1GK6A

Human vimentin coil 2b fragment linked to gcn4 leucine zipper (z2b)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
55
structure length
55
Chain Sequence
MKQLEDKVEELLSKNYHLENEVARLKKLVGDLLNVKMALDIEIATYRKLLEGEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VIMENTIN
publication title Conserved Segments 1A and 2B of the Intermediate Filament Dimer: Their Atomic Structures and Role in Filament Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 25
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gk6A00
1T2KC 2YNYA 4C7NA 5AVRB 3IR9A 3VMXA 1GD2E 2WWWA 5APXA 3A2AA 2R32A 4RESB 5AW2B 5AVQB 2IPPA 2Q3IA 2QM7A 2R5DA 3P32A 2H7HA 4KHXA 2E42A 2WPSA 2XZRA 4JYCA 3NXSA 3VYIA 1S9KE 3HTKA 3NMDA 1H88A 5AVUB 2ZFCA 2Z5HA 2Q7CA 2YO2A 5AVZB 1MUUA 3TNUA 3A3YB 2WPQA 3M06A 3HE4B 4I2LC 1GTWA 2QM8A 5AVYB 2C9LY 3L37A 3O8ZA 4GT1A 4M3LA 2C9NY 3A7OA 4EOTA 3T97A 3NTNA 1CZQA 3HE5B 1YYCA 5AVSB 1GK6A 4JYBA 1HWTC 3P7KA 5APVA 1DH3A 5APSA 3L36A 5AW3B 1HUCA 3M91A 2YO3A 1A02F 1CSBA 5APYA 3L35A 5AW6B 3M9BA 1T2KD 3I5CA 4HYTB 3TK1A 3VMZA 2VRSA 2P7JA 1KQLA 1H8AA 5APUA 3V4QA 5AVVB 3HE4A 4DZOA 3OAKA 4XE5B 5AW1B 1GK4A 2XU6A 1JNMA 2R5BA 1GU5A 1X8YA 3HE5A 5AVXB 1SP4A 2P67A 5AVTB 3M0DA 1OXZA 2W6AA 1GZLA 5AVWB 1J2JB 1MFZA 3SWFA 1JUNA 3V5BA 3A5TA 3VTPC 1A02J 2WPRA 2WT7B 1NWQA 1MV8A 1CI6B 3NFQA 3P8MC 5AW8B 3TYYA 2N9BA 2XV5A 4AQRD 1HBWA 2Q5UA 2WTYA 1G2CB 5APQA 1NAFA 3KQGA 4C46A 1OWAA 1FOSF 4C7NB 5CMZA 5AW7B 3LIDA 2BASA 2KP8A 2ZXEB 3KDPB 1S9KD 3VMYA 2W27A 3M9HA 4AUWA 1IO4A 3V4WA 5AW9B 4GKGA 5APWA 3M0AA 5AW4B 1HJBA 2JJLA 2P2UA 2E43A 1FAVA 3LIEA 1SLQA 2WT7A 4B86A 1CI6A 3MD0A 1GU4A 5AW5B 3TNUB 2R3CA 1FOSE 3MGNA 5APTA 3B8EB 4LC1A 2Z5IA 1H89A 4AYCA 5AW0B 3UIAA 3VN0A 4I6MC
chains in the Genus database with same CATH superfamily
1YTZI 3IR9A 1GD2E 3TDKA 1NYHA 2Q3IA 2JEEA 5KKZC 1H88A 5AVUB 1L2PA 1BCCG 3H1HE 1S2EA 2FYUE 1Q2NA 1X9VA 4EOTA 2FKWB 1S5LH 3H1JG 3GHGC 3AE6C 4EIJA 1IFJA 3OA7A 4I1LA 5AW3B 3PJSK 3L35A 1RF1B 2O01N 2LXBA 1L0LK 2WMMA 1SQXK 3RL0C 2R5BA 2HPCB 2H88C 4HB1A 5CJ0A 1KORA 1ZR4A 3AEFC 2P67A 2M3BA 3L75E 1VQOP 3SFDC 3D6ZA 1EZVD 1MZ9A 3H25A 1LT9B 5AW8B 1KC8Q 3CC7P 1HBWA 4WY4C 1U7MA 1OWAA 2N1TD 3H6PA 4AUWA 1SQPG 2AXCA 5KLIB 3B71A 1DD4A 1RQUA 2PAJA 3L70G 1KV4A 1GU4A 2BEQD 2D2CB 2GA1A 3L71D 4IFDK 2HFED 1H89A 3L73J 2H43A 1ZP0C 1SQQE 2YNYA 1KQSO 3VMXA 5DJTB 2OGUA 1KN7A 3BCCJ 3EQ2A 2C0WA 1OVUA 4KHXA 2XDJA 4PD4I 1SQVG 2KNCB 4JQ0D 1NJIQ 3L74G 4TT3H 2NPSB 3HE4B 1P84H 4M3LA 2IYPA 2WSEJ 2FYUK 3RK3C 1CZQA 1NTZE 1LTJB 1N7SD 1VQNP 3RBZA 1KILA 4EYYQ 4OGQC 2LR2A 3ZDMA 2G8YA 5B5EE 1EZVI 3U1AA 2VRSA 3KZIE 3I55P 4XE5B 1GU5A 1RHZB 5AVXB 4H44B 1ZN5A 2IBZG 3CI9A 4ZKUA 1URQB 1JUNA 4H0LB 5CCGD 2QSIA 2KI7B 4AQRD 3Q2YA 1NTMG 1FZCA 3H1JE 4C7NB 2WSCJ 3CCRP 5AW9B 1NTKD 1HJBA 4JF7A 1P84D 2JDIH 1SQQD 3HTKB 5KAIE 5APTA 3B8EB 1G2CA 4Y28J 2KS1A 3RBXA 4NPFX 3T97B 2ZT9C 3RK3E 3V2RA 4RESB 2B87A 4XFJA 1JTHB 1RF1C 3P32A 2W6JH 5GTHH 4OVNF 3NMDA 2Q7CA 5BU8B 3A3YB 2WPQA 3WUTA 1LP1B 4ASWA 2SPZA 3Q5SA 3H1LJ 3ITKA 1PPJD 1USEA 5H2FE 3RK2C 2V4HA 1GDTA 2GM4A 1NTZK 4WY4D 3L70E 3CCMP 3WU2E 1LT9C 3EFFK 3TK1A 3IF4A 5AW1B 1VQLP 3AEGC 4GOEA 1Q82Q 1BGYJ 5AVTB 1L0NE 3M0DA 3CCQP 4QMAA 3FGAD 3CXHE 2ZJSE 1DIPA 2AEMA 5KLVJ 1ZRTD 2E75B 1AVYA 3CX5E 3P8CD 2YKOA 3KDPB 1M1KQ 3AE3C 3V4WA 1R8EA 5APWA 1R5LA 3SWYA 1EDJA 1SVFA 2WSEH 3AE2C 4B86A 1J1EC 1FZCC 3OJAB 5GTIH 3QWOC 4OGQD 4IL6H 1RQVA 1WT6A 1LTJC 2IBZE 3B5ND 3IN6A 4IFFA 5AW2B 2I8DA 1AQTA 1JY2O 1L0LG 2QE7H 1E79H 1PGQA 1OIPA 1ZV8A 2N1TA 1NTME 4I7ZB 4HH2A 2IFNA 1EC5A 3AECC 2BCCD 3TGUD 3BCCD 1KD1Q 1YTZT 1OFCX 2YO3A 4H0LC 3N7NA 2IFMA 5APUA 3Q1MA 1SQXJ 4UB8E 1EZVG 2FXOA 1X0TA 4BWNA 1VQMP 4EI2A 2HR3A 3F5HA 4UB6E 2ZYAA 3SWFA 3ABVC 1LWUA 2ZT9D 2WPRA 5KKZB 1N7SA 1SQVK 2XV5A 4IL6X 3F89A 4ZKPA 1ZOYC 3M0DC 1SQBJ 2DW3A 2JP3A 3L4FA 2FYZA 5B66E 4TLFA 4N78E 3LIEA 5AW5B 2L91A 5KAFH 2Z5IA 4D6TJ 3CWBJ 3RL0B 3L72J 1IFPA 3HD7A 5CCGA 5APXA 3PLNA 3H1KE 2LXCB 2P10A 3VYIA 1OZHA 3MUDC 1KILD 1NU1E 2B89A 2M5AA 2AXTH 1AJYA 4U3FJ 1NTMK 4WY4B 1FS0E 3H1HJ 2FYUJ 2C0XA 1BSHA 2PFXA 1JMBA 3CX5I 2N1TC 1TU3F 1Y8AA 5BVZA 3E1IA 3O6QB 2NZ2A 3H1LD 2KXPB 5TJHA 1IFMA 2E76D 1SP4A 1GZLA 1FDMA 5AVWB 1H0TB 4N6JA 2K37A 1KB9D 3NFQA 1LGHB 2B88A 3L75J 1Y9BA 1JOCA 2JR8A 3S1KA 1NTKG 4C46A 1BGYD 1VQ8P 3RK3B 1SQQG 1HTLC 1LWUC 3GG2A 4OGQB 1X79B 5KLVD 1KTMA 2M3EA 1N7SC 1KFMA 3W67A 4L74A 3VOPA 1EZVE 2E74D 1VL2A 1ZLLA 2KZJA 1T6AA 1Q81Q 3FWNA 2HG5D 3R2PA 2JO1A 2Z5HA 1GTWA 1PPJG 1W2BO 3FWLA 3VMAA 3A7OA 2Q1KA 4PV1C 1K05A 1OVRA 5CCGC 1S5LE 1YYCA 1E5WA 1S1CX 1BE3J 3RGUA 1G1IA 3L71E 1JCDA 3IFMA 5AW6B 1NTZJ 2KK7A 2YXRB 1LT1A 2P58A 3VMZA 4MN4C 2P7JA 1H8AA 1KB9I 1L4AA 3B5NA 2K9JB 3HRNA 4KJMA 4ZNCA 2H89C 1HVVA 2ZT9B 3AEAC 3MHVA 1PP9D 3MIWA 2OQQA 3H1IE 1X22A 3MP7B 4GDOA 1M8OB 3A0HH 3JCUH 5APQA 1BCCJ 1FOSF 3AE9C 4O9BA 2ZYDA 3H1JJ 3RK2B 2JJLA 4IFMA 1Y47A 1BDCA 1PV3A 2GUSA 4W80A 1SQBD 1ZW0A 1HGVA 2J58A 1KILB 3GLMA 2QRXA 1FE6A 4W7ZA 1GL2D 4JYCA 5CCHD 1WMKA 1VPCA 2ZFCA 2ZVNB 2BCCG 1NTKE 3TGUG 1FZAA 1P84E 1IFNA 4GT1A 3S9OA 4A7PA 1S5LX 2ITAA 1IFDA 3BVHA 3TF5A 4K35A 1L0NG 3M9BA 1SQPJ 3D6YA 3FXDA 1J1EB 1EDLA 1RH5B 1FZCB 3BATA 3L70J 4U3FD 2FYNB 2QEXP 1YJWP 5TISH 3H1ID 4JBZA 1YQ4C 1GW4A 1RE4A 3HUSA 3Q5PA 4PJ0H 1NKNA 1NO4A 1A02J 1L4AC 3B5NC 2W83C 3IAOA 1PPJE 3TYYA 1G2CB 3C8VA 4R4MA 1SQVJ 2KS1B 3MZWB 5E79H 3PP5A 3L74J 1LTTC 2Z4EA 3M9HA 2WZ7A 2B87B 3K5BA 5L8RJ 3CCEP 4PV1D 1NGMB 3HD7D 1M56D 2FFDA 5KJ7A 1EDIA 1SLQA 1K04A 2W6BA 2CPBA 1UIXA 1XTGB 1DEBA 1ZRTE 2WWWA 2QA4P 1IK9A 1OMIA 3P8CE 2Y9YA 1HH0A 1GW3A 3AE4C 5GTHE 2KYVA 1EDKA 2L5GB 2M8RA 2KLUA 4WVZA 2P1JA 2FXMA 4GIFA 1NTKK 1NTMJ 5APVA 1SQQK 1CSBA 3H1LG 1MFTA 2Y0EA 1OW6A 2WSSH 4DZOA 3E1RA 3V2PA 3EFGA 1BE3D 2AEJA 4NPEA 2OTKE 2BCCE 2IDBA 2QJPC 2K1AA 3TGUE 2RH0A 2OARA 3BCCE 5EFWB 2Q9IA 2PRRA 1AFOA 2JWDA 2Q5UA 2POHA 2KSJA 3U1CA 1OVVA 2KP8A 2W27A 1KILC 1RE4C 1MKMA 3HUSC 3CCSP 4YTPC 2HYNA 1FBMA 3GF7A 2V7QJ 1P84I 3H1KG 2N1TB 3AE1C 5GTIE 1T3UA 1NU1G 1BCCD 1JCCA 4IL6E 4R4LA 3CCUP 3H32A 4WBAA 1IFIA 3A2AA 3V2QA 1YJNP 5AVQB 2N9YB 3FX0A 2E42A 4EDFA 4RKUJ 2E76C 4LLHA 1VQ7P 1HJ0A 2FYNC 2KLVA 2WVRA 1JY3O 1HF9A 3VP8A 1L4AD 4YXWH 1A02F 1YQ3C 3CC2P 3CCVP 1T2KD 1LWUB 1FZGA 3CC4P 1N7SB 5AVVB 3OAKA 3A0BH 3L73D 1LTBC 1PP9G 2OTLP 2R3SA 1GL2A 1KILE 2RKLA 5CCHA 3G6EP 2OYIA 2KB7P 1J2JB 1SQPD 2WQYC 2WSCH 2E74C 1NWQA 1L0LJ 1OX3A 2ZXEB 4PV1B 3HD7B 2UWJE 5AW4B 1N73A 3H1LE 2WT7A 1L0NK 1CI6A 4U7JA 1Z56A 2OYHA 1SQVD 5KAFE 2M5AB 3L74D 1KB9E 1M7LA 3W68A 2OTJP 1RF0A 1LTGC 1FJPA 1SFCA 3L71G 3B4SA 1BGYE 1MUUA 3TNUA 1PZQA 2CK3H 5KLVE 4RO0A 1M57D 2QJKC 5AVSB 1PGPA 2A45H 4JYBA 3P7KA 1M1JA 4H13C 1JY2P 3M9QA 3KHUA 2WPVB 3CL3D 3OW2O 3H1IG 1JNMA 1OW8A 2V7QH 1J1DC 2YMYA 3HE5A 2O01J 3I56P 2W6AA 2H8PD 1VQ5P 3A5TA 1S72P 2K88A 1K8AQ 5KJ7D 1GL2C 1KYOH 1S9KD 5CCHC 2OYIC 3VMYA 2D2CD 1D7MA 3GHGA 3G71P 1QGKB 1QLED 2HLOA 4K3AA 4IOIH 3PTZA 1QX8A 3MGNA 1PP9E 5AW0B 3UIAA 3JC22 2NPSD 1N73C 2R32A 5CBNA 1VF5C 1NH4A 1DD3A 4C7RA 1WRGA 3D70A 2OYHC 2IX7C 2YO2A 1L4AB 3B5NB 3L37A 1S3JA 3C1LA 1RF0C 1NTKJ 1AA0A 2IYOA 3CD6P 2KIKA 2QJYC 1SFCC 1QL2A 4H44D 1SQQJ 3I5CA 1KYOD 1AVOA 1SQBE 3KYQA 4HYTB 1FZFA 3N4XA 1IJDB 3GF3A 4PD4H 1VDFA 4BRYA 3BRVB 3HD7C 1NU1K 2E5TA 2FY8A 3VP9A 1PGOA 2O1KA 1N7LA 1Q86Q 4BXLA 3SWKA 3P8MC 2HODA 1QEXA 2A45I 3A0HE 1NAFA 3USSA 3SSUA 1ZMEC 1U7JA 1N2DC 1NVOA 4U3FE 2E43A 1EQ7A 2A06D 2ZXXA 2YIUC 2R3CA 4DJGA 1L0LD 2R44A 1LJ2A 3LW5J 4H13D 1SQXD 3VN0A 3KPEA 1XTCC 2QM7A 4PD4D 2OYOA 2Y0DA 1FDOA 1PL5A 4OWFA 2O01H 1KYOI 2KUBA 2QJPB 1YJ9P 3II6A 4WWIA 2M0BA 1JMMA 1DEEG 3L36A 3CCLP 1HUCA 3M91A 1LTIC 1N86A 3HUSB 3L73G 2K9JA 1LTAC 4D6TD 3CWBD 3BCCG 2E75D 1SQBK 1G1JA 3L72D 5TISE 1OXZA 4LGDE 1RF1A 3V5BA 4PJ0E 2FFDB 3C9IA 2ZYGA 1VF5D 1JM0A 2E76B 3JSVC 2HPCA 1NHLA 5E79E 2BCCJ 3H1HD 2Y9ZA 2FYUD 3GMAA 3TGUJ 1NAYA 1IO4A 1M90Q 2KZIA 5KTBA 4Z1MH 3WMM0 3AE8C 1FAVA 2K9YA 1BE3E 1LT9A 1OW7A 2RN0A 5C39A 2FXPA 3CPWO 1L0NJ 2YKQA 1SFCD 1AQ5A 1VQKP 1T2KC 2JKVA 1QVFO 1EXIA 1KZUB 2CPSA 1FU1A 1USDA 3SFEC 1KQFB 2WPSA 3R4YA 2I1KA 3NXSA 2ZVOB 1T8ZA 2E74B 3L75D 3O8ZA 4WB4A 5K5GB 2QVAA 2MJZA 1BCCE 5B5EH 4HKZH 1YI2P 1NKZB 2KNCA 1FZBA 4Y99C 3D71A 2NPSA 3KZIH 3HE4A 1LTJA 2RMZA 1CW5A 4RJTA 2WSFJ 1Q7YQ 1PIXA 5CHXA 3LW5H 3VTPC 4L75A 1MV8A 3CLQA 3KQGA 1JB0J 5CMZA 3S4RA 5DJUB 1T3JA 4L76A 1UIIA 2WITA 3BASA 3H32B 2QJKB 4GKGA 1DX7A 3RL0D 2A45G 1URQA 2PGDA 3L73E 4H13B 5KAIH 1NTZD 3RL0g 1KMIZ 5BU5A 1BGYG 1W5CE 3E7KA 1SQPE 4C7NA 5AVRB 1KQGB 2AEFA 4L73A 1J1DB 5KLVG 1JY3N 3EWKA 1LTSC 3HTKA 4ASVA 1JY2N 2J59M 3AE5C 4CPGA 1YIJP 1FZEA 2C9NY 4DT0A 3T97A 1Q90D 5KLIC 1GL2B 1FC2C 1AV1A 5H2FH 3WUVA 1DH3A 2OYIB 5APSA 1JTHA 2I1JA 1SQVE 3H1JD 1RE3A 3L74E 3WU2H 2FFDC 5KJ7C 1KFNA 1RY3A 3AEBC 2D2CC 1NOHA 2IZ1A 4DOJA 1LP1A 2XU6A 4KT0J 3A0BE 3H1KJ 2PP6A 2K3RA 1NU1J 3AEEC 3QH9A 3CXHH 1N73B 1VF5B 2B9BA 1MFZA 3RK3D 2NPSC 3BRTB 2QIWA 3AEDC 2WT7B 1CI6B 3MUDA 3CX5H 2OYHB 2WTYA 1K73Q 3G3ZA 1BSNA 1S4XA 1VQ9P 2GUVA 2A06G 3KXDA 1U57A 4DCKA 2QJYB 1SFCB 3CCJP 3V2NA 2G3AA 1SQXG 3TNUB 4AYCA 4H44C 3L70D 1PGJA 3Q5RA 2J5UA 1QL1A 1YBKA 3AE7C 1ZR2A 1URQC 1M1JB 1PP9J 3PRJA 1SQPK 2ZAEB 2BEZF 1S9KE 2WSFH 1L0ND 3M06A 1SQBG 5AVYB 2C9LY 3V6IA 3CXHD 2O3JA 3NTNA 3HE5B 4JPZB 1IC2A 2YXQB 3CX5D 4XA4A 3GW6A 2XNDH 5APYA 3G9RA 3TSIA 4D6TG 3CWBG 4GODA 3L72G 2IZ0A 4W7YA 1GK4A 2YIUB 4UB8H 4HJGH 2AXTE 1JY3P 3GHGB 2MKVA 1RE3C 2Q6QA 1QVGO 4UB6H 2NRGA 2IBZD 5M1BA 4U3FG 3G4SP 1ZXGA 3RK2D 3H1HG 2FYUG 3L71J 2LKMA 1KB9H 5AW7B 2FBWC 1KYOE 1NTMD 1JO5A 5B66H 1FJKA 1W2EA 1R5SA 1PFIA 5CJ4A 4LC1A 4I6MC 3CXHI 3CMEP 1VQ4P 3H1IJ 2O1JA 2E5YA 2IPPA 2YKPA 2R5DA 3L75G 2H7HA 2E75C 1YITP 1GMJA 2XZRA 4N3YB 3U59A 2KOGA 4GOFA 1VQPP 5AVZB 1SS1A 3PHLA 4I2LC 2QM8A 4BRYB 1HGZA 2Y0CA 4YPCA 2KSEA 4YXDC 1FDIA 1GK6A 2A06E 4NPDA 1HWTC 1L0LE 5CBOA 1SQXE 3Q3DA 2XKMA 2IBZI 1KQLA 3V4QA 2HODB 1BDDA 4PD4E 2W8ZA 1IK7A 3CMAP 1X8YA 4N78D 4WY4A 3MTUE 3WUUA 1VQ6P 4ZMDA 2W90A 5KLVK 2Q3EA 4I7ZC 3O6QA 2N9BA 1BE3G 1LNQA 1URQD 2YMKA 2XNXA 4H0LD 3H1KD 3LIDA 2BASA 1IZNB 4OH8B 1YHQP 1NTZG 1M1JC 1NU1D 3M0AA 3PH0A 3FXEA 1H0TA 1N8RQ 4D6TE 2JWAA 3CWBE 2QG4A 1JEKA 2P2UA 3L72E 1K9MQ 3MD0A 1FOSE 4Y99B 1EXJA 3JCUE
chains in the Genus database with same CATH topology
1T2KC 1YTZI 3IR9A 1KZUB 1GD2E 3HD7A 5CCGA 5APXA 3H32A 4WBAA 1IFIA 3A2AA 3V2QA 2CPSA 5AVQB 1FU1A 2Q3IA 2JEEA 2E42A 2WPSA 2I1KA 3NXSA 3VYIA 1H88A 5AVUB 1KILD 4LLHA 1T8ZA 1X9VA 3O8ZA 4WB4A 2KLVA 4EOTA 2FKWB 1JY3O 1NTMK 4WY4B 3GHGC 4EIJA 1IFJA 3VP8A 1L4AD 3OA7A 4I1LA 2C0XA 5AW3B 1A02F 2MJZA 3L35A 1RF1B 1T2KD 2N1TC 1LWUB 1NKZB 1L0LK 1FZBA 4Y99C 5BVZA 3E1IA 1FZGA 2NPSA 1N7SB 5AVVB 3HE4A 1SQXK 3OAKA 3RL0C 2R5BA 2HPCB 1LTBC 5CJ0A 1IFMA 1ZR4A 1LTJA 1CW5A 1GL2A 1SP4A 2P67A 5CCHA 2OYIA 2M3BA 5CHXA 3LW5H 1GZLA 1FDMA 5AVWB 2KB7P 1J2JB 2WSCH 4N6JA 1MZ9A 3VTPC 1NWQA 1LT9B 1MV8A 3NFQA 1LGHB 5AW8B 1HBWA 3CLQA 1JOCA 4WY4C 3KQGA 4C46A 1OWAA 2N1TD 5CMZA 2ZXEB 3H6PA 1T3JA 4AUWA 3HD7B 3RK3B 2WITA 3BASA 3H32B 4GKGA 1DX7A 5AW4B 1HTLC 3RL0D 2A45G 1N73A 1LWUC 1URQA 1X79B 2PAJA 1N7SC 2WT7A 1L0NK 1CI6A 1GU4A 1KFMA 5BU5A 1Z56A 2OYHA 4IFDK 2HFED 1H89A 2H43A 3VOPA 2YNYA 4C7NA 5AVRB 3VMXA 1M7LA 1ZLLA 1J1DB 1JY3N 3EQ2A 2C0WA 1RF0A 1LTGC 1FJPA 4KHXA 2XDJA 1LTSC 1SFCA 2HG5D 3HTKA 1JY2N 3R2PA 2J59M 2Z5HA 1MUUA 3TNUA 2NPSB 1GTWA 3HE4B 4M3LA 1FZEA 2C9NY 3A7OA 2FYUK 3T97A 3RK3C 5CCGC 1CZQA 1LTJB 1N7SD 1YYCA 1E5WA 5AVSB 2A45H 1GL2B 4JYBA 3P7KA 2OYIB 1DH3A 1KILA 5APSA 1M1JA 1G1IA 1JTHA 2I1JA 1JCDA 3IFMA 1JY2P 1RE3A 5AW6B 2FFDC 5KJ7C 1KFNA 1RY3A 3M9QA 3U1AA 3CL3D 3VMZA 2VRSA 2P7JA 1NOHA 1H8AA 1L4AA 3B5NA 4DOJA 4XE5B 2XU6A 1JNMA 3HRNA 1GU5A 1J1DC 2YMYA 3HE5A 5AVXB 1HVVA 1ZN5A 2PP6A 3CI9A 2W6AA 3MIWA 4ZKUA 1N73B 1MFZA 1URQB 2H8PD 1JUNA 3RK3D 5CCGD 3A5TA 2NPSC 3BRTB 2WT7B 1CI6B 3MUDA 4AQRD 2OYHB 2WTYA 5APQA 1FZCA 1FOSF 5KJ7D 3G3ZA 1GL2C 4C7NB 1S9KD 5CCHC 2OYIC 3VMYA 3GHGA 5AW9B 2GUVA 1HJBA 4JF7A 4O9BA 3RK2B 2HLOA 1SFCB 2JJLA 4IFMA 3HTKB 3V2NA 3TNUB 3MGNA 5APTA 3B8EB 1G2CA 4AYCA 5AW0B 3UIAA 2GUSA 3V2RA 1QL1A 4W80A 2NPSD 1N73C 1HGVA 2J58A 2R32A 4RESB 1NH4A 1ZR2A 1KILB 1URQC 1M1JB 1JTHB 1SQPK 1RF1C 3P32A 4W7ZA 1GL2D 4JYCA 5CCHD 1S9KE 4C7RA 3NMDA 1VPCA 2WSFH 1WRGA 2ZFCA 2OYHC 2IX7C 2YO2A 2Q7CA 5BU8B 3A3YB 2WPQA 1L4AB 3M06A 3B5NB 5AVYB 2C9LY 3L37A 1FZAA 1IFNA 4GT1A 3NTNA 3HE5B 1IC2A 1RF0C 3RK2C 1IFDA 4XA4A 3BVHA 1SFCC 1QL2A 1GDTA 2GM4A 1NTZK 4WY4D 5APYA 3M9BA 3TSIA 3I5CA 1LT9C 3KYQA 4HYTB 3TK1A 1FZFA 3N4XA 1IJDB 1VDFA 5AW1B 1J1EB 4W7YA 1GK4A 1FZCB 3BATA 3BRVB 3HD7C 1JY3P 1NU1K 3GHGB 3VP9A 1RE3C 5AVTB 3M0DA 2O1KA 1GW4A 1RE4A 3HUSA 1N7LA 1NKNA 1NO4A 1A02J 1L4AC 3B5NC 3P8MC 3RK2D 3TYYA 2HODA 3P8CD 1G2CB 2A45I 2YKOA 1NAFA 3PP5A 2LKMA 5AW7B 3KDPB 1LTTC 2Z4EA 3M9HA 3V4WA 2WZ7A 5APWA 1JO5A 3SWYA 1N2DC 1SVFA 2WSEH 1FJKA 1W2EA 3HD7D 2E43A 2FFDA 5KJ7A 1EQ7A 1SLQA 4B86A 1J1EC 1PFIA 1FZCC 2R3CA 3OJAB 2W6BA 5CJ4A 4LC1A 1WT6A 3VN0A 1LTJC 2CPBA 4I6MC 1XTGB 1DEBA 3KPEA 3B5ND 1XTCC 2WWWA 2O1JA 4IFFA 5AW2B 1IK9A 2IPPA 2YKPA 1JY2O 2QM7A 3P8CE 2R5DA 2H7HA 1HH0A 1GW3A 2XZRA 4N3YB 3U59A 2O01H 2KOGA 1ZV8A 2N1TA 2KYVA 5AVZB 4I2LC 2L5GB 2QM8A 4HH2A 2M8RA 1HGZA 2IFNA 3II6A 2P1JA 2FXMA 4GIFA 1NTKK 1GK6A 1JMMA 1HWTC 5APVA 3L36A 1HUCA 3M91A 1YTZT 1LTIC 2YO3A 1SQQK 1N86A 1CSBA 3HUSB 2XKMA 1KQLA 3N7NA 2IFMA 5APUA 3V4QA 2HODB 4DZOA 1LTAC 3V2PA 1SQBK 3EFGA 1G1JA 1X8YA 4N78D 4WY4A 3MTUE 1OXZA 4LGDE 5KLVK 3SWFA 1RF1A 3V5BA 1LWUA 2FFDB 3C9IA 2WPRA 2OARA 2Q9IA 1N7SA 1SQVK 2N9BA 2XV5A 1AFOA 1URQD 2Q5UA 2XNXA 2POHA 2HPCA 1NHLA 2KSJA 3LIDA 2BASA 2KP8A 4ZKPA 3U1CA 4OH8B 2W27A 3M0DC 1KILC 1M1JC 1IO4A 1RE4C 3HUSC 3M0AA 2HYNA 3L4FA 5KTBA 1FBMA 2FYZA 2P2UA 3WMM0 4N78E 1FAVA 3LIEA 1LT9A 2N1TB 3MD0A 5AW5B 1FOSE 4Y99B 2YKQA 2Z5IA 1SFCD 1AQ5A 1T3UA 1JCCA 3RL0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T2K C;  2YNY A;  4C7N A;  5AVR B;  3IR9 A;  3VMX A;  1GD2 E;  2WWW A;  5APX A;  3A2A A;  2R32 A;  4RES B;  5AW2 B;  5AVQ B;  2IPP A;  2Q3I A;  2QM7 A;  2R5D A;  3P32 A;  2H7H A;  4KHX A;  2E42 A;  2WPS A;  2XZR A;  4JYC A;  3NXS A;  3VYI A;  1S9K E;  3HTK A;  3NMD A;  1H88 A;  5AVU B;  2ZFC A;  2Z5H A;  2Q7C A;  2YO2 A;  5AVZ B;  1MUU A;  3TNU A;  3A3Y B;  2WPQ A;  3M06 A;  3HE4 B;  4I2L C;  1GTW A;  2QM8 A;  5AVY B;  2C9L Y;  3L37 A;  3O8Z A;  4GT1 A;  4M3L A;  2C9N Y;  3A7O A;  4EOT A;  3T97 A;  3NTN A;  1CZQ A;  3HE5 B;  1YYC A;  5AVS B;  1GK6 A;  4JYB A;  1HWT C;  3P7K A;  5APV A;  1DH3 A;  5APS A;  3L36 A;  5AW3 B;  1HUC A;  3M91 A;  2YO3 A;  1A02 F;  1CSB A;  5APY A;  3L35 A;  5AW6 B;  3M9B A;  1T2K D;  3I5C A;  4HYT B;  3TK1 A;  3VMZ A;  2VRS A;  2P7J A;  1KQL A;  1H8A A;  5APU A;  3V4Q A;  5AVV B;  3HE4 A;  4DZO A;  3OAK A;  4XE5 B;  5AW1 B;  1GK4 A;  2XU6 A;  1JNM A;  2R5B A;  1GU5 A;  1X8Y A;  3HE5 A;  5AVX B;  1SP4 A;  2P67 A;  5AVT B;  3M0D A;  1OXZ A;  2W6A A;  1GZL A;  5AVW B;  1J2J B;  1MFZ A;  3SWF A;  1JUN A;  3V5B A;  3A5T A;  3VTP C;  1A02 J;  2WPR A;  2WT7 B;  1NWQ A;  1MV8 A;  1CI6 B;  3NFQ A;  3P8M C;  5AW8 B;  3TYY A;  2N9B A;  2XV5 A;  4AQR D;  1HBW A;  2Q5U A;  2WTY A;  1G2C B;  5APQ A;  1NAF A;  3KQG A;  4C46 A;  1OWA A;  1FOS F;  4C7N B;  5CMZ A;  5AW7 B;  3LID A;  2BAS A;  2KP8 A;  2ZXE B;  3KDP B;  1S9K D;  3VMY A;  2W27 A;  3M9H A;  4AUW A;  1IO4 A;  3V4W A;  5AW9 B;  4GKG A;  5APW A;  3M0A A;  5AW4 B;  1HJB A;  2JJL A;  2P2U A;  2E43 A;  1FAV A;  3LIE A;  1SLQ A;  2WT7 A;  4B86 A;  1CI6 A;  3MD0 A;  1GU4 A;  5AW5 B;  3TNU B;  2R3C A;  1FOS E;  3MGN A;  5APT A;  3B8E B;  4LC1 A;  2Z5I A;  1H89 A;  4AYC A;  5AW0 B;  3UIA A;  3VN0 A;  4I6M C; 
#chains in the Genus database with same CATH topology
 1YTZ I;  3IR9 A;  1GD2 E;  3TDK A;  1NYH A;  2Q3I A;  2JEE A;  5KKZ C;  1H88 A;  5AVU B;  1L2P A;  1BCC G;  3H1H E;  1S2E A;  2FYU E;  1Q2N A;  1X9V A;  4EOT A;  2FKW B;  1S5L H;  3H1J G;  3GHG C;  3AE6 C;  4EIJ A;  1IFJ A;  3OA7 A;  4I1L A;  5AW3 B;  3PJS K;  3L35 A;  1RF1 B;  2O01 N;  2LXB A;  1L0L K;  2WMM A;  1SQX K;  3RL0 C;  2R5B A;  2HPC B;  2H88 C;  4HB1 A;  5CJ0 A;  1KOR A;  1ZR4 A;  3AEF C;  2P67 A;  2M3B A;  3L75 E;  1VQO P;  3SFD C;  3D6Z A;  1EZV D;  1MZ9 A;  3H25 A;  1LT9 B;  5AW8 B;  1KC8 Q;  3CC7 P;  1HBW A;  4WY4 C;  1U7M A;  1OWA A;  2N1T D;  3H6P A;  4AUW A;  1SQP G;  2AXC A;  5KLI B;  3B71 A;  1DD4 A;  1RQU A;  2PAJ A;  3L70 G;  1KV4 A;  1GU4 A;  2BEQ D;  2D2C B;  2GA1 A;  3L71 D;  4IFD K;  2HFE D;  1H89 A;  3L73 J;  2H43 A;  1ZP0 C;  1SQQ E;  2YNY A;  1KQS O;  3VMX A;  5DJT B;  2OGU A;  1KN7 A;  3BCC J;  3EQ2 A;  2C0W A;  1OVU A;  4KHX A;  2XDJ A;  4PD4 I;  1SQV G;  2KNC B;  4JQ0 D;  1NJI Q;  3L74 G;  4TT3 H;  2NPS B;  3HE4 B;  1P84 H;  4M3L A;  2IYP A;  2WSE J;  2FYU K;  3RK3 C;  1CZQ A;  1NTZ E;  1LTJ B;  1N7S D;  1VQN P;  3RBZ A;  1KIL A;  4EYY Q;  4OGQ C;  2LR2 A;  3ZDM A;  2G8Y A;  5B5E E;  1EZV I;  3U1A A;  2VRS A;  3KZI E;  3I55 P;  4XE5 B;  1GU5 A;  1RHZ B;  5AVX B;  4H44 B;  1ZN5 A;  2IBZ G;  3CI9 A;  4ZKU A;  1URQ B;  1JUN A;  4H0L B;  5CCG D;  2QSI A;  2KI7 B;  4AQR D;  3Q2Y A;  1NTM G;  1FZC A;  3H1J E;  4C7N B;  2WSC J;  3CCR P;  5AW9 B;  1NTK D;  1HJB A;  4JF7 A;  1P84 D;  2JDI H;  1SQQ D;  3HTK B;  5KAI E;  5APT A;  3B8E B;  1G2C A;  4Y28 J;  2KS1 A;  3RBX A;  4NPF X;  3T97 B;  2ZT9 C;  3RK3 E;  3V2R A;  4RES B;  2B87 A;  4XFJ A;  1JTH B;  1RF1 C;  3P32 A;  2W6J H;  5GTH H;  4OVN F;  3NMD A;  2Q7C A;  5BU8 B;  3A3Y B;  2WPQ A;  3WUT A;  1LP1 B;  4ASW A;  2SPZ A;  3Q5S A;  3H1L J;  3ITK A;  1PPJ D;  1USE A;  5H2F E;  3RK2 C;  2V4H A;  1GDT A;  2GM4 A;  1NTZ K;  4WY4 D;  3L70 E;  3CCM P;  3WU2 E;  1LT9 C;  3EFF K;  3TK1 A;  3IF4 A;  5AW1 B;  1VQL P;  3AEG C;  4GOE A;  1Q82 Q;  1BGY J;  5AVT B;  1L0N E;  3M0D A;  3CCQ P;  4QMA A;  3FGA D;  3CXH E;  2ZJS E;  1DIP A;  2AEM A;  5KLV J;  1ZRT D;  2E75 B;  1AVY A;  3CX5 E;  3P8C D;  2YKO A;  3KDP B;  1M1K Q;  3AE3 C;  3V4W A;  1R8E A;  5APW A;  1R5L A;  3SWY A;  1EDJ A;  1SVF A;  2WSE H;  3AE2 C;  4B86 A;  1J1E C;  1FZC C;  3OJA B;  5GTI H;  3QWO C;  4OGQ D;  4IL6 H;  1RQV A;  1WT6 A;  1LTJ C;  2IBZ E;  3B5N D;  3IN6 A;  4IFF A;  5AW2 B;  2I8D A;  1AQT A;  1JY2 O;  1L0L G;  2QE7 H;  1E79 H;  1PGQ A;  1OIP A;  1ZV8 A;  2N1T A;  1NTM E;  4I7Z B;  4HH2 A;  2IFN A;  1EC5 A;  3AEC C;  2BCC D;  3TGU D;  3BCC D;  1KD1 Q;  1YTZ T;  1OFC X;  2YO3 A;  4H0L C;  3N7N A;  2IFM A;  5APU A;  3Q1M A;  1SQX J;  4UB8 E;  1EZV G;  2FXO A;  1X0T A;  4BWN A;  1VQM P;  4EI2 A;  2HR3 A;  3F5H A;  4UB6 E;  2ZYA A;  3SWF A;  3ABV C;  1LWU A;  2ZT9 D;  2WPR A;  5KKZ B;  1N7S A;  1SQV K;  2XV5 A;  4IL6 X;  3F89 A;  4ZKP A;  1ZOY C;  3M0D C;  1SQB J;  2DW3 A;  2JP3 A;  3L4F A;  2FYZ A;  5B66 E;  4TLF A;  4N78 E;  3LIE A;  5AW5 B;  2L91 A;  5KAF H;  2Z5I A;  4D6T J;  3CWB J;  3RL0 B;  3L72 J;  1IFP A;  3HD7 A;  5CCG A;  5APX A;  3PLN A;  3H1K E;  2LXC B;  2P10 A;  3VYI A;  1OZH A;  3MUD C;  1KIL D;  1NU1 E;  2B89 A;  2M5A A;  2AXT H;  1AJY A;  4U3F J;  1NTM K;  4WY4 B;  1FS0 E;  3H1H J;  2FYU J;  2C0X A;  1BSH A;  2PFX A;  1JMB A;  3CX5 I;  2N1T C;  1TU3 F;  1Y8A A;  5BVZ A;  3E1I A;  3O6Q B;  2NZ2 A;  3H1L D;  2KXP B;  5TJH A;  1IFM A;  2E76 D;  1SP4 A;  1GZL A;  1FDM A;  5AVW B;  1H0T B;  4N6J A;  2K37 A;  1KB9 D;  3NFQ A;  1LGH B;  2B88 A;  3L75 J;  1Y9B A;  1JOC A;  2JR8 A;  3S1K A;  1NTK G;  4C46 A;  1BGY D;  1VQ8 P;  3RK3 B;  1SQQ G;  1HTL C;  1LWU C;  3GG2 A;  4OGQ B;  1X79 B;  5KLV D;  1KTM A;  2M3E A;  1N7S C;  1KFM A;  3W67 A;  4L74 A;  3VOP A;  1EZV E;  2E74 D;  1VL2 A;  1ZLL A;  2KZJ A;  1T6A A;  1Q81 Q;  3FWN A;  2HG5 D;  3R2P A;  2JO1 A;  2Z5H A;  1GTW A;  1PPJ G;  1W2B O;  3FWL A;  3VMA A;  3A7O A;  2Q1K A;  4PV1 C;  1K05 A;  1OVR A;  5CCG C;  1S5L E;  1YYC A;  1E5W A;  1S1C X;  1BE3 J;  3RGU A;  1G1I A;  3L71 E;  1JCD A;  3IFM A;  5AW6 B;  1NTZ J;  2KK7 A;  2YXR B;  1LT1 A;  2P58 A;  3VMZ A;  4MN4 C;  2P7J A;  1H8A A;  1KB9 I;  1L4A A;  3B5N A;  2K9J B;  3HRN A;  4KJM A;  4ZNC A;  2H89 C;  1HVV A;  2ZT9 B;  3AEA C;  3MHV A;  1PP9 D;  3MIW A;  2OQQ A;  3H1I E;  1X22 A;  3MP7 B;  4GDO A;  1M8O B;  3A0H H;  3JCU H;  5APQ A;  1BCC J;  1FOS F;  3AE9 C;  4O9B A;  2ZYD A;  3H1J J;  3RK2 B;  2JJL A;  4IFM A;  1Y47 A;  1BDC A;  1PV3 A;  2GUS A;  4W80 A;  1SQB D;  1ZW0 A;  1HGV A;  2J58 A;  1KIL B;  3GLM A;  2QRX A;  1FE6 A;  4W7Z A;  1GL2 D;  4JYC A;  5CCH D;  1WMK A;  1VPC A;  2ZFC A;  2ZVN B;  2BCC G;  1NTK E;  3TGU G;  1FZA A;  1P84 E;  1IFN A;  4GT1 A;  3S9O A;  4A7P A;  1S5L X;  2ITA A;  1IFD A;  3BVH A;  3TF5 A;  4K35 A;  1L0N G;  3M9B A;  1SQP J;  3D6Y A;  3FXD A;  1J1E B;  1EDL A;  1RH5 B;  1FZC B;  3BAT A;  3L70 J;  4U3F D;  2FYN B;  2QEX P;  1YJW P;  5TIS H;  3H1I D;  4JBZ A;  1YQ4 C;  1GW4 A;  1RE4 A;  3HUS A;  3Q5P A;  4PJ0 H;  1NKN A;  1NO4 A;  1A02 J;  1L4A C;  3B5N C;  2W83 C;  3IAO A;  1PPJ E;  3TYY A;  1G2C B;  3C8V A;  4R4M A;  1SQV J;  2KS1 B;  3MZW B;  5E79 H;  3PP5 A;  3L74 J;  1LTT C;  2Z4E A;  3M9H A;  2WZ7 A;  2B87 B;  3K5B A;  5L8R J;  3CCE P;  4PV1 D;  1NGM B;  3HD7 D;  1M56 D;  2FFD A;  5KJ7 A;  1EDI A;  1SLQ A;  1K04 A;  2W6B A;  2CPB A;  1UIX A;  1XTG B;  1DEB A;  1ZRT E;  2WWW A;  2QA4 P;  1IK9 A;  1OMI A;  3P8C E;  2Y9Y A;  1HH0 A;  1GW3 A;  3AE4 C;  5GTH E;  2KYV A;  1EDK A;  2L5G B;  2M8R A;  2KLU A;  4WVZ A;  2P1J A;  2FXM A;  4GIF A;  1NTK K;  1NTM J;  5APV A;  1SQQ K;  1CSB A;  3H1L G;  1MFT A;  2Y0E A;  1OW6 A;  2WSS H;  4DZO A;  3E1R A;  3V2P A;  3EFG A;  1BE3 D;  2AEJ A;  4NPE A;  2OTK E;  2BCC E;  2IDB A;  2QJP C;  2K1A A;  3TGU E;  2RH0 A;  2OAR A;  3BCC E;  5EFW B;  2Q9I A;  2PRR A;  1AFO A;  2JWD A;  2Q5U A;  2POH A;  2KSJ A;  3U1C A;  1OVV A;  2KP8 A;  2W27 A;  1KIL C;  1RE4 C;  1MKM A;  3HUS C;  3CCS P;  4YTP C;  2HYN A;  1FBM A;  3GF7 A;  2V7Q J;  1P84 I;  3H1K G;  2N1T B;  3AE1 C;  5GTI E;  1T3U A;  1NU1 G;  1BCC D;  1JCC A;  4IL6 E;  4R4L A;  3CCU P;  3H32 A;  4WBA A;  1IFI A;  3A2A A;  3V2Q A;  1YJN P;  5AVQ B;  2N9Y B;  3FX0 A;  2E42 A;  4EDF A;  4RKU J;  2E76 C;  4LLH A;  1VQ7 P;  1HJ0 A;  2FYN C;  2KLV A;  2WVR A;  1JY3 O;  1HF9 A;  3VP8 A;  1L4A D;  4YXW H;  1A02 F;  1YQ3 C;  3CC2 P;  3CCV P;  1T2K D;  1LWU B;  1FZG A;  3CC4 P;  1N7S B;  5AVV B;  3OAK A;  3A0B H;  3L73 D;  1LTB C;  1PP9 G;  2OTL P;  2R3S A;  1GL2 A;  1KIL E;  2RKL A;  5CCH A;  3G6E P;  2OYI A;  2KB7 P;  1J2J B;  1SQP D;  2WQY C;  2WSC H;  2E74 C;  1NWQ A;  1L0L J;  1OX3 A;  2ZXE B;  4PV1 B;  3HD7 B;  2UWJ E;  5AW4 B;  1N73 A;  3H1L E;  2WT7 A;  1L0N K;  1CI6 A;  4U7J A;  1Z56 A;  2OYH A;  1SQV D;  5KAF E;  2M5A B;  3L74 D;  1KB9 E;  1M7L A;  3W68 A;  2OTJ P;  1RF0 A;  1LTG C;  1FJP A;  1SFC A;  3L71 G;  3B4S A;  1BGY E;  1MUU A;  3TNU A;  1PZQ A;  2CK3 H;  5KLV E;  4RO0 A;  1M57 D;  2QJK C;  5AVS B;  1PGP A;  2A45 H;  4JYB A;  3P7K A;  1M1J A;  4H13 C;  1JY2 P;  3M9Q A;  3KHU A;  2WPV B;  3CL3 D;  3OW2 O;  3H1I G;  1JNM A;  1OW8 A;  2V7Q H;  1J1D C;  2YMY A;  3HE5 A;  2O01 J;  3I56 P;  2W6A A;  2H8P D;  1VQ5 P;  3A5T A;  1S72 P;  2K88 A;  1K8A Q;  5KJ7 D;  1GL2 C;  1KYO H;  1S9K D;  5CCH C;  2OYI C;  3VMY A;  2D2C D;  1D7M A;  3GHG A;  3G71 P;  1QGK B;  1QLE D;  2HLO A;  4K3A A;  4IOI H;  3PTZ A;  1QX8 A;  3MGN A;  1PP9 E;  5AW0 B;  3UIA A;  3JC2 2;  2NPS D;  1N73 C;  2R32 A;  5CBN A;  1VF5 C;  1NH4 A;  1DD3 A;  4C7R A;  1WRG A;  3D70 A;  2OYH C;  2IX7 C;  2YO2 A;  1L4A B;  3B5N B;  3L37 A;  1S3J A;  3C1L A;  1RF0 C;  1NTK J;  1AA0 A;  2IYO A;  3CD6 P;  2KIK A;  2QJY C;  1SFC C;  1QL2 A;  4H44 D;  1SQQ J;  3I5C A;  1KYO D;  1AVO A;  1SQB E;  3KYQ A;  4HYT B;  1FZF A;  3N4X A;  1IJD B;  3GF3 A;  4PD4 H;  1VDF A;  4BRY A;  3BRV B;  3HD7 C;  1NU1 K;  2E5T A;  2FY8 A;  3VP9 A;  1PGO A;  2O1K A;  1N7L A;  1Q86 Q;  4BXL A;  3SWK A;  3P8M C;  2HOD A;  1QEX A;  2A45 I;  3A0H E;  1NAF A;  3USS A;  3SSU A;  1ZME C;  1U7J A;  1N2D C;  1NVO A;  4U3F E;  2E43 A;  1EQ7 A;  2A06 D;  2ZXX A;  2YIU C;  2R3C A;  4DJG A;  1L0L D;  2R44 A;  1LJ2 A;  3LW5 J;  4H13 D;  1SQX D;  3VN0 A;  3KPE A;  1XTC C;  2QM7 A;  4PD4 D;  2OYO A;  2Y0D A;  1FDO A;  1PL5 A;  4OWF A;  2O01 H;  1KYO I;  2KUB A;  2QJP B;  1YJ9 P;  3II6 A;  4WWI A;  2M0B A;  1JMM A;  1DEE G;  3L36 A;  3CCL P;  1HUC A;  3M91 A;  1LTI C;  1N86 A;  3HUS B;  3L73 G;  2K9J A;  1LTA C;  4D6T D;  3CWB D;  3BCC G;  2E75 D;  1SQB K;  1G1J A;  3L72 D;  5TIS E;  1OXZ A;  4LGD E;  1RF1 A;  3V5B A;  4PJ0 E;  2FFD B;  3C9I A;  2ZYG A;  1VF5 D;  1JM0 A;  2E76 B;  3JSV C;  2HPC A;  1NHL A;  5E79 E;  2BCC J;  3H1H D;  2Y9Z A;  2FYU D;  3GMA A;  3TGU J;  1NAY A;  1IO4 A;  1M90 Q;  2KZI A;  5KTB A;  4Z1M H;  3WMM 0;  3AE8 C;  1FAV A;  2K9Y A;  1BE3 E;  1LT9 A;  1OW7 A;  2RN0 A;  5C39 A;  2FXP A;  3CPW O;  1L0N J;  2YKQ A;  1SFC D;  1AQ5 A;  1VQK P;  1T2K C;  2JKV A;  1QVF O;  1EXI A;  1KZU B;  2CPS A;  1FU1 A;  1USD A;  3SFE C;  1KQF B;  2WPS A;  3R4Y A;  2I1K A;  3NXS A;  2ZVO B;  1T8Z A;  2E74 B;  3L75 D;  3O8Z A;  4WB4 A;  5K5G B;  2QVA A;  2MJZ A;  1BCC E;  5B5E H;  4HKZ H;  1YI2 P;  1NKZ B;  2KNC A;  1FZB A;  4Y99 C;  3D71 A;  2NPS A;  3KZI H;  3HE4 A;  1LTJ A;  2RMZ A;  1CW5 A;  4RJT A;  2WSF J;  1Q7Y Q;  1PIX A;  5CHX A;  3LW5 H;  3VTP C;  4L75 A;  1MV8 A;  3CLQ A;  3KQG A;  1JB0 J;  5CMZ A;  3S4R A;  5DJU B;  1T3J A;  4L76 A;  1UII A;  2WIT A;  3BAS A;  3H32 B;  2QJK B;  4GKG A;  1DX7 A;  3RL0 D;  2A45 G;  1URQ A;  2PGD A;  3L73 E;  4H13 B;  5KAI H;  1NTZ D;  3RL0 g;  1KMI Z;  5BU5 A;  1BGY G;  1W5C E;  3E7K A;  1SQP E;  4C7N A;  5AVR B;  1KQG B;  2AEF A;  4L73 A;  1J1D B;  5KLV G;  1JY3 N;  3EWK A;  1LTS C;  3HTK A;  4ASV A;  1JY2 N;  2J59 M;  3AE5 C;  4CPG A;  1YIJ P;  1FZE A;  2C9N Y;  4DT0 A;  3T97 A;  1Q90 D;  5KLI C;  1GL2 B;  1FC2 C;  1AV1 A;  5H2F H;  3WUV A;  1DH3 A;  2OYI B;  5APS A;  1JTH A;  2I1J A;  1SQV E;  3H1J D;  1RE3 A;  3L74 E;  3WU2 H;  2FFD C;  5KJ7 C;  1KFN A;  1RY3 A;  3AEB C;  2D2C C;  1NOH A;  2IZ1 A;  4DOJ A;  1LP1 A;  2XU6 A;  4KT0 J;  3A0B E;  3H1K J;  2PP6 A;  2K3R A;  1NU1 J;  3AEE C;  3QH9 A;  3CXH H;  1N73 B;  1VF5 B;  2B9B A;  1MFZ A;  3RK3 D;  2NPS C;  3BRT B;  2QIW A;  3AED C;  2WT7 B;  1CI6 B;  3MUD A;  3CX5 H;  2OYH B;  2WTY A;  1K73 Q;  3G3Z A;  1BSN A;  1S4X A;  1VQ9 P;  2GUV A;  2A06 G;  3KXD A;  1U57 A;  4DCK A;  2QJY B;  1SFC B;  3CCJ P;  3V2N A;  2G3A A;  1SQX G;  3TNU B;  4AYC A;  4H44 C;  3L70 D;  1PGJ A;  3Q5R A;  2J5U A;  1QL1 A;  1YBK A;  3AE7 C;  1ZR2 A;  1URQ C;  1M1J B;  1PP9 J;  3PRJ A;  1SQP K;  2ZAE B;  2BEZ F;  1S9K E;  2WSF H;  1L0N D;  3M06 A;  1SQB G;  5AVY B;  2C9L Y;  3V6I A;  3CXH D;  2O3J A;  3NTN A;  3HE5 B;  4JPZ B;  1IC2 A;  2YXQ B;  3CX5 D;  4XA4 A;  3GW6 A;  2XND H;  5APY A;  3G9R A;  3TSI A;  4D6T G;  3CWB G;  4GOD A;  3L72 G;  2IZ0 A;  4W7Y A;  1GK4 A;  2YIU B;  4UB8 H;  4HJG H;  2AXT E;  1JY3 P;  3GHG B;  2MKV A;  1RE3 C;  2Q6Q A;  1QVG O;  4UB6 H;  2NRG A;  2IBZ D;  5M1B A;  4U3F G;  3G4S P;  1ZXG A;  3RK2 D;  3H1H G;  2FYU G;  3L71 J;  2LKM A;  1KB9 H;  5AW7 B;  2FBW C;  1KYO E;  1NTM D;  1JO5 A;  5B66 H;  1FJK A;  1W2E A;  1R5S A;  1PFI A;  5CJ4 A;  4LC1 A;  4I6M C;  3CXH I;  3CME P;  1VQ4 P;  3H1I J;  2O1J A;  2E5Y A;  2IPP A;  2YKP A;  2R5D A;  3L75 G;  2H7H A;  2E75 C;  1YIT P;  1GMJ A;  2XZR A;  4N3Y B;  3U59 A;  2KOG A;  4GOF A;  1VQP P;  5AVZ B;  1SS1 A;  3PHL A;  4I2L C;  2QM8 A;  4BRY B;  1HGZ A;  2Y0C A;  4YPC A;  2KSE A;  4YXD C;  1FDI A;  1GK6 A;  2A06 E;  4NPD A;  1HWT C;  1L0L E;  5CBO A;  1SQX E;  3Q3D A;  2XKM A;  2IBZ I;  1KQL A;  3V4Q A;  2HOD B;  1BDD A;  4PD4 E;  2W8Z A;  1IK7 A;  3CMA P;  1X8Y A;  4N78 D;  4WY4 A;  3MTU E;  3WUU A;  1VQ6 P;  4ZMD A;  2W90 A;  5KLV K;  2Q3E A;  4I7Z C;  3O6Q A;  2N9B A;  1BE3 G;  1LNQ A;  1URQ D;  2YMK A;  2XNX A;  4H0L D;  3H1K D;  3LID A;  2BAS A;  1IZN B;  4OH8 B;  1YHQ P;  1NTZ G;  1M1J C;  1NU1 D;  3M0A A;  3PH0 A;  3FXE A;  1H0T A;  1N8R Q;  4D6T E;  2JWA A;  3CWB E;  2QG4 A;  1JEK A;  2P2U A;  3L72 E;  1K9M Q;  3MD0 A;  1FOS E;  4Y99 B;  1EXJ A;  3JCU E; 
#chains in the Genus database with same CATH homology
 1T2K C;  1YTZ I;  3IR9 A;  1KZU B;  1GD2 E;  3HD7 A;  5CCG A;  5APX A;  3H32 A;  4WBA A;  1IFI A;  3A2A A;  3V2Q A;  2CPS A;  5AVQ B;  1FU1 A;  2Q3I A;  2JEE A;  2E42 A;  2WPS A;  2I1K A;  3NXS A;  3VYI A;  1H88 A;  5AVU B;  1KIL D;  4LLH A;  1T8Z A;  1X9V A;  3O8Z A;  4WB4 A;  2KLV A;  4EOT A;  2FKW B;  1JY3 O;  1NTM K;  4WY4 B;  3GHG C;  4EIJ A;  1IFJ A;  3VP8 A;  1L4A D;  3OA7 A;  4I1L A;  2C0X A;  5AW3 B;  1A02 F;  2MJZ A;  3L35 A;  1RF1 B;  1T2K D;  2N1T C;  1LWU B;  1NKZ B;  1L0L K;  1FZB A;  4Y99 C;  5BVZ A;  3E1I A;  1FZG A;  2NPS A;  1N7S B;  5AVV B;  3HE4 A;  1SQX K;  3OAK A;  3RL0 C;  2R5B A;  2HPC B;  1LTB C;  5CJ0 A;  1IFM A;  1ZR4 A;  1LTJ A;  1CW5 A;  1GL2 A;  1SP4 A;  2P67 A;  5CCH A;  2OYI A;  2M3B A;  5CHX A;  3LW5 H;  1GZL A;  1FDM A;  5AVW B;  2KB7 P;  1J2J B;  2WSC H;  4N6J A;  1MZ9 A;  3VTP C;  1NWQ A;  1LT9 B;  1MV8 A;  3NFQ A;  1LGH B;  5AW8 B;  1HBW A;  3CLQ A;  1JOC A;  4WY4 C;  3KQG A;  4C46 A;  1OWA A;  2N1T D;  5CMZ A;  2ZXE B;  3H6P A;  1T3J A;  4AUW A;  3HD7 B;  3RK3 B;  2WIT A;  3BAS A;  3H32 B;  4GKG A;  1DX7 A;  5AW4 B;  1HTL C;  3RL0 D;  2A45 G;  1N73 A;  1LWU C;  1URQ A;  1X79 B;  2PAJ A;  1N7S C;  2WT7 A;  1L0N K;  1CI6 A;  1GU4 A;  1KFM A;  5BU5 A;  1Z56 A;  2OYH A;  4IFD K;  2HFE D;  1H89 A;  2H43 A;  3VOP A;  2YNY A;  4C7N A;  5AVR B;  3VMX A;  1M7L A;  1ZLL A;  1J1D B;  1JY3 N;  3EQ2 A;  2C0W A;  1RF0 A;  1LTG C;  1FJP A;  4KHX A;  2XDJ A;  1LTS C;  1SFC A;  2HG5 D;  3HTK A;  1JY2 N;  3R2P A;  2J59 M;  2Z5H A;  1MUU A;  3TNU A;  2NPS B;  1GTW A;  3HE4 B;  4M3L A;  1FZE A;  2C9N Y;  3A7O A;  2FYU K;  3T97 A;  3RK3 C;  5CCG C;  1CZQ A;  1LTJ B;  1N7S D;  1YYC A;  1E5W A;  5AVS B;  2A45 H;  1GL2 B;  4JYB A;  3P7K A;  2OYI B;  1DH3 A;  1KIL A;  5APS A;  1M1J A;  1G1I A;  1JTH A;  2I1J A;  1JCD A;  3IFM A;  1JY2 P;  1RE3 A;  5AW6 B;  2FFD C;  5KJ7 C;  1KFN A;  1RY3 A;  3M9Q A;  3U1A A;  3CL3 D;  3VMZ A;  2VRS A;  2P7J A;  1NOH A;  1H8A A;  1L4A A;  3B5N A;  4DOJ A;  4XE5 B;  2XU6 A;  1JNM A;  3HRN A;  1GU5 A;  1J1D C;  2YMY A;  3HE5 A;  5AVX B;  1HVV A;  1ZN5 A;  2PP6 A;  3CI9 A;  2W6A A;  3MIW A;  4ZKU A;  1N73 B;  1MFZ A;  1URQ B;  2H8P D;  1JUN A;  3RK3 D;  5CCG D;  3A5T A;  2NPS C;  3BRT B;  2WT7 B;  1CI6 B;  3MUD A;  4AQR D;  2OYH B;  2WTY A;  5APQ A;  1FZC A;  1FOS F;  5KJ7 D;  3G3Z A;  1GL2 C;  4C7N B;  1S9K D;  5CCH C;  2OYI C;  3VMY A;  3GHG A;  5AW9 B;  2GUV A;  1HJB A;  4JF7 A;  4O9B A;  3RK2 B;  2HLO A;  1SFC B;  2JJL A;  4IFM A;  3HTK B;  3V2N A;  3TNU B;  3MGN A;  5APT A;  3B8E B;  1G2C A;  4AYC A;  5AW0 B;  3UIA A;  2GUS A;  3V2R A;  1QL1 A;  4W80 A;  2NPS D;  1N73 C;  1HGV A;  2J58 A;  2R32 A;  4RES B;  1NH4 A;  1ZR2 A;  1KIL B;  1URQ C;  1M1J B;  1JTH B;  1SQP K;  1RF1 C;  3P32 A;  4W7Z A;  1GL2 D;  4JYC A;  5CCH D;  1S9K E;  4C7R A;  3NMD A;  1VPC A;  2WSF H;  1WRG A;  2ZFC A;  2OYH C;  2IX7 C;  2YO2 A;  2Q7C A;  5BU8 B;  3A3Y B;  2WPQ A;  1L4A B;  3M06 A;  3B5N B;  5AVY B;  2C9L Y;  3L37 A;  1FZA A;  1IFN A;  4GT1 A;  3NTN A;  3HE5 B;  1IC2 A;  1RF0 C;  3RK2 C;  1IFD A;  4XA4 A;  3BVH A;  1SFC C;  1QL2 A;  1GDT A;  2GM4 A;  1NTZ K;  4WY4 D;  5APY A;  3M9B A;  3TSI A;  3I5C A;  1LT9 C;  3KYQ A;  4HYT B;  3TK1 A;  1FZF A;  3N4X A;  1IJD B;  1VDF A;  5AW1 B;  1J1E B;  4W7Y A;  1GK4 A;  1FZC B;  3BAT A;  3BRV B;  3HD7 C;  1JY3 P;  1NU1 K;  3GHG B;  3VP9 A;  1RE3 C;  5AVT B;  3M0D A;  2O1K A;  1GW4 A;  1RE4 A;  3HUS A;  1N7L A;  1NKN A;  1NO4 A;  1A02 J;  1L4A C;  3B5N C;  3P8M C;  3RK2 D;  3TYY A;  2HOD A;  3P8C D;  1G2C B;  2A45 I;  2YKO A;  1NAF A;  3PP5 A;  2LKM A;  5AW7 B;  3KDP B;  1LTT C;  2Z4E A;  3M9H A;  3V4W A;  2WZ7 A;  5APW A;  1JO5 A;  3SWY A;  1N2D C;  1SVF A;  2WSE H;  1FJK A;  1W2E A;  3HD7 D;  2E43 A;  2FFD A;  5KJ7 A;  1EQ7 A;  1SLQ A;  4B86 A;  1J1E C;  1PFI A;  1FZC C;  2R3C A;  3OJA B;  2W6B A;  5CJ4 A;  4LC1 A;  1WT6 A;  3VN0 A;  1LTJ C;  2CPB A;  4I6M C;  1XTG B;  1DEB A;  3KPE A;  3B5N D;  1XTC C;  2WWW A;  2O1J A;  4IFF A;  5AW2 B;  1IK9 A;  2IPP A;  2YKP A;  1JY2 O;  2QM7 A;  3P8C E;  2R5D A;  2H7H A;  1HH0 A;  1GW3 A;  2XZR A;  4N3Y B;  3U59 A;  2O01 H;  2KOG A;  1ZV8 A;  2N1T A;  2KYV A;  5AVZ B;  4I2L C;  2L5G B;  2QM8 A;  4HH2 A;  2M8R A;  1HGZ A;  2IFN A;  3II6 A;  2P1J A;  2FXM A;  4GIF A;  1NTK K;  1GK6 A;  1JMM A;  1HWT C;  5APV A;  3L36 A;  1HUC A;  3M91 A;  1YTZ T;  1LTI C;  2YO3 A;  1SQQ K;  1N86 A;  1CSB A;  3HUS B;  2XKM A;  1KQL A;  3N7N A;  2IFM A;  5APU A;  3V4Q A;  2HOD B;  4DZO A;  1LTA C;  3V2P A;  1SQB K;  3EFG A;  1G1J A;  1X8Y A;  4N78 D;  4WY4 A;  3MTU E;  1OXZ A;  4LGD E;  5KLV K;  3SWF A;  1RF1 A;  3V5B A;  1LWU A;  2FFD B;  3C9I A;  2WPR A;  2OAR A;  2Q9I A;  1N7S A;  1SQV K;  2N9B A;  2XV5 A;  1AFO A;  1URQ D;  2Q5U A;  2XNX A;  2POH A;  2HPC A;  1NHL A;  2KSJ A;  3LID A;  2BAS A;  2KP8 A;  4ZKP A;  3U1C A;  4OH8 B;  2W27 A;  3M0D C;  1KIL C;  1M1J C;  1IO4 A;  1RE4 C;  3HUS C;  3M0A A;  2HYN A;  3L4F A;  5KTB A;  1FBM A;  2FYZ A;  2P2U A;  3WMM 0;  4N78 E;  1FAV A;  3LIE A;  1LT9 A;  2N1T B;  3MD0 A;  5AW5 B;  1FOS E;  4Y99 B;  2YKQ A;  2Z5I A;  1SFC D;  1AQ5 A;  1T3U A;  1JCC A;  3RL0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...