2Q9IA

Crystal structure of d-dimer from human fibrin complexed with met-his-arg-pro-tyr-amide.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
67
structure length
67
Chain Sequence
b'VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrinogen alpha chain
publication title Probing the beta-chain hole of fibrinogen with synthetic peptides that differ at their amino termini
pubmed doi rcsb
molecule tags Blood clotting
total genus 23
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2q9iA00
1FZGA 1T3UA 1LWUB 2HPCA 1JY2N 2Q9IA 1RE3A 3H32A 2FFDB 1RF0A 1LWUA 1FZFA 2OYIC 3E1IA 3GHGB 1JY2P 1FZBA 1W2EA 2FFDA 1LT9C 1N73C 3GHGA 1RF1C 3HUSC 2OYIB 2OYHC 1JY3O 2XNXA 3BVHA 1FZEA 2Z4EA 1FZCC 1RE4C 2OYIA 1LTJC 2OYHB 1LT9B 1N73B 1M1JC 1RF1B 3HUSB 2A45I 1N86A 1JY2O 1LT9A 2H43A 1N73A 1FZAA 1RF1A 3HUSA 2OYHA 1LTJB 1RE3C 1JY3N 1FZCB 1RF0C 1LWUC 2A45H 2HODB 2A45G 1M1JB 2HPCB 1FZCA 2FFDC 1JY3P 1RE4A 2HODA 1LTJA 2HLOA 3GHGC 3H32B 1M1JA
chains in the Genus database with same CATH superfamily
1R8EA 3TGUD 4Y99C 1P84H 2ZYDA 1JY2P 3L71G 1LTBC 1SQBK 5CCGA 3H25A 1GU5A 2C0XA 1Q86Q 3NFQA 1JY3P 1NO4A 3EFFK 2W83C 3UIAA 1NAYA 4BXLA 3CCMP 4ZKUA 1N7SD 1BCCJ 2M3EA 2P67A 4H44B 1FZAA 1DD3A 1ZRTE 5H2FH 2M8RA 1EZVE 2NPSA 3OAKA 5BU5A 2WSCJ 3ZDMA 3A0HE 5CHXA 3L75J 1J1DC 5CCHD 1KQSO 1CSBA 3MTUE 4EOTA 3PH0A 4TLFA 4PD4D 2WTYA 1ZXGA 3A0BH 1LTIC 4JF7A 4H0LB 2LKMA 2OTLP 2QJYB 1FS0E 3C8VA 4JQ0D 3CD6P 3TNUB 5B66H 2P58A 5APXA 3T97A 2O01N 3EWKA 3AE2C 1HGVA 2KZJA 2WPSA 2YMKA 2QSIA 1QVGO 1IO4A 1URQB 3VMAA 5KTBA 2WSFJ 3V2QA 1EDIA 1KQFB 2D2CC 5AW3B 4OH8B 1L0LD 1BGYD 3VYIA 3MHVA 2OQQA 2W90A 3AEDC 2FYUD 1USDA 2KB7P 1M1KQ 2KS1A 2ZVNB 3E1RA 2XKMA 1FOSE 1CZQA 3HRNA 1KYOE 1PPJE 4BRYA 1X8YA 2YIUB 2V7QJ 1BGYG 3VOPA 2E75B 1ZN5A 3RL0B 1R5LA 1CW5A 5EFWB 2FYUG 1W2BO 2ZYAA 1WRGA 3CWBD 1VQLP 3G71P 4UB8E 1T2KD 1K9MQ 1N7SA 3WUUA 2A06E 3H1KJ 1PIXA 5CJ0A 2HLOA 4H13C 1QX8A 1RQUA 3CWBG 1S4XA 3N4XA 1VF5C 3GW6A 2OTJP 5TISE 3G9RA 1FZCC 5CCHA 5APSA 1LT9B 1QL2A 3M91A 1PFIA 2RMZA 3CCLP 1K73Q 1KYOH 3OJAB 3FX0A 2H8PD 4R4LA 1T3JA 1S9KE 2BCCJ 2Q6QA 4IL6X 2HFED 5DJUB 4C46A 3H6PA 1LTTC 1N73B 4UB6E 3AE9C 1N8RQ 1GL2B 1BDCA 1M8OB 1RY3A 3CX5H 2IFMA 1ZP0C 2FFDB 3WUTA 2KSJA 5APTA 1MFZA 1IFMA 2H43A 5TISH 4XA4A 1GU4A 3TF5A 2WSFH 1RH5B 2ZYGA 5DJTB 5AVUB 3V4WA 1W2EA 1EDKA 1SQQJ 3R4YA 2JP3A 1IK9A 3CCJP 3H1JD 3L37A 3BCCD 1S5LE 1NJIQ 2E76D 3KXDA 1G2CB 2V7QH 2BCCE 2ZT9B 3VN0A 2AXCA 3HD7D 4WBAA 3JCUH 3V2RA 1OVUA 3H1JG 3CXHE 3BCCG 4PD4I 2B87B 2IZ0A 2KOGA 1VQ7P 1USEA 2D2CD 1FAVA 3AEBC 4N6JA 1Y9BA 1PZQA 2ZXEB 1PP9J 1JMMA 3I5CA 1L0ND 1RF1B 1JY2O 3TGUJ 3L74E 3G3ZA 5L8RJ 1K05A 4YXDC 1NTZE 1Q81Q 5KJ7A 3S4RA 1M1JA 2OGUA 1EDJA 1L4AB 1M7LA 1G2CA 1KN7A 1DIPA 1SQQE 5AW7B 1L0NG 3D71A 4H44C 1DX7A 1HJBA 2M0BA 2B87A 1BE3G 1S1CX 3V5BA 1R5SA 3NXSA 1VF5D 1FDOA 1W5CE 1VQ8P 2O1KA 3M0DA 2K9YA 1VDFA 4IOIH 4H0LC 1NTMK 1NTZK 2G8YA 2QJYC 1PP9E 1PGJA 2R5BA 2WPRA 2QIWA 4BWNA 4DT0A 1YBKA 3U59A 2YXQB 2J5UA 4HB1A 1SQQK 4L76A 2FBWC 2E74D 4WY4D 1LWUB 1LJ2A 1FJKA 3M0AA 1URQC 3B71A 4I6MC 4LGDE 1FOSF 3AE6C 2OYHC 3HE5A 5AW8B 3P8MC 3HD7A 1VQOP 3I56P 3AECC 1NKNA 3L72J 1QGKB 3AE1C 2OYIC 2IYOA 4O9BA 1FJPA 4OGQB 2AEJA 3A5TA 4ASWA 2YIUC 2XZRA 4W7ZA 1L0LJ 2YO3A 1LTJC 4PV1D 2E75C 4D6TD 4Y28J 1GDTA 1SQXD 3RL0C 3SWKA 1A02F 5CMZA 4AUWA 4JYCA 4ZNCA 1YJWP 5B5EE 5AVXB 4D6TG 4KT0J 2JR8A 3Q2YA 1NU1D 1H0TB 2Y9ZA 3BRTB 5GTHH 1L2PA 2WWWA 4U7JA 1ZV8A 2R44A 4JBZA 2K9JA 1NTMD 1LT9C 2YKQA 1NU1G 1DEEG 3S1KA 1VQNP 4K3AA 3RGUA 3L74G 3CCUP 2E5YA 1KB9D 3L72E 1NTMG 1JM0A 1KILD 1N73C 2XV5A 1WT6A 1GL2C 3H1IE 4A7PA 1YQ4C 5H2FE 3CX5I 4PD4H 2NPSB 3GMAA 2FFDC 1SQPJ 3AE7C 3L70J 4WY4A 2QJKB 1OW6A 3ABVC 4LC1A 3WU2E 2B88A 3AE8C 3VTPC 2L5GB 1EQ7A 1SFCC 3HUSA 1IFIA 1X22A 1S2EA 4I2LC 3RK3E 1NHLA 4ASVA 2WT7A 3A0BE 3VP9A 3B8EB 5KAFH 3BATA 1JTHA 3D70A 1PL5A 3IAOA 1AV1A 4N78E 4RKUJ 1DH3A 5B66E 1VQKP 1X9VA 3RK2B 2IFNA 3T97B 2A45G 2ZT9C 4C7RA 2N1TD 1RF0A 3A3YB 3C9IA 3BCCJ 1AA0A 4JYBA 2KIKA 2BEZF 1Q7YQ 1FZEA 1Q82Q 1BSHA 3WU2H 2JDIH 2WZ7A 1GZLA 5TJHA 3HE4A 3M9QA 1SQPE 4KJMA 3L70E 3Q5PA 2PGDA 3HTKB 2KS1B 4HKZH 1KFNA 4RO0A 1RF1C 1JB0J 2O01J 1OIPA 1UIXA 2XNXA 4EI2A 4BRYB 3P8CD 3V4QA 1L4AC 4I7ZC 2W6BA 1J1EB 1VQ9P 1M56D 2KK7A 3AE5C 2AXTH 5AW5B 3MUDA 3II6A 1P84D 1SQBD 1KILA 2LXBA 1N7SB 1H8AA 5AW4B 1FDMA 1BCCE 4EYYQ 5GTIH 3CCEP 1WMKA 1H88A 1QL1A 3O6QA 3LW5H 1HGZA 3H1LG 1NTKJ 1VQPP 1SQBG 1SQPK 3HTKA 3L75E 3K5BA 1OVVA 4N3YB 3S9OA 3Q1MA 3M9BA 3KPEA 2KYVA 4PJ0E 1KFMA 3VMYA 2I1JA 4DZOA 1VQ6P 1JY2N 4DOJA 3AE3C 1JEKA 3B5NC 5C39A 3QH9A 3R2PA 1OWAA 2LR2A 3CX5E 1MV8A 4HH2A 3H1IG 3RL0g 1LWUC 1NKZB 2QA4P 4IFFA 1NGMB 5AW0B 1RE3A 3F89A 2N1TA 4U3FJ 3SWFA 3L73J 3W68A 2IBZI 1N7LA 3IF4A 1GMJA 3KHUA 2IYPA 1FC2C 2BASA 1S5LX 2JEEA 1SFCD 3EFGA 4OGQC 2N9BA 2KNCA 4PJ0H 1NTKE 1IFDA 3EQ2A 1JCCA 1ZRTD 1EZVD 4EDFA 2Y9YA 1HTLC 4I1LA 3O8ZA 5AVWB 2O01H 2OYOA 3U1CA 1SQVJ 4XFJA 1MKMA 4GT1A 1KV4A 1IC2A 3JCUE 1EZVG 1SQXJ 3RK3B 1OW8A 1GW3A 5KLVJ 2JWDA 2A45I 3GG2A 2OTKE 3H1KE 1RE4A 5CCGC 2MKVA 1FZGA 3H1HJ 2FXOA 1HBWA 4U3FE 4Y99B 1S72P 3L73E 2NZ2A 3LIEA 1NTKK 5KAIH 1FBMA 2AEMA 4MN4C 2R5DA 2YMYA 1M1JB 3CLQA 2Q3EA 3PLNA 4K35A 1KZUB 3MD0A 1EXJA 5AW9B 2NPSC 4YXWH 1SQVE 1G1IA 3L35A 1NYHA 1BCCG 1IZNB 1VL2A 3CL3D 1D7MA 1KYOD 1PPJD 3L71J 4IL6E 3TDKA 3AEGC 3GHGA 5KLVE 3L75G 4GDOA 3ITKA 1NAFA 3D6ZA 3TYYA 1PPJG 3FXDA 1K8AQ 3H1HE 1BE3D 2A06D 1MUUA 1JY3O 3GF3A 1BDDA 1JUNA 3RK2C 3B5ND 1JOCA 2YNYA 2WITA 1LT1A 2E76B 1MFTA 2HPCB 2A06G 1SQVK 4H13D 3HE5B 4IL6H 1NOHA 1KORA 3HD7B 2IBZE 1S9KD 4TT3H 2ZFCA 3BASA 1VQ5P 3A2AA 3CC2P 5KLVK 2C9NY 3V2NA 3L71E 1RQVA 3NMDA 1KC8Q 2D2CB 3CC7P 5KLIB 2CPBA 2KLVA 3CCVP 1GW4A 2JJLA 2Y0EA 3I55P 5CBOA 1J1EC 1PGPA 4L75A 4GOFA 3TGUE 1BSNA 2QJPB 4IFDK 2KP8A 2JO1A 2R3SA 2HPCA 1N7SC 5GTHE 2KZIA 2WQYC 3AEEC 3L4FA 1KB9H 2K9JB 3A7OA 5AVTB 2FXPA 2W6JH 5CCHC 3W67A 1ZR4A 3SSUA 2I8DA 3MGNA 3TK1A 2BCCD 5APUA 4DJGA 2XNDH 1BGYJ 1VF5B 2FYUJ 3CXHD 3PJSK 4HJGH 2P10A 5CBNA 2VRSA 1LP1B 5K5GB 4HYTB 5CJ4A 3D6YA 2BCCG 1OW7A 1AVYA 2Z4EA 3AEAC 1EC5A 2E5TA 4PD4E 2V4HA 2E74B 2A45H 2KI7B 3CWBJ 4WY4B 1Q90D 3CCSP 2KUBA 3CPWO 3WMM0 1SS1A 1ZMEC 3L74D 4OVNF 2Z5HA 1NTZD 1HWTC 2L91A 3AEFC 1K04A 3M9HA 4JPZB 3HUSB 1SQQD 2FYZA 3KYQA 2WT7B 4GIFA 4NPFX 1FZCA 2WPQA 2XDJA 3RBXA 2JWAA 1E79H 5KAFE 1IFPA 1NTZG 1JTHB 2OARA 1E5WA 1HF9A 3RBZA 1SLQA 1LP1A 2M5AA 1L0LE 1BGYE 1SQQG 4PV1B 1YJ9P 4H44D 1VQMP 2FYUE 3LW5J 2XU6A 4C7NB 1PGOA 3H32B 3IN6A 2LXCB 1VPCA 1OXZA 2W8ZA 3RK3C 2KSEA 1U7MA 1Y8AA 2ZVOB 2KXPB 3VP8A 4GODA 2ZXXA 2N9YB 3HE4B 1PP9D 3CWBE 3OA7A 2O1JA 2FXMA 3Q3DA 2Q5UA 4WWIA 1SP4A 3LIDA 2CPSA 1OZHA 2G3AA 4H0LD 5APWA 3KZIH 3WUVA 1ZR2A 5KJ7C 1PP9G 1M1JC 1N86A 2AXTE 1L0LK 3TGUG 3E1IA 4C7NA 3H32A 2FYUK 2IZ1A 1FZBA 1CI6A 3H1JJ 3CCRP 1KILB 1FDIA 1JCDA 1XTGB 5AVSB 1S3JA 5GTIE 1URQD 1HJ0A 1YQ3C 1IFNA 2FKWB 3JC22 3O6QB 3SFEC 2HODA 2PFXA 5AVQB 2UWJE 1QLED 2B9BA 4Z1MH 3USSA 3CMAP 4KHXA 2R32A 1AQTA 1XTCC 3M0DC 1JNMA 1M90Q 3FXEA 2E75D 3BRVB 2QM8A 3RL0D 2ZAEB 1L0NJ 3PRJA 2Y0DA 3H1LD 1ZOYC 1DEBA 2E76C 1BE3J 3PTZA 5KKZB 3PHLA 2K3RA 1EDLA 1Q2NA 5AVRB 2ZJSE 1A02J 2W27A 3HD7C 2WVRA 2N1TB 3JSVC 1VQ4P 2HYNA 3H1JE 2POHA 2WSEH 3BCCE 1U57A 2O3JA 3A0HH 4NPDA 3L72D 2OYHB 3CXHI 1H89A 4WB4A 5KLIC 3H1ID 2P1JA 1M57D 3CCQP 2KNCB 1EXIA 3CC4P 1YIJP 3L72G 1GK4A 2OYIB 2GM4A 1KD1Q 2E43A 2QJPC 4R4MA 1GL2D 1LTJB 4WVZA 1JY3N 1L0LG 5AW2B 4CPGA 2RKLA 3GF7A 4IFMA 3TNUA 1YYCA 1HUCA 2IDBA 1L0NE 3RK3D 2K37A 2SPZA 1GD2E 1HH0A 1BE3E 1URQA 3FWLA 4YPCA 1KB9I 2OYHA 2NRGA 1RHZB 2H88C 4N78D 4DCKA 1MZ9A 4NPEA 1IFJA 4RJTA 2Z5IA 5BU8B 2WSCH 3CI9A 4QMAA 5KAIE 2OYIA 1ZW0A 1JMBA 2IX7C 5KJ7D 3VMZA 2C0WA 3MZWB 1LTJA 2FYNB 3IFMA 2ZT9D 2RH0A 2PP6A 4LLHA 4D6TJ 2YKPA 1SQPD 3L70D 1L0NK 1NVOA 2E74C 4WY4C 2K88A 4UB8H 5E79E 1JO5A 1FE6A 3FGAD 1SQPG 3GLMA 5APQA 1NU1J 3GHGB 3E7KA 3L70G 3HUSC 2HG5D 3P32A 1GK6A 1T6AA 2FY8A 2WSSH 1LTSC 1LNQA 1X0TA 1LT9A 3L74J 1YI2P 1NTMJ 3KDPB 1NTZJ 1SVFA 1LTGC 1SFCB 2GUSA 1BCCD 3Q5RA 1L4AD 2QM7A 4PV1C 1YHQP 1Z56A 2GUVA 2IPPA 3B4SA 2B89A 3L75D 1N73A 3IR9A 2JKVA 1RF0C 1GTWA 5AVVB 1GL2A 2QJKC 2DW3A 2J58A 4UB6H 1YTZI 4YTPC 5E79H 1KTMA 2PRRA 4D6TE 1SQXE 3FWNA 2FFDA 2QG4A 5APYA 3CMEP 2P7JA 1J1DB 1FU1A 5AVZB 5M1BA 2H7HA 1P84I 3CX5D 4GKGA 3QWOC 1OVRA 1SFCA 1NU1E 3SWYA 1PGQA 5APVA 1J2JB 1OFCX 3AE4C 1G1JA 1NTME 3MUDC 2WPVB 1S5LH 4I7ZB 1KILC 2YO2A 3L36A 1NTKD 1NWQA 1KB9E 1SQXK 4ZKPA 5BVZA 2BEQD 3CXHH 4W7YA 1KILE 2HR3A 4OWFA 3V6IA 3VMXA 2GA1A 2MJZA 1QVFO 3OW2O 4B86A 4OGQD 2YKOA 1KMIZ 1NTKG 4ZMDA 3BVHA 1NU1K 1RF1A 1AFOA 3MP7B 1YITP 3V2PA 3NTNA 4EIJA 2W6AA 1L4AA 1U7JA 2KLUA 3H1KD 3SFDC 1QEXA 5KKZC 2CK3H 3B5NB 4U3FD 2I1KA 1RE3C 3H1LJ 3L73D 2N1TC 2Q3IA 1SQBJ 1YTZT 2Q7CA 1EZVI 3H1KG 1IJDB 2ITAA 2E42A 5CCGD 1KQGB 4H13B 1N2DC 2QE7H 1KQLA 3G6EP 1IK7A 4U3FG 4AQRD 2Y0CA 3L73G 1FZCB 3N7NA 2R3CA 1DD4A 3G4SP 1AJYA 1SQVD 4GOEA 1AQ5A 2K1AA 2QEXP 3P7KA 2M5AB 3H1IJ 5AVYB 2J59M 3B5NA 2NPSD 1TU3F 5KLVD 2Q1KA 1SQVG 4RESB 1PV3A 4W80A 3U1AA 3P8CE 1FZFA 1LWUA 5AW1B 2C9LY 1LGHB 3H1HD 2QRXA 1SQXG 1RE4C 2H89C 4L73A 5KLVG 3H1LE 3M06A 1NH4A 1P84E 1SQBE 1UIIA 1LTAC 3MIWA 4L74A 1OX3A 1ZLLA 3KZIE 2M3BA 3H1HG 4XE5B 3C1LA 3TSIA 5AW6B 4AYCA 2FYNC 1KYOI 1OMIA 3RK2D 3PP5A 2IBZD 2RN0A 2PAJA 1T3UA 3F5HA 2Q9IA 2WSEJ 1Y47A 1CI6B 2AEFA 1T2KC 3L71D 2P2UA 4M3LA 1T8ZA 1AVOA 5B5EH 1YJNP 1X79B 2IBZG 1H0TA 3KQGA 3Q5SA 2HODB 2WMMA 1HVVA 2QVAA 2YXRB 3GHGC
chains in the Genus database with same CATH topology
1LWUB 1KZUB 1FJKA 3M0AA 4Y99C 1URQC 3MD0A 1JY2P 1LTBC 4I6MC 4LGDE 1GK4A 1SQBK 5CCGA 2OYIB 1FOSF 2OYHC 2GM4A 3HE5A 5AW8B 3P8MC 5AW9B 2E43A 3HD7A 2NPSC 1GU5A 2C0XA 1GL2D 1LTJB 1G1IA 1JY3N 3L35A 3NFQA 5AW2B 4IFMA 1JY3P 3TNUA 3CL3D 1YYCA 1NKNA 1HUCA 1NO4A 2OYIC 4O9BA 3UIAA 1FJPA 3RK3D 3A5TA 3GHGA 2XZRA 1N7SD 4W7ZA 4ZKUA 1GD2E 1HH0A 2YO3A 1LTJC 2P67A 1URQA 1GDTA 3RL0C 1NAFA 1FZAA 3TYYA 2OYHA 1A02F 2M8RA 4N78D 2NPSA 3OAKA 5BU5A 5CMZA 4AUWA 4JYCA 5CHXA 1MZ9A 1IFJA 2Z5IA 5BU8B 1J1DC 2WSCH 3CI9A 1MUUA 1JY3O 5CCHD 5AVXB 1JUNA 3RK2C 3B5ND 2OYIA 1CSBA 1JOCA 2IX7C 2YNYA 3MTUE 4EOTA 3BRTB 2WITA 5KJ7D 3VMZA 2C0WA 2WWWA 2HPCB 1LTJA 1ZV8A 3IFMA 2WTYA 1SQVK 2PP6A 4LLHA 2YKPA 3HE5B 1LT9C 1NOHA 2YKQA 3HD7B 1LTIC 4JF7A 2LKMA 1L0NK 1S9KD 2ZFCA 4WY4C 3BASA 1JO5A 3A2AA 3TNUB 5KLVK 2C9NY 3V2NA 5APXA 3T97A 3NMDA 5APQA 3GHGB 2CPBA 1HGVA 1KILD 2KLVA 2WPSA 1N73C 3HUSC 2XV5A 1WT6A 2HG5D 1IO4A 1GL2C 3P32A 1GW4A 1URQB 1GK6A 2JJLA 1J1EC 1LTSC 5KTBA 1LT9A 3V2QA 3KDPB 2NPSB 2FFDC 4IFDK 4OH8B 1SVFA 2KP8A 1LTGC 1SFCB 2GUSA 5AW3B 4WY4A 1L4AD 3VYIA 2HPCA 2QM7A 2KB7P 1N7SC 4LC1A 3VTPC 1Z56A 2GUVA 2XKMA 1FOSE 1CZQA 2L5GB 3HRNA 2IPPA 1X8YA 1N73A 3L4FA 1EQ7A 1SFCC 3HUSA 3IR9A 1IFIA 1RF0C 1GTWA 5AVVB 1GL2A 3VOPA 4I2LC 2J58A 1NHLA 1ZN5A 1YTZI 3RL0B 2WT7A 1CW5A 3A7OA 5AVTB 5CCHC 1WRGA 3VP9A 1ZR4A 3B8EB 2FFDA 3BATA 1JTHA 5APYA 3MGNA 3TK1A 5APUA 2P7JA 4N78E 1T2KD 1J1DB 1DH3A 1N7SA 1FU1A 5AVZB 1X9VA 3RK2B 2IFNA 2A45G 5CJ0A 2H7HA 2HLOA 4GKGA 4C7RA 1SFCA 2N1TD 1RF0A 2VRSA 3A3YB 3C9IA 4HYTB 4JYBA 5CJ4A 3N4XA 3SWYA 1FZEA 5APVA 1J2JB 2Z4EA 1FZCC 5CCHA 5APSA 1LT9B 1QL2A 3M91A 1PFIA 1G1JA 2WZ7A 1GZLA 2A45H 3HE4A 3M9QA 4WY4B 3OJAB 2H8PD 1T3JA 3WMM0 1KILC 1S9KE 3HTKB 2HFED 2Z5HA 4C46A 1KFNA 1RF1C 1HWTC 2XNXA 3H6PA 2YO2A 3L36A 1LTTC 3P8CD 1NWQA 3M9HA 1N73B 3HUSB 1SQXK 3V4QA 2FYZA 1GL2B 4ZKPA 3KYQA 5BVZA 1L4AC 1RY3A 2W6BA 4W7YA 2WT7B 1J1EB 4GIFA 1FZCA 2WPQA 2XDJA 3VMXA 2IFMA 2MJZA 2FFDB 1JTHB 5AW5B 3MUDA 2OARA 1E5WA 4B86A 3II6A 2YKOA 1SLQA 2KSJA 3BVHA 5APTA 1KILA 1N7SB 1H8AA 5AW4B 1FDMA 1NU1K 1MFZA 1IFMA 2H43A 1H88A 1RF1A 1AFOA 1QL1A 4XA4A 2XU6A 4C7NB 1GU4A 3V2PA 2WSFH 3H32B 3NTNA 4EIJA 3LW5H 1HGZA 1VPCA 1OXZA 2W6AA 3RK3C 5AVUB 1L4AA 3V4WA 1SQPK 3HTKA 1W2EA 3VP8A 1IK9A 4N3YB 3B5NB 3L37A 3HE4B 3M9BA 2I1KA 1RE3C 3KPEA 2KYVA 3OA7A 1G2CB 2O1JA 1KFMA 2FXMA 2N1TC 2I1JA 3VMYA 4DZOA 2Q3IA 1YTZT 2Q7CA 1JY2N 2Q5UA 1IJDB 2E42A 4DOJA 5CCGD 3VN0A 1N2DC 1SP4A 3LIDA 2CPSA 3B5NC 3HD7D 4WBAA 5APWA 1KQLA 3R2PA 1OWAA 3V2RA 1ZR2A 4AQRD 5KJ7C 1M1JC 1MV8A 1N86A 4HH2A 1FZCB 1LWUC 1NKZB 3N7NA 2R3CA 4IFFA 1L0LK 2KOGA 3E1IA 4C7NA 1FAVA 5AW0B 1RE3A 2FYUK 3H32A 1AQ5A 4N6JA 1FZBA 1CI6A 2N1TA 2ZXEB 1KILB 3P7KA 1JMMA 1JCDA 1XTGB 3I5CA 3SWFA 5AVSB 1URQD 2FKWB 1IFNA 1N7LA 5AVYB 1RF1B 2J59M 1JY2O 3B5NA 3G3ZA 2BASA 2JEEA 2NPSD 1SFCD 2HODA 5KJ7A 1M1JA 1L4AB 1M7LA 3EFGA 1G2CA 2N9BA 4RESB 4W80A 5AVQB 3U1AA 1IFDA 3P8CE 1FZFA 1LWUA 5AW1B 3EQ2A 2C9LY 1JCCA 1LGHB 4KHXA 5AW7B 2R32A 1XTCC 1HTLC 4I1LA 1RE4C 3O8ZA 5AVWB 3M0DC 2O01H 1JNMA 1DX7A 1HJBA 3U1CA 3M06A 3BRVB 1NH4A 2QM8A 3RL0D 4GT1A 1LTAC 1IC2A 3MIWA 1ZLLA 2M3BA 3V5BA 3RK3B 4XE5B 3TSIA 1GW3A 3NXSA 5AW6B 1DEBA 2A45I 4AYCA 3RK2D 3PP5A 2O1KA 1RE4A 5CCGC 3M0DA 5AVRB 1A02J 2PAJA 1T3UA 1FZGA 2Q9IA 1VDFA 2W27A 3HD7C 1HBWA 1CI6B 2N1TB 1NTMK 2HYNA 1NTZK 2POHA 2WSEH 2R5BA 2WPRA 4Y99B 1T2KC 2P2UA 4M3LA 3U59A 3LIEA 1NTKK 1T8ZA 2OYHB 1X79B 1FBMA 1SQQK 1H89A 3KQGA 2R5DA 2HODB 4WB4A 2YMYA 1M1JB 4WY4D 1HVVA 2P1JA 3CLQA 3GHGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZG A;  1T3U A;  1LWU B;  2HPC A;  1JY2 N;  2Q9I A;  1RE3 A;  3H32 A;  2FFD B;  1RF0 A;  1LWU A;  1FZF A;  2OYI C;  3E1I A;  3GHG B;  1JY2 P;  1FZB A;  1W2E A;  2FFD A;  1LT9 C;  1N73 C;  3GHG A;  1RF1 C;  3HUS C;  2OYI B;  2OYH C;  1JY3 O;  2XNX A;  3BVH A;  1FZE A;  2Z4E A;  1FZC C;  1RE4 C;  2OYI A;  1LTJ C;  2OYH B;  1LT9 B;  1N73 B;  1M1J C;  1RF1 B;  3HUS B;  2A45 I;  1N86 A;  1JY2 O;  1LT9 A;  2H43 A;  1N73 A;  1FZA A;  1RF1 A;  3HUS A;  2OYH A;  1LTJ B;  1RE3 C;  1JY3 N;  1FZC B;  1RF0 C;  1LWU C;  2A45 H;  2HOD B;  2A45 G;  1M1J B;  2HPC B;  1FZC A;  2FFD C;  1JY3 P;  1RE4 A;  2HOD A;  1LTJ A;  2HLO A;  3GHG C;  3H32 B;  1M1J A; 
#chains in the Genus database with same CATH topology
 1R8E A;  3TGU D;  4Y99 C;  1P84 H;  2ZYD A;  1JY2 P;  3L71 G;  1LTB C;  1SQB K;  5CCG A;  3H25 A;  1GU5 A;  2C0X A;  1Q86 Q;  3NFQ A;  1JY3 P;  1NO4 A;  3EFF K;  2W83 C;  3UIA A;  1NAY A;  4BXL A;  3CCM P;  4ZKU A;  1N7S D;  1BCC J;  2M3E A;  2P67 A;  4H44 B;  1FZA A;  1DD3 A;  1ZRT E;  5H2F H;  2M8R A;  1EZV E;  2NPS A;  3OAK A;  5BU5 A;  2WSC J;  3ZDM A;  3A0H E;  5CHX A;  3L75 J;  1J1D C;  5CCH D;  1KQS O;  1CSB A;  3MTU E;  4EOT A;  3PH0 A;  4TLF A;  4PD4 D;  2WTY A;  1ZXG A;  3A0B H;  1LTI C;  4JF7 A;  4H0L B;  2LKM A;  2OTL P;  2QJY B;  1FS0 E;  3C8V A;  4JQ0 D;  3CD6 P;  3TNU B;  5B66 H;  2P58 A;  5APX A;  3T97 A;  2O01 N;  3EWK A;  3AE2 C;  1HGV A;  2KZJ A;  2WPS A;  2YMK A;  2QSI A;  1QVG O;  1IO4 A;  1URQ B;  3VMA A;  5KTB A;  2WSF J;  3V2Q A;  1EDI A;  1KQF B;  2D2C C;  5AW3 B;  4OH8 B;  1L0L D;  1BGY D;  3VYI A;  3MHV A;  2OQQ A;  2W90 A;  3AED C;  2FYU D;  1USD A;  2KB7 P;  1M1K Q;  2KS1 A;  2ZVN B;  3E1R A;  2XKM A;  1FOS E;  1CZQ A;  3HRN A;  1KYO E;  1PPJ E;  4BRY A;  1X8Y A;  2YIU B;  2V7Q J;  1BGY G;  3VOP A;  2E75 B;  1ZN5 A;  3RL0 B;  1R5L A;  1CW5 A;  5EFW B;  2FYU G;  1W2B O;  2ZYA A;  1WRG A;  3CWB D;  1VQL P;  3G71 P;  4UB8 E;  1T2K D;  1K9M Q;  1N7S A;  3WUU A;  2A06 E;  3H1K J;  1PIX A;  5CJ0 A;  2HLO A;  4H13 C;  1QX8 A;  1RQU A;  3CWB G;  1S4X A;  3N4X A;  1VF5 C;  3GW6 A;  2OTJ P;  5TIS E;  3G9R A;  1FZC C;  5CCH A;  5APS A;  1LT9 B;  1QL2 A;  3M91 A;  1PFI A;  2RMZ A;  3CCL P;  1K73 Q;  1KYO H;  3OJA B;  3FX0 A;  2H8P D;  4R4L A;  1T3J A;  1S9K E;  2BCC J;  2Q6Q A;  4IL6 X;  2HFE D;  5DJU B;  4C46 A;  3H6P A;  1LTT C;  1N73 B;  4UB6 E;  3AE9 C;  1N8R Q;  1GL2 B;  1BDC A;  1M8O B;  1RY3 A;  3CX5 H;  2IFM A;  1ZP0 C;  2FFD B;  3WUT A;  2KSJ A;  5APT A;  1MFZ A;  1IFM A;  2H43 A;  5TIS H;  4XA4 A;  1GU4 A;  3TF5 A;  2WSF H;  1RH5 B;  2ZYG A;  5DJT B;  5AVU B;  3V4W A;  1W2E A;  1EDK A;  1SQQ J;  3R4Y A;  2JP3 A;  1IK9 A;  3CCJ P;  3H1J D;  3L37 A;  3BCC D;  1S5L E;  1NJI Q;  2E76 D;  3KXD A;  1G2C B;  2V7Q H;  2BCC E;  2ZT9 B;  3VN0 A;  2AXC A;  3HD7 D;  4WBA A;  3JCU H;  3V2R A;  1OVU A;  3H1J G;  3CXH E;  3BCC G;  4PD4 I;  2B87 B;  2IZ0 A;  2KOG A;  1VQ7 P;  1USE A;  2D2C D;  1FAV A;  3AEB C;  4N6J A;  1Y9B A;  1PZQ A;  2ZXE B;  1PP9 J;  1JMM A;  3I5C A;  1L0N D;  1RF1 B;  1JY2 O;  3TGU J;  3L74 E;  3G3Z A;  5L8R J;  1K05 A;  4YXD C;  1NTZ E;  1Q81 Q;  5KJ7 A;  3S4R A;  1M1J A;  2OGU A;  1EDJ A;  1L4A B;  1M7L A;  1G2C A;  1KN7 A;  1DIP A;  1SQQ E;  5AW7 B;  1L0N G;  3D71 A;  4H44 C;  1DX7 A;  1HJB A;  2M0B A;  2B87 A;  1BE3 G;  1S1C X;  3V5B A;  1R5S A;  3NXS A;  1VF5 D;  1FDO A;  1W5C E;  1VQ8 P;  2O1K A;  3M0D A;  2K9Y A;  1VDF A;  4IOI H;  4H0L C;  1NTM K;  1NTZ K;  2G8Y A;  2QJY C;  1PP9 E;  1PGJ A;  2R5B A;  2WPR A;  2QIW A;  4BWN A;  4DT0 A;  1YBK A;  3U59 A;  2YXQ B;  2J5U A;  4HB1 A;  1SQQ K;  4L76 A;  2FBW C;  2E74 D;  4WY4 D;  1LWU B;  1LJ2 A;  1FJK A;  3M0A A;  1URQ C;  3B71 A;  4I6M C;  4LGD E;  1FOS F;  3AE6 C;  2OYH C;  3HE5 A;  5AW8 B;  3P8M C;  3HD7 A;  1VQO P;  3I56 P;  3AEC C;  1NKN A;  3L72 J;  1QGK B;  3AE1 C;  2OYI C;  2IYO A;  4O9B A;  1FJP A;  4OGQ B;  2AEJ A;  3A5T A;  4ASW A;  2YIU C;  2XZR A;  4W7Z A;  1L0L J;  2YO3 A;  1LTJ C;  4PV1 D;  2E75 C;  4D6T D;  4Y28 J;  1GDT A;  1SQX D;  3RL0 C;  3SWK A;  1A02 F;  5CMZ A;  4AUW A;  4JYC A;  4ZNC A;  1YJW P;  5B5E E;  5AVX B;  4D6T G;  4KT0 J;  2JR8 A;  3Q2Y A;  1NU1 D;  1H0T B;  2Y9Z A;  3BRT B;  5GTH H;  1L2P A;  2WWW A;  4U7J A;  1ZV8 A;  2R44 A;  4JBZ A;  2K9J A;  1NTM D;  1LT9 C;  2YKQ A;  1NU1 G;  1DEE G;  3S1K A;  1VQN P;  4K3A A;  3RGU A;  3L74 G;  3CCU P;  2E5Y A;  1KB9 D;  3L72 E;  1NTM G;  1JM0 A;  1KIL D;  1N73 C;  2XV5 A;  1WT6 A;  1GL2 C;  3H1I E;  4A7P A;  1YQ4 C;  5H2F E;  3CX5 I;  4PD4 H;  2NPS B;  3GMA A;  2FFD C;  1SQP J;  3AE7 C;  3L70 J;  4WY4 A;  2QJK B;  1OW6 A;  3ABV C;  4LC1 A;  3WU2 E;  2B88 A;  3AE8 C;  3VTP C;  2L5G B;  1EQ7 A;  1SFC C;  3HUS A;  1IFI A;  1X22 A;  1S2E A;  4I2L C;  3RK3 E;  1NHL A;  4ASV A;  2WT7 A;  3A0B E;  3VP9 A;  3B8E B;  5KAF H;  3BAT A;  1JTH A;  3D70 A;  1PL5 A;  3IAO A;  1AV1 A;  4N78 E;  4RKU J;  1DH3 A;  5B66 E;  1VQK P;  1X9V A;  3RK2 B;  2IFN A;  3T97 B;  2A45 G;  2ZT9 C;  4C7R A;  2N1T D;  1RF0 A;  3A3Y B;  3C9I A;  3BCC J;  1AA0 A;  4JYB A;  2KIK A;  2BEZ F;  1Q7Y Q;  1FZE A;  1Q82 Q;  1BSH A;  3WU2 H;  2JDI H;  2WZ7 A;  1GZL A;  5TJH A;  3HE4 A;  3M9Q A;  1SQP E;  4KJM A;  3L70 E;  3Q5P A;  2PGD A;  3HTK B;  2KS1 B;  4HKZ H;  1KFN A;  4RO0 A;  1RF1 C;  1JB0 J;  2O01 J;  1OIP A;  1UIX A;  2XNX A;  4EI2 A;  4BRY B;  3P8C D;  3V4Q A;  1L4A C;  4I7Z C;  2W6B A;  1J1E B;  1VQ9 P;  1M56 D;  2KK7 A;  3AE5 C;  2AXT H;  5AW5 B;  3MUD A;  3II6 A;  1P84 D;  1SQB D;  1KIL A;  2LXB A;  1N7S B;  1H8A A;  5AW4 B;  1FDM A;  1BCC E;  4EYY Q;  5GTI H;  3CCE P;  1WMK A;  1H88 A;  1QL1 A;  3O6Q A;  3LW5 H;  1HGZ A;  3H1L G;  1NTK J;  1VQP P;  1SQB G;  1SQP K;  3HTK A;  3L75 E;  3K5B A;  1OVV A;  4N3Y B;  3S9O A;  3Q1M A;  3M9B A;  3KPE A;  2KYV A;  4PJ0 E;  1KFM A;  3VMY A;  2I1J A;  4DZO A;  1VQ6 P;  1JY2 N;  4DOJ A;  3AE3 C;  1JEK A;  3B5N C;  5C39 A;  3QH9 A;  3R2P A;  1OWA A;  2LR2 A;  3CX5 E;  1MV8 A;  4HH2 A;  3H1I G;  3RL0 g;  1LWU C;  1NKZ B;  2QA4 P;  4IFF A;  1NGM B;  5AW0 B;  1RE3 A;  3F89 A;  2N1T A;  4U3F J;  3SWF A;  3L73 J;  3W68 A;  2IBZ I;  1N7L A;  3IF4 A;  1GMJ A;  3KHU A;  2IYP A;  1FC2 C;  2BAS A;  1S5L X;  2JEE A;  1SFC D;  3EFG A;  4OGQ C;  2N9B A;  2KNC A;  4PJ0 H;  1NTK E;  1IFD A;  3EQ2 A;  1JCC A;  1ZRT D;  1EZV D;  4EDF A;  2Y9Y A;  1HTL C;  4I1L A;  3O8Z A;  5AVW B;  2O01 H;  2OYO A;  3U1C A;  1SQV J;  4XFJ A;  1MKM A;  4GT1 A;  1KV4 A;  1IC2 A;  3JCU E;  1EZV G;  1SQX J;  3RK3 B;  1OW8 A;  1GW3 A;  5KLV J;  2JWD A;  2A45 I;  3GG2 A;  2OTK E;  3H1K E;  1RE4 A;  5CCG C;  2MKV A;  1FZG A;  3H1H J;  2FXO A;  1HBW A;  4U3F E;  4Y99 B;  1S72 P;  3L73 E;  2NZ2 A;  3LIE A;  1NTK K;  5KAI H;  1FBM A;  2AEM A;  4MN4 C;  2R5D A;  2YMY A;  1M1J B;  3CLQ A;  2Q3E A;  3PLN A;  4K35 A;  1KZU B;  3MD0 A;  1EXJ A;  5AW9 B;  2NPS C;  4YXW H;  1SQV E;  1G1I A;  3L35 A;  1NYH A;  1BCC G;  1IZN B;  1VL2 A;  3CL3 D;  1D7M A;  1KYO D;  1PPJ D;  3L71 J;  4IL6 E;  3TDK A;  3AEG C;  3GHG A;  5KLV E;  3L75 G;  4GDO A;  3ITK A;  1NAF A;  3D6Z A;  3TYY A;  1PPJ G;  3FXD A;  1K8A Q;  3H1H E;  1BE3 D;  2A06 D;  1MUU A;  1JY3 O;  3GF3 A;  1BDD A;  1JUN A;  3RK2 C;  3B5N D;  1JOC A;  2YNY A;  2WIT A;  1LT1 A;  2E76 B;  1MFT A;  2HPC B;  2A06 G;  1SQV K;  4H13 D;  3HE5 B;  4IL6 H;  1NOH A;  1KOR A;  3HD7 B;  2IBZ E;  1S9K D;  4TT3 H;  2ZFC A;  3BAS A;  1VQ5 P;  3A2A A;  3CC2 P;  5KLV K;  2C9N Y;  3V2N A;  3L71 E;  1RQV A;  3NMD A;  1KC8 Q;  2D2C B;  3CC7 P;  5KLI B;  2CPB A;  2KLV A;  3CCV P;  1GW4 A;  2JJL A;  2Y0E A;  3I55 P;  5CBO A;  1J1E C;  1PGP A;  4L75 A;  4GOF A;  3TGU E;  1BSN A;  2QJP B;  4IFD K;  2KP8 A;  2JO1 A;  2R3S A;  2HPC A;  1N7S C;  5GTH E;  2KZI A;  2WQY C;  3AEE C;  3L4F A;  1KB9 H;  2K9J B;  3A7O A;  5AVT B;  2FXP A;  2W6J H;  5CCH C;  3W67 A;  1ZR4 A;  3SSU A;  2I8D A;  3MGN A;  3TK1 A;  2BCC D;  5APU A;  4DJG A;  2XND H;  1BGY J;  1VF5 B;  2FYU J;  3CXH D;  3PJS K;  4HJG H;  2P10 A;  5CBN A;  2VRS A;  1LP1 B;  5K5G B;  4HYT B;  5CJ4 A;  3D6Y A;  2BCC G;  1OW7 A;  1AVY A;  2Z4E A;  3AEA C;  1EC5 A;  2E5T A;  4PD4 E;  2V4H A;  2E74 B;  2A45 H;  2KI7 B;  3CWB J;  4WY4 B;  1Q90 D;  3CCS P;  2KUB A;  3CPW O;  3WMM 0;  1SS1 A;  1ZME C;  3L74 D;  4OVN F;  2Z5H A;  1NTZ D;  1HWT C;  2L91 A;  3AEF C;  1K04 A;  3M9H A;  4JPZ B;  3HUS B;  1SQQ D;  2FYZ A;  3KYQ A;  2WT7 B;  4GIF A;  4NPF X;  1FZC A;  2WPQ A;  2XDJ A;  3RBX A;  2JWA A;  1E79 H;  5KAF E;  1IFP A;  1NTZ G;  1JTH B;  2OAR A;  1E5W A;  1HF9 A;  3RBZ A;  1SLQ A;  1LP1 A;  2M5A A;  1L0L E;  1BGY E;  1SQQ G;  4PV1 B;  1YJ9 P;  4H44 D;  1VQM P;  2FYU E;  3LW5 J;  2XU6 A;  4C7N B;  1PGO A;  3H32 B;  3IN6 A;  2LXC B;  1VPC A;  1OXZ A;  2W8Z A;  3RK3 C;  2KSE A;  1U7M A;  1Y8A A;  2ZVO B;  2KXP B;  3VP8 A;  4GOD A;  2ZXX A;  2N9Y B;  3HE4 B;  1PP9 D;  3CWB E;  3OA7 A;  2O1J A;  2FXM A;  3Q3D A;  2Q5U A;  4WWI A;  1SP4 A;  3LID A;  2CPS A;  1OZH A;  2G3A A;  4H0L D;  5APW A;  3KZI H;  3WUV A;  1ZR2 A;  5KJ7 C;  1PP9 G;  1M1J C;  1N86 A;  2AXT E;  1L0L K;  3TGU G;  3E1I A;  4C7N A;  3H32 A;  2FYU K;  2IZ1 A;  1FZB A;  1CI6 A;  3H1J J;  3CCR P;  1KIL B;  1FDI A;  1JCD A;  1XTG B;  5AVS B;  1S3J A;  5GTI E;  1URQ D;  1HJ0 A;  1YQ3 C;  1IFN A;  2FKW B;  3JC2 2;  3O6Q B;  3SFE C;  2HOD A;  2PFX A;  5AVQ B;  2UWJ E;  1QLE D;  2B9B A;  4Z1M H;  3USS A;  3CMA P;  4KHX A;  2R32 A;  1AQT A;  1XTC C;  3M0D C;  1JNM A;  1M90 Q;  3FXE A;  2E75 D;  3BRV B;  2QM8 A;  3RL0 D;  2ZAE B;  1L0N J;  3PRJ A;  2Y0D A;  3H1L D;  1ZOY C;  1DEB A;  2E76 C;  1BE3 J;  3PTZ A;  5KKZ B;  3PHL A;  2K3R A;  1EDL A;  1Q2N A;  5AVR B;  2ZJS E;  1A02 J;  2W27 A;  3HD7 C;  2WVR A;  2N1T B;  3JSV C;  1VQ4 P;  2HYN A;  3H1J E;  2POH A;  2WSE H;  3BCC E;  1U57 A;  2O3J A;  3A0H H;  4NPD A;  3L72 D;  2OYH B;  3CXH I;  1H89 A;  4WB4 A;  5KLI C;  3H1I D;  2P1J A;  1M57 D;  3CCQ P;  2KNC B;  1EXI A;  3CC4 P;  1YIJ P;  3L72 G;  1GK4 A;  2OYI B;  2GM4 A;  1KD1 Q;  2E43 A;  2QJP C;  4R4M A;  1GL2 D;  1LTJ B;  4WVZ A;  1JY3 N;  1L0L G;  5AW2 B;  4CPG A;  2RKL A;  3GF7 A;  4IFM A;  3TNU A;  1YYC A;  1HUC A;  2IDB A;  1L0N E;  3RK3 D;  2K37 A;  2SPZ A;  1GD2 E;  1HH0 A;  1BE3 E;  1URQ A;  3FWL A;  4YPC A;  1KB9 I;  2OYH A;  2NRG A;  1RHZ B;  2H88 C;  4N78 D;  4DCK A;  1MZ9 A;  4NPE A;  1IFJ A;  4RJT A;  2Z5I A;  5BU8 B;  2WSC H;  3CI9 A;  4QMA A;  5KAI E;  2OYI A;  1ZW0 A;  1JMB A;  2IX7 C;  5KJ7 D;  3VMZ A;  2C0W A;  3MZW B;  1LTJ A;  2FYN B;  3IFM A;  2ZT9 D;  2RH0 A;  2PP6 A;  4LLH A;  4D6T J;  2YKP A;  1SQP D;  3L70 D;  1L0N K;  1NVO A;  2E74 C;  4WY4 C;  2K88 A;  4UB8 H;  5E79 E;  1JO5 A;  1FE6 A;  3FGA D;  1SQP G;  3GLM A;  5APQ A;  1NU1 J;  3GHG B;  3E7K A;  3L70 G;  3HUS C;  2HG5 D;  3P32 A;  1GK6 A;  1T6A A;  2FY8 A;  2WSS H;  1LTS C;  1LNQ A;  1X0T A;  1LT9 A;  3L74 J;  1YI2 P;  1NTM J;  3KDP B;  1NTZ J;  1SVF A;  1LTG C;  1SFC B;  2GUS A;  1BCC D;  3Q5R A;  1L4A D;  2QM7 A;  4PV1 C;  1YHQ P;  1Z56 A;  2GUV A;  2IPP A;  3B4S A;  2B89 A;  3L75 D;  1N73 A;  3IR9 A;  2JKV A;  1RF0 C;  1GTW A;  5AVV B;  1GL2 A;  2QJK C;  2DW3 A;  2J58 A;  4UB6 H;  1YTZ I;  4YTP C;  5E79 H;  1KTM A;  2PRR A;  4D6T E;  1SQX E;  3FWN A;  2FFD A;  2QG4 A;  5APY A;  3CME P;  2P7J A;  1J1D B;  1FU1 A;  5AVZ B;  5M1B A;  2H7H A;  1P84 I;  3CX5 D;  4GKG A;  3QWO C;  1OVR A;  1SFC A;  1NU1 E;  3SWY A;  1PGQ A;  5APV A;  1J2J B;  1OFC X;  3AE4 C;  1G1J A;  1NTM E;  3MUD C;  2WPV B;  1S5L H;  4I7Z B;  1KIL C;  2YO2 A;  3L36 A;  1NTK D;  1NWQ A;  1KB9 E;  1SQX K;  4ZKP A;  5BVZ A;  2BEQ D;  3CXH H;  4W7Y A;  1KIL E;  2HR3 A;  4OWF A;  3V6I A;  3VMX A;  2GA1 A;  2MJZ A;  1QVF O;  3OW2 O;  4B86 A;  4OGQ D;  2YKO A;  1KMI Z;  1NTK G;  4ZMD A;  3BVH A;  1NU1 K;  1RF1 A;  1AFO A;  3MP7 B;  1YIT P;  3V2P A;  3NTN A;  4EIJ A;  2W6A A;  1L4A A;  1U7J A;  2KLU A;  3H1K D;  3SFD C;  1QEX A;  5KKZ C;  2CK3 H;  3B5N B;  4U3F D;  2I1K A;  1RE3 C;  3H1L J;  3L73 D;  2N1T C;  2Q3I A;  1SQB J;  1YTZ T;  2Q7C A;  1EZV I;  3H1K G;  1IJD B;  2ITA A;  2E42 A;  5CCG D;  1KQG B;  4H13 B;  1N2D C;  2QE7 H;  1KQL A;  3G6E P;  1IK7 A;  4U3F G;  4AQR D;  2Y0C A;  3L73 G;  1FZC B;  3N7N A;  2R3C A;  1DD4 A;  3G4S P;  1AJY A;  1SQV D;  4GOE A;  1AQ5 A;  2K1A A;  2QEX P;  3P7K A;  2M5A B;  3H1I J;  5AVY B;  2J59 M;  3B5N A;  2NPS D;  1TU3 F;  5KLV D;  2Q1K A;  1SQV G;  4RES B;  1PV3 A;  4W80 A;  3U1A A;  3P8C E;  1FZF A;  1LWU A;  5AW1 B;  2C9L Y;  1LGH B;  3H1H D;  2QRX A;  1SQX G;  1RE4 C;  2H89 C;  4L73 A;  5KLV G;  3H1L E;  3M06 A;  1NH4 A;  1P84 E;  1SQB E;  1UII A;  1LTA C;  3MIW A;  4L74 A;  1OX3 A;  1ZLL A;  3KZI E;  2M3B A;  3H1H G;  4XE5 B;  3C1L A;  3TSI A;  5AW6 B;  4AYC A;  2FYN C;  1KYO I;  1OMI A;  3RK2 D;  3PP5 A;  2IBZ D;  2RN0 A;  2PAJ A;  1T3U A;  3F5H A;  2Q9I A;  2WSE J;  1Y47 A;  1CI6 B;  2AEF A;  1T2K C;  3L71 D;  2P2U A;  4M3L A;  1T8Z A;  1AVO A;  5B5E H;  1YJN P;  1X79 B;  2IBZ G;  1H0T A;  3KQG A;  3Q5S A;  2HOD B;  2WMM A;  1HVV A;  2QVA A;  2YXR B;  3GHG C; 
#chains in the Genus database with same CATH homology
 1LWU B;  1KZU B;  1FJK A;  3M0A A;  4Y99 C;  1URQ C;  3MD0 A;  1JY2 P;  1LTB C;  4I6M C;  4LGD E;  1GK4 A;  1SQB K;  5CCG A;  2OYI B;  1FOS F;  2OYH C;  2GM4 A;  3HE5 A;  5AW8 B;  3P8M C;  5AW9 B;  2E43 A;  3HD7 A;  2NPS C;  1GU5 A;  2C0X A;  1GL2 D;  1LTJ B;  1G1I A;  1JY3 N;  3L35 A;  3NFQ A;  5AW2 B;  4IFM A;  1JY3 P;  3TNU A;  3CL3 D;  1YYC A;  1NKN A;  1HUC A;  1NO4 A;  2OYI C;  4O9B A;  3UIA A;  1FJP A;  3RK3 D;  3A5T A;  3GHG A;  2XZR A;  1N7S D;  4W7Z A;  4ZKU A;  1GD2 E;  1HH0 A;  2YO3 A;  1LTJ C;  2P67 A;  1URQ A;  1GDT A;  3RL0 C;  1NAF A;  1FZA A;  3TYY A;  2OYH A;  1A02 F;  2M8R A;  4N78 D;  2NPS A;  3OAK A;  5BU5 A;  5CMZ A;  4AUW A;  4JYC A;  5CHX A;  1MZ9 A;  1IFJ A;  2Z5I A;  5BU8 B;  1J1D C;  2WSC H;  3CI9 A;  1MUU A;  1JY3 O;  5CCH D;  5AVX B;  1JUN A;  3RK2 C;  3B5N D;  2OYI A;  1CSB A;  1JOC A;  2IX7 C;  2YNY A;  3MTU E;  4EOT A;  3BRT B;  2WIT A;  5KJ7 D;  3VMZ A;  2C0W A;  2WWW A;  2HPC B;  1LTJ A;  1ZV8 A;  3IFM A;  2WTY A;  1SQV K;  2PP6 A;  4LLH A;  2YKP A;  3HE5 B;  1LT9 C;  1NOH A;  2YKQ A;  3HD7 B;  1LTI C;  4JF7 A;  2LKM A;  1L0N K;  1S9K D;  2ZFC A;  4WY4 C;  3BAS A;  1JO5 A;  3A2A A;  3TNU B;  5KLV K;  2C9N Y;  3V2N A;  5APX A;  3T97 A;  3NMD A;  5APQ A;  3GHG B;  2CPB A;  1HGV A;  1KIL D;  2KLV A;  2WPS A;  1N73 C;  3HUS C;  2XV5 A;  1WT6 A;  2HG5 D;  1IO4 A;  1GL2 C;  3P32 A;  1GW4 A;  1URQ B;  1GK6 A;  2JJL A;  1J1E C;  1LTS C;  5KTB A;  1LT9 A;  3V2Q A;  3KDP B;  2NPS B;  2FFD C;  4IFD K;  4OH8 B;  1SVF A;  2KP8 A;  1LTG C;  1SFC B;  2GUS A;  5AW3 B;  4WY4 A;  1L4A D;  3VYI A;  2HPC A;  2QM7 A;  2KB7 P;  1N7S C;  4LC1 A;  3VTP C;  1Z56 A;  2GUV A;  2XKM A;  1FOS E;  1CZQ A;  2L5G B;  3HRN A;  2IPP A;  1X8Y A;  1N73 A;  3L4F A;  1EQ7 A;  1SFC C;  3HUS A;  3IR9 A;  1IFI A;  1RF0 C;  1GTW A;  5AVV B;  1GL2 A;  3VOP A;  4I2L C;  2J58 A;  1NHL A;  1ZN5 A;  1YTZ I;  3RL0 B;  2WT7 A;  1CW5 A;  3A7O A;  5AVT B;  5CCH C;  1WRG A;  3VP9 A;  1ZR4 A;  3B8E B;  2FFD A;  3BAT A;  1JTH A;  5APY A;  3MGN A;  3TK1 A;  5APU A;  2P7J A;  4N78 E;  1T2K D;  1J1D B;  1DH3 A;  1N7S A;  1FU1 A;  5AVZ B;  1X9V A;  3RK2 B;  2IFN A;  2A45 G;  5CJ0 A;  2H7H A;  2HLO A;  4GKG A;  4C7R A;  1SFC A;  2N1T D;  1RF0 A;  2VRS A;  3A3Y B;  3C9I A;  4HYT B;  4JYB A;  5CJ4 A;  3N4X A;  3SWY A;  1FZE A;  5APV A;  1J2J B;  2Z4E A;  1FZC C;  5CCH A;  5APS A;  1LT9 B;  1QL2 A;  3M91 A;  1PFI A;  1G1J A;  2WZ7 A;  1GZL A;  2A45 H;  3HE4 A;  3M9Q A;  4WY4 B;  3OJA B;  2H8P D;  1T3J A;  3WMM 0;  1KIL C;  1S9K E;  3HTK B;  2HFE D;  2Z5H A;  4C46 A;  1KFN A;  1RF1 C;  1HWT C;  2XNX A;  3H6P A;  2YO2 A;  3L36 A;  1LTT C;  3P8C D;  1NWQ A;  3M9H A;  1N73 B;  3HUS B;  1SQX K;  3V4Q A;  2FYZ A;  1GL2 B;  4ZKP A;  3KYQ A;  5BVZ A;  1L4A C;  1RY3 A;  2W6B A;  4W7Y A;  2WT7 B;  1J1E B;  4GIF A;  1FZC A;  2WPQ A;  2XDJ A;  3VMX A;  2IFM A;  2MJZ A;  2FFD B;  1JTH B;  5AW5 B;  3MUD A;  2OAR A;  1E5W A;  4B86 A;  3II6 A;  2YKO A;  1SLQ A;  2KSJ A;  3BVH A;  5APT A;  1KIL A;  1N7S B;  1H8A A;  5AW4 B;  1FDM A;  1NU1 K;  1MFZ A;  1IFM A;  2H43 A;  1H88 A;  1RF1 A;  1AFO A;  1QL1 A;  4XA4 A;  2XU6 A;  4C7N B;  1GU4 A;  3V2P A;  2WSF H;  3H32 B;  3NTN A;  4EIJ A;  3LW5 H;  1HGZ A;  1VPC A;  1OXZ A;  2W6A A;  3RK3 C;  5AVU B;  1L4A A;  3V4W A;  1SQP K;  3HTK A;  1W2E A;  3VP8 A;  1IK9 A;  4N3Y B;  3B5N B;  3L37 A;  3HE4 B;  3M9B A;  2I1K A;  1RE3 C;  3KPE A;  2KYV A;  3OA7 A;  1G2C B;  2O1J A;  1KFM A;  2FXM A;  2N1T C;  2I1J A;  3VMY A;  4DZO A;  2Q3I A;  1YTZ T;  2Q7C A;  1JY2 N;  2Q5U A;  1IJD B;  2E42 A;  4DOJ A;  5CCG D;  3VN0 A;  1N2D C;  1SP4 A;  3LID A;  2CPS A;  3B5N C;  3HD7 D;  4WBA A;  5APW A;  1KQL A;  3R2P A;  1OWA A;  3V2R A;  1ZR2 A;  4AQR D;  5KJ7 C;  1M1J C;  1MV8 A;  1N86 A;  4HH2 A;  1FZC B;  1LWU C;  1NKZ B;  3N7N A;  2R3C A;  4IFF A;  1L0L K;  2KOG A;  3E1I A;  4C7N A;  1FAV A;  5AW0 B;  1RE3 A;  2FYU K;  3H32 A;  1AQ5 A;  4N6J A;  1FZB A;  1CI6 A;  2N1T A;  2ZXE B;  1KIL B;  3P7K A;  1JMM A;  1JCD A;  1XTG B;  3I5C A;  3SWF A;  5AVS B;  1URQ D;  2FKW B;  1IFN A;  1N7L A;  5AVY B;  1RF1 B;  2J59 M;  1JY2 O;  3B5N A;  3G3Z A;  2BAS A;  2JEE A;  2NPS D;  1SFC D;  2HOD A;  5KJ7 A;  1M1J A;  1L4A B;  1M7L A;  3EFG A;  1G2C A;  2N9B A;  4RES B;  4W80 A;  5AVQ B;  3U1A A;  1IFD A;  3P8C E;  1FZF A;  1LWU A;  5AW1 B;  3EQ2 A;  2C9L Y;  1JCC A;  1LGH B;  4KHX A;  5AW7 B;  2R32 A;  1XTC C;  1HTL C;  4I1L A;  1RE4 C;  3O8Z A;  5AVW B;  3M0D C;  2O01 H;  1JNM A;  1DX7 A;  1HJB A;  3U1C A;  3M06 A;  3BRV B;  1NH4 A;  2QM8 A;  3RL0 D;  4GT1 A;  1LTA C;  1IC2 A;  3MIW A;  1ZLL A;  2M3B A;  3V5B A;  3RK3 B;  4XE5 B;  3TSI A;  1GW3 A;  3NXS A;  5AW6 B;  1DEB A;  2A45 I;  4AYC A;  3RK2 D;  3PP5 A;  2O1K A;  1RE4 A;  5CCG C;  3M0D A;  5AVR B;  1A02 J;  2PAJ A;  1T3U A;  1FZG A;  2Q9I A;  1VDF A;  2W27 A;  3HD7 C;  1HBW A;  1CI6 B;  2N1T B;  1NTM K;  2HYN A;  1NTZ K;  2POH A;  2WSE H;  2R5B A;  2WPR A;  4Y99 B;  1T2K C;  2P2U A;  4M3L A;  3U59 A;  3LIE A;  1NTK K;  1T8Z A;  2OYH B;  1X79 B;  1FBM A;  1SQQ K;  1H89 A;  3KQG A;  2R5D A;  2HOD B;  4WB4 A;  2YMY A;  1M1J B;  4WY4 D;  1HVV A;  2P1J A;  3CLQ A;  3GHG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...