K5B A;  4D6T E;  2YKQ A;  1S9K E;  3SSU A;  1NOH A;  3M91 A;  3PJS K;  1S72 P;  2NPS A;  1EXJ A;  2JP3 A;  5CCH A;  4AYC A;  2QSI A;  2D2C B;  2J58 A;  4EYY Q;  2W27 A;  2FXM A;  3TK1 A;  2H43 A;  4ZKP A;  1BE3 G;  4K3A A;  1X0T A;  1NU1 D;  3KQG A;  1SFC C;  2WQY C;  1ZR4 A;  5AW9 B;  2K3R A;  4LC1 A;  2WPV B;  3NTN A;  2GUS A;  3D71 A;  1SQX G;  2QJY B;  3TGU G;  2YXQ B;  3SFE C;  4ZKU A;  1YBK A;  3MHV A;  1JNM A;  1NAY A;  1QGK B;  1X22 A;  3HE4 A;  3H25 A;  2R44 A;  2L5G B;  2PAJ A;  3O6Q A;  1M1K Q;  3KYQ A;  2Z4E A;  2E43 A;  2KSE A;  1OZH A;  3HUS B;  2KZI A;  3CWB E;  4L73 A;  1FJP A;  1GTW A;  1GL2 D;  1IK7 A;  1VQP P;  2IFM A;  2H89 C;  2N1T D;  2BAS A;  2KOG A;  2KYV A;  1Q2N A;  1URQ C;  1LT9 A;  1PP9 G;  1H8A A;  4XE5 B;  3CCJ P;  2WSF H;  5APQ A;  2KIK A;  5E79 E;  1T2K C;  2J59 M;  4H44 C;  5CJ0 A;  2GUV A;  5CBN A;  2OYH A;  5AVY B;  2DW3 A;  3AE1 C;  2XZR A;  4K35 A;  2R3S A;  2OYI B;  2HFE D;  4OGQ B;  1S4X A;  3H1H J;  4BRY A;  4JYC A;  3VN0 A;  1JTH B;  1T6A A;  3OA7 A;  1GU5 A;  4I6M C;  1JOC A;  4H0L C;  2R5D A;  4PD4 I;  1R8E A;  3RK2 C;  1VPC A;  3H1J J;  2QIW A;  4L76 A;  1X79 B;  3TNU B;  3V2P A;  1R5S A;  3H1H E;  2QJP B;  1M90 Q;  3L72 J;  5KLV D;  4WY4 A;  4KHX A;  3L75 D;  1N73 C;  1RQV A;  2FYU G;  1L0N K;  4XFJ A;  2IPP A;  2K88 A;  3H1J E;  4WVZ A;  1HF9 A;  1EDK A;  1YJW P;  1PV3 A;  2WT7 A;  2XU6 A;  2P10 A;  3L72 E;  1ZN5 A;  1NTM K;  3FXE A;  1OFC X;  1RF1 B;  3C1L A;  2QJK C;  1RQU A;  2BCC J;  3CPW O;  2YKO A;  2ZJS E;  2QM7 A;  3CD6 P;  4W7Z A;  1U7J A;  3QWO C;  2Q3E A;  5TIS H;  2XKM A;  4HH2 A;  2IBZ G;  3AEB C;  5TIS E;  4U7J A;  1OVR A;  2WPR A;  2BCC E;  1K9M Q;  1EZV G;  3L71 D;  1FOS E;  3BCC J;  1LTJ A;  4UB8 H;  3GMA A;  3ITK A;  1SFC B;  3L73 D;  5CCG C;  1N86 A;  1IFI A;  3CC7 P;  4UB8 E;  3VYI A;  1BCC D;  1NTZ J;  3LIE A;  3P7K A;  2D2C D;  2C9N Y;  2HLO A;  1SQV K;  1EDJ A;  1VQL P;  3BCC E;  4OWF A;  5AW2 B;  2WSE H;  2R3C A;  3CX5 I;  4IL6 H;  1NU1 G;  2RMZ A;  3AEE C;  4WB4 A;  1NTK J;  4IL6 E;  1FZC B;  1NTZ E;  4N6J A;  1LGH B;  1SQP J;  1AA0 A;  2QVA A;  1LNQ A;  2ZVN B;  1L0L K;  1NTM J;  1BDD A;  2IZ0 A;  4AUW A;  1SQQ D;  2WPS A;  3H1I G;  4ZNC A;  1VF5 D;  1NTK E;  1N8R Q;  1FDO A;  3V2Q A;  1FZB A;  1URQ B;  1SQP E;  3CX5 D;  5CBO A;  2O1K A;  4H44 B;  3R4Y A;  1KQG B;  1NTM E;  3AEG C;  1MUU A;  3E7K A;  5H2F H;  1KIL C;  1FDM A;  1BE3 D;  1HGV A;  1W2E A;  5H2F E;  1OXZ A;  2HOD B;  2M3B A;  2C0X A;  3M0D C;  1L0N G;  4H0L B;  1SQX D;  1HJB A;  5APV A;  1DEB A;  3TGU D;  2OYO A;  3RK2 B;  1GW3 A;  2AXT H;  3U59 A;  3MUD C;  3G71 P;  4OGQ D;  3RK3 C;  1DIP A;  2Q6Q A;  3RBZ A;  3AE5 C;  1LWU A;  3BRV B;  1M1J A;  3CL3 D;  1XTC C;  2FFD A;  2NPS C;  5CCH C;  3HD7 C;  3SWK A;  2E74 C;  1SQB K;  2KUB A;  3KDP B;  4A7P A;  1N73 B;  2ZT9 C;  5GTI E;  1FOS F;  2QRX A;  1L0L J;  1OX3 A;  4R4L A;  4PD4 H;  5DJT B;  1VQK P;  4ASV A;  1KOR A;  4IFM A;  2RH0 A;  1Y9B A;  1QLE D;  4PD4 E;  2QE7 H;  3KXD A;  4HKZ H;  1PP9 D;  4QMA A;  2QJK B;  4OH8 B;  2C0W A;  4Z1M H;  3KPE A;  3L74 J;  2O3J A;  1VL2 A;  1OW7 A;  1L0L E;  1KC8 Q;  1P84 E;  1GZL A;  1KIL E;  4H13 C;  4L75 A;  2IYP A;  3L70 G;  1KB9 E;  3CLQ A;  3GG2 A;  3D70 A;  1SQV G;  3GHG C;  1IO4 A;  3L74 E;  5AVR B;  1JMB A;  2K9J A;  3BRT B;  2IYO A;  1AV1 A;  1KTM A;  1LT9 C;  3Q5S A;  2FYN B;  3II6 A;  4N78 E;  2Y0D A;  1JY2 O;  3CCE P;  2GM4 A;  3L71 G;  2B87 A;  1L4A A;  1ZME C;  2OYH C;  4WWI A;  3MTU E;  2ZYD A;  1SFC D;  2RKL A;  1SQB J;  1EDL A;  4GOD A;  3VMY A;  3W68 A;  4AQR D;  1H0T B;  2W8Z A;  2OTK E;  1BCC G;  3H1L E;  3IF4 A;  3ABV C;  3B8E B;  5GTH H;  1QEX A;  1KYO E;  1YTZ T;  2W90 A;  3CCL P;  4GIF A;  2YIU C;  5GTH E;  3CMA P;  3MZW B;  2WVR A;  1SQB E;  3AED C;  1NH4 A;  3L4F A;  4UB6 H;  2P7J A;  2JWD A;  3CX5 H;  1LTB C;  2L91 A;  2IBZ D;  4WY4 C;  1FJK A;  3L35 A;  1KFN A;  5AVS B;  2LXB A;  2OTJ P;  4RO0 A;  2FXP A;  3L37 A;  2HPC B;  1EZV D;  2M8R A;  2O01 H;  2KLU A;  2QM8 A;  1IC2 A;  1MZ9 A;  5B66 H;  5KAF H;  2WIT A;  1URQ D;  3PH0 A;  4EDF A;  1T2K D;  1MFZ A;  4H44 D;  1AFO A;  2YKP A;  3HD7 A;  4EOT A;  1HBW A;  3AE7 C;  1GK4 A;  3RK3 B;  3ZDM A;  2HYN A;  1T8Z A;  2PRR A;  3VP9 A;  3M0A A;  1RE3 C;  2BCC D;  2PP6 A;  2NPS B;  1NYH A;  1QL1 A;  4C46 A;  4H0L D;  4PJ0 H;  2E74 B;  1LTJ C;  3CWB J;  2ZT9 B;  4YPC A;  5APX A;  4OVN F;  3RK2 D;  1QVF O;  2MJZ A;  4PJ0 E;  4D6T G;  5KKZ C;  1KQL A;  1CSB A;  1PGO A;  3A3Y B;  4L74 A;  3VP8 A;  1LTG C;  3CCV P;  3H1I D;  1NGM B;  3HRN A;  1VF5 B;  3TSI A;  2K37 A;  1FU1 A;  2Q5U A;  2MKV A;  1VQM P;  2HG5 D;  2O1J A;  3V4Q A;  1FZE A;  3HE5 B;  1D7M A;  3CCR P;  3GHG A;  3HE4 B;  5APS A;  2WMM A;  3Q2Y A;  1NAF A;  2WSF J;  4H13 B;  1Q7Y Q;  1K73 Q;  3M06 A;  3CCQ P;  3P8C E;  1LP1 A;  3VMA A;  2V7Q J;  4CPG A;  2M0B A;  1IFP A;  1L0N D;  3UIA A;  4IFD K;  4EI2 A;  2AXC A;  2Y9Z A;  5B5E H;  1J1D C;  4U3F J;  2V7Q H;  1K04 A;  3LW5 J;  1LT9 B;  1S5L H;  1WRG A;  2XV5 A;  3H32 A;  2M3E A;  5B5E E;  3HTK B;  1HJ0 A;  1FE6 A;  3PP5 A;  1NTM D;  1PPJ E;  1KD1 Q;  5EFW B;  1G1I A;  1BGY J;  3LW5 H;  4C7N A;  5CCG D;  3TNU A;  3MP7 B;  4U3F E;  1NTZ K;  4BRY B;  2OAR A;  2W6B A;  2B89 A;  2QEX P;  1MKM A;  1ZV8 A;  3TDK A;  1IFJ A;  4YXD C;  3JCU H;  3Q1M A;  1BGY E;  1ZRT D;  1NTK K;  3JCU E;  1J1E C;  2R32 A;  2W6J H;  1LWU C;  5BU8 B;  1M1J C;  1SQP K;  1N7S A;  2FFD C;  4DT0 A;  3WMM 0;  3L70 D;  2E5Y A;  3VTP C;  3EFG A;  4LGD E;  1SQV D;  3Q3D A;  2A06 E;  3IN6 A;  2BEQ D;  2N1T C;  3H1H G;  1JCC A;  1HH0 A;  2I1J A;  4DOJ A;  3NMD A;  4JYB A;  2WT7 B;  3C8V A;  3C9I A;  2WWW A;  1JEK A;  4BXL A;  3GLM A;  3Q5R A;  1RE3 A;  3PLN A;  3B5N A;  3H1J G;  5K5G B;  1QVG O;  2RN0 A;  1EDI A;  1L0L D;  1P84 D;  1KMI Z;  1KIL D;  1FAV A;  3OAK A;  1JB0 J;  3SWF A;  4PV1 C;  2BEZ F;  3L72 G;  1G2C A;  1KB9 D;  3I56 P;  2WSE J;  2ZFC A;  1FZA A;  1QL2 A;  1DH3 A;  1FC2 C;  2P1J A;  2FXO A;  2W83 C;  3CC2 P;  3A0H H;  1LTJ B;  1NHL A;  2ZVO B;  5KKZ B;  3AE9 C;  3A0H E;  3RK3 D;  2CPS A;  4ASW A;  1YQ4 C;  3RGU A;  2KS1 B;  2POH A;  2BCC G;  1UII A;  2NPS D;  5KJ7 D;  2E74 D;  3IAO A;  2ZT9 D;  1L4A C;  1E5W A;  1YYC A;  3U1C A;  4YXW H;  3PRJ A;  3CXH D;  3AE8 C;  2A45 G;  1KYO D;  3BCC G;  3SFD C;  1SQB D;  3MD0 A;  4DCK A;  3U1A A;  2KP8 A;  5BVZ A;  4H13 D;  1NTZ G;  1RE4 A;  1J1D B;  3L36 A;  2K1A A;  2XND H;  3GF3 A;  1Z56 A;  4KT0 J;  1KZU B;  2JR8 A;  1KQS O;  3SWY A;  3H1K J;  5KLV J;  4RJT A;  2ZAE B;  5KAI H;  3L75 J;  1VDF A;  1NTK G;  1WT6 A;  3FWL A;  1RHZ B;  1CZQ A;  2WZ7 A;  2E76 C;  3TF5 A;  5KAI E;  4D6T D;  3S1K A;  1S9K D;  1SQP G;  5APW A;  2V4H A;  2AXT E;  1JY2 N;  1NTM G;  2D2C C;  3KZI H;  3H1K E;  5KLV E;  2Z5I A;  1W2B O;  1SVF A;  4B86 A;  4R4M A;  1OIP A;  3L75 E;  4IOI H;  1GL2 A;  1USD A;  3KZI E;  1S1C X;  3FWN A;  1GDT A;  1PL5 A;  1BSN A;  1J1E B;  1PGP A;  2N1T A;  3CCM P;  2O01 N;  2M5A A; 
#chains in the Genus database with same CATH homology
 5B66 E;  4UB8 E;  5KAF E;  1W5C E;  5TIS E;  4IL6 E;  3A0B E;  5GTI E;  3WU2 E;  3JCU E;  5KAI E;  3KZI E;  4PJ0 E;  5H2F E;  5B5E E;  5E79 E;  4UB6 E;  2AXT E;  3A0H E;  5GTH E;  1S5L E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...