2Q9IA

Crystal structure of d-dimer from human fibrin complexed with met-his-arg-pro-tyr-amide.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
67
structure length
67
Chain Sequence
VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrinogen alpha chain
publication title Probing the beta-chain hole of fibrinogen with synthetic peptides that differ at their amino termini
pubmed doi rcsb
molecule tags Blood clotting
total genus 23
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2q9iA00
2A45H 1LT9A 1N86A 2HPCB 2A45G 2FFDB 3GHGA 2OYHB 1LT9B 2A45I 1RE3A 1LWUC 2XNXA 1LTJA 3HUSA 1FZFA 2OYIA 2HODA 1N73A 1M1JA 3E1IA 1RF1C 1FZCA 3GHGB 1FZAA 1LTJB 1JY2P 3HUSB 1N73B 1FZBA 2OYIB 1M1JB 1T3UA 1FZGA 1JY3O 1RF0C 1JY3N 2HODB 3BVHA 1FZCB 2FFDC 2HLOA 1RE4C 1LT9C 3H32A 2OYHC 1LWUA 3GHGC 1RF1A 1FZEA 1RE3C 3H32B 1LWUB 1LTJC 1W2EA 3HUSC 1N73C 2OYIC 1M1JC 2Z4EA 1RF1B 1RF0A 2H43A 2Q9IA 1JY3P 2HPCA 1JY2N 1FZCC 1JY2O 2FFDA 1RE4A 2OYHA
chains in the Genus database with same CATH superfamily
3AE3C 2WSCJ 3P8CE 3PHLA 2P10A 1LTJA 3VYIA 4U3FJ 1BDDA 3KZIH 1NU1J 2WMMA 1NTMD 1K8AQ 1CW5A 1X0TA 3KQGA 3L73E 1SQVG 4C7RA 3R4YA 3D6YA 2NRGA 1BE3G 5CCHD 3I56P 3LIEA 1Q7YQ 1SQQK 3A0BE 1SFCA 2PP6A 2Y9ZA 5CCHC 2IBZE 5KLVK 1Q90D 2Q7CA 3SWYA 1PPJD 4PD4E 3JCUE 2KNCA 1FDIA 4D6TE 2P7JA 4JYBA 1DH3A 1KQGB 5K5GB 4ASVA 3KHUA 4BXLA 2KSEA 1L0LG 3GLMA 3HUSC 3AE1C 1L0NG 1YITP 1SQBK 2FXMA 1EDIA 1WRGA 2AEJA 1QL2A 3QWOC 3ABVC 2Q3IA 1IFPA 4U3FE 5BU5A 1NU1E 5E79E 1ZRTD 2R3CA 2RMZA 3U1CA 1RE3A 3IN6A 4OVNF 3H1IG 3WUTA 3HUSB 2R5DA 2IBZI 1SQXJ 4WBAA 1QX8A 3Q3DA 1MFZA 5AW8B 3M9HA 1T6AA 1VQ7P 1S72P 2KUBA 2RKLA 4PD4I 1G1JA 3WU2E 1EZVD 1VQ6P 3A0BH 4MN4C 1NTMG 1AA0A 2O1JA 1JTHA 3BCCJ 4HJGH 1S9KE 1YYCA 3MD0A 1BGYJ 2W83C 4PD4H 3JCUH 1MFTA 1IFJA 2ZVOB 3BASA 3Q5RA 1YTZI 2OARA 5AW5B 3Q5PA 1S5LX 2WVRA 2AEMA 1SQPK 4OWFA 2R32A 1M57D 3H1HG 3RL0C 3OA7A 4UB8H 2IFMA 5KAFE 2KLUA 1YI2P 1R8EA 1IFMA 3E7KA 4B86A 1LTIC 3L73D 3D70A 5CMZA 4Y99C 4JBZA 3IFMA 3M0AA 1LNQA 4CPGA 4HKZH 1ZXGA 1PP9J 3OJAB 3P32A 1HWTC 2IBZD 3NXSA 5CCHA 1EQ7A 5E79H 1AVOA 4ASWA 1LTBC 3IR9A 5APVA 3RL0B 1VQ5P 4PV1D 5AW4B 1LT9B 2JWAA 1JB0J 4PV1C 1KN7A 3V2NA 2Y0EA 3C1LA 2WPQA 4Y99B 3BCCE 3WU2H 3PTZA 1RY3A 2V4HA 1QGKB 3HUSA 4DOJA 3CCRP 2NPSD 2W27A 2ZT9C 1L0LJ 1YQ4C 4I6MC 2QSIA 1EZVG 1FZEA 1T8ZA 1N73C 2POHA 4PV1B 1FDMA 2Y9YA 1BSNA 2P58A 4U3FD 5B5EE 1EXJA 2BEZF 1NU1D 3O6QA 5AW0B 3CX5H 1NKNA 1XTCC 2FKWB 5KAFH 3BATA 4Y28J 1KMIZ 1UIXA 5APTA 4LLHA 1IFNA 2QJKC 2ZT9B 2QVAA 1LT1A 1BE3E 2NPSB 2WT7A 1QVGO 2P2UA 1KB9E 1ZP0C 3V4WA 1N73B 1PFIA 2YO3A 1SS1A 3L73G 1S9KD 4GOFA 3GMAA 4H13D 1FC2C 4TLFA 3FGAD 1Y47A 2A45I 1Q2NA 2HR3A 4RJTA 2IBZG 4AYCA 2WTYA 2OTJP 2C0XA 2LKMA 2YNYA 4WWIA 2W6BA 1L0LE 2ZXXA 3S9OA 4C7NB 2QJYC 2A45H 3H1HJ 3L74J 3KPEA 5AVTB 3AE5C 1HJ0A 1NU1K 1OVRA 2ZYAA 1W2EA 5B5EH 5AVZB 1LTSC 1AFOA 1SQXD 2GUSA 1KB9I 1GW4A 3RK2C 2JKVA 1K73Q 1NU1G 5C39A 1PL5A 2W6JH 3A2AA 1FOSE 3BCCD 1KB9H 1RQVA 2B89A 5AVYB 1BGYD 1SFCD 3ZDMA 3AEEC 4HH2A 5AVVB 1ZOYC 4C46A 3T97A 3L72J 1J1EC 3RK2B 3VMXA 3ITKA 1N73A 3RBXA 1JMBA 3VP8A 2VRSA 2QIWA 1FDOA 3S4RA 1RE4C 3H1HE 3L74E 4WY4D 5BVZA 3CCVP 3TDKA 1Q82Q 3AEAC 2IFNA 4WY4C 3CC2P 1KZUB 1KFMA 1CZQA 2M3BA 2WPRA 2W6AA 1PP9D 3MGNA 1E79H 1NWQA 3I55P 2FXOA 1S5LE 2O3JA 3TNUB 1NGMB 1PIXA 4BRYA 1SFCB 1J1EB 2QRXA 1LTTC 1Y8AA 4C7NA 1KQLA 4W7YA 1KYOE 2Q9IA 2C9LY 2SPZA 3AECC 2WSEH 4EYYQ 2R5BA 4WY4B 2H88C 3L37A 2N9BA 4DZOA 2FYUK 3CMEP 2QM8A 5TISE 3FXDA 1SQXG 5KTBA 1YJ9P 1QVFO 1L0LD 2LR2A 3M9QA 3VN0A 5APQA 3L72E 4WVZA 3G3ZA 3Q2YA 1RF0C 2QE7H 4R4LA 1EDLA 4YXDC 4QMAA 2YKQA 1S3JA 3V2RA 1VPCA 3A0HE 1OW6A 2LXBA 2G8YA 1BGYG 2A45G 3MUDC 3H1JJ 5H2FE 1URQA 3M06A 3GF7A 5AW9B 1SQVK 1OX3A 4Z1MH 1H88A 3AE8C 1KC8Q 2YIUC 1KYOI 1N2DC 1OFCX 2CPSA 2WWWA 2C0WA 4DCKA 1FE6A 2KB7P 5APXA 1AJYA 1GK6A 1S5LH 4YPCA 1YIJP 1GU5A 1JTHB 1DIPA 3P7KA 1KYOH 3B8EB 1PP9G 2N1TC 3CC7P 3CL3D 3AE2C 1OW7A 3CWBJ 3TNUA 2OGUA 2HODA 3A7OA 2JDIH 2WITA 1NTKJ 3PH0A 1FJPA 1T3UA 2YIUB 5TJHA 1L0LK 5TISH 1L0NK 4ZKUA 4IL6X 3H1HD 3L74D 1EZVI 5AW2B 5CJ4A 1RE4A 4PJ0E 1EXIA 1U57A 2OYOA 4WY4A 4K3AA 5EFWB 4GDOA 1N7SD 2KP8A 2ZYDA 4JF7A 3H1JE 2N1TB 4NPFX 1RH5B 4L76A 1N7SC 3A0HH 2R44A 2H43A 1YBKA 2PAJA 5H2FH 1OVUA 1KYOD 1EDKA 2XZRA 3RL0g 1HF9A 2KS1B 3G9RA 3B5ND 2E75C 2XNDH 2K3RA 1M8OB 3SWKA 4YTPC 2KZJA 3B5NC 2HYNA 3CCQP 3E1RA 1HJBA 1NTMK 1KQFB 3FWLA 3FX0A 1N7SB 2B9BA 3CCMP 1EC5A 1NAYA 1AV1A 3GW6A 2PFXA 3CWBE 3L72D 3OAKA 2Z5IA 1P84D 1NTKE 1RF0A 3AEGC 1Q86Q 3G6EP 3B5NB 3O6QB 3MUDA 4WB4A 2QA4P 3A3YB 3PRJA 4GODA 1JEKA 1FZCC 1H8AA 1VQMP 1JO5A 3RL0D 1FZGA 2WT7B 2JR8A 4RO0A 3L74G 3V2QA 1GU4A 3H32A 3A5TA 1Y9BA 1GZLA 3GG2A 2OYHA 1BCCJ 3SFEC 1IK7A 2XNXA 1M90Q 1H89A 1HGZA 2WSCH 2N1TA 2O01J 3B4SA 2K88A 1AQ5A 1FZCB 4W80A 2KYVA 1J1DC 1YTZT 4KHXA 3AEBC 5AVQB 2KK7A 2UWJE 1SQXE 1JCCA 5KJ7D 1N86A 4ZMDA 2IDBA 2RH0A 1LGHB 2KS1A 5KJ7C 4YXWH 4DT0A 2WSSH 1G2CB 1OVVA 1NTZJ 3W67A 3TSIA 3VTPC 5AW7B 1Z56A 3K5BA 2D2CC 1QEXA 3H1JD 2P67A 2V7QJ 1JY2N 1J1DB 3G4SP 1BGYE 1VL2A 2ZT9D 1N7SA 1HTLC 3L36A 4N78E 3L72G 1FAVA 2HLOA 3H1KJ 1X8YA 3HTKB 3AE9C 2IPPA 5CJ0A 1SQQJ 3C8VA 3U59A 4EOTA 4H44D 1OW8A 3B5NA 1A02J 2D2CB 4KJMA 5KLVJ 1QL1A 1KILC 2KOGA 2KZIA 4H44C 1GK4A 4LC1A 3V5BA 3GHGC 1VQLP 2ZVNB 1DEEG 3CWBD 3B71A 1PP9E 3IF4A 4K35A 1NTKD 3T97B 3H25A 1RF1C 2Q1KA 2M8RA 4AQRD 2E74C 4UB6E 2B88A 2R3SA 1KILB 3S1KA 3M0DC 1IC2A 4H44B 5KKZC 1FZCA 3HD7D 4GT1A 1JY3N 4LGDE 1S4XA 2QJKB 4BRYB 3HD7C 2FYNC 1RF1B 4EDFA 5CBOA 3N4XA 4IL6E 1R5LA 3H1KE 3II6A 1GMJA 2E74B 1GTWA 1G2CA 1SQQE 2E42A 3H1JG 2QM7A 1Q81Q 1URQD 3L35A 5KKZB 2GM4A 5CHXA 1XTGB 2YXRB 1URQC 3KXDA 3EQ2A 4H0LD 3RK2D 3HD7B 2HFED 2M5AA 2FYNB 4H0LC 1HH0A 3CD6P 1NTKK 3HTKA 2QJYB 3CXHE 3AE6C 1ZLLA 2O01H 2RN0A 2E43A 5KJ7A 5B66E 4NPDA 2BASA 1PGOA 3WMM0 1SQPJ 2Z5HA 1ZN5A 4A7PA 3CCJP 1URQB 4N78D 4UB6H 3CWBG 3SWFA 2I8DA 1M7LA 1NTKG 3L71J 4XFJA 1FOSF 4H0LB 3PP5A 3D6ZA 3JC22 1JCDA 3L70J 3BRVB 5AVXB 5APUA 2JP3A 2KXPB 3KDPB 3CC4P 5APSA 2E76C 5BU8B 1BCCD 2G3AA 1KILA 2ZJSE 4BWNA 2E5TA 3GHGA 2Q3EA 3R2PA 4M3LA 2ZFCA 2HODB 2XDJA 1SLQA 1BSHA 1SQXK 2B87B 3CXHI 2J59M 1RF1A 3TK1A 3VMAA 2FBWC 2Z4EA 3FWNA 1OIPA 1FBMA 4RKUJ 1NTZD 3FXEA 2E76B 1SVFA 2KSJA 1D7MA 1AQTA 3CXHH 3M0DA 1ZMEC 1SQPE 4JPZB 5B66H 2PRRA 3CCSP 2LXCB 1X22A 2A06D 5AVWB 1MV8A 1RQUA 3HD7A 3GF3A 1VQ9P 3H1KD 4N6JA 3HE4B 1P84E 3L70E 3RK3E 1SQQD 1CSBA 1NOHA 3H1LJ 1JY2O 2I1JA 1VQPP 5KLVD 4HYTB 1E5WA 4IFDK 5AW6B 4D6TJ 1S1CX 3AE7C 2AXCA 3CXHD 2WSFJ 3M91A 3RBZA 2I1KA 4AUWA 3EFFK 2QG4A 3MZWB 3Q1MA 2K1AA 1BCCG 3TYYA 2OYHC 1U7MA 2N1TD 2IYPA 4U7JA 2CK3H 3I5CA 1MKMA 4XE5B 3SSUA 1W2BO 3LW5J 2B87A 1FS0E 3MTUE 1P84I 3L75J 3H32B 4ZNCA 1NTZG 2JJLA 5CCGD 2OYHB 4W7ZA 1N8RQ 1R5SA 3H1LE 5CCGC 1P84H 1JY3O 2A06G 1LP1B 3O8ZA 2GUVA 3H1KG 3CCUP 1YHQP 2N9YB 2E75D 1X9VA 2BEQD 1SQQG 2ZYGA 3HE4A 5AW3B 1VDFA 1VQ8P 4UB8E 1K05A 5KLVG 4GIFA 1SQPD 4IFMA 2H89C 1HGVA 1KILE 2IZ1A 4O9BA 2KIKA 1T3JA 2O01N 3N7NA 2YKOA 3QH9A 2IX7C 3EWKA 4GOEA 5KAIE 1NJIQ 3L71D 1HUCA 5AVRB 1K04A 2OTKE 1IFDA 3CI9A 3L70D 3RK3D 2FFDA 2XV5A 3VMZA 1MZ9A 2KI7B 3H6PA 1SQBG 3L75E 2BCCJ 2E75B 3RK3C 3G71P 2OYIA 2W8ZA 3TGUG 1PGQA 3MP7B 4JYCA 4I2LC 3TF5A 4PJ0H 3CCLP 3M9BA 1LWUC 2KLVA 1PZQA 1IO4A 1ZW0A 2XKMA 1JY2P 2XU6A 2FYUJ 2GA1A 3P8MC 4HB1A 3BRTB 3RK3B 1YJWP 3CPWO 1OWAA 3WUVA 1NAFA 2Y0CA 4EIJA 1IZNB 2WSFH 1IJDB 1U7JA 3P8CD 3USSA 2L91A 1PPJG 1LP1A 2YKPA 1WMKA 4XA4A 5AW1B 2Q6QA 3CX5E 4N3YB 1LT9C 2JEEA 1LWUB 2K37A 1PGPA 3SFDC 1ZV8A 1GW3A 5KAIH 1FU1A 1FZAA 1SQVJ 1SQPG 2D2CD 5KLIC 2BCCE 1BE3J 3H1LD 1QLED 3LW5H 1NKZB 3AEDC 5CCGA 2YMYA 2AEFA 2K9JB 2WZ7A 1CI6B 4PD4D 1JUNA 3L71G 1FZFA 1L4AD 1KQSO 3NFQA 3WUUA 2J58A 4D6TD 2H7HA 3L70G 2M5AB 1L4AC 2M3EA 3VOPA 1DEBA 2AXTE 2WPVB 1JY3P 3AEFC 2FYUE 1H0TB 5AVUB 3EFGA 5KLIB 3D71A 1KILD 3MIWA 1LTAC 1EDJA 1L0NJ 1GL2D 3CX5I 1BCCE 2NPSC 1IFIA 2Y0DA 1KD1Q 2QEXP 1VQNP 1X79B 1GL2C 1NYHA 1JOCA 1DX7A 1L4AB 1N7LA 4GKGA 4I1LA 2E74D 2C9NY 3L75D 1DD4A 3W68A 2DW3A 2ZXEB 1WT6A 4DJGA 2JO1A 2WSEJ 1SQBJ 4OGQD 1NO4A 1SQVE 1L2PA 3H1IJ 1GD2E 1NTZE 3TGUJ 1ZR4A 4OGQC 1JMMA 3E1IA 3GHGB 1VQKP 1GL2B 5GTIE 1MUUA 2A06E 1LWUA 1NTMJ 3NTNA 3KYQA 2ZAEB 3NMDA 3L4FA 2HPCB 1DD3A 4OH8B 4H13C 5L8RJ 3H1LG 2IZ0A 2CPBA 3CCEP 2H8PD 2AXTH 4OGQB 3CX5D 2K9JA 3F89A 1M1JC 5KLVE 1L0NE 1CI6A 1LT9A 4D6TG 2HG5D 3C9IA 1S2EA 2J5UA 1JNMA 3PLNA 1YJNP 1A02F 3MHVA 1NVOA 5AVSB 4H13B 1H0TA 2BCCD 1AVYA 2MJZA 2YMKA 2NZ2A 4RESB 5APWA 1OZHA 1SQBE 3OW2O 2WPSA 3H1IE 1M1JB 2W90A 3TGUE 2IYOA 2OTLP 3Q5SA 3PJSK 2P1JA 2JWDA 3JSVC 4U3FG 4I7ZC 3AE4C 1LTJC 2FYZA 3F5HA 1L4AA 2ITAA 3L75G 5CBNA 2V7QH 2FYUD 1KORA 1NTME 1VQOP 1KV4A 5GTIH 3HE5B 4ZKPA 2E76D 3IAOA 2YXQB 5DJUB 1FJKA 2FXPA 1SFCC 4IL6H 4NPEA 3VMYA 1GDTA 2Q5UA 3VP9A 1YQ3C 1KTMA 2NPSA 2YO2A 1LTGC 4I7ZB 1GL2A 1USEA 5GTHE 4L73A 2K9YA 1LTJB 1USDA 1PPJE 4L75A 2L5GB 2OQQA 1VF5D 1HVVA 1M1KQ 2PGDA 2HPCA 2QJPC 1VF5C 3V6IA 1M56D 1SQVD 1OMIA 3V4QA 1BE3D 3V2PA 1FZBA 4KT0J 1KFNA 1KB9D 3KZIE 1NH4A 4EI2A 1BDCA 1LJ2A 1JM0A 3RGUA 1PV3A 1RHZB 3LIDA 2KNCB 1UIIA 3L71E 1PGJA 3L73J 1W5CE 2FFDC 2BCCG 2QJPB 1VF5B 5APYA 1ZRTE 1RE3C 1HBWA 1SP4A 2OYIC 1ZR2A 2MKVA 5DJTB 1T2KD 1VQ4P 1L0ND 4L74A 1M1JA 4JQ0D 1T2KC 4IFFA 3U1AA 2O1KA 3UIAA 3CMAP 2E5YA 1G1IA 3BCCG 1EZVE 2FYUG 1J2JB 4R4MA 2M0BA 2FFDB 1K9MQ 4TT3H 5GTHH 2FY8A 3HE5A 2OYIB 3BVHA 1SQBD 1TU3F 1IK9A 1OXZA 4IOIH 1NTZK 3H1ID 2WQYC 5M1BA 3TGUD 1NHLA 3CLQA 3HRNA
chains in the Genus database with same CATH topology
3RK2B 3P8CE 3M9BA 1LWUC 1LTJA 3VMXA 3VYIA 2KLVA 1N73A 1RF1C 1IO4A 2XKMA 1JY2P 3VP8A 2VRSA 2XU6A 2M8RA 1RE4C 4AQRD 4WY4D 5BVZA 3P8MC 1CW5A 3BRTB 3RK3B 3KQGA 4C7RA 1OWAA 2IFNA 4WY4C 1KZUB 1KFMA 1KILB 1CZQA 1NAFA 5CCHD 3M0DC 2M3BA 3LIEA 4EIJA 2WPRA 1SQQK 1IC2A 2W6AA 2WSFH 3MGNA 1IJDB 3P8CD 1NWQA 1SFCA 2PP6A 1FZCA 5CCHC 3HD7D 3TNUB 4GT1A 2YKPA 4XA4A 5AW1B 1JY3N 4N3YB 1SFCB 4LGDE 1J1EB 1LT9C 5KLVK 1LTTC 2JEEA 2Q7CA 3HD7C 4C7NA 1KQLA 4W7YA 3SWYA 1LWUB 1RF1B 2Q9IA 3N4XA 2C9LY 3II6A 1ZV8A 1GW3A 2WSEH 2P7JA 2R5BA 1GTWA 1FU1A 1FZAA 1G2CA 2E42A 4WY4B 4JYBA 2QM7A 1DH3A 3L37A 2N9BA 4DZOA 2FYUK 1URQD 3LW5H 1NKZB 2QM8A 3L35A 5CCGA 2GM4A 5CHXA 2YMYA 1XTGB 3HUSC 1SQBK 2FXMA 5KTBA 2WZ7A 1URQC 3EQ2A 1CI6B 1JUNA 3RK2D 3M9QA 3VN0A 1FZFA 1WRGA 1L4AD 3HD7B 3NFQA 2HFED 5APQA 2J58A 2H7HA 3G3ZA 1HH0A 1RF0C 1QL2A 1NTKK 3HTKA 1L4AC 3VOPA 1ZLLA 1DEBA 2O01H 2Q3IA 2E43A 5KJ7A 5BU5A 2YKQA 3V2RA 1VPCA 1JY3P 2BASA 5AVUB 2R3CA 2A45G 3WMM0 2Z5HA 3EFGA 1KILD 3U1CA 1RE3A 1ZN5A 3MIWA 1LTAC 3HUSB 1URQA 2R5DA 3M06A 4WBAA 5AW9B 1GL2D 1MFZA 1SQVK 1URQB 4N78D 2NPSC 1IFIA 3SWFA 1H88A 5AW8B 1M7LA 3M9HA 1X79B 1GL2C 1G1JA 1N2DC 1FOSF 2CPSA 2WWWA 3PP5A 2C0WA 1JCDA 1JOCA 2KB7P 1DX7A 1L4AB 5APXA 1GK6A 1N7LA 3BRVB 5AVXB 4GKGA 2O1JA 5APUA 1JTHA 4I1LA 2C9NY 1S9KE 1GU5A 3KDPB 1JTHB 2ZXEB 1YYCA 3MD0A 5APSA 1WT6A 3P7KA 5BU8B 3B8EB 1NO4A 1IFJA 1KILA 3BASA 1YTZI 2N1TC 2OARA 1GD2E 3CL3D 5AW5B 1ZR4A 3GHGA 3R2PA 1JMMA 3TNUA 1SQPK 2HODA 3A7OA 2R32A 3E1IA 2WITA 3GHGB 4M3LA 1FJPA 1GL2B 1T3UA 2ZFCA 2HODB 2XDJA 3RL0C 3OA7A 1L0LK 1SLQA 2IFMA 1MUUA 1SQXK 1LWUA 1L0NK 4ZKUA 2J59M 1RF1A 3TK1A 1IFMA 2Z4EA 5AW2B 5CJ4A 3NTNA 3KYQA 1RE4A 4B86A 3NMDA 1LTIC 3L4FA 2HPCB 4OH8B 1FBMA 5CMZA 4Y99C 3IFMA 3M0AA 4WY4A 1SVFA 2KSJA 1N7SD 2KP8A 2CPBA 4JF7A 3M0DA 2N1TB 3OJAB 2H8PD 3P32A 1HWTC 3NXSA 1N7SC 5CCHA 1EQ7A 1M1JC 2H43A 3IR9A 2PAJA 1CI6A 1LTBC 1LT9A 1MV8A 5AVWB 5APVA 3RL0B 2HG5D 3C9IA 5AW4B 3HD7A 2XZRA 1LT9B 1JNMA 4N6JA 3V2NA 3HE4B 3B5ND 1A02F 5AVSB 2WPQA 1CSBA 1NOHA 4Y99B 3B5NC 2HYNA 2MJZA 1JY2O 4RESB 1HJBA 1NTMK 2I1JA 1RY3A 5APWA 3HUSA 1N7SB 4DOJA 2NPSD 2W27A 2WPSA 4HYTB 1E5WA 1M1JB 4IFDK 4I6MC 2P1JA 5AW6B 3OAKA 2Z5IA 1FZEA 1LTJC 1T8ZA 2FYZA 1N73C 2POHA 1RF0A 3M91A 1FDMA 1L4AA 2I1KA 4AUWA 5AW0B 1NKNA 1XTCC 3B5NB 2FKWB 3HE5B 3BATA 4ZKPA 3MUDA 1FJKA 3TYYA 4WB4A 2OYHC 3A3YB 2N1TD 5APTA 4LLHA 1IFNA 3I5CA 1SFCC 1FZCC 3VMYA 1GDTA 2Q5UA 3VP9A 4XE5B 2NPSA 2YO2A 1LTGC 1H8AA 1JO5A 3RL0D 2NPSB 2WT7A 1GL2A 2P2UA 1LTJB 3V4WA 1N73B 1FZGA 2WT7B 1GU4A 3V2QA 1PFIA 2L5GB 3MTUE 3H32A 3A5TA 2YO3A 1HVVA 1GZLA 3H32B 1S9KD 2HPCA 2JJLA 2OYHA 5CCGD 2OYHB 4W7ZA 2A45I 3V4QA 2XNXA 1H89A 5CCGC 1HGZA 4AYCA 2WSCH 3V2PA 2N1TA 2WTYA 1FZBA 1AQ5A 1JY3O 1FZCB 1KFNA 2C0XA 4W80A 2KYVA 1J1DC 2LKMA 2YNYA 3O8ZA 1NH4A 1YTZT 2W6BA 4KHXA 5AVQB 4C7NB 2GUVA 3LIDA 1JCCA 2A45H 5KJ7D 1N86A 1LGHB 3KPEA 5AVTB 1X9VA 5KJ7C 3HE4A 5AW3B 1VDFA 1G2CB 2FFDC 3TSIA 3VTPC 1NU1K 5AW7B 5APYA 1Z56A 1RE3C 1W2EA 4GIFA 2P67A 1HBWA 1SP4A 4IFMA 2OYIC 1HGVA 1JY2N 4O9BA 1ZR2A 1T3JA 5AVZB 1LTSC 3N7NA 1T2KD 1J1DB 1AFOA 1N7SA 1HTLC 2YKOA 3L36A 4N78E 1M1JA 2GUSA 1T2KC 2IX7C 4IFFA 3U1AA 1FAVA 1GW4A 3RK2C 2O1KA 2HLOA 3UIAA 1X8YA 1HUCA 3HTKB 5AVRB 1G1IA 1IFDA 3CI9A 2IPPA 3RK3D 2FFDA 1J2JB 2XV5A 3VMZA 5CJ0A 1MZ9A 3U59A 3A2AA 4EOTA 1FOSE 2FFDB 3H6PA 3RK3C 2OYIA 3B5NA 1A02J 3HE5A 5AVYB 1QL1A 1KILC 2OYIB 3BVHA 2KOGA 1GK4A 1IK9A 1OXZA 1SFCD 4LC1A 4JYCA 1NTZK 3V5BA 3GHGC 4HH2A 5AVVB 4I2LC 1NHLA 3CLQA 3HRNA 4C46A 3T97A 1J1EC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A45 H;  1LT9 A;  1N86 A;  2HPC B;  2A45 G;  2FFD B;  3GHG A;  2OYH B;  1LT9 B;  2A45 I;  1RE3 A;  1LWU C;  2XNX A;  1LTJ A;  3HUS A;  1FZF A;  2OYI A;  2HOD A;  1N73 A;  1M1J A;  3E1I A;  1RF1 C;  1FZC A;  3GHG B;  1FZA A;  1LTJ B;  1JY2 P;  3HUS B;  1N73 B;  1FZB A;  2OYI B;  1M1J B;  1T3U A;  1FZG A;  1JY3 O;  1RF0 C;  1JY3 N;  2HOD B;  3BVH A;  1FZC B;  2FFD C;  2HLO A;  1RE4 C;  1LT9 C;  3H32 A;  2OYH C;  1LWU A;  3GHG C;  1RF1 A;  1FZE A;  1RE3 C;  3H32 B;  1LWU B;  1LTJ C;  1W2E A;  3HUS C;  1N73 C;  2OYI C;  1M1J C;  2Z4E A;  1RF1 B;  1RF0 A;  2H43 A;  2Q9I A;  1JY3 P;  2HPC A;  1JY2 N;  1FZC C;  1JY2 O;  2FFD A;  1RE4 A;  2OYH A; 
#chains in the Genus database with same CATH topology
 3AE3 C;  2WSC J;  3P8C E;  3PHL A;  2P10 A;  1LTJ A;  3VYI A;  4U3F J;  1BDD A;  3KZI H;  1NU1 J;  2WMM A;  1NTM D;  1K8A Q;  1CW5 A;  1X0T A;  3KQG A;  3L73 E;  1SQV G;  4C7R A;  3R4Y A;  3D6Y A;  2NRG A;  1BE3 G;  5CCH D;  3I56 P;  3LIE A;  1Q7Y Q;  1SQQ K;  3A0B E;  1SFC A;  2PP6 A;  2Y9Z A;  5CCH C;  2IBZ E;  5KLV K;  1Q90 D;  2Q7C A;  3SWY A;  1PPJ D;  4PD4 E;  3JCU E;  2KNC A;  1FDI A;  4D6T E;  2P7J A;  4JYB A;  1DH3 A;  1KQG B;  5K5G B;  4ASV A;  3KHU A;  4BXL A;  2KSE A;  1L0L G;  3GLM A;  3HUS C;  3AE1 C;  1L0N G;  1YIT P;  1SQB K;  2FXM A;  1EDI A;  1WRG A;  2AEJ A;  1QL2 A;  3QWO C;  3ABV C;  2Q3I A;  1IFP A;  4U3F E;  5BU5 A;  1NU1 E;  5E79 E;  1ZRT D;  2R3C A;  2RMZ A;  3U1C A;  1RE3 A;  3IN6 A;  4OVN F;  3H1I G;  3WUT A;  3HUS B;  2R5D A;  2IBZ I;  1SQX J;  4WBA A;  1QX8 A;  3Q3D A;  1MFZ A;  5AW8 B;  3M9H A;  1T6A A;  1VQ7 P;  1S72 P;  2KUB A;  2RKL A;  4PD4 I;  1G1J A;  3WU2 E;  1EZV D;  1VQ6 P;  3A0B H;  4MN4 C;  1NTM G;  1AA0 A;  2O1J A;  1JTH A;  3BCC J;  4HJG H;  1S9K E;  1YYC A;  3MD0 A;  1BGY J;  2W83 C;  4PD4 H;  3JCU H;  1MFT A;  1IFJ A;  2ZVO B;  3BAS A;  3Q5R A;  1YTZ I;  2OAR A;  5AW5 B;  3Q5P A;  1S5L X;  2WVR A;  2AEM A;  1SQP K;  4OWF A;  2R32 A;  1M57 D;  3H1H G;  3RL0 C;  3OA7 A;  4UB8 H;  2IFM A;  5KAF E;  2KLU A;  1YI2 P;  1R8E A;  1IFM A;  3E7K A;  4B86 A;  1LTI C;  3L73 D;  3D70 A;  5CMZ A;  4Y99 C;  4JBZ A;  3IFM A;  3M0A A;  1LNQ A;  4CPG A;  4HKZ H;  1ZXG A;  1PP9 J;  3OJA B;  3P32 A;  1HWT C;  2IBZ D;  3NXS A;  5CCH A;  1EQ7 A;  5E79 H;  1AVO A;  4ASW A;  1LTB C;  3IR9 A;  5APV A;  3RL0 B;  1VQ5 P;  4PV1 D;  5AW4 B;  1LT9 B;  2JWA A;  1JB0 J;  4PV1 C;  1KN7 A;  3V2N A;  2Y0E A;  3C1L A;  2WPQ A;  4Y99 B;  3BCC E;  3WU2 H;  3PTZ A;  1RY3 A;  2V4H A;  1QGK B;  3HUS A;  4DOJ A;  3CCR P;  2NPS D;  2W27 A;  2ZT9 C;  1L0L J;  1YQ4 C;  4I6M C;  2QSI A;  1EZV G;  1FZE A;  1T8Z A;  1N73 C;  2POH A;  4PV1 B;  1FDM A;  2Y9Y A;  1BSN A;  2P58 A;  4U3F D;  5B5E E;  1EXJ A;  2BEZ F;  1NU1 D;  3O6Q A;  5AW0 B;  3CX5 H;  1NKN A;  1XTC C;  2FKW B;  5KAF H;  3BAT A;  4Y28 J;  1KMI Z;  1UIX A;  5APT A;  4LLH A;  1IFN A;  2QJK C;  2ZT9 B;  2QVA A;  1LT1 A;  1BE3 E;  2NPS B;  2WT7 A;  1QVG O;  2P2U A;  1KB9 E;  1ZP0 C;  3V4W A;  1N73 B;  1PFI A;  2YO3 A;  1SS1 A;  3L73 G;  1S9K D;  4GOF A;  3GMA A;  4H13 D;  1FC2 C;  4TLF A;  3FGA D;  1Y47 A;  2A45 I;  1Q2N A;  2HR3 A;  4RJT A;  2IBZ G;  4AYC A;  2WTY A;  2OTJ P;  2C0X A;  2LKM A;  2YNY A;  4WWI A;  2W6B A;  1L0L E;  2ZXX A;  3S9O A;  4C7N B;  2QJY C;  2A45 H;  3H1H J;  3L74 J;  3KPE A;  5AVT B;  3AE5 C;  1HJ0 A;  1NU1 K;  1OVR A;  2ZYA A;  1W2E A;  5B5E H;  5AVZ B;  1LTS C;  1AFO A;  1SQX D;  2GUS A;  1KB9 I;  1GW4 A;  3RK2 C;  2JKV A;  1K73 Q;  1NU1 G;  5C39 A;  1PL5 A;  2W6J H;  3A2A A;  1FOS E;  3BCC D;  1KB9 H;  1RQV A;  2B89 A;  5AVY B;  1BGY D;  1SFC D;  3ZDM A;  3AEE C;  4HH2 A;  5AVV B;  1ZOY C;  4C46 A;  3T97 A;  3L72 J;  1J1E C;  3RK2 B;  3VMX A;  3ITK A;  1N73 A;  3RBX A;  1JMB A;  3VP8 A;  2VRS A;  2QIW A;  1FDO A;  3S4R A;  1RE4 C;  3H1H E;  3L74 E;  4WY4 D;  5BVZ A;  3CCV P;  3TDK A;  1Q82 Q;  3AEA C;  2IFN A;  4WY4 C;  3CC2 P;  1KZU B;  1KFM A;  1CZQ A;  2M3B A;  2WPR A;  2W6A A;  1PP9 D;  3MGN A;  1E79 H;  1NWQ A;  3I55 P;  2FXO A;  1S5L E;  2O3J A;  3TNU B;  1NGM B;  1PIX A;  4BRY A;  1SFC B;  1J1E B;  2QRX A;  1LTT C;  1Y8A A;  4C7N A;  1KQL A;  4W7Y A;  1KYO E;  2Q9I A;  2C9L Y;  2SPZ A;  3AEC C;  2WSE H;  4EYY Q;  2R5B A;  4WY4 B;  2H88 C;  3L37 A;  2N9B A;  4DZO A;  2FYU K;  3CME P;  2QM8 A;  5TIS E;  3FXD A;  1SQX G;  5KTB A;  1YJ9 P;  1QVF O;  1L0L D;  2LR2 A;  3M9Q A;  3VN0 A;  5APQ A;  3L72 E;  4WVZ A;  3G3Z A;  3Q2Y A;  1RF0 C;  2QE7 H;  4R4L A;  1EDL A;  4YXD C;  4QMA A;  2YKQ A;  1S3J A;  3V2R A;  1VPC A;  3A0H E;  1OW6 A;  2LXB A;  2G8Y A;  1BGY G;  2A45 G;  3MUD C;  3H1J J;  5H2F E;  1URQ A;  3M06 A;  3GF7 A;  5AW9 B;  1SQV K;  1OX3 A;  4Z1M H;  1H88 A;  3AE8 C;  1KC8 Q;  2YIU C;  1KYO I;  1N2D C;  1OFC X;  2CPS A;  2WWW A;  2C0W A;  4DCK A;  1FE6 A;  2KB7 P;  5APX A;  1AJY A;  1GK6 A;  1S5L H;  4YPC A;  1YIJ P;  1GU5 A;  1JTH B;  1DIP A;  3P7K A;  1KYO H;  3B8E B;  1PP9 G;  2N1T C;  3CC7 P;  3CL3 D;  3AE2 C;  1OW7 A;  3CWB J;  3TNU A;  2OGU A;  2HOD A;  3A7O A;  2JDI H;  2WIT A;  1NTK J;  3PH0 A;  1FJP A;  1T3U A;  2YIU B;  5TJH A;  1L0L K;  5TIS H;  1L0N K;  4ZKU A;  4IL6 X;  3H1H D;  3L74 D;  1EZV I;  5AW2 B;  5CJ4 A;  1RE4 A;  4PJ0 E;  1EXI A;  1U57 A;  2OYO A;  4WY4 A;  4K3A A;  5EFW B;  4GDO A;  1N7S D;  2KP8 A;  2ZYD A;  4JF7 A;  3H1J E;  2N1T B;  4NPF X;  1RH5 B;  4L76 A;  1N7S C;  3A0H H;  2R44 A;  2H43 A;  1YBK A;  2PAJ A;  5H2F H;  1OVU A;  1KYO D;  1EDK A;  2XZR A;  3RL0 g;  1HF9 A;  2KS1 B;  3G9R A;  3B5N D;  2E75 C;  2XND H;  2K3R A;  1M8O B;  3SWK A;  4YTP C;  2KZJ A;  3B5N C;  2HYN A;  3CCQ P;  3E1R A;  1HJB A;  1NTM K;  1KQF B;  3FWL A;  3FX0 A;  1N7S B;  2B9B A;  3CCM P;  1EC5 A;  1NAY A;  1AV1 A;  3GW6 A;  2PFX A;  3CWB E;  3L72 D;  3OAK A;  2Z5I A;  1P84 D;  1NTK E;  1RF0 A;  3AEG C;  1Q86 Q;  3G6E P;  3B5N B;  3O6Q B;  3MUD A;  4WB4 A;  2QA4 P;  3A3Y B;  3PRJ A;  4GOD A;  1JEK A;  1FZC C;  1H8A A;  1VQM P;  1JO5 A;  3RL0 D;  1FZG A;  2WT7 B;  2JR8 A;  4RO0 A;  3L74 G;  3V2Q A;  1GU4 A;  3H32 A;  3A5T A;  1Y9B A;  1GZL A;  3GG2 A;  2OYH A;  1BCC J;  3SFE C;  1IK7 A;  2XNX A;  1M90 Q;  1H89 A;  1HGZ A;  2WSC H;  2N1T A;  2O01 J;  3B4S A;  2K88 A;  1AQ5 A;  1FZC B;  4W80 A;  2KYV A;  1J1D C;  1YTZ T;  4KHX A;  3AEB C;  5AVQ B;  2KK7 A;  2UWJ E;  1SQX E;  1JCC A;  5KJ7 D;  1N86 A;  4ZMD A;  2IDB A;  2RH0 A;  1LGH B;  2KS1 A;  5KJ7 C;  4YXW H;  4DT0 A;  2WSS H;  1G2C B;  1OVV A;  1NTZ J;  3W67 A;  3TSI A;  3VTP C;  5AW7 B;  1Z56 A;  3K5B A;  2D2C C;  1QEX A;  3H1J D;  2P67 A;  2V7Q J;  1JY2 N;  1J1D B;  3G4S P;  1BGY E;  1VL2 A;  2ZT9 D;  1N7S A;  1HTL C;  3L36 A;  4N78 E;  3L72 G;  1FAV A;  2HLO A;  3H1K J;  1X8Y A;  3HTK B;  3AE9 C;  2IPP A;  5CJ0 A;  1SQQ J;  3C8V A;  3U59 A;  4EOT A;  4H44 D;  1OW8 A;  3B5N A;  1A02 J;  2D2C B;  4KJM A;  5KLV J;  1QL1 A;  1KIL C;  2KOG A;  2KZI A;  4H44 C;  1GK4 A;  4LC1 A;  3V5B A;  3GHG C;  1VQL P;  2ZVN B;  1DEE G;  3CWB D;  3B71 A;  1PP9 E;  3IF4 A;  4K35 A;  1NTK D;  3T97 B;  3H25 A;  1RF1 C;  2Q1K A;  2M8R A;  4AQR D;  2E74 C;  4UB6 E;  2B88 A;  2R3S A;  1KIL B;  3S1K A;  3M0D C;  1IC2 A;  4H44 B;  5KKZ C;  1FZC A;  3HD7 D;  4GT1 A;  1JY3 N;  4LGD E;  1S4X A;  2QJK B;  4BRY B;  3HD7 C;  2FYN C;  1RF1 B;  4EDF A;  5CBO A;  3N4X A;  4IL6 E;  1R5L A;  3H1K E;  3II6 A;  1GMJ A;  2E74 B;  1GTW A;  1G2C A;  1SQQ E;  2E42 A;  3H1J G;  2QM7 A;  1Q81 Q;  1URQ D;  3L35 A;  5KKZ B;  2GM4 A;  5CHX A;  1XTG B;  2YXR B;  1URQ C;  3KXD A;  3EQ2 A;  4H0L D;  3RK2 D;  3HD7 B;  2HFE D;  2M5A A;  2FYN B;  4H0L C;  1HH0 A;  3CD6 P;  1NTK K;  3HTK A;  2QJY B;  3CXH E;  3AE6 C;  1ZLL A;  2O01 H;  2RN0 A;  2E43 A;  5KJ7 A;  5B66 E;  4NPD A;  2BAS A;  1PGO A;  3WMM 0;  1SQP J;  2Z5H A;  1ZN5 A;  4A7P A;  3CCJ P;  1URQ B;  4N78 D;  4UB6 H;  3CWB G;  3SWF A;  2I8D A;  1M7L A;  1NTK G;  3L71 J;  4XFJ A;  1FOS F;  4H0L B;  3PP5 A;  3D6Z A;  3JC2 2;  1JCD A;  3L70 J;  3BRV B;  5AVX B;  5APU A;  2JP3 A;  2KXP B;  3KDP B;  3CC4 P;  5APS A;  2E76 C;  5BU8 B;  1BCC D;  2G3A A;  1KIL A;  2ZJS E;  4BWN A;  2E5T A;  3GHG A;  2Q3E A;  3R2P A;  4M3L A;  2ZFC A;  2HOD B;  2XDJ A;  1SLQ A;  1BSH A;  1SQX K;  2B87 B;  3CXH I;  2J59 M;  1RF1 A;  3TK1 A;  3VMA A;  2FBW C;  2Z4E A;  3FWN A;  1OIP A;  1FBM A;  4RKU J;  1NTZ D;  3FXE A;  2E76 B;  1SVF A;  2KSJ A;  1D7M A;  1AQT A;  3CXH H;  3M0D A;  1ZME C;  1SQP E;  4JPZ B;  5B66 H;  2PRR A;  3CCS P;  2LXC B;  1X22 A;  2A06 D;  5AVW B;  1MV8 A;  1RQU A;  3HD7 A;  3GF3 A;  1VQ9 P;  3H1K D;  4N6J A;  3HE4 B;  1P84 E;  3L70 E;  3RK3 E;  1SQQ D;  1CSB A;  1NOH A;  3H1L J;  1JY2 O;  2I1J A;  1VQP P;  5KLV D;  4HYT B;  1E5W A;  4IFD K;  5AW6 B;  4D6T J;  1S1C X;  3AE7 C;  2AXC A;  3CXH D;  2WSF J;  3M91 A;  3RBZ A;  2I1K A;  4AUW A;  3EFF K;  2QG4 A;  3MZW B;  3Q1M A;  2K1A A;  1BCC G;  3TYY A;  2OYH C;  1U7M A;  2N1T D;  2IYP A;  4U7J A;  2CK3 H;  3I5C A;  1MKM A;  4XE5 B;  3SSU A;  1W2B O;  3LW5 J;  2B87 A;  1FS0 E;  3MTU E;  1P84 I;  3L75 J;  3H32 B;  4ZNC A;  1NTZ G;  2JJL A;  5CCG D;  2OYH B;  4W7Z A;  1N8R Q;  1R5S A;  3H1L E;  5CCG C;  1P84 H;  1JY3 O;  2A06 G;  1LP1 B;  3O8Z A;  2GUV A;  3H1K G;  3CCU P;  1YHQ P;  2N9Y B;  2E75 D;  1X9V A;  2BEQ D;  1SQQ G;  2ZYG A;  3HE4 A;  5AW3 B;  1VDF A;  1VQ8 P;  4UB8 E;  1K05 A;  5KLV G;  4GIF A;  1SQP D;  4IFM A;  2H89 C;  1HGV A;  1KIL E;  2IZ1 A;  4O9B A;  2KIK A;  1T3J A;  2O01 N;  3N7N A;  2YKO A;  3QH9 A;  2IX7 C;  3EWK A;  4GOE A;  5KAI E;  1NJI Q;  3L71 D;  1HUC A;  5AVR B;  1K04 A;  2OTK E;  1IFD A;  3CI9 A;  3L70 D;  3RK3 D;  2FFD A;  2XV5 A;  3VMZ A;  1MZ9 A;  2KI7 B;  3H6P A;  1SQB G;  3L75 E;  2BCC J;  2E75 B;  3RK3 C;  3G71 P;  2OYI A;  2W8Z A;  3TGU G;  1PGQ A;  3MP7 B;  4JYC A;  4I2L C;  3TF5 A;  4PJ0 H;  3CCL P;  3M9B A;  1LWU C;  2KLV A;  1PZQ A;  1IO4 A;  1ZW0 A;  2XKM A;  1JY2 P;  2XU6 A;  2FYU J;  2GA1 A;  3P8M C;  4HB1 A;  3BRT B;  3RK3 B;  1YJW P;  3CPW O;  1OWA A;  3WUV A;  1NAF A;  2Y0C A;  4EIJ A;  1IZN B;  2WSF H;  1IJD B;  1U7J A;  3P8C D;  3USS A;  2L91 A;  1PPJ G;  1LP1 A;  2YKP A;  1WMK A;  4XA4 A;  5AW1 B;  2Q6Q A;  3CX5 E;  4N3Y B;  1LT9 C;  2JEE A;  1LWU B;  2K37 A;  1PGP A;  3SFD C;  1ZV8 A;  1GW3 A;  5KAI H;  1FU1 A;  1FZA A;  1SQV J;  1SQP G;  2D2C D;  5KLI C;  2BCC E;  1BE3 J;  3H1L D;  1QLE D;  3LW5 H;  1NKZ B;  3AED C;  5CCG A;  2YMY A;  2AEF A;  2K9J B;  2WZ7 A;  1CI6 B;  4PD4 D;  1JUN A;  3L71 G;  1FZF A;  1L4A D;  1KQS O;  3NFQ A;  3WUU A;  2J58 A;  4D6T D;  2H7H A;  3L70 G;  2M5A B;  1L4A C;  2M3E A;  3VOP A;  1DEB A;  2AXT E;  2WPV B;  1JY3 P;  3AEF C;  2FYU E;  1H0T B;  5AVU B;  3EFG A;  5KLI B;  3D71 A;  1KIL D;  3MIW A;  1LTA C;  1EDJ A;  1L0N J;  1GL2 D;  3CX5 I;  1BCC E;  2NPS C;  1IFI A;  2Y0D A;  1KD1 Q;  2QEX P;  1VQN P;  1X79 B;  1GL2 C;  1NYH A;  1JOC A;  1DX7 A;  1L4A B;  1N7L A;  4GKG A;  4I1L A;  2E74 D;  2C9N Y;  3L75 D;  1DD4 A;  3W68 A;  2DW3 A;  2ZXE B;  1WT6 A;  4DJG A;  2JO1 A;  2WSE J;  1SQB J;  4OGQ D;  1NO4 A;  1SQV E;  1L2P A;  3H1I J;  1GD2 E;  1NTZ E;  3TGU J;  1ZR4 A;  4OGQ C;  1JMM A;  3E1I A;  3GHG B;  1VQK P;  1GL2 B;  5GTI E;  1MUU A;  2A06 E;  1LWU A;  1NTM J;  3NTN A;  3KYQ A;  2ZAE B;  3NMD A;  3L4F A;  2HPC B;  1DD3 A;  4OH8 B;  4H13 C;  5L8R J;  3H1L G;  2IZ0 A;  2CPB A;  3CCE P;  2H8P D;  2AXT H;  4OGQ B;  3CX5 D;  2K9J A;  3F89 A;  1M1J C;  5KLV E;  1L0N E;  1CI6 A;  1LT9 A;  4D6T G;  2HG5 D;  3C9I A;  1S2E A;  2J5U A;  1JNM A;  3PLN A;  1YJN P;  1A02 F;  3MHV A;  1NVO A;  5AVS B;  4H13 B;  1H0T A;  2BCC D;  1AVY A;  2MJZ A;  2YMK A;  2NZ2 A;  4RES B;  5APW A;  1OZH A;  1SQB E;  3OW2 O;  2WPS A;  3H1I E;  1M1J B;  2W90 A;  3TGU E;  2IYO A;  2OTL P;  3Q5S A;  3PJS K;  2P1J A;  2JWD A;  3JSV C;  4U3F G;  4I7Z C;  3AE4 C;  1LTJ C;  2FYZ A;  3F5H A;  1L4A A;  2ITA A;  3L75 G;  5CBN A;  2V7Q H;  2FYU D;  1KOR A;  1NTM E;  1VQO P;  1KV4 A;  5GTI H;  3HE5 B;  4ZKP A;  2E76 D;  3IAO A;  2YXQ B;  5DJU B;  1FJK A;  2FXP A;  1SFC C;  4IL6 H;  4NPE A;  3VMY A;  1GDT A;  2Q5U A;  3VP9 A;  1YQ3 C;  1KTM A;  2NPS A;  2YO2 A;  1LTG C;  4I7Z B;  1GL2 A;  1USE A;  5GTH E;  4L73 A;  2K9Y A;  1LTJ B;  1USD A;  1PPJ E;  4L75 A;  2L5G B;  2OQQ A;  1VF5 D;  1HVV A;  1M1K Q;  2PGD A;  2HPC A;  2QJP C;  1VF5 C;  3V6I A;  1M56 D;  1SQV D;  1OMI A;  3V4Q A;  1BE3 D;  3V2P A;  1FZB A;  4KT0 J;  1KFN A;  1KB9 D;  3KZI E;  1NH4 A;  4EI2 A;  1BDC A;  1LJ2 A;  1JM0 A;  3RGU A;  1PV3 A;  1RHZ B;  3LID A;  2KNC B;  1UII A;  3L71 E;  1PGJ A;  3L73 J;  1W5C E;  2FFD C;  2BCC G;  2QJP B;  1VF5 B;  5APY A;  1ZRT E;  1RE3 C;  1HBW A;  1SP4 A;  2OYI C;  1ZR2 A;  2MKV A;  5DJT B;  1T2K D;  1VQ4 P;  1L0N D;  4L74 A;  1M1J A;  4JQ0 D;  1T2K C;  4IFF A;  3U1A A;  2O1K A;  3UIA A;  3CMA P;  2E5Y A;  1G1I A;  3BCC G;  1EZV E;  2FYU G;  1J2J B;  4R4M A;  2M0B A;  2FFD B;  1K9M Q;  4TT3 H;  5GTH H;  2FY8 A;  3HE5 A;  2OYI B;  3BVH A;  1SQB D;  1TU3 F;  1IK9 A;  1OXZ A;  4IOI H;  1NTZ K;  3H1I D;  2WQY C;  5M1B A;  3TGU D;  1NHL A;  3CLQ A;  3HRN A; 
#chains in the Genus database with same CATH homology
 3RK2 B;  3P8C E;  3M9B A;  1LWU C;  1LTJ A;  3VMX A;  3VYI A;  2KLV A;  1N73 A;  1RF1 C;  1IO4 A;  2XKM A;  1JY2 P;  3VP8 A;  2VRS A;  2XU6 A;  2M8R A;  1RE4 C;  4AQR D;  4WY4 D;  5BVZ A;  3P8M C;  1CW5 A;  3BRT B;  3RK3 B;  3KQG A;  4C7R A;  1OWA A;  2IFN A;  4WY4 C;  1KZU B;  1KFM A;  1KIL B;  1CZQ A;  1NAF A;  5CCH D;  3M0D C;  2M3B A;  3LIE A;  4EIJ A;  2WPR A;  1SQQ K;  1IC2 A;  2W6A A;  2WSF H;  3MGN A;  1IJD B;  3P8C D;  1NWQ A;  1SFC A;  2PP6 A;  1FZC A;  5CCH C;  3HD7 D;  3TNU B;  4GT1 A;  2YKP A;  4XA4 A;  5AW1 B;  1JY3 N;  4N3Y B;  1SFC B;  4LGD E;  1J1E B;  1LT9 C;  5KLV K;  1LTT C;  2JEE A;  2Q7C A;  3HD7 C;  4C7N A;  1KQL A;  4W7Y A;  3SWY A;  1LWU B;  1RF1 B;  2Q9I A;  3N4X A;  2C9L Y;  3II6 A;  1ZV8 A;  1GW3 A;  2WSE H;  2P7J A;  2R5B A;  1GTW A;  1FU1 A;  1FZA A;  1G2C A;  2E42 A;  4WY4 B;  4JYB A;  2QM7 A;  1DH3 A;  3L37 A;  2N9B A;  4DZO A;  2FYU K;  1URQ D;  3LW5 H;  1NKZ B;  2QM8 A;  3L35 A;  5CCG A;  2GM4 A;  5CHX A;  2YMY A;  1XTG B;  3HUS C;  1SQB K;  2FXM A;  5KTB A;  2WZ7 A;  1URQ C;  3EQ2 A;  1CI6 B;  1JUN A;  3RK2 D;  3M9Q A;  3VN0 A;  1FZF A;  1WRG A;  1L4A D;  3HD7 B;  3NFQ A;  2HFE D;  5APQ A;  2J58 A;  2H7H A;  3G3Z A;  1HH0 A;  1RF0 C;  1QL2 A;  1NTK K;  3HTK A;  1L4A C;  3VOP A;  1ZLL A;  1DEB A;  2O01 H;  2Q3I A;  2E43 A;  5KJ7 A;  5BU5 A;  2YKQ A;  3V2R A;  1VPC A;  1JY3 P;  2BAS A;  5AVU B;  2R3C A;  2A45 G;  3WMM 0;  2Z5H A;  3EFG A;  1KIL D;  3U1C A;  1RE3 A;  1ZN5 A;  3MIW A;  1LTA C;  3HUS B;  1URQ A;  2R5D A;  3M06 A;  4WBA A;  5AW9 B;  1GL2 D;  1MFZ A;  1SQV K;  1URQ B;  4N78 D;  2NPS C;  1IFI A;  3SWF A;  1H88 A;  5AW8 B;  1M7L A;  3M9H A;  1X79 B;  1GL2 C;  1G1J A;  1N2D C;  1FOS F;  2CPS A;  2WWW A;  3PP5 A;  2C0W A;  1JCD A;  1JOC A;  2KB7 P;  1DX7 A;  1L4A B;  5APX A;  1GK6 A;  1N7L A;  3BRV B;  5AVX B;  4GKG A;  2O1J A;  5APU A;  1JTH A;  4I1L A;  2C9N Y;  1S9K E;  1GU5 A;  3KDP B;  1JTH B;  2ZXE B;  1YYC A;  3MD0 A;  5APS A;  1WT6 A;  3P7K A;  5BU8 B;  3B8E B;  1NO4 A;  1IFJ A;  1KIL A;  3BAS A;  1YTZ I;  2N1T C;  2OAR A;  1GD2 E;  3CL3 D;  5AW5 B;  1ZR4 A;  3GHG A;  3R2P A;  1JMM A;  3TNU A;  1SQP K;  2HOD A;  3A7O A;  2R32 A;  3E1I A;  2WIT A;  3GHG B;  4M3L A;  1FJP A;  1GL2 B;  1T3U A;  2ZFC A;  2HOD B;  2XDJ A;  3RL0 C;  3OA7 A;  1L0L K;  1SLQ A;  2IFM A;  1MUU A;  1SQX K;  1LWU A;  1L0N K;  4ZKU A;  2J59 M;  1RF1 A;  3TK1 A;  1IFM A;  2Z4E A;  5AW2 B;  5CJ4 A;  3NTN A;  3KYQ A;  1RE4 A;  4B86 A;  3NMD A;  1LTI C;  3L4F A;  2HPC B;  4OH8 B;  1FBM A;  5CMZ A;  4Y99 C;  3IFM A;  3M0A A;  4WY4 A;  1SVF A;  2KSJ A;  1N7S D;  2KP8 A;  2CPB A;  4JF7 A;  3M0D A;  2N1T B;  3OJA B;  2H8P D;  3P32 A;  1HWT C;  3NXS A;  1N7S C;  5CCH A;  1EQ7 A;  1M1J C;  2H43 A;  3IR9 A;  2PAJ A;  1CI6 A;  1LTB C;  1LT9 A;  1MV8 A;  5AVW B;  5APV A;  3RL0 B;  2HG5 D;  3C9I A;  5AW4 B;  3HD7 A;  2XZR A;  1LT9 B;  1JNM A;  4N6J A;  3V2N A;  3HE4 B;  3B5N D;  1A02 F;  5AVS B;  2WPQ A;  1CSB A;  1NOH A;  4Y99 B;  3B5N C;  2HYN A;  2MJZ A;  1JY2 O;  4RES B;  1HJB A;  1NTM K;  2I1J A;  1RY3 A;  5APW A;  3HUS A;  1N7S B;  4DOJ A;  2NPS D;  2W27 A;  2WPS A;  4HYT B;  1E5W A;  1M1J B;  4IFD K;  4I6M C;  2P1J A;  5AW6 B;  3OAK A;  2Z5I A;  1FZE A;  1LTJ C;  1T8Z A;  2FYZ A;  1N73 C;  2POH A;  1RF0 A;  3M91 A;  1FDM A;  1L4A A;  2I1K A;  4AUW A;  5AW0 B;  1NKN A;  1XTC C;  3B5N B;  2FKW B;  3HE5 B;  3BAT A;  4ZKP A;  3MUD A;  1FJK A;  3TYY A;  4WB4 A;  2OYH C;  3A3Y B;  2N1T D;  5APT A;  4LLH A;  1IFN A;  3I5C A;  1SFC C;  1FZC C;  3VMY A;  1GDT A;  2Q5U A;  3VP9 A;  4XE5 B;  2NPS A;  2YO2 A;  1LTG C;  1H8A A;  1JO5 A;  3RL0 D;  2NPS B;  2WT7 A;  1GL2 A;  2P2U A;  1LTJ B;  3V4W A;  1N73 B;  1FZG A;  2WT7 B;  1GU4 A;  3V2Q A;  1PFI A;  2L5G B;  3MTU E;  3H32 A;  3A5T A;  2YO3 A;  1HVV A;  1GZL A;  3H32 B;  1S9K D;  2HPC A;  2JJL A;  2OYH A;  5CCG D;  2OYH B;  4W7Z A;  2A45 I;  3V4Q A;  2XNX A;  1H89 A;  5CCG C;  1HGZ A;  4AYC A;  2WSC H;  3V2P A;  2N1T A;  2WTY A;  1FZB A;  1AQ5 A;  1JY3 O;  1FZC B;  1KFN A;  2C0X A;  4W80 A;  2KYV A;  1J1D C;  2LKM A;  2YNY A;  3O8Z A;  1NH4 A;  1YTZ T;  2W6B A;  4KHX A;  5AVQ B;  4C7N B;  2GUV A;  3LID A;  1JCC A;  2A45 H;  5KJ7 D;  1N86 A;  1LGH B;  3KPE A;  5AVT B;  1X9V A;  5KJ7 C;  3HE4 A;  5AW3 B;  1VDF A;  1G2C B;  2FFD C;  3TSI A;  3VTP C;  1NU1 K;  5AW7 B;  5APY A;  1Z56 A;  1RE3 C;  1W2E A;  4GIF A;  2P67 A;  1HBW A;  1SP4 A;  4IFM A;  2OYI C;  1HGV A;  1JY2 N;  4O9B A;  1ZR2 A;  1T3J A;  5AVZ B;  1LTS C;  3N7N A;  1T2K D;  1J1D B;  1AFO A;  1N7S A;  1HTL C;  2YKO A;  3L36 A;  4N78 E;  1M1J A;  2GUS A;  1T2K C;  2IX7 C;  4IFF A;  3U1A A;  1FAV A;  1GW4 A;  3RK2 C;  2O1K A;  2HLO A;  3UIA A;  1X8Y A;  1HUC A;  3HTK B;  5AVR B;  1G1I A;  1IFD A;  3CI9 A;  2IPP A;  3RK3 D;  2FFD A;  1J2J B;  2XV5 A;  3VMZ A;  5CJ0 A;  1MZ9 A;  3U59 A;  3A2A A;  4EOT A;  1FOS E;  2FFD B;  3H6P A;  3RK3 C;  2OYI A;  3B5N A;  1A02 J;  3HE5 A;  5AVY B;  1QL1 A;  1KIL C;  2OYI B;  3BVH A;  2KOG A;  1GK4 A;  1IK9 A;  1OXZ A;  1SFC D;  4LC1 A;  4JYC A;  1NTZ K;  3V5B A;  3GHG C;  4HH2 A;  5AVV B;  4I2L C;  1NHL A;  3CLQ A;  3HRN A;  4C46 A;  3T97 A;  1J1E C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...