2Q9IA

Crystal structure of d-dimer from human fibrin complexed with met-his-arg-pro-tyr-amide.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
67
structure length
67
Chain Sequence
VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
publication title Probing the beta-chain hole of fibrinogen with synthetic peptides that differ at their amino termini
pubmed doi rcsb
total genus 23
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2q9iA00
2OYIB 2HPCA 1LTJC 1M1JC 2A45G 1JY3P 2HODA 3GHGA 1N73B 1RF0C 1FZAA 2OYHC 2FFDA 1RE3A 1JY3N 3HUSC 1RF1A 3HUSA 1N73A 2OYIA 1FZEA 1LT9B 1FZGA 3GHGC 1LWUB 2FFDC 2H43A 1RE3C 1RF1C 2OYIC 1JY3O 1LT9A 1LWUA 2Q9IA 1T3UA 1N73C 1FZCB 3H32B 2FFDB 1JY2P 1RE4A 2HLOA 3BVHA 1LT9C 3H32A 1LWUC 1N86A 2A45H 1FZFA 1LTJB 1JY2N 1M1JB 2HODB 1FZCA 3E1IA 2OYHB 2XNXA 1RE4C 1M1JA 3HUSB 1FZCC 1W2EA 1LTJA 2Z4EA 1JY2O 1RF0A 2OYHA 2HPCB 2A45I 3GHGB 1FZBA 1RF1B
chains in the Genus database with same CATH superfamily
2E75B 1SFCB 2KNCB 3H1LJ 3FWLA 3BATA 1KQLA 2P67A 1JY2N 2OYHB 5H2FE 4H0LD 1PPJG 3USSA 1Q7YQ 2O1JA 1U7JA 3A7OA 5CCHC 1PP9D 1EDLA 1L4AC 3GLMA 1BDDA 1R8EA 2WT7B 5AVYB 1OVVA 1FE6A 4QMAA 3WU2E 3L74D 1LTJC 1GL2C 4I2LC 3AEFC 3L71E 3S4RA 1WT6A 3B5ND 5B66E 1FZCB 3NTNA 5APUA 1NU1G 4HB1A 2XKMA 2WPQA 1FS0E 1BDCA 4B86A 2IBZG 3HRNA 3TDKA 1Y9BA 3G9RA 3TNUB 1QGKB 4XE5B 1W5CE 2G3AA 4IFMA 2FFDC 1PV3A 1JEKA 3NMDA 2BASA 3F89A 2Q5UA 4C7NA 1K9MQ 5AVRB 4WBAA 3H1KG 5KLVK 3Q5PA 3R2PA 1IC2A 4WY4B 2LKMA 2WSSH 1IFDA 2N9BA 3CCSP 3M9HA 1K04A 1K73Q 2BCCG 2FYNC 1ZOYC 1HUCA 4L74A 3B5NA 4AUWA 3CXHE 2PGDA 2ZVOB 3HE4A 3KHUA 1SQPJ 1YTZT 1L4AD 2ZVNB 3CWBD 1HWTC 3KDPB 1R5SA 1JMBA 1PP9G 1GK4A 1SQBE 1ZLLA 3AECC 2A06E 1OXZA 3C8VA 2QJKB 4KJMA 3EFGA 1L2PA 4A7PA 1OFCX 1N73C 1XTCC 2J59M 4H13C 1VQKP 3L74G 2GUVA 3PH0A 4DOJA 3SWYA 2OYIB 1DH3A 4D6TE 3VMXA 2I1KA 1J1EC 2I1JA 1ZR4A 3G6EP 4IL6X 2H89C 2PFXA 3B4SA 3UIAA 1S5LH 1NTME 3MUDC 3L71D 3MTUE 3P7KA 1YHQP 1IK9A 1L4AA 1SQXE 5BU8B 1H89A 3P8CE 2PRRA 4R4LA 4MN4C 2NZ2A 4KT0J 1YJNP 2E75C 4NPEA 1VQOP 2Q3EA 2Q3IA 1VDFA 2K37A 4WB4A 3T97A 3D6ZA 2YXQB 3M0DC 1FAVA 3O6QB 3AE1C 2W83C 2OYHC 1G1JA 2W6JH 4Z1MH 1NTKD 2H43A 2KYVA 1LWUA 3AE7C 5APXA 4OVNF 3A0BH 3B71A 3H1JE 1LTIC 3L75E 2E76C 1OWAA 1IFIA 5M1BA 1NU1J 4L75A 4U3FJ 3HUSA 3E1RA 2JKVA 4YXDC 2OARA 2B88A 3LW5H 2ZYDA 1QL1A 3CWBG 4JPZB 3BASA 5B5EE 4KHXA 1KTMA 4C46A 1KN7A 4JF7A 1FZCC 2FYZA 5APWA 3BRTB 3HD7A 2KLVA 4ZNCA 3V2QA 1RE3A 5AVTB 5AW0B 1JO5A 1HH0A 4YTPC 1BE3D 2Q7CA 3AEGC 2ZAEB 3I5CA 1SQVE 2IBZI 2W6AA 2BCCJ 1KB9D 4PD4H 4OGQB 3WUTA 4PD4I 2YMYA 3L4FA 4WY4C 1P84H 1SQBK 2AXCA 2YXRB 3H1HE 3AE3C 1N86A 1P84I 3L70D 2E75D 1M7LA 1SFCD 1K05A 3WUVA 1X8YA 4D6TD 2OTKE 1A02J 2R44A 1N73A 3CCJP 1PP9J 3H1IE 2G8YA 1FJKA 1JY3O 4XA4A 1LNQA 4LGDE 3PHLA 2YO2A 5TISH 1BGYG 2B87A 4R4MA 2OQQA 1L0LD 2H8PD 2WSFJ 2ZT9B 3L74J 2HODA 1NTKG 1SQXD 4EDFA 2P7JA 5AW9B 2BEQD 3P8CD 1Q86Q 3RL0g 5GTHH 2IPPA 1GTWA 2WITA 1M57D 2QJKC 3JCUH 3MUDA 2FYUG 5AW5B 2R5BA 1LT9B 2J58A 2WSFH 3HE5A 2OYIC 1SFCA 2KNCA 3L75D 3M0AA 2GUSA 1FBMA 1NYHA 2Q1KA 2ZXEB 1SQPK 1SQQD 1AFOA 1T2KC 4BXLA 2D2CC 2L5GB 3L35A 1BE3G 3K5BA 3RL0C 3PTZA 1KYOD 1N8RQ 1M56D 1JUNA 4I6MC 4WY4D 3CCMP 1FZFA 4BRYB 3CD6P 2WT7A 4GDOA 2IYOA 4AQRD 4I1LA 2HPCB 1NHLA 1HGVA 4JBZA 5AVXB 2FYNB 3IR9A 1IFJA 1NAYA 2KP8A 3N7NA 3L70G 4HH2A 3VP8A 1KMIZ 1SQVD 4IOIH 1MFZA 1AQ5A 4D6TG 1YJ9P 5TJHA 4JYCA 3EQ2A 1NH4A 1J2JB 1GK6A 1PGQA 3TNUA 5KLVE 1FOSE 1YYCA 1VQ8P 3KZIE 2DW3A 1SS1A 2OYOA 2QRXA 3CX5E 1AA0A 1L0LG 1SQXG 2AXTH 1PGOA 4WY4A 3OJAB 2OTLP 1J1DB 3H1ID 4OH8B 3PLNA 4H13B 1QEXA 3O8ZA 2KLUA 1VQ7P 3L36A 1N2DC 4NPDA 3MD0A 3BCCE 4I7ZB 2W90A 1RF0C 2QVAA 1T2KD 1NU1K 5E79H 3L75G 5AVSB 3D71A 1OW7A 1GW4A 3Q2YA 5AVWB 1NKNA 1SQQG 1M1KQ 1YQ3C 1D7MA 3OA7A 1NTZD 1JTHB 2E5YA 1BGYJ 3WU2H 5KJ7C 2XU6A 1KQGB 3CCQP 1NTKJ 2JO1A 2O01N 3Q5RA 1HVVA 1JY2P 3TK1A 3WMM0 2C9NY 1BCCJ 1EZVI 1FZBA 2A45G 1G1IA 2FYUJ 1Q90D 4RESB 2WPSA 1SQVG 1JM0A 2ZT9C 1JCCA 2E76B 1USDA 1N7LA 2K9JB 3GW6A 1OVRA 3KYQA 3LIDA 1X22A 4IL6H 1VF5B 4C7RA 4H44B 5GTIE 3FXDA 3AE2C 1BE3J 3MP7B 2VRSA 1ZP0C 2YIUB 1LT9C 3VYIA 5AW4B 1RF1B 3H1IG 1YQ4C 5CBNA 1JY3N 1ZW0A 5KLVD 3CC7P 2K9YA 1VQ6P 1VQ9P 2M3EA 1URQB 2JWAA 4OGQD 2M5AB 1LT1A 2KZJA 4TT3H 1YI2P 1GW3A 4ASWA 3L70J 3V2NA 3IF4A 2WWWA 4IFDK 4UB6H 1JCDA 1KB9H 2WMMA 1U7MA 1HF9A 5AVZB 5KJ7D 1KB9I 1LTBC 1NTZG 3BCCD 2Z5IA 2J5UA 2SPZA 2C0WA 2N1TC 1L0LJ 1KFNA 3ZDMA 3L72D 5CCHD 3R4YA 1Q82Q 5KLIC 4GODA 2HR3A 1L0NJ 4HKZH 1RE4A 2ZT9D 4RJTA 4N6JA 1CSBA 3RBZA 2WPVB 2HG5D 1ZXGA 3I55P 1S9KE 4K3AA 5KAIH 1R5LA 1RQVA 1GL2D 2XDJA 1J1DC 2LXCB 3L75J 1NOHA 1SQQJ 1KORA 3M91A 5KJ7A 3V2PA 1KILB 4LC1A 5CMZA 3E7KA 2AEMA 3GG2A 1OX3A 3AEAC 2E5TA 4I7ZC 1KQFB 1USEA 1N7SB 2V4HA 1NJIQ 2D2CB 1FJPA 1G2CB 1QVFO 3RK3B 1E5WA 5CCHA 3RL0B 3U59A 5KLVG 2H7HA 2CK3H 1IO4A 1CW5A 3SWFA 3U1CA 5KAFH 2KIKA 3JSVC 2XV5A 2ITAA 2O3JA 1KYOH 3A0HH 1KV4A 2CPBA 1LTJA 2XZRA 3CCRP 1GL2A 1KYOI 1AQTA 1FOSF 2IX7C 1SQPE 5BVZA 3EWKA 2YKOA 3M9BA 4O9BA 3BCCG 5APYA 2A45H 1VQLP 3L72G 2HYNA 1YBKA 2FFDA 3D70A 3H1IJ 1VPCA 4C7NB 1LTTC 1VF5C 4H44C 2E43A 1OZHA 1Z56A 2HLOA 1S5LE 1DD3A 2IDBA 3VN0A 1NTKK 4BRYA 4UB8H 3CXHD 4H13D 2YIUC 2FXPA 2HPCA 3H1KJ 4YPCA 1JMMA 3CCEP 1QLED 1RF1C 1PGJA 1VQMP 2FYUK 1H88A 2R3SA 3B5NB 4M3LA 1URQC 1H0TB 3V4WA 1NTZJ 1SQBD 2UWJE 1T3JA 1S9KD 2A06D 3A0BE 1EDJA 3B8EB 3W68A 1LP1B 1KQSO 1M1JB 1PIXA 1ZRTE 3II6A 2P1JA 1IFPA 1HBWA 1KC8Q 3L71G 4L76A 1FU1A 1ZMEC 1EC5A 2YKPA 5K5GB 3OAKA 5KKZC 3L73E 3V4QA 1DX7A 2KZIA 1EQ7A 3GF7A 3G71P 2FXOA 1VQNP 1NU1E 1KILE 4U3FE 2QIWA 1NTMD 2WSCJ 2E76D 2IBZE 1H8AA 2W27A 5EFWB 3GHGC 3CMEP 3AE4C 1HTLC 3CCLP 3RK3E 4PD4E 1VF5D 4H44D 2NPSC 4ASVA 5CBOA 1JOCA 2KK7A 2KI7B 5C39A 1HGZA 3SWKA 1JTHA 1P84E 3C9IA 1SLQA 4N78E 2WSCH 1OMIA 1L0LK 2FKWB 1KILC 3H1JD 3MHVA 3T97B 3M0DA 1GMJA 2BCCE 2Y0CA 1L0NK 1LTGC 2OYHA 3W67A 1N7SC 1DEEG 1URQD 4PV1B 3RK3C 1MV8A 1S4XA 3LIEA 2E42A 5APTA 3H32B 2R5DA 2HFED 2LXBA 2QG4A 1SQBG 3HUSB 3KZIH 3AE9C 3CCUP 4DZOA 2A06G 4CPGA 1T8ZA 3ITKA 1SQQK 3JCUE 3L72J 4HYTB 3V6IA 3JC22 1YITP 3H6PA 3A2AA 1GDTA 1FZCA 2N1TB 3HD7B 3CWBJ 1Y47A 2Z4EA 3L74E 5KLIB 5AVVB 1RY3A 1S2EA 4XFJA 2FXMA 3S1KA 1YJWP 1NO4A 3H25A 3H1HD 4WWIA 1VQPP 3V2RA 1IJDB 1ZRTD 2QSIA 2M5AA 1NTMG 3E1IA 4PJ0H 2KSEA 3AEEC 3V5BA 2C9LY 2QE7H 1VQ5P 1CI6B 3OW2O 3L73D 2IZ0A 3HTKB 2AEFA 4EI2A 3NXSA 5AW7B 1KILD 1S3JA 1Q2NA 4U3FD 2Y0DA 2YO3A 2H88C 2IBZD 4RKUJ 3MIWA 3B5NC 5H2FH 2K1AA 1N7SD 3L71J 3PRJA 3RK2B 2B9BA 3H1JG 1XTGB 2D2CD 3RK3D 4PD4D 3RL0D 5AW3B 2K88A 1Q81Q 2B87B 1HJ0A 3SFDC 1EXIA 3P32A 1P84D 2W6BA 1M1JC 1OW6A 4N78D 2WTYA 2RN0A 1PL5A 3TSIA 2AXTE 3D6YA 5L8RJ 3IFMA 4GKGA 5B66H 2YNYA 1JB0J 2XNDH 4ZKUA 3HE5B 2OYIA 1ZR2A 1KILA 1NTZK 3ABVC 3CL3D 3TGUE 3VMYA 2KOGA 2L91A 2M8RA 3CC2P 1N7SA 5APQA 1G2CA 4EYYQ 1K8AQ 5E79E 1M8OB 1IFMA 2CPSA 2JP3A 2IYPA 1EDIA 2KS1B 2O1KA 3H1HG 3FGAD 3FX0A 3G4SP 1NVOA 1AJYA 1GU4A 1DIPA 2AEJA 1IFNA 4K35A 5BU5A 2POHA 2WVRA 1JY3P 3L73G 1SQBJ 1FZAA 3O6QA 4N3YB 1EZVE 3CXHH 1FDIA 1YTZI 3PP5A 4PV1C 3GF3A 5AW1B 5KTBA 3CXHI 3IAOA 4U3FG 1SVFA 1LWUC 2ZXXA 3CX5D 4WVZA 1X79B 2QM8A 1WMKA 3CCVP 1S1CX 1BGYE 4D6TJ 3HUSC 3P8MC 3H1LE 1NTKE 4Y99B 2IFMA 5CJ0A 1BCCE 4IL6E 3QH9A 1AVOA 5KKZB 1UIIA 1NTMJ 2FYUE 2I8DA 2IFNA 3HD7C 3I56P 3CI9A 2YKQA 3VTPC 2NRGA 1SQXJ 3C1LA 2Q6QA 2M0BA 1RE3C 2JR8A 2Q9IA 5CJ4A 3BVHA 4GIFA 1RF0A 3GHGB 5AW2B 4DCKA 5CCGC 1H0TA 2OTJP 1RQUA 3A3YB 5AVUB 1FC2C 2JDIH 1BE3E 2NPSB 1PFIA 2YMKA 3H1JJ 1LP1A 2QJYC 4UB6E 1M1JA 1KB9E 1KD1Q 1YIJP 4HJGH 2GA1A 3TGUD 3VP9A 4U7JA 1T3UA 5DJTB 3KPEA 4PV1D 3RK2C 1A02F 3L70E 3KXDA 4OWFA 1KZUB 2LR2A 4ZKPA 3N4XA 2V7QJ 1TU3F 1IK7A 2M3BA 1SQVJ 1QL2A 2RKLA 5B5EH 5KAIE 1L0LE 3FWNA 2E74B 1EZVD 2N1TD 4W80A 1WRGA 1ZV8A 3HD7D 2ZYGA 1LT9A 1L0NE 2QM7A 2ZFCA 1HJBA 2V7QH 1SFCC 3H1HJ 1S72P 1EDKA 3M9QA 3AE6C 2A45I 2FY8A 3AE8C 1BGYD 3L37A 3LW5J 1MUUA 5CCGD 3H1LD 2MKVA 4H0LB 3U1AA 1OVUA 3L73J 1U57A 3GMAA 2C0XA 1BCCD 4IFFA 1PZQA 2KB7P 3H32A 1IZNB 3SFEC 1SQQE 1JNMA 1LTAC 1DD4A 2FYUD 5KAFE 5AW8B 1GU5A 2IZ1A 3MGNA 4Y28J 1KYOE 1QX8A 2JWDA 3A0HE 1NGMB 1OIPA 1ZN5A 2QJPB 2GM4A 4EOTA 3SSUA 2R32A 2N1TA 3RK2D 1JY2O 2QA4P 1PGPA 4BWNA 3HE4B 3F5HA 4TLFA 3TGUG 2Y0EA 1KFMA 2WZ7A 2R3CA 1PPJE 5APSA 1LTSC 2JJLA 1OW8A 2W8ZA 2RH0A 4JYBA 4Y99C 2RMZA 5CCGA 1EXJA 1W2EA 3MZWB 1QVGO 4GOEA 2KUBA 3CPWO 2O01J 4JQ0D 2JEEA 1CZQA 3CLQA 2PP6A 1CI6A 3VOPA 1FDOA 4GT1A 1E79H 1NKZB 3HTKA 4UB8E 3VMZA 3VMAA 2XNXA 1GZLA 1FDMA 1EZVG 2KSJA 2WSEJ 1W2BO 2O01H 1S5LX 3S9OA 2P10A 2N9YB 1RHZB 1X9VA 1NWQA 1X0TA 3H1KE 3H1LG 1L4AB 1AVYA 4YXWH 3RGUA 1FZGA 1SQPD 3TYYA 1BCCG 3AEBC 5KLVJ 1L0ND 1NTMK 2WSEH 1SQXK 1LTJB 1GL2B 1NAFA 3WUUA 1VL2A 1NTZE 3RBXA 2P58A 2ZYAA 2OGUA 1T6AA 5DJUB 1LWUB 5TISE 3KQGA 2BEZF 4ZMDA 3TF5A 1RH5B 4LLHA 3AEDC 2K9JA 1BSNA 2Y9YA 2FFDB 3BCCJ 3CX5H 2Y9ZA 5GTHE 3A5TA 3CC4P 1FZEA 3CX5I 1PP9E 4W7YA 2KS1A 2E74C 3IN6A 1SP4A 1MZ9A 3Q5SA 1GD2E 4L73A 3AE5C 1Y8AA 3Q3DA 4EIJA 5AW6B 2MJZA 4W7ZA 5APVA 3PJSK 2K3RA 1RF1A 1PPJD 3CMAP 2FBWC 1VQ4P 4AYCA 1URQA 3FXEA 4H0LC 1AV1A 1UIXA 3NFQA 2NPSD 1SQVK 2QEXP 2QJYB 3TGUJ 1BSHA 5AVQB 1LGHB 1NU1D 4NPFX 4DJGA 2QJPC 3G3ZA 1SQPG 1N73B 1L0NG 2KXPB 1DEBA 4DT0A 2Z5HA 1LJ2A 2B89A 3Q1MA 1RE4C 3M06A 1J1EB 2PAJA 3H1KD 2HODB 3GHGA 1M90Q 1MKMA 3L72E 4GOFA 5CHXA 4OGQC 3BRVB 2WQYC 4PJ0E 5GTIH 2ZJSE 1MFTA 2NPSA 3QWOC 2P2UA 2E74D 4RO0A 3CWBE 2BCCD 2WPRA 3EFFK
chains in the Genus database with same CATH topology
2HPCA 2L5GB 3L35A 3A3YB 5AVUB 3RL0C 1JMMA 1SFCB 1RF1C 2NPSB 1PFIA 1JUNA 4I6MC 2FYUK 3BATA 1H88A 1KQLA 4WY4D 1FZFA 2P67A 1JY2N 3B5NB 4M3LA 2WT7A 2OYHB 1URQC 1M1JA 4AQRD 4I1LA 2HPCB 3V4WA 1NHLA 2O1JA 1HGVA 3A7OA 5CCHC 1T3JA 1S9KD 5AVXB 3B8EB 3IR9A 3VP9A 1IFJA 2KP8A 1L4AC 3N7NA 1T3UA 4HH2A 3VP8A 1MFZA 2WT7B 3KPEA 1M1JB 3RK2C 5AVYB 1A02F 3II6A 1AQ5A 2P1JA 1HBWA 4JYCA 3EQ2A 1KZUB 1FU1A 1LTJC 1NH4A 4ZKPA 1J2JB 1GL2C 4I2LC 3N4XA 1GK6A 3TNUA 2YKPA 3OAKA 1WT6A 1FOSE 3B5ND 1YYCA 3V4QA 1DX7A 1FZCB 3NTNA 5APUA 1EQ7A 2XKMA 2M3BA 2WPQA 1QL2A 4B86A 3HRNA 3TNUB 4WY4A 3OJAB 1J1DB 1H8AA 2W27A 4XE5B 2N1TD 3GHGC 4IFMA 4OH8B 4W80A 1WRGA 1ZV8A 2FFDC 3HD7D 3NMDA 1LT9A 2BASA 2QM7A 1HTLC 2ZFCA 1HJBA 2Q5UA 3O8ZA 4C7NA 1SFCC 5AVRB 4WBAA 3L36A 5KLVK 2NPSC 3R2PA 1N2DC 1JOCA 1IC2A 3M9QA 1HGZA 3MD0A 2A45I 4WY4B 2LKMA 3L37A 1IFDA 1JTHA 1MUUA 1RF0C 2N9BA 1T2KD 3C9IA 1SLQA 4N78E 1NU1K 5CCGD 2WSCH 3U1AA 3M9HA 5AVSB 1L0LK 1GW4A 2FKWB 2C0XA 1KILC 5AVWB 1NKNA 3M0DA 4IFFA 2KB7P 3H32A 1HUCA 1JNMA 1LTAC 3OA7A 1L0NK 1LTGC 3B5NA 2OYHA 4AUWA 1N7SC 1JTHB 1URQD 3HE4A 5AW8B 3RK3C 5KJ7C 1GU5A 2XU6A 3MGNA 1MV8A 3LIEA 2E42A 5APTA 3H32B 2R5DA 1ZN5A 2GM4A 1YTZT 4EOTA 1HVVA 1JY2P 3TK1A 3WMM0 1L4AD 2C9NY 2HFED 1HWTC 2R32A 2N1TA 3HUSB 3KDPB 3RK2D 4DZOA 1JY2O 1GK4A 1FZBA 2A45G 3HE4B 1ZLLA 1T8ZA 1G1IA 1OXZA 1KFMA 1SQQK 2WZ7A 2R3CA 4RESB 4HYTB 3EFGA 2WPSA 1JCCA 5APSA 1LTSC 2JJLA 1N73C 3H6PA 3A2AA 1N7LA 1GDTA 1XTCC 2J59M 1FZCA 2N1TB 3KYQA 4JYBA 4Y99C 5CCGA 3HD7B 3LIDA 1W2EA 2Z4EA 2GUVA 4DOJA 3SWYA 2OYIB 1DH3A 4C7RA 3VMXA 2I1KA 5AVVB 2JEEA 1CZQA 1J1EC 3CLQA 1RY3A 2I1JA 2PP6A 1ZR4A 1CI6A 3VOPA 2FXMA 4GT1A 1NO4A 2VRSA 1NKZB 3HTKA 3V2RA 3VMZA 1IJDB 1LT9C 3E1IA 2XNXA 3VYIA 1GZLA 3UIAA 1FDMA 5AW4B 3V5BA 1RF1B 2C9LY 2KSJA 3MTUE 3P7KA 1IK9A 1JY3N 1L4AA 1CI6B 5BU8B 1H89A 3P8CE 2O01H 1URQB 3HTKB 2Q3IA 1VDFA 4WB4A 3NXSA 5AW7B 3T97A 1KILD 1GW3A 3M0DC 1X9VA 3V2NA 2WWWA 4IFDK 2YO3A 1FAVA 1NWQA 1L4AB 3MIWA 3B5NC 2OYHC 1G1JA 1N7SD 1JCDA 1FZGA 3RK2B 3TYYA 1XTGB 2H43A 1NTMK 2WSEH 2KYVA 1LWUA 5AVZB 3RK3D 5KJ7D 5APXA 1LTBC 3RL0D 5AW3B 1LTIC 1SQXK 1LTJB 1GL2B 1NAFA 1OWAA 1IFIA 2Z5IA 3P32A 3HUSA 2C0WA 2N1TC 2W6BA 1M1JC 4N78D 1KFNA 2WTYA 1LWUB 2OARA 5CCHD 3LW5H 3TSIA 1QL1A 3BASA 3KQGA 1RE4A 4KHXA 4C46A 4LLHA 3IFMA 4GKGA 4N6JA 4JF7A 1CSBA 1FZCC 2FYZA 5APWA 2YNYA 3BRTB 3HD7A 2HG5D 2FFDB 4ZKUA 2KLVA 3V2QA 3A5TA 1S9KE 1RE3A 3HE5B 5AVTB 2OYIA 5AW0B 1FZEA 1ZR2A 1KILA 1JO5A 4W7YA 1HH0A 1NTZK 3CL3D 1GL2D 2XDJA 2Q7CA 1SP4A 3VMYA 1MZ9A 2KOGA 1GD2E 1J1DC 2M8RA 3I5CA 1N7SA 4EIJA 5AW6B 1NOHA 5APQA 2W6AA 2MJZA 1G2CA 3M91A 5KJ7A 1IFMA 2CPSA 4W7ZA 5APVA 3V2PA 1KILB 4LC1A 1RF1A 2YMYA 5CMZA 2O1KA 3L4FA 4WY4C 4AYCA 1SQBK 1N7SB 1URQA 1N86A 1M7LA 1GU4A 1FJPA 1IFNA 1G2CB 3RK3B 1E5WA 5CCHA 5BU5A 2POHA 1SFCD 3RL0B 3NFQA 3U59A 1X8YA 2H7HA 2NPSD 1A02J 1SQVK 1JY3P 1IO4A 1FZAA 1CW5A 3SWFA 3U1CA 1N73A 4N3YB 1YTZI 3PP5A 1FJKA 1JY3O 4XA4A 5AW1B 5KTBA 4LGDE 2XV5A 5AVQB 1SVFA 1LWUC 2YO2A 1LGHB 1X79B 2QM8A 2CPBA 1LTJA 2XZRA 1GL2A 2H8PD 3G3ZA 2HODA 1N73B 1FOSF 2P7JA 3HUSC 3P8MC 5AW9B 3P8CD 2IX7C 1DEBA 4Y99B 5BVZA 2IPPA 1GTWA 2WITA 2Z5HA 2IFMA 3M9BA 2YKOA 4O9BA 5CJ0A 5APYA 2A45H 3MUDA 1RE4C 3M06A 5AW5B 1J1EB 2PAJA 2HODB 2HYNA 2R5BA 3GHGA 2IFNA 3HD7C 2FFDA 3CI9A 2YKQA 3VTPC 1LT9B 2J58A 2WSFH 5CHXA 3BRVB 3HE5A 1RE3C 1VPCA 2OYIC 4C7NB 1SFCA 1LTTC 2Q9IA 2E43A 5CJ4A 2NPSA 1Z56A 2HLOA 2GUSA 3M0AA 3BVHA 1FBMA 2P2UA 2ZXEB 4GIFA 1SQPK 3VN0A 1NTKK 1AFOA 2WPRA 1RF0A 1T2KC 3GHGB 5AW2B 5CCGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OYI B;  2HPC A;  1LTJ C;  1M1J C;  2A45 G;  1JY3 P;  2HOD A;  3GHG A;  1N73 B;  1RF0 C;  1FZA A;  2OYH C;  2FFD A;  1RE3 A;  1JY3 N;  3HUS C;  1RF1 A;  3HUS A;  1N73 A;  2OYI A;  1FZE A;  1LT9 B;  1FZG A;  3GHG C;  1LWU B;  2FFD C;  2H43 A;  1RE3 C;  1RF1 C;  2OYI C;  1JY3 O;  1LT9 A;  1LWU A;  2Q9I A;  1T3U A;  1N73 C;  1FZC B;  3H32 B;  2FFD B;  1JY2 P;  1RE4 A;  2HLO A;  3BVH A;  1LT9 C;  3H32 A;  1LWU C;  1N86 A;  2A45 H;  1FZF A;  1LTJ B;  1JY2 N;  1M1J B;  2HOD B;  1FZC A;  3E1I A;  2OYH B;  2XNX A;  1RE4 C;  1M1J A;  3HUS B;  1FZC C;  1W2E A;  1LTJ A;  2Z4E A;  1JY2 O;  1RF0 A;  2OYH A;  2HPC B;  2A45 I;  3GHG B;  1FZB A;  1RF1 B; 
#chains in the Genus database with same CATH topology
 2E75 B;  1SFC B;  2KNC B;  3H1L J;  3FWL A;  3BAT A;  1KQL A;  2P67 A;  1JY2 N;  2OYH B;  5H2F E;  4H0L D;  1PPJ G;  3USS A;  1Q7Y Q;  2O1J A;  1U7J A;  3A7O A;  5CCH C;  1PP9 D;  1EDL A;  1L4A C;  3GLM A;  1BDD A;  1R8E A;  2WT7 B;  5AVY B;  1OVV A;  1FE6 A;  4QMA A;  3WU2 E;  3L74 D;  1LTJ C;  1GL2 C;  4I2L C;  3AEF C;  3L71 E;  3S4R A;  1WT6 A;  3B5N D;  5B66 E;  1FZC B;  3NTN A;  5APU A;  1NU1 G;  4HB1 A;  2XKM A;  2WPQ A;  1FS0 E;  1BDC A;  4B86 A;  2IBZ G;  3HRN A;  3TDK A;  1Y9B A;  3G9R A;  3TNU B;  1QGK B;  4XE5 B;  1W5C E;  2G3A A;  4IFM A;  2FFD C;  1PV3 A;  1JEK A;  3NMD A;  2BAS A;  3F89 A;  2Q5U A;  4C7N A;  1K9M Q;  5AVR B;  4WBA A;  3H1K G;  5KLV K;  3Q5P A;  3R2P A;  1IC2 A;  4WY4 B;  2LKM A;  2WSS H;  1IFD A;  2N9B A;  3CCS P;  3M9H A;  1K04 A;  1K73 Q;  2BCC G;  2FYN C;  1ZOY C;  1HUC A;  4L74 A;  3B5N A;  4AUW A;  3CXH E;  2PGD A;  2ZVO B;  3HE4 A;  3KHU A;  1SQP J;  1YTZ T;  1L4A D;  2ZVN B;  3CWB D;  1HWT C;  3KDP B;  1R5S A;  1JMB A;  1PP9 G;  1GK4 A;  1SQB E;  1ZLL A;  3AEC C;  2A06 E;  1OXZ A;  3C8V A;  2QJK B;  4KJM A;  3EFG A;  1L2P A;  4A7P A;  1OFC X;  1N73 C;  1XTC C;  2J59 M;  4H13 C;  1VQK P;  3L74 G;  2GUV A;  3PH0 A;  4DOJ A;  3SWY A;  2OYI B;  1DH3 A;  4D6T E;  3VMX A;  2I1K A;  1J1E C;  2I1J A;  1ZR4 A;  3G6E P;  4IL6 X;  2H89 C;  2PFX A;  3B4S A;  3UIA A;  1S5L H;  1NTM E;  3MUD C;  3L71 D;  3MTU E;  3P7K A;  1YHQ P;  1IK9 A;  1L4A A;  1SQX E;  5BU8 B;  1H89 A;  3P8C E;  2PRR A;  4R4L A;  4MN4 C;  2NZ2 A;  4KT0 J;  1YJN P;  2E75 C;  4NPE A;  1VQO P;  2Q3E A;  2Q3I A;  1VDF A;  2K37 A;  4WB4 A;  3T97 A;  3D6Z A;  2YXQ B;  3M0D C;  1FAV A;  3O6Q B;  3AE1 C;  2W83 C;  2OYH C;  1G1J A;  2W6J H;  4Z1M H;  1NTK D;  2H43 A;  2KYV A;  1LWU A;  3AE7 C;  5APX A;  4OVN F;  3A0B H;  3B71 A;  3H1J E;  1LTI C;  3L75 E;  2E76 C;  1OWA A;  1IFI A;  5M1B A;  1NU1 J;  4L75 A;  4U3F J;  3HUS A;  3E1R A;  2JKV A;  4YXD C;  2OAR A;  2B88 A;  3LW5 H;  2ZYD A;  1QL1 A;  3CWB G;  4JPZ B;  3BAS A;  5B5E E;  4KHX A;  1KTM A;  4C46 A;  1KN7 A;  4JF7 A;  1FZC C;  2FYZ A;  5APW A;  3BRT B;  3HD7 A;  2KLV A;  4ZNC A;  3V2Q A;  1RE3 A;  5AVT B;  5AW0 B;  1JO5 A;  1HH0 A;  4YTP C;  1BE3 D;  2Q7C A;  3AEG C;  2ZAE B;  3I5C A;  1SQV E;  2IBZ I;  2W6A A;  2BCC J;  1KB9 D;  4PD4 H;  4OGQ B;  3WUT A;  4PD4 I;  2YMY A;  3L4F A;  4WY4 C;  1P84 H;  1SQB K;  2AXC A;  2YXR B;  3H1H E;  3AE3 C;  1N86 A;  1P84 I;  3L70 D;  2E75 D;  1M7L A;  1SFC D;  1K05 A;  3WUV A;  1X8Y A;  4D6T D;  2OTK E;  1A02 J;  2R44 A;  1N73 A;  3CCJ P;  1PP9 J;  3H1I E;  2G8Y A;  1FJK A;  1JY3 O;  4XA4 A;  1LNQ A;  4LGD E;  3PHL A;  2YO2 A;  5TIS H;  1BGY G;  2B87 A;  4R4M A;  2OQQ A;  1L0L D;  2H8P D;  2WSF J;  2ZT9 B;  3L74 J;  2HOD A;  1NTK G;  1SQX D;  4EDF A;  2P7J A;  5AW9 B;  2BEQ D;  3P8C D;  1Q86 Q;  3RL0 g;  5GTH H;  2IPP A;  1GTW A;  2WIT A;  1M57 D;  2QJK C;  3JCU H;  3MUD A;  2FYU G;  5AW5 B;  2R5B A;  1LT9 B;  2J58 A;  2WSF H;  3HE5 A;  2OYI C;  1SFC A;  2KNC A;  3L75 D;  3M0A A;  2GUS A;  1FBM A;  1NYH A;  2Q1K A;  2ZXE B;  1SQP K;  1SQQ D;  1AFO A;  1T2K C;  4BXL A;  2D2C C;  2L5G B;  3L35 A;  1BE3 G;  3K5B A;  3RL0 C;  3PTZ A;  1KYO D;  1N8R Q;  1M56 D;  1JUN A;  4I6M C;  4WY4 D;  3CCM P;  1FZF A;  4BRY B;  3CD6 P;  2WT7 A;  4GDO A;  2IYO A;  4AQR D;  4I1L A;  2HPC B;  1NHL A;  1HGV A;  4JBZ A;  5AVX B;  2FYN B;  3IR9 A;  1IFJ A;  1NAY A;  2KP8 A;  3N7N A;  3L70 G;  4HH2 A;  3VP8 A;  1KMI Z;  1SQV D;  4IOI H;  1MFZ A;  1AQ5 A;  4D6T G;  1YJ9 P;  5TJH A;  4JYC A;  3EQ2 A;  1NH4 A;  1J2J B;  1GK6 A;  1PGQ A;  3TNU A;  5KLV E;  1FOS E;  1YYC A;  1VQ8 P;  3KZI E;  2DW3 A;  1SS1 A;  2OYO A;  2QRX A;  3CX5 E;  1AA0 A;  1L0L G;  1SQX G;  2AXT H;  1PGO A;  4WY4 A;  3OJA B;  2OTL P;  1J1D B;  3H1I D;  4OH8 B;  3PLN A;  4H13 B;  1QEX A;  3O8Z A;  2KLU A;  1VQ7 P;  3L36 A;  1N2D C;  4NPD A;  3MD0 A;  3BCC E;  4I7Z B;  2W90 A;  1RF0 C;  2QVA A;  1T2K D;  1NU1 K;  5E79 H;  3L75 G;  5AVS B;  3D71 A;  1OW7 A;  1GW4 A;  3Q2Y A;  5AVW B;  1NKN A;  1SQQ G;  1M1K Q;  1YQ3 C;  1D7M A;  3OA7 A;  1NTZ D;  1JTH B;  2E5Y A;  1BGY J;  3WU2 H;  5KJ7 C;  2XU6 A;  1KQG B;  3CCQ P;  1NTK J;  2JO1 A;  2O01 N;  3Q5R A;  1HVV A;  1JY2 P;  3TK1 A;  3WMM 0;  2C9N Y;  1BCC J;  1EZV I;  1FZB A;  2A45 G;  1G1I A;  2FYU J;  1Q90 D;  4RES B;  2WPS A;  1SQV G;  1JM0 A;  2ZT9 C;  1JCC A;  2E76 B;  1USD A;  1N7L A;  2K9J B;  3GW6 A;  1OVR A;  3KYQ A;  3LID A;  1X22 A;  4IL6 H;  1VF5 B;  4C7R A;  4H44 B;  5GTI E;  3FXD A;  3AE2 C;  1BE3 J;  3MP7 B;  2VRS A;  1ZP0 C;  2YIU B;  1LT9 C;  3VYI A;  5AW4 B;  1RF1 B;  3H1I G;  1YQ4 C;  5CBN A;  1JY3 N;  1ZW0 A;  5KLV D;  3CC7 P;  2K9Y A;  1VQ6 P;  1VQ9 P;  2M3E A;  1URQ B;  2JWA A;  4OGQ D;  2M5A B;  1LT1 A;  2KZJ A;  4TT3 H;  1YI2 P;  1GW3 A;  4ASW A;  3L70 J;  3V2N A;  3IF4 A;  2WWW A;  4IFD K;  4UB6 H;  1JCD A;  1KB9 H;  2WMM A;  1U7M A;  1HF9 A;  5AVZ B;  5KJ7 D;  1KB9 I;  1LTB C;  1NTZ G;  3BCC D;  2Z5I A;  2J5U A;  2SPZ A;  2C0W A;  2N1T C;  1L0L J;  1KFN A;  3ZDM A;  3L72 D;  5CCH D;  3R4Y A;  1Q82 Q;  5KLI C;  4GOD A;  2HR3 A;  1L0N J;  4HKZ H;  1RE4 A;  2ZT9 D;  4RJT A;  4N6J A;  1CSB A;  3RBZ A;  2WPV B;  2HG5 D;  1ZXG A;  3I55 P;  1S9K E;  4K3A A;  5KAI H;  1R5L A;  1RQV A;  1GL2 D;  2XDJ A;  1J1D C;  2LXC B;  3L75 J;  1NOH A;  1SQQ J;  1KOR A;  3M91 A;  5KJ7 A;  3V2P A;  1KIL B;  4LC1 A;  5CMZ A;  3E7K A;  2AEM A;  3GG2 A;  1OX3 A;  3AEA C;  2E5T A;  4I7Z C;  1KQF B;  1USE A;  1N7S B;  2V4H A;  1NJI Q;  2D2C B;  1FJP A;  1G2C B;  1QVF O;  3RK3 B;  1E5W A;  5CCH A;  3RL0 B;  3U59 A;  5KLV G;  2H7H A;  2CK3 H;  1IO4 A;  1CW5 A;  3SWF A;  3U1C A;  5KAF H;  2KIK A;  3JSV C;  2XV5 A;  2ITA A;  2O3J A;  1KYO H;  3A0H H;  1KV4 A;  2CPB A;  1LTJ A;  2XZR A;  3CCR P;  1GL2 A;  1KYO I;  1AQT A;  1FOS F;  2IX7 C;  1SQP E;  5BVZ A;  3EWK A;  2YKO A;  3M9B A;  4O9B A;  3BCC G;  5APY A;  2A45 H;  1VQL P;  3L72 G;  2HYN A;  1YBK A;  2FFD A;  3D70 A;  3H1I J;  1VPC A;  4C7N B;  1LTT C;  1VF5 C;  4H44 C;  2E43 A;  1OZH A;  1Z56 A;  2HLO A;  1S5L E;  1DD3 A;  2IDB A;  3VN0 A;  1NTK K;  4BRY A;  4UB8 H;  3CXH D;  4H13 D;  2YIU C;  2FXP A;  2HPC A;  3H1K J;  4YPC A;  1JMM A;  3CCE P;  1QLE D;  1RF1 C;  1PGJ A;  1VQM P;  2FYU K;  1H88 A;  2R3S A;  3B5N B;  4M3L A;  1URQ C;  1H0T B;  3V4W A;  1NTZ J;  1SQB D;  2UWJ E;  1T3J A;  1S9K D;  2A06 D;  3A0B E;  1EDJ A;  3B8E B;  3W68 A;  1LP1 B;  1KQS O;  1M1J B;  1PIX A;  1ZRT E;  3II6 A;  2P1J A;  1IFP A;  1HBW A;  1KC8 Q;  3L71 G;  4L76 A;  1FU1 A;  1ZME C;  1EC5 A;  2YKP A;  5K5G B;  3OAK A;  5KKZ C;  3L73 E;  3V4Q A;  1DX7 A;  2KZI A;  1EQ7 A;  3GF7 A;  3G71 P;  2FXO A;  1VQN P;  1NU1 E;  1KIL E;  4U3F E;  2QIW A;  1NTM D;  2WSC J;  2E76 D;  2IBZ E;  1H8A A;  2W27 A;  5EFW B;  3GHG C;  3CME P;  3AE4 C;  1HTL C;  3CCL P;  3RK3 E;  4PD4 E;  1VF5 D;  4H44 D;  2NPS C;  4ASV A;  5CBO A;  1JOC A;  2KK7 A;  2KI7 B;  5C39 A;  1HGZ A;  3SWK A;  1JTH A;  1P84 E;  3C9I A;  1SLQ A;  4N78 E;  2WSC H;  1OMI A;  1L0L K;  2FKW B;  1KIL C;  3H1J D;  3MHV A;  3T97 B;  3M0D A;  1GMJ A;  2BCC E;  2Y0C A;  1L0N K;  1LTG C;  2OYH A;  3W67 A;  1N7S C;  1DEE G;  1URQ D;  4PV1 B;  3RK3 C;  1MV8 A;  1S4X A;  3LIE A;  2E42 A;  5APT A;  3H32 B;  2R5D A;  2HFE D;  2LXB A;  2QG4 A;  1SQB G;  3HUS B;  3KZI H;  3AE9 C;  3CCU P;  4DZO A;  2A06 G;  4CPG A;  1T8Z A;  3ITK A;  1SQQ K;  3JCU E;  3L72 J;  4HYT B;  3V6I A;  3JC2 2;  1YIT P;  3H6P A;  3A2A A;  1GDT A;  1FZC A;  2N1T B;  3HD7 B;  3CWB J;  1Y47 A;  2Z4E A;  3L74 E;  5KLI B;  5AVV B;  1RY3 A;  1S2E A;  4XFJ A;  2FXM A;  3S1K A;  1YJW P;  1NO4 A;  3H25 A;  3H1H D;  4WWI A;  1VQP P;  3V2R A;  1IJD B;  1ZRT D;  2QSI A;  2M5A A;  1NTM G;  3E1I A;  4PJ0 H;  2KSE A;  3AEE C;  3V5B A;  2C9L Y;  2QE7 H;  1VQ5 P;  1CI6 B;  3OW2 O;  3L73 D;  2IZ0 A;  3HTK B;  2AEF A;  4EI2 A;  3NXS A;  5AW7 B;  1KIL D;  1S3J A;  1Q2N A;  4U3F D;  2Y0D A;  2YO3 A;  2H88 C;  2IBZ D;  4RKU J;  3MIW A;  3B5N C;  5H2F H;  2K1A A;  1N7S D;  3L71 J;  3PRJ A;  3RK2 B;  2B9B A;  3H1J G;  1XTG B;  2D2C D;  3RK3 D;  4PD4 D;  3RL0 D;  5AW3 B;  2K88 A;  1Q81 Q;  2B87 B;  1HJ0 A;  3SFD C;  1EXI A;  3P32 A;  1P84 D;  2W6B A;  1M1J C;  1OW6 A;  4N78 D;  2WTY A;  2RN0 A;  1PL5 A;  3TSI A;  2AXT E;  3D6Y A;  5L8R J;  3IFM A;  4GKG A;  5B66 H;  2YNY A;  1JB0 J;  2XND H;  4ZKU A;  3HE5 B;  2OYI A;  1ZR2 A;  1KIL A;  1NTZ K;  3ABV C;  3CL3 D;  3TGU E;  3VMY A;  2KOG A;  2L91 A;  2M8R A;  3CC2 P;  1N7S A;  5APQ A;  1G2C A;  4EYY Q;  1K8A Q;  5E79 E;  1M8O B;  1IFM A;  2CPS A;  2JP3 A;  2IYP A;  1EDI A;  2KS1 B;  2O1K A;  3H1H G;  3FGA D;  3FX0 A;  3G4S P;  1NVO A;  1AJY A;  1GU4 A;  1DIP A;  2AEJ A;  1IFN A;  4K35 A;  5BU5 A;  2POH A;  2WVR A;  1JY3 P;  3L73 G;  1SQB J;  1FZA A;  3O6Q A;  4N3Y B;  1EZV E;  3CXH H;  1FDI A;  1YTZ I;  3PP5 A;  4PV1 C;  3GF3 A;  5AW1 B;  5KTB A;  3CXH I;  3IAO A;  4U3F G;  1SVF A;  1LWU C;  2ZXX A;  3CX5 D;  4WVZ A;  1X79 B;  2QM8 A;  1WMK A;  3CCV P;  1S1C X;  1BGY E;  4D6T J;  3HUS C;  3P8M C;  3H1L E;  1NTK E;  4Y99 B;  2IFM A;  5CJ0 A;  1BCC E;  4IL6 E;  3QH9 A;  1AVO A;  5KKZ B;  1UII A;  1NTM J;  2FYU E;  2I8D A;  2IFN A;  3HD7 C;  3I56 P;  3CI9 A;  2YKQ A;  3VTP C;  2NRG A;  1SQX J;  3C1L A;  2Q6Q A;  2M0B A;  1RE3 C;  2JR8 A;  2Q9I A;  5CJ4 A;  3BVH A;  4GIF A;  1RF0 A;  3GHG B;  5AW2 B;  4DCK A;  5CCG C;  1H0T A;  2OTJ P;  1RQU A;  3A3Y B;  5AVU B;  1FC2 C;  2JDI H;  1BE3 E;  2NPS B;  1PFI A;  2YMK A;  3H1J J;  1LP1 A;  2QJY C;  4UB6 E;  1M1J A;  1KB9 E;  1KD1 Q;  1YIJ P;  4HJG H;  2GA1 A;  3TGU D;  3VP9 A;  4U7J A;  1T3U A;  5DJT B;  3KPE A;  4PV1 D;  3RK2 C;  1A02 F;  3L70 E;  3KXD A;  4OWF A;  1KZU B;  2LR2 A;  4ZKP A;  3N4X A;  2V7Q J;  1TU3 F;  1IK7 A;  2M3B A;  1SQV J;  1QL2 A;  2RKL A;  5B5E H;  5KAI E;  1L0L E;  3FWN A;  2E74 B;  1EZV D;  2N1T D;  4W80 A;  1WRG A;  1ZV8 A;  3HD7 D;  2ZYG A;  1LT9 A;  1L0N E;  2QM7 A;  2ZFC A;  1HJB A;  2V7Q H;  1SFC C;  3H1H J;  1S72 P;  1EDK A;  3M9Q A;  3AE6 C;  2A45 I;  2FY8 A;  3AE8 C;  1BGY D;  3L37 A;  3LW5 J;  1MUU A;  5CCG D;  3H1L D;  2MKV A;  4H0L B;  3U1A A;  1OVU A;  3L73 J;  1U57 A;  3GMA A;  2C0X A;  1BCC D;  4IFF A;  1PZQ A;  2KB7 P;  3H32 A;  1IZN B;  3SFE C;  1SQQ E;  1JNM A;  1LTA C;  1DD4 A;  2FYU D;  5KAF E;  5AW8 B;  1GU5 A;  2IZ1 A;  3MGN A;  4Y28 J;  1KYO E;  1QX8 A;  2JWD A;  3A0H E;  1NGM B;  1OIP A;  1ZN5 A;  2QJP B;  2GM4 A;  4EOT A;  3SSU A;  2R32 A;  2N1T A;  3RK2 D;  1JY2 O;  2QA4 P;  1PGP A;  4BWN A;  3HE4 B;  3F5H A;  4TLF A;  3TGU G;  2Y0E A;  1KFM A;  2WZ7 A;  2R3C A;  1PPJ E;  5APS A;  1LTS C;  2JJL A;  1OW8 A;  2W8Z A;  2RH0 A;  4JYB A;  4Y99 C;  2RMZ A;  5CCG A;  1EXJ A;  1W2E A;  3MZW B;  1QVG O;  4GOE A;  2KUB A;  3CPW O;  2O01 J;  4JQ0 D;  2JEE A;  1CZQ A;  3CLQ A;  2PP6 A;  1CI6 A;  3VOP A;  1FDO A;  4GT1 A;  1E79 H;  1NKZ B;  3HTK A;  4UB8 E;  3VMZ A;  3VMA A;  2XNX A;  1GZL A;  1FDM A;  1EZV G;  2KSJ A;  2WSE J;  1W2B O;  2O01 H;  1S5L X;  3S9O A;  2P10 A;  2N9Y B;  1RHZ B;  1X9V A;  1NWQ A;  1X0T A;  3H1K E;  3H1L G;  1L4A B;  1AVY A;  4YXW H;  3RGU A;  1FZG A;  1SQP D;  3TYY A;  1BCC G;  3AEB C;  5KLV J;  1L0N D;  1NTM K;  2WSE H;  1SQX K;  1LTJ B;  1GL2 B;  1NAF A;  3WUU A;  1VL2 A;  1NTZ E;  3RBX A;  2P58 A;  2ZYA A;  2OGU A;  1T6A A;  5DJU B;  1LWU B;  5TIS E;  3KQG A;  2BEZ F;  4ZMD A;  3TF5 A;  1RH5 B;  4LLH A;  3AED C;  2K9J A;  1BSN A;  2Y9Y A;  2FFD B;  3BCC J;  3CX5 H;  2Y9Z A;  5GTH E;  3A5T A;  3CC4 P;  1FZE A;  3CX5 I;  1PP9 E;  4W7Y A;  2KS1 A;  2E74 C;  3IN6 A;  1SP4 A;  1MZ9 A;  3Q5S A;  1GD2 E;  4L73 A;  3AE5 C;  1Y8A A;  3Q3D A;  4EIJ A;  5AW6 B;  2MJZ A;  4W7Z A;  5APV A;  3PJS K;  2K3R A;  1RF1 A;  1PPJ D;  3CMA P;  2FBW C;  1VQ4 P;  4AYC A;  1URQ A;  3FXE A;  4H0L C;  1AV1 A;  1UIX A;  3NFQ A;  2NPS D;  1SQV K;  2QEX P;  2QJY B;  3TGU J;  1BSH A;  5AVQ B;  1LGH B;  1NU1 D;  4NPF X;  4DJG A;  2QJP C;  3G3Z A;  1SQP G;  1N73 B;  1L0N G;  2KXP B;  1DEB A;  4DT0 A;  2Z5H A;  1LJ2 A;  2B89 A;  3Q1M A;  1RE4 C;  3M06 A;  1J1E B;  2PAJ A;  3H1K D;  2HOD B;  3GHG A;  1M90 Q;  1MKM A;  3L72 E;  4GOF A;  5CHX A;  4OGQ C;  3BRV B;  2WQY C;  4PJ0 E;  5GTI H;  2ZJS E;  1MFT A;  2NPS A;  3QWO C;  2P2U A;  2E74 D;  4RO0 A;  3CWB E;  2BCC D;  2WPR A;  3EFF K; 
#chains in the Genus database with same CATH homology
 2HPC A;  2L5G B;  3L35 A;  3A3Y B;  5AVU B;  3RL0 C;  1JMM A;  1SFC B;  1RF1 C;  2NPS B;  1PFI A;  1JUN A;  4I6M C;  2FYU K;  3BAT A;  1H88 A;  1KQL A;  4WY4 D;  1FZF A;  2P67 A;  1JY2 N;  3B5N B;  4M3L A;  2WT7 A;  2OYH B;  1URQ C;  1M1J A;  4AQR D;  4I1L A;  2HPC B;  3V4W A;  1NHL A;  2O1J A;  1HGV A;  3A7O A;  5CCH C;  1T3J A;  1S9K D;  5AVX B;  3B8E B;  3IR9 A;  3VP9 A;  1IFJ A;  2KP8 A;  1L4A C;  3N7N A;  1T3U A;  4HH2 A;  3VP8 A;  1MFZ A;  2WT7 B;  3KPE A;  1M1J B;  3RK2 C;  5AVY B;  1A02 F;  3II6 A;  1AQ5 A;  2P1J A;  1HBW A;  4JYC A;  3EQ2 A;  1KZU B;  1FU1 A;  1LTJ C;  1NH4 A;  4ZKP A;  1J2J B;  1GL2 C;  4I2L C;  3N4X A;  1GK6 A;  3TNU A;  2YKP A;  3OAK A;  1WT6 A;  1FOS E;  3B5N D;  1YYC A;  3V4Q A;  1DX7 A;  1FZC B;  3NTN A;  5APU A;  1EQ7 A;  2XKM A;  2M3B A;  2WPQ A;  1QL2 A;  4B86 A;  3HRN A;  3TNU B;  4WY4 A;  3OJA B;  1J1D B;  1H8A A;  2W27 A;  4XE5 B;  2N1T D;  3GHG C;  4IFM A;  4OH8 B;  4W80 A;  1WRG A;  1ZV8 A;  2FFD C;  3HD7 D;  3NMD A;  1LT9 A;  2BAS A;  2QM7 A;  1HTL C;  2ZFC A;  1HJB A;  2Q5U A;  3O8Z A;  4C7N A;  1SFC C;  5AVR B;  4WBA A;  3L36 A;  5KLV K;  2NPS C;  3R2P A;  1N2D C;  1JOC A;  1IC2 A;  3M9Q A;  1HGZ A;  3MD0 A;  2A45 I;  4WY4 B;  2LKM A;  3L37 A;  1IFD A;  1JTH A;  1MUU A;  1RF0 C;  2N9B A;  1T2K D;  3C9I A;  1SLQ A;  4N78 E;  1NU1 K;  5CCG D;  2WSC H;  3U1A A;  3M9H A;  5AVS B;  1L0L K;  1GW4 A;  2FKW B;  2C0X A;  1KIL C;  5AVW B;  1NKN A;  3M0D A;  4IFF A;  2KB7 P;  3H32 A;  1HUC A;  1JNM A;  1LTA C;  3OA7 A;  1L0N K;  1LTG C;  3B5N A;  2OYH A;  4AUW A;  1N7S C;  1JTH B;  1URQ D;  3HE4 A;  5AW8 B;  3RK3 C;  5KJ7 C;  1GU5 A;  2XU6 A;  3MGN A;  1MV8 A;  3LIE A;  2E42 A;  5APT A;  3H32 B;  2R5D A;  1ZN5 A;  2GM4 A;  1YTZ T;  4EOT A;  1HVV A;  1JY2 P;  3TK1 A;  3WMM 0;  1L4A D;  2C9N Y;  2HFE D;  1HWT C;  2R32 A;  2N1T A;  3HUS B;  3KDP B;  3RK2 D;  4DZO A;  1JY2 O;  1GK4 A;  1FZB A;  2A45 G;  3HE4 B;  1ZLL A;  1T8Z A;  1G1I A;  1OXZ A;  1KFM A;  1SQQ K;  2WZ7 A;  2R3C A;  4RES B;  4HYT B;  3EFG A;  2WPS A;  1JCC A;  5APS A;  1LTS C;  2JJL A;  1N73 C;  3H6P A;  3A2A A;  1N7L A;  1GDT A;  1XTC C;  2J59 M;  1FZC A;  2N1T B;  3KYQ A;  4JYB A;  4Y99 C;  5CCG A;  3HD7 B;  3LID A;  1W2E A;  2Z4E A;  2GUV A;  4DOJ A;  3SWY A;  2OYI B;  1DH3 A;  4C7R A;  3VMX A;  2I1K A;  5AVV B;  2JEE A;  1CZQ A;  1J1E C;  3CLQ A;  1RY3 A;  2I1J A;  2PP6 A;  1ZR4 A;  1CI6 A;  3VOP A;  2FXM A;  4GT1 A;  1NO4 A;  2VRS A;  1NKZ B;  3HTK A;  3V2R A;  3VMZ A;  1IJD B;  1LT9 C;  3E1I A;  2XNX A;  3VYI A;  1GZL A;  3UIA A;  1FDM A;  5AW4 B;  3V5B A;  1RF1 B;  2C9L Y;  2KSJ A;  3MTU E;  3P7K A;  1IK9 A;  1JY3 N;  1L4A A;  1CI6 B;  5BU8 B;  1H89 A;  3P8C E;  2O01 H;  1URQ B;  3HTK B;  2Q3I A;  1VDF A;  4WB4 A;  3NXS A;  5AW7 B;  3T97 A;  1KIL D;  1GW3 A;  3M0D C;  1X9V A;  3V2N A;  2WWW A;  4IFD K;  2YO3 A;  1FAV A;  1NWQ A;  1L4A B;  3MIW A;  3B5N C;  2OYH C;  1G1J A;  1N7S D;  1JCD A;  1FZG A;  3RK2 B;  3TYY A;  1XTG B;  2H43 A;  1NTM K;  2WSE H;  2KYV A;  1LWU A;  5AVZ B;  3RK3 D;  5KJ7 D;  5APX A;  1LTB C;  3RL0 D;  5AW3 B;  1LTI C;  1SQX K;  1LTJ B;  1GL2 B;  1NAF A;  1OWA A;  1IFI A;  2Z5I A;  3P32 A;  3HUS A;  2C0W A;  2N1T C;  2W6B A;  1M1J C;  4N78 D;  1KFN A;  2WTY A;  1LWU B;  2OAR A;  5CCH D;  3LW5 H;  3TSI A;  1QL1 A;  3BAS A;  3KQG A;  1RE4 A;  4KHX A;  4C46 A;  4LLH A;  3IFM A;  4GKG A;  4N6J A;  4JF7 A;  1CSB A;  1FZC C;  2FYZ A;  5APW A;  2YNY A;  3BRT B;  3HD7 A;  2HG5 D;  2FFD B;  4ZKU A;  2KLV A;  3V2Q A;  3A5T A;  1S9K E;  1RE3 A;  3HE5 B;  5AVT B;  2OYI A;  5AW0 B;  1FZE A;  1ZR2 A;  1KIL A;  1JO5 A;  4W7Y A;  1HH0 A;  1NTZ K;  3CL3 D;  1GL2 D;  2XDJ A;  2Q7C A;  1SP4 A;  3VMY A;  1MZ9 A;  2KOG A;  1GD2 E;  1J1D C;  2M8R A;  3I5C A;  1N7S A;  4EIJ A;  5AW6 B;  1NOH A;  5APQ A;  2W6A A;  2MJZ A;  1G2C A;  3M91 A;  5KJ7 A;  1IFM A;  2CPS A;  4W7Z A;  5APV A;  3V2P A;  1KIL B;  4LC1 A;  1RF1 A;  2YMY A;  5CMZ A;  2O1K A;  3L4F A;  4WY4 C;  4AYC A;  1SQB K;  1N7S B;  1URQ A;  1N86 A;  1M7L A;  1GU4 A;  1FJP A;  1IFN A;  1G2C B;  3RK3 B;  1E5W A;  5CCH A;  5BU5 A;  2POH A;  1SFC D;  3RL0 B;  3NFQ A;  3U59 A;  1X8Y A;  2H7H A;  2NPS D;  1A02 J;  1SQV K;  1JY3 P;  1IO4 A;  1FZA A;  1CW5 A;  3SWF A;  3U1C A;  1N73 A;  4N3Y B;  1YTZ I;  3PP5 A;  1FJK A;  1JY3 O;  4XA4 A;  5AW1 B;  5KTB A;  4LGD E;  2XV5 A;  5AVQ B;  1SVF A;  1LWU C;  2YO2 A;  1LGH B;  1X79 B;  2QM8 A;  2CPB A;  1LTJ A;  2XZR A;  1GL2 A;  2H8P D;  3G3Z A;  2HOD A;  1N73 B;  1FOS F;  2P7J A;  3HUS C;  3P8M C;  5AW9 B;  3P8C D;  2IX7 C;  1DEB A;  4Y99 B;  5BVZ A;  2IPP A;  1GTW A;  2WIT A;  2Z5H A;  2IFM A;  3M9B A;  2YKO A;  4O9B A;  5CJ0 A;  5APY A;  2A45 H;  3MUD A;  1RE4 C;  3M06 A;  5AW5 B;  1J1E B;  2PAJ A;  2HOD B;  2HYN A;  2R5B A;  3GHG A;  2IFN A;  3HD7 C;  2FFD A;  3CI9 A;  2YKQ A;  3VTP C;  1LT9 B;  2J58 A;  2WSF H;  5CHX A;  3BRV B;  3HE5 A;  1RE3 C;  1VPC A;  2OYI C;  4C7N B;  1SFC A;  1LTT C;  2Q9I A;  2E43 A;  5CJ4 A;  2NPS A;  1Z56 A;  2HLO A;  2GUS A;  3M0A A;  3BVH A;  1FBM A;  2P2U A;  2ZXE B;  4GIF A;  1SQP K;  3VN0 A;  1NTK K;  1AFO A;  2WPR A;  1RF0 A;  1T2K C;  3GHG B;  5AW2 B;  5CCG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...