1GK6A

Human vimentin coil 2b fragment linked to gcn4 leucine zipper (z2b)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
55
structure length
55
Chain Sequence
MKQLEDKVEELLSKNYHLENEVARLKKLVGDLLNVKMALDIEIATYRKLLEGEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords VIMENTIN
publication title Conserved Segments 1A and 2B of the Intermediate Filament Dimer: Their Atomic Structures and Role in Filament Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 25
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gk6A00
2WPRA 4B86A 1GK4A 4I2LC 3HTKA 1NWQA 1GZLA 2YO3A 5AW2B 3A2AA 5AVQB 3TNUA 1X8YA 3T97A 3VMYA 2WWWA 5AVWB 2C9LY 1GU5A 1JUNA 4GKGA 1SLQA 2Z5IA 1FOSE 1YYCA 5AVVB 3TNUB 3MGNA 2WT7A 3VYIA 4EOTA 5AVZB 5APXA 2R5DA 2P7JA 4JYBA 3VMZA 3KDPB 2WT7B 1HJBA 3L37A 1MFZA 2P67A 1OXZA 3L35A 2KP8A 5APUA 2N9BA 1S9KE 3LIEA 5APYA 3V4WA 3VMXA 5APVA 3MD0A 1KQLA 3M91A 1J2JB 1H8AA 5AW0B 2E42A 2R5BA 4M3LA 3I5CA 4C46A 1H88A 3SWFA 4AQRD 3TYYA 5CMZA 1NAFA 3HE5A 1A02J 3M9BA 1T2KC 1HWTC 3P7KA 3NTNA 3A7OA 2YNYA 4HYTB 5AW8B 4XE5B 3HE5B 2XU6A 3M0AA 2ZFCA 1GD2E 3OAKA 1FAVA 1CZQA 2Q3IA 4KHXA 4DZOA 4C7NA 2Z5HA 3M06A 1GU4A 2VRSA 3LIDA 3A5TA 2C9NY 3V4QA 3IR9A 5AVRB 3HE4A 3V5BA 3VTPC 3M9HA 2W27A 1T2KD 2ZXEB 2QM8A 5AW1B 5AVXB 2Q7CA 3B8EB 2WPSA 2QM7A 1CI6A 2WPQA 1MUUA 4GT1A 3HE4B 4AYCA 3L36A 1HUCA 2R3CA 3NFQA 2Q5UA 5APSA 5AW3B 1CI6B 1H89A 1OWAA 4RESB 5AW7B 3TK1A 1HBWA 2XZRA 5AW5B 5AVTB 3UIAA 2H7HA 3NMDA 3A3YB 1A02F 1G2CB 1CSBA 4JYCA 1GK6A 5AVUB 1FOSF 2JJLA 3VN0A 5APQA 3KQGA 5APWA 1JNMA 1DH3A 5AW4B 5AW9B 4AUWA 2IPPA 5AVSB 1SP4A 2YO2A 4LC1A 3P8MC 2R32A 1GTWA 1MV8A 5APTA 4C7NB 2P2UA 5AW6B 2XV5A 2E43A 3NXSA 2BASA 3O8ZA 1S9KD 2WTYA 1IO4A 3M0DA 2W6AA 4I6MC 3P32A 5AVYB
chains in the Genus database with same CATH superfamily
4R4MA 1G1IA 1RH5B 2WWWA 4UB8E 1M1JC 2ITAA 1URQA 3IF4A 1SQXG 2K3RA 1S5LH 2RH0A 4JQ0D 2G3AA 2ZT9D 1HF9A 2P7JA 1M90Q 4H13C 2E76B 2P67A 4RJTA 2HPCB 2ZVNB 5CCGD 4U3FD 1MZ9A 2FYUK 4TT3H 3L70E 1SQPD 2V7QH 1NTKD 5GTIE 3M0AA 3OAKA 2B89A 2HODB 4C7NA 3D6YA 2VRSA 3RK2C 1ZW0A 4W80A 4PD4I 1BGYE 2Y0DA 1LT9B 1VQPP 2KZIA 1FZEA 1K9MQ 3N7NA 4D6TE 2CPSA 1ZRTD 3KYQA 2KLVA 1RE3C 2FY8A 2HLOA 1U7JA 5AW9B 4HH2A 4H13B 4NPDA 5TJHA 1LTJC 1FZCC 1KV4A 5KLVD 3L72G 2C0XA 4U3FJ 4UB8H 2OYIC 3USSA 2E76D 5L8RJ 3CCSP 1JUNA 1SS1A 2IBZD 1NTKJ 3RK2B 2KSJA 2WT7B 1HJBA 3HUSA 2B87B 2Y9YA 2HG5D 3LW5H 3L35A 2YKPA 3VMXA 1IFPA 1KQLA 1H8AA 1H0TB 4WBAA 2M3EA 1SQXJ 5GTIH 2O1JA 1HJ0A 4XE5B 3L70G 1FZBA 1FAVA 4MN4C 1LTJB 1J1EC 1NTZE 1FZCB 3CWBE 3AEDC 3LIDA 1VQ6P 1R5SA 2WSFJ 1NU1E 2KS1A 3TSIA 1L0LD 4ZMDA 3EWKA 3HE4B 1BGYG 4H13D 2LXCB 4D6TG 1QVGO 2BCCD 3L74E 3WMM0 1JOCA 3TF5A 1S1CX 5APWA 5AW4B 1FC2C 2V7QJ 1SVFA 4LC1A 2AXTE 2QJPC 4O9BA 1Z56A 3O8ZA 1QL1A 1RQVA 2WPRA 4B86A 3EFFK 3CCVP 3H32A 3V2RA 1KTMA 5KLIC 2ZYDA 1M1KQ 2FYUE 4Z1MH 3S9OA 5BVZA 3VYIA 1JEKA 1URQB 1NTMG 3AEAC 1MFZA 3RL0C 2N9BA 3MHVA 1SQPK 3AE4C 3M91A 1LTSC 3S1KA 3CD6P 4GOEA 3SWFA 2WQYC 2W90A 2L5GB 2BCCJ 3NTNA 1S3JA 3MUDA 5CBNA 2OTKE 3MIWA 1EZVD 2XDJA 2QJPB 1VL2A 1JY3P 4KHXA 1X9VA 1NTZG 2WSEH 3CWBG 4ASWA 2L91A 3LW5J 3BASA 1AQTA 1NU1G 4L76A 2QJYC 5KLIB 3HUSC 4N78D 3L70J 2GUVA 4RESB 1KZUB 2B9BA 3H1LD 1VPCA 1CSBA 3CCRP 1Y9BA 4JYCA 3KZIH 3VN0A 3BRTB 3PHLA 1JNMA 3L74G 2AXTH 1PP9E 3P8MC 1KB9E 5APTA 1LTBC 4JBZA 1BGYJ 3QH9A 4PD4E 2FYNB 4D6TJ 1JTHA 3HTKA 1NWQA 1URQD 3Q3DA 2ZYGA 3AE3C 3L75E 2N1TD 3I56P 1L4AC 4A7PA 1PPJD 3G6EP 2RKLA 3H1HD 2Q9IA 2QEXP 3D71A 1OW6A 2YMYA 1L0NK 2FYUG 4XA4A 1X79B 3HD7A 1GW4A 5KAFE 1OXZA 1U7MA 2QJYB 3HUSB 2AEJA 2AEFA 1TU3F 2P10A 3H1IG 2I1JA 1KILA 1L0LK 1IFDA 2SPZA 3BVHA 1USDA 2Y0CA 1Q90D 2JDIH 3H6PA 4IFFA 1G1JA 2PGDA 3ITKA 2BEZF 1NH4A 2KS1B 2K88A 1Q82Q 2XNDH 4YXDC 2YXQB 1EZVI 3OJAB 1KORA 3MZWB 4H44C 1KB9H 2KIKA 1NTZJ 3CWBJ 2Q1KA 1AA0A 3BATA 4GOFA 3MUDC 3H1KD 1NU1J 1MKMA 1VQ5P 1QL2A 4IFDK 2WSEJ 3CLQA 3U1AA 1JMBA 1SQPE 1N7LA 1X8YA 3L74J 3AE7C 3H32B 1YYCA 3MGNA 3TGUE 2DW3A 5KAFH 1NHLA 4JYBA 1ZR2A 3ABVC 2QJKC 2AEMA 2KP8A 2R3SA 1ZRTE 5KJ7D 1S9KE 5APYA 1Q86Q 2LKMA 3I5CA 1SFCA 3V2QA 1BSNA 1NAYA 3HE5A 4H44B 1OVVA 1GDTA 2NZ2A 3HRNA 2FYUJ 3FWLA 1PP9D 1QEXA 5CHXA 1ZXGA 1GMJA 5KLVE 1GL2A 1OIPA 5KTBA 1K04A 1FBMA 1IFIA 1JY3N 1KYOH 3M0DC 3HD7C 5CCHA 1SQVK 2O01H 3L75D 1OWAA 2CK3H 2IBZE 1A02F 3AEBC 1YQ4C 1NYHA 2QJKB 1LNQA 1BDCA 2QE7H 5B66E 3B5NA 2E76C 2XV5A 2PAJA 1IO4A 3CCEP 3RL0g 4U3FG 1IFMA 5DJTB 1JTHB 2C9LY 3HTKB 1SQPG 1NTKG 2O01N 1PP9J 4TLFA 2IZ1A 4H44D 3Q5PA 1LT9C 1L0LE 2GM4A 3HD7B 1FU1A 1LGHB 2WSCH 4PJ0E 2J5UA 2R5BA 1LT1A 2BCCE 1N7SA 1KYOD 3L73D 1NAFA 3CMEP 3L75J 3U59A 2N1TA 3GG2A 1IK7A 3G4SP 2XU6A 2H89C 4GODA 5B5EE 4PV1C 1EDLA 4NPFX 3B71A 1KC8Q 5CJ4A 5KLVG 3GW6A 1RQUA 5APSA 4ASVA 4WY4A 2XZRA 3F89A 2H7HA 1Y8AA 3TGUD 1GK6A 1KB9I 1FOSF 3FX0A 2IBZG 2RN0A 5B66H 4OWFA 1MV8A 2C0WA 4L74A 2KZJA 3W67A 1T6AA 1S9KD 2FFDA 1VQ7P 2W6AA 1SQQK 4OGQC 2FKWB 2OTLP 1GZLA 2KOGA 2A06D 1M56D 2YO3A 3FXDA 1LWUA 5DJUB 1GL2C 1P84D 2NPSA 1VQKP 2H8PD 2O01J 1EZVE 3HD7D 2JR8A 1ZMEC 2JKVA 4PV1B 2KB7P 4EOTA 3II6A 5CCHC 2R5DA 1VQLP 2R44A 3CL3D 5C39A 2A45H 4PJ0H 3OA7A 4DJGA 1K8AQ 1J2JB 1L0LG 4L73A 4N78E 4M3LA 1SQPJ 2JWDA 3H1LE 1DD3A 3TYYA 2ZVOB 1ZLLA 1KILD 4QMAA 3SWYA 3C1LA 2BCCG 1SFCB 3V2NA 3TGUJ 5B5EH 4EIJA 3HE5B 1GD2E 2ZFCA 1CZQA 2OGUA 1WT6A 1L0ND 2OTJP 4OGQB 4IL6X 5AVXB 2Q7CA 3VMAA 2WPSA 5KJ7A 1KYOI 1VQMP 4RO0A 1GL2B 3Q5SA 2WSCJ 3FGAD 2I1KA 3JCUE 5AW7B 1SQBK 1PPJE 3H1HE 3CXHD 1YTZI 5TISE 4OVNF 1S2EA 1URQC 1UIXA 1N7SC 1AV1A 4JPZB 4K3AA 1VQ4P 1K05A 2P2UA 5KLVJ 2N1TC 3IFMA 3P32A 3B5NB 4PV1D 3RBXA 3V6IA 1JY2O 3KPEA 3H1JE 5AW2B 1VDFA 3T97A 2Y9ZA 1OFCX 5E79E 1GU5A 1FOSE 3KZIE 1DEEG 1KFMA 5CBOA 2WZ7A 3TDKA 1EZVG 3WUVA 1LTTC 1SFCD 1JCDA 1EDKA 4EI2A 1YJNP 2ZJSE 4OGQD 2Q3EA 1RF1A 3H1LG 3L71D 2GUSA 1N7SB 3PTZA 3K5BA 1PIXA 1GL2D 1LWUC 2N1TB 2M0BA 3H1KE 1GU4A 3IR9A 3KXDA 3M9HA 1L0LJ 1T2KD 2FYNC 1VF5B 5CCHD 2ZAEB 3PRJA 4GT1A 1HUCA 2IBZI 3JCUH 2FXOA 1H89A 1QLED 1HBWA 3UIAA 5TISH 4WY4B 2J59M 1XTGB 3B5ND 1PPJG 4AUWA 4ZNCA 5AVSB 1JM0A 3H1HG 1PGJA 1SP4A 2KNCA 2W6JH 4C7NB 1BCCD 1HH0A 1YHQP 1YIJP 2JEEA 3RBZA 2QM7A 4LGDE 2JP3A 1FJPA 5E79H 3A0BE 3VMYA 1SQXK 3Q5RA 1SQVD 1PGPA 4HB1A 5KJ7C 2JWAA 1LWUB 3L71J 1Q7YQ 2NPSB 1X22A 3WU2E 2A45I 1N7SD 3LIEA 3V4WA 5APVA 4BRYA 1BE3E 4WWIA 3EFGA 2IYPA 2YXRB 2ZYAA 5CMZA 1A02J 2IFMA 1NJIQ 1VF5D 1BSHA 2J58A 2YNYA 1SQBE 2FBWC 4I7ZB 2LR2A 2QG4A 4DZOA 4U7JA 5AVRB 1IK9A 3V5BA 1T3UA 3H1KG 4WY4D 2LXBA 2XKMA 2M8RA 1JMMA 3AECC 2GA1A 1OVRA 3H1JD 3H1LJ 3BCCD 1SQVJ 2YKQA 2JJLA 1YJ9P 2YO2A 1LTAC 1RF1C 4CPGA 2IX7C 2YIUC 3GHGA 3I55P 2NRGA 3A0BH 2YKOA 2NPSD 1KYOE 2E75C 3L73E 4BXLA 1NKZB 3H1HJ 2Z5IA 2ZXXA 3T97B 3WU2H 2QIWA 2WMMA 1PP9G 1KQSO 2O3JA 3RGUA 2W8ZA 5H2FE 5APUA 2H88C 3AE2C 3D70A 4Y28J 1T8ZA 1SQQD 1FS0E 2M5AA 1M1JA 2V4HA 3H1JJ 3A0HE 3SSUA 3AEGC 3L75G 3P7KA 1RE4A 1LP1A 4IFMA 1RF1B 3OW2O 2YIUB 2Q3IA 2OQQA 2BEQD 2Z5HA 3E1RA 3V4QA 2AXCA 3AE8C 2E75B 3CCUP 2A06E 1WMKA 4AYCA 1W2BO 4YPCA 5AW3B 1P84E 1KMIZ 4W7ZA 1EDIA 5AVTB 2MKVA 3A3YB 1OW8A 1X0TA 1QGKB 3H1KJ 2R32A 5M1BA 3AEFC 4NPEA 3B4SA 1YJWP 3CCMP 2KNCB 3U1CA 5AVYB 1BE3D 1M8OB 1ZP0C 4DCKA 1RE3A 4ZKUA 3AE6C 1KILE 2I8DA 3L73G 1E5WA 1SQBD 2D2CC 3R4YA 1NTMK 1VQNP 2WVRA 5APXA 1L0NE 3CCLP 1W2EA 5H2FH 1N73A 3RK3C 1KILC 5GTHE 2FXMA 2OYIA 3CC7P 2OARA 2OYOA 3A0HH 1AVOA 2IFNA 3H25A 3G9RA 3CXHE 4BRYB 3KHUA 1M7LA 2Z4EA 1BDDA 3A7OA 2E75D 3PJSK 3TGUG 4WVZA 1N2DC 2QA4P 3M06A 3E7KA 1NU1K 2IYOA 3L72E 1MUUA 1P84H 1BE3J 1PZQA 3R2PA 2Q5UA 3V2PA 1FDMA 2A06G 1L2PA 2WPVB 2D2CB 3F5HA 3PP5A 5AW5B 1PFIA 2P58A 3PLNA 1Q2NA 1SQBJ 5APQA 1GW3A 1DH3A 3RK3B 1KILB 2IZ0A 4IL6E 1Q81Q 1FZAA 1RE4C 2XNXA 1S5LX 1IC2A 3FXEA 2WSFH 2WSSH 3CX5E 1JY2P 4I2LC 1VQOP 3GHGB 3IN6A 1ZN5A 2KLUA 3TNUA 1E79H 3L71E 2OYHA 1JCCA 1EQ7A 1KD1Q 3O6QA 1SFCC 1SLQA 1Y47A 1VQ9P 5AVZB 1FDIA 5GTHH 3AE9C 4DT0A 3KDPB 4UB6E 3L37A 2QSIA 3CMAP 1L0NG 1QVFO 2POHA 3MD0A 3CXHH 3L73J 2E42A 1H88A 2IDBA 1T2KC 2M5AB 1M1JB 1SQXD 1YI2P 4JF7A 1RY3A 3AEEC 1WRGA 1BCCE 1LP1B 1PGOA 2D2CD 2C9NY 1DX7A 5AW1B 2K1AA 2E5YA 1EDJA 3B5NC 1CI6A 2A45G 4BWNA 3RK3D 3GMAA 1N73C 1SQVE 3W68A 1XTCC 4GDOA 4IL6H 1NTME 3CX5H 5AW6B 4H0LC 1ZR4A 1EXIA 1HTLC 1LTIC 4I6MC 1NO4A 1KQFB 3MTUE 2W6BA 1YBKA 1W5CE 4LLHA 3AE5C 4L75A 5AVWB 2JO1A 2FXPA 5AVVB 3L71G 4UB6H 4C7RA 1USEA 2PP6A 2YMKA 1AVYA 3CC2P 3ZDMA 3GF7A 1IZNB 1VF5C 3L72D 1R8EA 2HR3A 4K35A 1N73B 2KXPB 2E74C 1L4AA 2OYIB 4AQRD 3BCCE 1M57D 1HWTC 4WY4C 3MP7B 1L0NJ 3P8CE 4H0LB 3VP9A 3EQ2A 2OYHC 3A5TA 4XFJA 4KT0J 1BCCG 3CX5D 4IOIH 3B8EB 1P84I 3Q1MA 4KJMA 1ZV8A 3L36A 2FFDC 3NFQA 1G2CA 3CCQP 3RK2D 1HGVA 3CI9A 4Y99C 3L70D 1SQVG 1EXJA 2IPPA 2NPSC 4YTPC 1J1DC 1J1EB 1GTWA 2FYZA 1RF0A 4W7YA 2E43A 3NXSA 4I1LA 2QRXA 2E74B 3L72J 2P1JA 1SQQE 1BGYD 1U57A 1GK4A 2KUBA 2MJZA 1PGQA 5BU5A 4D6TD 4HKZH 2W83C 5AVQB 1NTKK 1DEBA 5BU8B 1JY2N 3H1IE 1MFTA 3TNUB 5KAIE 2OYHB 4I7ZC 3O6QB 2O1KA 3VMZA 1D7MA 3GLMA 4EYYQ 1IFJA 2FFDB 3CXHI 1JO5A 1KQGB 1HGZA 4Y99B 4H0LD 1R5LA 3H1JG 2K9JA 3BRVB 1NGMB 5CCGA 4R4LA 5K5GB 3BCCG 4GIFA 3SFEC 1J1DB 2N9YB 1NTMD 3E1IA 1KFNA 3WUTA 5KLVK 2PFXA 1LTGC 2B88A 3RL0B 2QM8A 3QWOC 1S72P 2R3CA 1LJ2A 2RMZA 3IAOA 1YITP 1YQ3C 1CI6B 3WUUA 3N4XA 2Q6QA 2E74D 5AVUB 1NVOA 3C9IA 3KQGA 4EDFA 1BCCJ 2KK7A 1PV3A 3CX5I 1S4XA 1NTZD 2K9YA 3CWBD 1EC5A 2WTYA 3M0DA 1NU1D 4RKUJ 5EFWB 1FZFA 2PRRA 3JC22 1YTZT 3JSVC 4YXWH 1SQQG 1DIPA 4N3YB 5KAIH 4GKGA 5CJ0A 3AE1C 3L74D 3P8CD 2HPCA 1T3JA 1NTMJ 1FZGA 1NKNA 1DD4A 3M9QA 3GF3A 5AW0B 1RF0C 3FWNA 1OVUA 3RL0D 1L4AB 1KN7A 3C8VA 2HODA 1OZHA 1FE6A 2WITA 3CCJP 4HYTB 1N8RQ 2FYUD 4ZKPA 1LT9A 1HVVA 3PH0A 1AJYA 1CW5A 1JY3O 2W27A 3L4FA 4PD4H 1K73Q 2WPQA 4OH8B 3G71P 1BE3G 1OW7A 4U3FE 3BCCJ 1AFOA 3D6ZA 1OX3A 3VOPA 3TK1A 3H1ID 2ZT9C 1VQ8P 3NMDA 1G2CB 1SQBG 1NTKE 5CCGC 1JB0J 1FJKA 5KKZC 2KI7B 1UIIA 3Q2YA 2HFED 3A2AA 1SQXE 4N6JA 2KSEA 2WT7A 2H43A 2B87A 3G3ZA 2G8YA 1S5LE 4DOJA 1KB9D 3CC4P 1L4AD 1H0TA 1SQQJ 3RK3E 4PD4D 4C46A 2ZT9B 2HYNA 1N86A 3M9BA 4WB4A 3H1IJ 1LTJA 1FDOA 2Y0EA 1FZCA 2K9JB 5AW8B 1OMIA 2UWJE 2M3BA 5KKZB 3HE4A 3VTPC 2KYVA 2ZXEB 1NOHA 2QVAA 1PL5A 3VP8A 3GHGC 1IFNA 1RHZB 3CPWO 4HJGH 2E5TA 1NTZK 1QX8A 1ZOYC 3SWKA 3S4RA 3SFDC 2CPBA 1IJDB 1AQ5A 2BASA 2K37A
chains in the Genus database with same CATH topology
3MTUE 2W6BA 4IFDK 1FJPA 3CLQA 1G1IA 3U1AA 4LLHA 1N7LA 1X8YA 3VMYA 1SQXK 2WWWA 5AVWB 1M1JC 1URQA 3H32B 5KJ7C 1LWUB 1YYCA 5AVVB 3MGNA 4C7RA 2NPSB 1NHLA 2P7JA 2PP6A 4JYBA 1ZR2A 2A45I 2P67A 2HPCB 2KP8A 1N7SD 5KJ7D 1S9KE 3LIEA 5APYA 3V4WA 5CCGD 1N73B 5APVA 2LKMA 3EFGA 1L4AA 3I5CA 2OYIB 4AQRD 1SFCA 3V2QA 1MZ9A 5CMZA 3HE5A 2FYUK 1A02J 1GDTA 2IFMA 1HWTC 4WY4C 3HRNA 2J58A 2YNYA 3M0AA 3OAKA 3P8CE 5CHXA 2HODB 4DZOA 4C7NA 3VP9A 3EQ2A 2OYHC 2VRSA 3RK2C 3A5TA 5AVRB 1IK9A 4W80A 3V5BA 1GL2A 1LT9B 1T3UA 1FZEA 4WY4D 3B8EB 5KTBA 2XKMA 2M8RA 1JMMA 3N7NA 1ZV8A 2CPSA 3L36A 1FBMA 1IFIA 3KYQA 2FFDC 1JY3N 3M0DC 3NFQA 1G2CA 3HD7C 5CCHA 1SQVK 2KLVA 2O01H 1OWAA 3RK2D 1HGVA 3CI9A 4Y99C 1RE3C 1A02F 2YKQA 2JJLA 2HLOA 5AW9B 2IPPA 2NPSC 4HH2A 2YO2A 1J1DC 1J1EB 1LTAC 1GTWA 2FYZA 1RF1C 3B5NA 1LTJC 1RF0A 2IX7C 4W7YA 2XV5A 2E43A 2PAJA 3NXSA 1FZCC 4I1LA 1IO4A 3GHGA 2P1JA 1GK4A 2MJZA 2YKOA 2NPSD 2C0XA 2OYIC 1IFMA 5BU5A 5AVQB 1JTHB 1NTKK 1NKZB 2C9LY 1JUNA 3HTKB 1DEBA 5BU8B 1JY2N 2Z5IA 3TNUB 2OYHB 3RK2B 2O1KA 2KSJA 3VMZA 2WT7B 1HJBA 3HUSA 1IFJA 1LT9C 2HG5D 3LW5H 3L35A 2GM4A 5APUA 2FFDB 2YKPA 3HD7B 3VMXA 1T8ZA 1JO5A 1KQLA 1FU1A 1LGHB 2WSCH 1HGZA 1H8AA 4Y99B 1M1JA 2R5BA 4WBAA 1N7SA 3BRVB 1NAFA 5CCGA 3P7KA 3U59A 2N1TA 2O1JA 1RE4A 4GIFA 1J1DB 4XE5B 4IFMA 2XU6A 1FZBA 1FAVA 1RF1B 1LTJB 2Q3IA 1J1EC 1FZCB 2Z5HA 3E1IA 3LIDA 3V4QA 1KFNA 5KLVK 1LTGC 3RL0B 2QM8A 3TSIA 5CJ4A 3HE4B 4AYCA 2R3CA 4LGDE 5APSA 5AW3B 4WY4A 4W7ZA 1CI6B 3N4XA 2XZRA 5AVTB 3WMM0 2H7HA 3A3YB 1JOCA 1GK6A 5AVUB 1FOSF 3C9IA 3KQGA 5APWA 5AW4B 1SVFA 4LC1A 2R32A 1MV8A 2C0WA 4O9BA 1Z56A 3O8ZA 1S9KD 2WTYA 2FFDA 1QL1A 3M0DA 3U1CA 2W6AA 1SQQK 5AVYB 2WPRA 4B86A 2FKWB 1FZFA 1YTZT 1RE3A 1GZLA 4ZKUA 2KOGA 3H32A 2YO3A 1LWUA 1GL2C 3V2RA 4N3YB 2NPSA 4GKGA 2H8PD 5CJ0A 1E5WA 3HD7D 1NTMK 3P8CD 2KB7P 5BVZA 3VYIA 4EOTA 2HPCA 3II6A 1URQB 5APXA 1T3JA 2R5DA 5CCHC 1W2EA 1FZGA 1N73A 3CL3D 1NKNA 1KILC 3RK3C 1MFZA 3RL0C 2A45H 2FXMA 2OYIA 2N9BA 3OA7A 1SQPK 2OARA 3M9QA 3M91A 1LTSC 1J2JB 5AW0B 4N78E 2IFNA 4M3LA 3SWFA 1RF0C 3TYYA 1M7LA 1ZLLA 1KILD 3SWYA 2Z4EA 2L5GB 3RL0D 1L4AB 3NTNA 3MUDA 3A7OA 2HODA 1SFCB 3V2NA 2WITA 4HYTB 4EIJA 3HE5B 3MIWA 1GD2E 2ZFCA 2XDJA 1N2DC 1CZQA 4ZKPA 1LT9A 1HVVA 1JY3P 4KHXA 3M06A 1X9VA 1WT6A 1CW5A 1JY3O 2W27A 3L4FA 2WSEH 5AVXB 1NU1K 2Q7CA 2WPSA 5KJ7A 2WPQA 1MUUA 4OH8B 3BASA 1GL2B 3R2PA 2Q5UA 3HUSC 3V2PA 1FDMA 1AFOA 2GUVA 4N78D 2I1KA 4RESB 1KZUB 5AW7B 3VOPA 1SQBK 3PP5A 3TK1A 5AW5B 1PFIA 3NMDA 1G2CB 1VPCA 1CSBA 4JYCA 3VN0A 3BRTB 1GW3A 1YTZI 5APQA 1JNMA 1DH3A 1URQC 1N7SC 3RK3B 1KILB 3P8MC 5CCGC 5APTA 2P2UA 1FZAA 1LTBC 2N1TC 1RE4C 2XNXA 1FJKA 1IC2A 3IFMA 2WSFH 1JY2P 3P32A 1JTHA 3B5NB 4I2LC 3HTKA 1NWQA 1JY2O 3KPEA 1URQD 3GHGB 1ZN5A 2HFED 5AW2B 3A2AA 1VDFA 3TNUA 3T97A 2OYHA 1JCCA 1EQ7A 2N1TD 1GU5A 1L4AC 4N6JA 1SFCC 1SLQA 1FOSE 2WT7A 2Q9IA 1KFMA 2H43A 2WZ7A 5AVZB 2YMYA 1L0NK 3G3ZA 3KDPB 4XA4A 1X79B 3HD7A 3L37A 4DOJA 1GW4A 1L4AD 1OXZA 1LTTC 1SFCD 1JCDA 2POHA 3HUSB 3MD0A 2E42A 4C46A 1H88A 2HYNA 1N86A 3M9BA 1T2KC 1RF1A 4WB4A 1LTJA 1M1JB 2I1JA 1FZCA 2GUSA 1N7SB 5AW8B 4JF7A 1RY3A 1GL2D 2M3BA 1KILA 1LWUC 1WRGA 2N1TB 1L0LK 1IFDA 1GU4A 2C9NY 1DX7A 3IR9A 3HE4A 3BVHA 3VTPC 3M9HA 1T2KD 2KYVA 2ZXEB 5AW1B 1NOHA 5CCHD 3H6PA 3B5NC 1CI6A 4GT1A 3VP8A 2A45G 1HUCA 4IFFA 3GHGC 3RK3D 1G1JA 1N73C 1NH4A 1H89A 1IFNA 1HBWA 3UIAA 1XTCC 3OJAB 1NTZK 4WY4B 2J59M 1XTGB 3B5ND 4AUWA 5AVSB 1SP4A 2CPBA 3BATA 1IJDB 1AQ5A 4C7NB 1HH0A 5AW6B 2BASA 1ZR4A 2JEEA 1HTLC 1LTIC 2QM7A 1QL2A 4I6MC 1NO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPR A;  4B86 A;  1GK4 A;  4I2L C;  3HTK A;  1NWQ A;  1GZL A;  2YO3 A;  5AW2 B;  3A2A A;  5AVQ B;  3TNU A;  1X8Y A;  3T97 A;  3VMY A;  2WWW A;  5AVW B;  2C9L Y;  1GU5 A;  1JUN A;  4GKG A;  1SLQ A;  2Z5I A;  1FOS E;  1YYC A;  5AVV B;  3TNU B;  3MGN A;  2WT7 A;  3VYI A;  4EOT A;  5AVZ B;  5APX A;  2R5D A;  2P7J A;  4JYB A;  3VMZ A;  3KDP B;  2WT7 B;  1HJB A;  3L37 A;  1MFZ A;  2P67 A;  1OXZ A;  3L35 A;  2KP8 A;  5APU A;  2N9B A;  1S9K E;  3LIE A;  5APY A;  3V4W A;  3VMX A;  5APV A;  3MD0 A;  1KQL A;  3M91 A;  1J2J B;  1H8A A;  5AW0 B;  2E42 A;  2R5B A;  4M3L A;  3I5C A;  4C46 A;  1H88 A;  3SWF A;  4AQR D;  3TYY A;  5CMZ A;  1NAF A;  3HE5 A;  1A02 J;  3M9B A;  1T2K C;  1HWT C;  3P7K A;  3NTN A;  3A7O A;  2YNY A;  4HYT B;  5AW8 B;  4XE5 B;  3HE5 B;  2XU6 A;  3M0A A;  2ZFC A;  1GD2 E;  3OAK A;  1FAV A;  1CZQ A;  2Q3I A;  4KHX A;  4DZO A;  4C7N A;  2Z5H A;  3M06 A;  1GU4 A;  2VRS A;  3LID A;  3A5T A;  2C9N Y;  3V4Q A;  3IR9 A;  5AVR B;  3HE4 A;  3V5B A;  3VTP C;  3M9H A;  2W27 A;  1T2K D;  2ZXE B;  2QM8 A;  5AW1 B;  5AVX B;  2Q7C A;  3B8E B;  2WPS A;  2QM7 A;  1CI6 A;  2WPQ A;  1MUU A;  4GT1 A;  3HE4 B;  4AYC A;  3L36 A;  1HUC A;  2R3C A;  3NFQ A;  2Q5U A;  5APS A;  5AW3 B;  1CI6 B;  1H89 A;  1OWA A;  4RES B;  5AW7 B;  3TK1 A;  1HBW A;  2XZR A;  5AW5 B;  5AVT B;  3UIA A;  2H7H A;  3NMD A;  3A3Y B;  1A02 F;  1G2C B;  1CSB A;  4JYC A;  1GK6 A;  5AVU B;  1FOS F;  2JJL A;  3VN0 A;  5APQ A;  3KQG A;  5APW A;  1JNM A;  1DH3 A;  5AW4 B;  5AW9 B;  4AUW A;  2IPP A;  5AVS B;  1SP4 A;  2YO2 A;  4LC1 A;  3P8M C;  2R32 A;  1GTW A;  1MV8 A;  5APT A;  4C7N B;  2P2U A;  5AW6 B;  2XV5 A;  2E43 A;  3NXS A;  2BAS A;  3O8Z A;  1S9K D;  2WTY A;  1IO4 A;  3M0D A;  2W6A A;  4I6M C;  3P32 A;  5AVY B; 
#chains in the Genus database with same CATH topology
 4R4M A;  1G1I A;  1RH5 B;  2WWW A;  4UB8 E;  1M1J C;  2ITA A;  1URQ A;  3IF4 A;  1SQX G;  2K3R A;  1S5L H;  2RH0 A;  4JQ0 D;  2G3A A;  2ZT9 D;  1HF9 A;  2P7J A;  1M90 Q;  4H13 C;  2E76 B;  2P67 A;  4RJT A;  2HPC B;  2ZVN B;  5CCG D;  4U3F D;  1MZ9 A;  2FYU K;  4TT3 H;  3L70 E;  1SQP D;  2V7Q H;  1NTK D;  5GTI E;  3M0A A;  3OAK A;  2B89 A;  2HOD B;  4C7N A;  3D6Y A;  2VRS A;  3RK2 C;  1ZW0 A;  4W80 A;  4PD4 I;  1BGY E;  2Y0D A;  1LT9 B;  1VQP P;  2KZI A;  1FZE A;  1K9M Q;  3N7N A;  4D6T E;  2CPS A;  1ZRT D;  3KYQ A;  2KLV A;  1RE3 C;  2FY8 A;  2HLO A;  1U7J A;  5AW9 B;  4HH2 A;  4H13 B;  4NPD A;  5TJH A;  1LTJ C;  1FZC C;  1KV4 A;  5KLV D;  3L72 G;  2C0X A;  4U3F J;  4UB8 H;  2OYI C;  3USS A;  2E76 D;  5L8R J;  3CCS P;  1JUN A;  1SS1 A;  2IBZ D;  1NTK J;  3RK2 B;  2KSJ A;  2WT7 B;  1HJB A;  3HUS A;  2B87 B;  2Y9Y A;  2HG5 D;  3LW5 H;  3L35 A;  2YKP A;  3VMX A;  1IFP A;  1KQL A;  1H8A A;  1H0T B;  4WBA A;  2M3E A;  1SQX J;  5GTI H;  2O1J A;  1HJ0 A;  4XE5 B;  3L70 G;  1FZB A;  1FAV A;  4MN4 C;  1LTJ B;  1J1E C;  1NTZ E;  1FZC B;  3CWB E;  3AED C;  3LID A;  1VQ6 P;  1R5S A;  2WSF J;  1NU1 E;  2KS1 A;  3TSI A;  1L0L D;  4ZMD A;  3EWK A;  3HE4 B;  1BGY G;  4H13 D;  2LXC B;  4D6T G;  1QVG O;  2BCC D;  3L74 E;  3WMM 0;  1JOC A;  3TF5 A;  1S1C X;  5APW A;  5AW4 B;  1FC2 C;  2V7Q J;  1SVF A;  4LC1 A;  2AXT E;  2QJP C;  4O9B A;  1Z56 A;  3O8Z A;  1QL1 A;  1RQV A;  2WPR A;  4B86 A;  3EFF K;  3CCV P;  3H32 A;  3V2R A;  1KTM A;  5KLI C;  2ZYD A;  1M1K Q;  2FYU E;  4Z1M H;  3S9O A;  5BVZ A;  3VYI A;  1JEK A;  1URQ B;  1NTM G;  3AEA C;  1MFZ A;  3RL0 C;  2N9B A;  3MHV A;  1SQP K;  3AE4 C;  3M91 A;  1LTS C;  3S1K A;  3CD6 P;  4GOE A;  3SWF A;  2WQY C;  2W90 A;  2L5G B;  2BCC J;  3NTN A;  1S3J A;  3MUD A;  5CBN A;  2OTK E;  3MIW A;  1EZV D;  2XDJ A;  2QJP B;  1VL2 A;  1JY3 P;  4KHX A;  1X9V A;  1NTZ G;  2WSE H;  3CWB G;  4ASW A;  2L91 A;  3LW5 J;  3BAS A;  1AQT A;  1NU1 G;  4L76 A;  2QJY C;  5KLI B;  3HUS C;  4N78 D;  3L70 J;  2GUV A;  4RES B;  1KZU B;  2B9B A;  3H1L D;  1VPC A;  1CSB A;  3CCR P;  1Y9B A;  4JYC A;  3KZI H;  3VN0 A;  3BRT B;  3PHL A;  1JNM A;  3L74 G;  2AXT H;  1PP9 E;  3P8M C;  1KB9 E;  5APT A;  1LTB C;  4JBZ A;  1BGY J;  3QH9 A;  4PD4 E;  2FYN B;  4D6T J;  1JTH A;  3HTK A;  1NWQ A;  1URQ D;  3Q3D A;  2ZYG A;  3AE3 C;  3L75 E;  2N1T D;  3I56 P;  1L4A C;  4A7P A;  1PPJ D;  3G6E P;  2RKL A;  3H1H D;  2Q9I A;  2QEX P;  3D71 A;  1OW6 A;  2YMY A;  1L0N K;  2FYU G;  4XA4 A;  1X79 B;  3HD7 A;  1GW4 A;  5KAF E;  1OXZ A;  1U7M A;  2QJY B;  3HUS B;  2AEJ A;  2AEF A;  1TU3 F;  2P10 A;  3H1I G;  2I1J A;  1KIL A;  1L0L K;  1IFD A;  2SPZ A;  3BVH A;  1USD A;  2Y0C A;  1Q90 D;  2JDI H;  3H6P A;  4IFF A;  1G1J A;  2PGD A;  3ITK A;  2BEZ F;  1NH4 A;  2KS1 B;  2K88 A;  1Q82 Q;  2XND H;  4YXD C;  2YXQ B;  1EZV I;  3OJA B;  1KOR A;  3MZW B;  4H44 C;  1KB9 H;  2KIK A;  1NTZ J;  3CWB J;  2Q1K A;  1AA0 A;  3BAT A;  4GOF A;  3MUD C;  3H1K D;  1NU1 J;  1MKM A;  1VQ5 P;  1QL2 A;  4IFD K;  2WSE J;  3CLQ A;  3U1A A;  1JMB A;  1SQP E;  1N7L A;  1X8Y A;  3L74 J;  3AE7 C;  3H32 B;  1YYC A;  3MGN A;  3TGU E;  2DW3 A;  5KAF H;  1NHL A;  4JYB A;  1ZR2 A;  3ABV C;  2QJK C;  2AEM A;  2KP8 A;  2R3S A;  1ZRT E;  5KJ7 D;  1S9K E;  5APY A;  1Q86 Q;  2LKM A;  3I5C A;  1SFC A;  3V2Q A;  1BSN A;  1NAY A;  3HE5 A;  4H44 B;  1OVV A;  1GDT A;  2NZ2 A;  3HRN A;  2FYU J;  3FWL A;  1PP9 D;  1QEX A;  5CHX A;  1ZXG A;  1GMJ A;  5KLV E;  1GL2 A;  1OIP A;  5KTB A;  1K04 A;  1FBM A;  1IFI A;  1JY3 N;  1KYO H;  3M0D C;  3HD7 C;  5CCH A;  1SQV K;  2O01 H;  3L75 D;  1OWA A;  2CK3 H;  2IBZ E;  1A02 F;  3AEB C;  1YQ4 C;  1NYH A;  2QJK B;  1LNQ A;  1BDC A;  2QE7 H;  5B66 E;  3B5N A;  2E76 C;  2XV5 A;  2PAJ A;  1IO4 A;  3CCE P;  3RL0 g;  4U3F G;  1IFM A;  5DJT B;  1JTH B;  2C9L Y;  3HTK B;  1SQP G;  1NTK G;  2O01 N;  1PP9 J;  4TLF A;  2IZ1 A;  4H44 D;  3Q5P A;  1LT9 C;  1L0L E;  2GM4 A;  3HD7 B;  1FU1 A;  1LGH B;  2WSC H;  4PJ0 E;  2J5U A;  2R5B A;  1LT1 A;  2BCC E;  1N7S A;  1KYO D;  3L73 D;  1NAF A;  3CME P;  3L75 J;  3U59 A;  2N1T A;  3GG2 A;  1IK7 A;  3G4S P;  2XU6 A;  2H89 C;  4GOD A;  5B5E E;  4PV1 C;  1EDL A;  4NPF X;  3B71 A;  1KC8 Q;  5CJ4 A;  5KLV G;  3GW6 A;  1RQU A;  5APS A;  4ASV A;  4WY4 A;  2XZR A;  3F89 A;  2H7H A;  1Y8A A;  3TGU D;  1GK6 A;  1KB9 I;  1FOS F;  3FX0 A;  2IBZ G;  2RN0 A;  5B66 H;  4OWF A;  1MV8 A;  2C0W A;  4L74 A;  2KZJ A;  3W67 A;  1T6A A;  1S9K D;  2FFD A;  1VQ7 P;  2W6A A;  1SQQ K;  4OGQ C;  2FKW B;  2OTL P;  1GZL A;  2KOG A;  2A06 D;  1M56 D;  2YO3 A;  3FXD A;  1LWU A;  5DJU B;  1GL2 C;  1P84 D;  2NPS A;  1VQK P;  2H8P D;  2O01 J;  1EZV E;  3HD7 D;  2JR8 A;  1ZME C;  2JKV A;  4PV1 B;  2KB7 P;  4EOT A;  3II6 A;  5CCH C;  2R5D A;  1VQL P;  2R44 A;  3CL3 D;  5C39 A;  2A45 H;  4PJ0 H;  3OA7 A;  4DJG A;  1K8A Q;  1J2J B;  1L0L G;  4L73 A;  4N78 E;  4M3L A;  1SQP J;  2JWD A;  3H1L E;  1DD3 A;  3TYY A;  2ZVO B;  1ZLL A;  1KIL D;  4QMA A;  3SWY A;  3C1L A;  2BCC G;  1SFC B;  3V2N A;  3TGU J;  5B5E H;  4EIJ A;  3HE5 B;  1GD2 E;  2ZFC A;  1CZQ A;  2OGU A;  1WT6 A;  1L0N D;  2OTJ P;  4OGQ B;  4IL6 X;  5AVX B;  2Q7C A;  3VMA A;  2WPS A;  5KJ7 A;  1KYO I;  1VQM P;  4RO0 A;  1GL2 B;  3Q5S A;  2WSC J;  3FGA D;  2I1K A;  3JCU E;  5AW7 B;  1SQB K;  1PPJ E;  3H1H E;  3CXH D;  1YTZ I;  5TIS E;  4OVN F;  1S2E A;  1URQ C;  1UIX A;  1N7S C;  1AV1 A;  4JPZ B;  4K3A A;  1VQ4 P;  1K05 A;  2P2U A;  5KLV J;  2N1T C;  3IFM A;  3P32 A;  3B5N B;  4PV1 D;  3RBX A;  3V6I A;  1JY2 O;  3KPE A;  3H1J E;  5AW2 B;  1VDF A;  3T97 A;  2Y9Z A;  1OFC X;  5E79 E;  1GU5 A;  1FOS E;  3KZI E;  1DEE G;  1KFM A;  5CBO A;  2WZ7 A;  3TDK A;  1EZV G;  3WUV A;  1LTT C;  1SFC D;  1JCD A;  1EDK A;  4EI2 A;  1YJN P;  2ZJS E;  4OGQ D;  2Q3E A;  1RF1 A;  3H1L G;  3L71 D;  2GUS A;  1N7S B;  3PTZ A;  3K5B A;  1PIX A;  1GL2 D;  1LWU C;  2N1T B;  2M0B A;  3H1K E;  1GU4 A;  3IR9 A;  3KXD A;  3M9H A;  1L0L J;  1T2K D;  2FYN C;  1VF5 B;  5CCH D;  2ZAE B;  3PRJ A;  4GT1 A;  1HUC A;  2IBZ I;  3JCU H;  2FXO A;  1H89 A;  1QLE D;  1HBW A;  3UIA A;  5TIS H;  4WY4 B;  2J59 M;  1XTG B;  3B5N D;  1PPJ G;  4AUW A;  4ZNC A;  5AVS B;  1JM0 A;  3H1H G;  1PGJ A;  1SP4 A;  2KNC A;  2W6J H;  4C7N B;  1BCC D;  1HH0 A;  1YHQ P;  1YIJ P;  2JEE A;  3RBZ A;  2QM7 A;  4LGD E;  2JP3 A;  1FJP A;  5E79 H;  3A0B E;  3VMY A;  1SQX K;  3Q5R A;  1SQV D;  1PGP A;  4HB1 A;  5KJ7 C;  2JWA A;  1LWU B;  3L71 J;  1Q7Y Q;  2NPS B;  1X22 A;  3WU2 E;  2A45 I;  1N7S D;  3LIE A;  3V4W A;  5APV A;  4BRY A;  1BE3 E;  4WWI A;  3EFG A;  2IYP A;  2YXR B;  2ZYA A;  5CMZ A;  1A02 J;  2IFM A;  1NJI Q;  1VF5 D;  1BSH A;  2J58 A;  2YNY A;  1SQB E;  2FBW C;  4I7Z B;  2LR2 A;  2QG4 A;  4DZO A;  4U7J A;  5AVR B;  1IK9 A;  3V5B A;  1T3U A;  3H1K G;  4WY4 D;  2LXB A;  2XKM A;  2M8R A;  1JMM A;  3AEC C;  2GA1 A;  1OVR A;  3H1J D;  3H1L J;  3BCC D;  1SQV J;  2YKQ A;  2JJL A;  1YJ9 P;  2YO2 A;  1LTA C;  1RF1 C;  4CPG A;  2IX7 C;  2YIU C;  3GHG A;  3I55 P;  2NRG A;  3A0B H;  2YKO A;  2NPS D;  1KYO E;  2E75 C;  3L73 E;  4BXL A;  1NKZ B;  3H1H J;  2Z5I A;  2ZXX A;  3T97 B;  3WU2 H;  2QIW A;  2WMM A;  1PP9 G;  1KQS O;  2O3J A;  3RGU A;  2W8Z A;  5H2F E;  5APU A;  2H88 C;  3AE2 C;  3D70 A;  4Y28 J;  1T8Z A;  1SQQ D;  1FS0 E;  2M5A A;  1M1J A;  2V4H A;  3H1J J;  3A0H E;  3SSU A;  3AEG C;  3L75 G;  3P7K A;  1RE4 A;  1LP1 A;  4IFM A;  1RF1 B;  3OW2 O;  2YIU B;  2Q3I A;  2OQQ A;  2BEQ D;  2Z5H A;  3E1R A;  3V4Q A;  2AXC A;  3AE8 C;  2E75 B;  3CCU P;  2A06 E;  1WMK A;  4AYC A;  1W2B O;  4YPC A;  5AW3 B;  1P84 E;  1KMI Z;  4W7Z A;  1EDI A;  5AVT B;  2MKV A;  3A3Y B;  1OW8 A;  1X0T A;  1QGK B;  3H1K J;  2R32 A;  5M1B A;  3AEF C;  4NPE A;  3B4S A;  1YJW P;  3CCM P;  2KNC B;  3U1C A;  5AVY B;  1BE3 D;  1M8O B;  1ZP0 C;  4DCK A;  1RE3 A;  4ZKU A;  3AE6 C;  1KIL E;  2I8D A;  3L73 G;  1E5W A;  1SQB D;  2D2C C;  3R4Y A;  1NTM K;  1VQN P;  2WVR A;  5APX A;  1L0N E;  3CCL P;  1W2E A;  5H2F H;  1N73 A;  3RK3 C;  1KIL C;  5GTH E;  2FXM A;  2OYI A;  3CC7 P;  2OAR A;  2OYO A;  3A0H H;  1AVO A;  2IFN A;  3H25 A;  3G9R A;  3CXH E;  4BRY B;  3KHU A;  1M7L A;  2Z4E A;  1BDD A;  3A7O A;  2E75 D;  3PJS K;  3TGU G;  4WVZ A;  1N2D C;  2QA4 P;  3M06 A;  3E7K A;  1NU1 K;  2IYO A;  3L72 E;  1MUU A;  1P84 H;  1BE3 J;  1PZQ A;  3R2P A;  2Q5U A;  3V2P A;  1FDM A;  2A06 G;  1L2P A;  2WPV B;  2D2C B;  3F5H A;  3PP5 A;  5AW5 B;  1PFI A;  2P58 A;  3PLN A;  1Q2N A;  1SQB J;  5APQ A;  1GW3 A;  1DH3 A;  3RK3 B;  1KIL B;  2IZ0 A;  4IL6 E;  1Q81 Q;  1FZA A;  1RE4 C;  2XNX A;  1S5L X;  1IC2 A;  3FXE A;  2WSF H;  2WSS H;  3CX5 E;  1JY2 P;  4I2L C;  1VQO P;  3GHG B;  3IN6 A;  1ZN5 A;  2KLU A;  3TNU A;  1E79 H;  3L71 E;  2OYH A;  1JCC A;  1EQ7 A;  1KD1 Q;  3O6Q A;  1SFC C;  1SLQ A;  1Y47 A;  1VQ9 P;  5AVZ B;  1FDI A;  5GTH H;  3AE9 C;  4DT0 A;  3KDP B;  4UB6 E;  3L37 A;  2QSI A;  3CMA P;  1L0N G;  1QVF O;  2POH A;  3MD0 A;  3CXH H;  3L73 J;  2E42 A;  1H88 A;  2IDB A;  1T2K C;  2M5A B;  1M1J B;  1SQX D;  1YI2 P;  4JF7 A;  1RY3 A;  3AEE C;  1WRG A;  1BCC E;  1LP1 B;  1PGO A;  2D2C D;  2C9N Y;  1DX7 A;  5AW1 B;  2K1A A;  2E5Y A;  1EDJ A;  3B5N C;  1CI6 A;  2A45 G;  4BWN A;  3RK3 D;  3GMA A;  1N73 C;  1SQV E;  3W68 A;  1XTC C;  4GDO A;  4IL6 H;  1NTM E;  3CX5 H;  5AW6 B;  4H0L C;  1ZR4 A;  1EXI A;  1HTL C;  1LTI C;  4I6M C;  1NO4 A;  1KQF B;  3MTU E;  2W6B A;  1YBK A;  1W5C E;  4LLH A;  3AE5 C;  4L75 A;  5AVW B;  2JO1 A;  2FXP A;  5AVV B;  3L71 G;  4UB6 H;  4C7R A;  1USE A;  2PP6 A;  2YMK A;  1AVY A;  3CC2 P;  3ZDM A;  3GF7 A;  1IZN B;  1VF5 C;  3L72 D;  1R8E A;  2HR3 A;  4K35 A;  1N73 B;  2KXP B;  2E74 C;  1L4A A;  2OYI B;  4AQR D;  3BCC E;  1M57 D;  1HWT C;  4WY4 C;  3MP7 B;  1L0N J;  3P8C E;  4H0L B;  3VP9 A;  3EQ2 A;  2OYH C;  3A5T A;  4XFJ A;  4KT0 J;  1BCC G;  3CX5 D;  4IOI H;  3B8E B;  1P84 I;  3Q1M A;  4KJM A;  1ZV8 A;  3L36 A;  2FFD C;  3NFQ A;  1G2C A;  3CCQ P;  3RK2 D;  1HGV A;  3CI9 A;  4Y99 C;  3L70 D;  1SQV G;  1EXJ A;  2IPP A;  2NPS C;  4YTP C;  1J1D C;  1J1E B;  1GTW A;  2FYZ A;  1RF0 A;  4W7Y A;  2E43 A;  3NXS A;  4I1L A;  2QRX A;  2E74 B;  3L72 J;  2P1J A;  1SQQ E;  1BGY D;  1U57 A;  1GK4 A;  2KUB A;  2MJZ A;  1PGQ A;  5BU5 A;  4D6T D;  4HKZ H;  2W83 C;  5AVQ B;  1NTK K;  1DEB A;  5BU8 B;  1JY2 N;  3H1I E;  1MFT A;  3TNU B;  5KAI E;  2OYH B;  4I7Z C;  3O6Q B;  2O1K A;  3VMZ A;  1D7M A;  3GLM A;  4EYY Q;  1IFJ A;  2FFD B;  3CXH I;  1JO5 A;  1KQG B;  1HGZ A;  4Y99 B;  4H0L D;  1R5L A;  3H1J G;  2K9J A;  3BRV B;  1NGM B;  5CCG A;  4R4L A;  5K5G B;  3BCC G;  4GIF A;  3SFE C;  1J1D B;  2N9Y B;  1NTM D;  3E1I A;  1KFN A;  3WUT A;  5KLV K;  2PFX A;  1LTG C;  2B88 A;  3RL0 B;  2QM8 A;  3QWO C;  1S72 P;  2R3C A;  1LJ2 A;  2RMZ A;  3IAO A;  1YIT P;  1YQ3 C;  1CI6 B;  3WUU A;  3N4X A;  2Q6Q A;  2E74 D;  5AVU B;  1NVO A;  3C9I A;  3KQG A;  4EDF A;  1BCC J;  2KK7 A;  1PV3 A;  3CX5 I;  1S4X A;  1NTZ D;  2K9Y A;  3CWB D;  1EC5 A;  2WTY A;  3M0D A;  1NU1 D;  4RKU J;  5EFW B;  1FZF A;  2PRR A;  3JC2 2;  1YTZ T;  3JSV C;  4YXW H;  1SQQ G;  1DIP A;  4N3Y B;  5KAI H;  4GKG A;  5CJ0 A;  3AE1 C;  3L74 D;  3P8C D;  2HPC A;  1T3J A;  1NTM J;  1FZG A;  1NKN A;  1DD4 A;  3M9Q A;  3GF3 A;  5AW0 B;  1RF0 C;  3FWN A;  1OVU A;  3RL0 D;  1L4A B;  1KN7 A;  3C8V A;  2HOD A;  1OZH A;  1FE6 A;  2WIT A;  3CCJ P;  4HYT B;  1N8R Q;  2FYU D;  4ZKP A;  1LT9 A;  1HVV A;  3PH0 A;  1AJY A;  1CW5 A;  1JY3 O;  2W27 A;  3L4F A;  4PD4 H;  1K73 Q;  2WPQ A;  4OH8 B;  3G71 P;  1BE3 G;  1OW7 A;  4U3F E;  3BCC J;  1AFO A;  3D6Z A;  1OX3 A;  3VOP A;  3TK1 A;  3H1I D;  2ZT9 C;  1VQ8 P;  3NMD A;  1G2C B;  1SQB G;  1NTK E;  5CCG C;  1JB0 J;  1FJK A;  5KKZ C;  2KI7 B;  1UII A;  3Q2Y A;  2HFE D;  3A2A A;  1SQX E;  4N6J A;  2KSE A;  2WT7 A;  2H43 A;  2B87 A;  3G3Z A;  2G8Y A;  1S5L E;  4DOJ A;  1KB9 D;  3CC4 P;  1L4A D;  1H0T A;  1SQQ J;  3RK3 E;  4PD4 D;  4C46 A;  2ZT9 B;  2HYN A;  1N86 A;  3M9B A;  4WB4 A;  3H1I J;  1LTJ A;  1FDO A;  2Y0E A;  1FZC A;  2K9J B;  5AW8 B;  1OMI A;  2UWJ E;  2M3B A;  5KKZ B;  3HE4 A;  3VTP C;  2KYV A;  2ZXE B;  1NOH A;  2QVA A;  1PL5 A;  3VP8 A;  3GHG C;  1IFN A;  1RHZ B;  3CPW O;  4HJG H;  2E5T A;  1NTZ K;  1QX8 A;  1ZOY C;  3SWK A;  3S4R A;  3SFD C;  2CPB A;  1IJD B;  1AQ5 A;  2BAS A;  2K37 A; 
#chains in the Genus database with same CATH homology
 3MTU E;  2W6B A;  4IFD K;  1FJP A;  3CLQ A;  1G1I A;  3U1A A;  4LLH A;  1N7L A;  1X8Y A;  3VMY A;  1SQX K;  2WWW A;  5AVW B;  1M1J C;  1URQ A;  3H32 B;  5KJ7 C;  1LWU B;  1YYC A;  5AVV B;  3MGN A;  4C7R A;  2NPS B;  1NHL A;  2P7J A;  2PP6 A;  4JYB A;  1ZR2 A;  2A45 I;  2P67 A;  2HPC B;  2KP8 A;  1N7S D;  5KJ7 D;  1S9K E;  3LIE A;  5APY A;  3V4W A;  5CCG D;  1N73 B;  5APV A;  2LKM A;  3EFG A;  1L4A A;  3I5C A;  2OYI B;  4AQR D;  1SFC A;  3V2Q A;  1MZ9 A;  5CMZ A;  3HE5 A;  2FYU K;  1A02 J;  1GDT A;  2IFM A;  1HWT C;  4WY4 C;  3HRN A;  2J58 A;  2YNY A;  3M0A A;  3OAK A;  3P8C E;  5CHX A;  2HOD B;  4DZO A;  4C7N A;  3VP9 A;  3EQ2 A;  2OYH C;  2VRS A;  3RK2 C;  3A5T A;  5AVR B;  1IK9 A;  4W80 A;  3V5B A;  1GL2 A;  1LT9 B;  1T3U A;  1FZE A;  4WY4 D;  3B8E B;  5KTB A;  2XKM A;  2M8R A;  1JMM A;  3N7N A;  1ZV8 A;  2CPS A;  3L36 A;  1FBM A;  1IFI A;  3KYQ A;  2FFD C;  1JY3 N;  3M0D C;  3NFQ A;  1G2C A;  3HD7 C;  5CCH A;  1SQV K;  2KLV A;  2O01 H;  1OWA A;  3RK2 D;  1HGV A;  3CI9 A;  4Y99 C;  1RE3 C;  1A02 F;  2YKQ A;  2JJL A;  2HLO A;  5AW9 B;  2IPP A;  2NPS C;  4HH2 A;  2YO2 A;  1J1D C;  1J1E B;  1LTA C;  1GTW A;  2FYZ A;  1RF1 C;  3B5N A;  1LTJ C;  1RF0 A;  2IX7 C;  4W7Y A;  2XV5 A;  2E43 A;  2PAJ A;  3NXS A;  1FZC C;  4I1L A;  1IO4 A;  3GHG A;  2P1J A;  1GK4 A;  2MJZ A;  2YKO A;  2NPS D;  2C0X A;  2OYI C;  1IFM A;  5BU5 A;  5AVQ B;  1JTH B;  1NTK K;  1NKZ B;  2C9L Y;  1JUN A;  3HTK B;  1DEB A;  5BU8 B;  1JY2 N;  2Z5I A;  3TNU B;  2OYH B;  3RK2 B;  2O1K A;  2KSJ A;  3VMZ A;  2WT7 B;  1HJB A;  3HUS A;  1IFJ A;  1LT9 C;  2HG5 D;  3LW5 H;  3L35 A;  2GM4 A;  5APU A;  2FFD B;  2YKP A;  3HD7 B;  3VMX A;  1T8Z A;  1JO5 A;  1KQL A;  1FU1 A;  1LGH B;  2WSC H;  1HGZ A;  1H8A A;  4Y99 B;  1M1J A;  2R5B A;  4WBA A;  1N7S A;  3BRV B;  1NAF A;  5CCG A;  3P7K A;  3U59 A;  2N1T A;  2O1J A;  1RE4 A;  4GIF A;  1J1D B;  4XE5 B;  4IFM A;  2XU6 A;  1FZB A;  1FAV A;  1RF1 B;  1LTJ B;  2Q3I A;  1J1E C;  1FZC B;  2Z5H A;  3E1I A;  3LID A;  3V4Q A;  1KFN A;  5KLV K;  1LTG C;  3RL0 B;  2QM8 A;  3TSI A;  5CJ4 A;  3HE4 B;  4AYC A;  2R3C A;  4LGD E;  5APS A;  5AW3 B;  4WY4 A;  4W7Z A;  1CI6 B;  3N4X A;  2XZR A;  5AVT B;  3WMM 0;  2H7H A;  3A3Y B;  1JOC A;  1GK6 A;  5AVU B;  1FOS F;  3C9I A;  3KQG A;  5APW A;  5AW4 B;  1SVF A;  4LC1 A;  2R32 A;  1MV8 A;  2C0W A;  4O9B A;  1Z56 A;  3O8Z A;  1S9K D;  2WTY A;  2FFD A;  1QL1 A;  3M0D A;  3U1C A;  2W6A A;  1SQQ K;  5AVY B;  2WPR A;  4B86 A;  2FKW B;  1FZF A;  1YTZ T;  1RE3 A;  1GZL A;  4ZKU A;  2KOG A;  3H32 A;  2YO3 A;  1LWU A;  1GL2 C;  3V2R A;  4N3Y B;  2NPS A;  4GKG A;  2H8P D;  5CJ0 A;  1E5W A;  3HD7 D;  1NTM K;  3P8C D;  2KB7 P;  5BVZ A;  3VYI A;  4EOT A;  2HPC A;  3II6 A;  1URQ B;  5APX A;  1T3J A;  2R5D A;  5CCH C;  1W2E A;  1FZG A;  1N73 A;  3CL3 D;  1NKN A;  1KIL C;  3RK3 C;  1MFZ A;  3RL0 C;  2A45 H;  2FXM A;  2OYI A;  2N9B A;  3OA7 A;  1SQP K;  2OAR A;  3M9Q A;  3M91 A;  1LTS C;  1J2J B;  5AW0 B;  4N78 E;  2IFN A;  4M3L A;  3SWF A;  1RF0 C;  3TYY A;  1M7L A;  1ZLL A;  1KIL D;  3SWY A;  2Z4E A;  2L5G B;  3RL0 D;  1L4A B;  3NTN A;  3MUD A;  3A7O A;  2HOD A;  1SFC B;  3V2N A;  2WIT A;  4HYT B;  4EIJ A;  3HE5 B;  3MIW A;  1GD2 E;  2ZFC A;  2XDJ A;  1N2D C;  1CZQ A;  4ZKP A;  1LT9 A;  1HVV A;  1JY3 P;  4KHX A;  3M06 A;  1X9V A;  1WT6 A;  1CW5 A;  1JY3 O;  2W27 A;  3L4F A;  2WSE H;  5AVX B;  1NU1 K;  2Q7C A;  2WPS A;  5KJ7 A;  2WPQ A;  1MUU A;  4OH8 B;  3BAS A;  1GL2 B;  3R2P A;  2Q5U A;  3HUS C;  3V2P A;  1FDM A;  1AFO A;  2GUV A;  4N78 D;  2I1K A;  4RES B;  1KZU B;  5AW7 B;  3VOP A;  1SQB K;  3PP5 A;  3TK1 A;  5AW5 B;  1PFI A;  3NMD A;  1G2C B;  1VPC A;  1CSB A;  4JYC A;  3VN0 A;  3BRT B;  1GW3 A;  1YTZ I;  5APQ A;  1JNM A;  1DH3 A;  1URQ C;  1N7S C;  3RK3 B;  1KIL B;  3P8M C;  5CCG C;  5APT A;  2P2U A;  1FZA A;  1LTB C;  2N1T C;  1RE4 C;  2XNX A;  1FJK A;  1IC2 A;  3IFM A;  2WSF H;  1JY2 P;  3P32 A;  1JTH A;  3B5N B;  4I2L C;  3HTK A;  1NWQ A;  1JY2 O;  3KPE A;  1URQ D;  3GHG B;  1ZN5 A;  2HFE D;  5AW2 B;  3A2A A;  1VDF A;  3TNU A;  3T97 A;  2OYH A;  1JCC A;  1EQ7 A;  2N1T D;  1GU5 A;  1L4A C;  4N6J A;  1SFC C;  1SLQ A;  1FOS E;  2WT7 A;  2Q9I A;  1KFM A;  2H43 A;  2WZ7 A;  5AVZ B;  2YMY A;  1L0N K;  3G3Z A;  3KDP B;  4XA4 A;  1X79 B;  3HD7 A;  3L37 A;  4DOJ A;  1GW4 A;  1L4A D;  1OXZ A;  1LTT C;  1SFC D;  1JCD A;  2POH A;  3HUS B;  3MD0 A;  2E42 A;  4C46 A;  1H88 A;  2HYN A;  1N86 A;  3M9B A;  1T2K C;  1RF1 A;  4WB4 A;  1LTJ A;  1M1J B;  2I1J A;  1FZC A;  2GUS A;  1N7S B;  5AW8 B;  4JF7 A;  1RY3 A;  1GL2 D;  2M3B A;  1KIL A;  1LWU C;  1WRG A;  2N1T B;  1L0L K;  1IFD A;  1GU4 A;  2C9N Y;  1DX7 A;  3IR9 A;  3HE4 A;  3BVH A;  3VTP C;  3M9H A;  1T2K D;  2KYV A;  2ZXE B;  5AW1 B;  1NOH A;  5CCH D;  3H6P A;  3B5N C;  1CI6 A;  4GT1 A;  3VP8 A;  2A45 G;  1HUC A;  4IFF A;  3GHG C;  3RK3 D;  1G1J A;  1N73 C;  1NH4 A;  1H89 A;  1IFN A;  1HBW A;  3UIA A;  1XTC C;  3OJA B;  1NTZ K;  4WY4 B;  2J59 M;  1XTG B;  3B5N D;  4AUW A;  5AVS B;  1SP4 A;  2CPB A;  3BAT A;  1IJD B;  1AQ5 A;  4C7N B;  1HH0 A;  5AW6 B;  2BAS A;  1ZR4 A;  2JEE A;  1HTL C;  1LTI C;  2QM7 A;  1QL2 A;  4I6M C;  1NO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...