1GK6A

Human vimentin coil 2b fragment linked to gcn4 leucine zipper (z2b)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
55
structure length
55
Chain Sequence
b'MKQLEDKVEELLSKNYHLENEVARLKKLVGDLLNVKMALDIEIATYRKLLEGEES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VIMENTIN
molecule tags Structural protein
source organism Saccharomyces cerevisiae
publication title Conserved Segments 1A and 2B of the Intermediate Filament Dimer: Their Atomic Structures and Role in Filament Assembly.
pubmed doi rcsb
total genus 25
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gk6A00
1T2KD 3NMDA 2W27A 4KHXA 5AVRB 1NAFA 2R32A 4XE5B 5APUA 2WPSA 5AW3B 2W6AA 1OXZA 1X8YA 2Q7CA 1A02F 4B86A 1CZQA 1NWQA 4C46A 1JNMA 3VN0A 1MUUA 1HWTC 5AW1B 2WWWA 4DZOA 1T2KC 3L36A 5AW9B 4JYBA 2WPQA 3A7OA 3VMZA 1G2CB 2P7JA 2ZFCA 3OAKA 2IPPA 1H8AA 3P7KA 3TNUB 2N9BA 2R5DA 3M9BA 5APVA 3B8EB 2ZXEB 2WT7A 5AVZB 5AW2B 3L35A 3L37A 5APYA 1YYCA 1MV8A 3VMXA 3P8MC 2WPRA 3MGNA 5AW6B 1GK6A 4C7NA 2JJLA 1JUNA 4M3LA 2YO2A 5CMZA 3LIEA 3HE4A 3TK1A 3SWFA 3V5BA 5APQA 2QM8A 1H89A 3A2AA 2H7HA 5AVXB 2KP8A 2XV5A 2Z5HA 3I5CA 1GU5A 5AW5B 1SP4A 2E43A 1HJBA 2XZRA 5AVUB 5AVWB 3IR9A 3M0DA 3HE4B 5APXA 1FAVA 2Q3IA 3V4QA 1H88A 1IO4A 5AW0B 3NTNA 3M0AA 3M9HA 1SLQA 4C7NB 1S9KD 4LC1A 5AVQB 5APSA 2XU6A 3P32A 2WT7B 3NFQA 2R5BA 1HUCA 1J2JB 2R3CA 5AW8B 3V4WA 5AVYB 3TNUA 3HTKA 5AW4B 2Z5IA 3NXSA 3TYYA 1DH3A 4GKGA 3A3YB 5APWA 1CI6B 3M06A 3UIAA 1GTWA 3M91A 5APTA 2C9LY 3O8ZA 1FOSF 3VYIA 1OWAA 3VMYA 1CI6A 2YO3A 2QM7A 3T97A 3KQGA 4JYCA 5AVSB 1FOSE 5AVTB 1CSBA 1GK4A 4AQRD 1A02J 1MFZA 3MD0A 1HBWA 4EOTA 2WTYA 3A5TA 2P2UA 4RESB 5AW7B 4GT1A 5AVVB 1GU4A 1S9KE 4AUWA 2YNYA 2C9NY 3HE5A 1GD2E 1KQLA 4I6MC 2BASA 2Q5UA 3KDPB 4AYCA 2VRSA 3LIDA 4I2LC 3VTPC 2E42A 1GZLA 2P67A 4HYTB 3HE5B
chains in the Genus database with same CATH superfamily
4HH2A 1ZMEC 3L71D 2KLUA 4N3YB 3L75E 2OYIC 2J58A 2FYUJ 3CWBD 3H1IJ 1ZW0A 1FC2C 5KLIB 5APUA 5GTHE 1SQVD 3QWOC 4XA4A 1E79H 2OYHC 2Q7CA 2LXBA 2AXCA 3CWBE 1OVUA 1CZQA 4OWFA 3AEGC 4KT0J 1KYOD 1RF0C 4C46A 1NTZD 3OA7A 1MUUA 1SQPJ 3WMM0 1NO4A 3KYQA 3SFDC 4U3FE 3AE5C 5AW1B 1AVOA 1K05A 1KYOH 3L72G 2R44A 3M0DC 3L73J 5CJ4A 3CMAP 1Q86Q 3L36A 5AW9B 3TDKA 2WPQA 1L0NJ 1L4AB 3L72J 4NPEA 5KJ7A 3Q1MA 5KKZB 4EI2A 2P7JA 4DT0A 1IFDA 1VQMP 1EDKA 1VQNP 1USEA 2K9JB 1NTKK 3P7KA 1L4AA 2N9BA 4BXLA 2R5DA 3A0BE 1BGYD 4I7ZB 3HD7B 5APVA 1M1KQ 4BRYB 2D2CD 2G8YA 4I1LA 4PD4I 5AW2B 3TGUG 3V2QA 3MTUE 2ZYDA 2GUVA 4IFMA 3R4YA 1KFMA 3U1AA 1SQXD 3VMXA 2Q1KA 2WPRA 3H1IG 3MGNA 4GIFA 1GK6A 1L0LE 1PZQA 3RK3E 1NKNA 5KAFE 3HE5B 1N7SB 1HJ0A 4IFDK 4OGQB 2JJLA 3HRNA 2YKOA 4M3LA 2YO2A 5CJ0A 3LIEA 1KILB 1VDFA 3IN6A 4L74A 1GL2A 3G3ZA 4PD4E 3RL0B 4ZKPA 4WWIA 1VQLP 1RF0A 3RBZA 1JTHA 2K88A 2NPSA 2KXPB 3A2AA 4W7ZA 1RHZB 3MIWA 5B66E 1JTHB 2MJZA 1WRGA 1SP4A 2N9YB 2OQQA 3C8VA 2A45H 5DJTB 2XZRA 1GL2B 3CXHI 3K5BA 2XNXA 3H32B 1Y8AA 3CCJP 1RQUA 3M0DA 5KJ7D 1W5CE 2Q3IA 3L70G 1FZFA 1H88A 1FDOA 1JY3N 3L74E 5K5GB 5KLVK 1BGYG 1T6AA 4K35A 3RK2D 4U3FG 1S4XA 4C7NB 1USDA 3M0AA 5TISH 3I55P 4QMAA 2YIUB 4R4MA 2OTLP 1SQPG 2XU6A 3AE6C 1OFCX 1JOCA 3AE8C 3CXHE 2WT7B 2HYNA 3S4RA 1U7JA 1X9VA 1G1JA 1J2JB 2QIWA 2R3CA 3HD7A 3IAOA 4R4LA 4I7ZC 1EQ7A 2Z5IA 1L0NK 1K8AQ 5TJHA 1EZVD 2ZYAA 1RE4A 4CPGA 1VQOP 1H0TA 1N7LA 3L71E 3UIAA 1YJWP 1LTBC 3N4XA 5B5EE 2AEFA 2GUSA 2NPSC 3RGUA 1N7SC 1SFCD 1YITP 4U3FD 3KQGA 2E76B 2J5UA 5AVSB 1AVYA 4H13C 1FOSE 1AQ5A 2QA4P 1A02J 1OZHA 1JY3O 1HBWA 1IK7A 4DJGA 1EC5A 1OW6A 3L70J 2JDIH 1S5LH 1NTKG 5B5EH 3A5TA 2A45I 3BVHA 2HPCB 4C7RA 1M1JB 4RESB 4D6TJ 4O9BA 1OW8A 5AW7B 3CI9A 1GU4A 3WU2E 1N8RQ 1BSHA 2FXMA 3A0HE 3H1LE 1JCDA 4ZMDA 3HE5A 2N1TC 3CPWO 1Y47A 2MKVA 3QH9A 3G6EP 1LT9A 1VL2A 2PFXA 2RN0A 5DJUB 3BCCD 1HH0A 2BASA 4WY4B 1U57A 5KKZC 3D6ZA 1BGYE 2B87B 3KDPB 2VRSA 1FBMA 4IL6H 2E5TA 1Q81Q 3WU2H 2GA1A 2HR3A 2P67A 2A45G 4HYTB 2Y0EA 1T2KD 1KC8Q 2ZVNB 3FWNA 5KLVJ 4YPCA 1RY3A 1OW7A 1PGJA 2IBZE 3USSA 4ZNCA 1PP9D 1VQ7P 1NAFA 2R32A 1EDLA 3H1HJ 1LWUA 3TGUJ 1LP1B 1M1JC 2WPSA 1AA0A 1BCCG 5KLVD 1A02F 1PP9E 2M5AB 4JBZA 1JMMA 3H1HG 1Q2NA 2DW3A 2B89A 1NWQA 1JNMA 2OYIB 2PGDA 2QE7H 1L4AD 2YMKA 4HJGH 1HF9A 1SQVE 3F5HA 2FXPA 2A06D 1RF1A 1BE3G 2YKQA 2LKMA 5KLIC 4UB6E 1G2CB 3VMZA 1URQA 1SQBG 1SQQK 1SQQG 3SFEC 3L73E 2CK3H 3AEBC 2E74D 2WITA 3HTKB 1RE4C 1OX3A 5H2FH 4N78E 1IZNB 1SFCB 1FDIA 1LTGC 1X79B 1N73B 2ZXEB 2IZ1A 4GODA 3JCUE 5AVZB 4WY4C 2W90A 3CC2P 1PP9J 1ZRTD 2IZ0A 2WSEH 3RK3C 5APYA 5BVZA 1FJPA 1YYCA 1MV8A 1PPJD 3VP9A 2QJPB 1GMJA 1Z56A 1FZEA 1ZOYC 3B4SA 3GF7A 3O6QA 5AW6B 1X22A 1VQ9P 1LWUC 1KB9D 1HTLC 2RH0A 2C0XA 3BCCG 1JUNA 1Q7YQ 3FX0A 2JWAA 2B88A 1PPJE 2WSFH 1JMBA 3HE4A 2KI7B 2KNCB 3L75J 3TK1A 3TSIA 2IX7C 3OW2O 2KB7P 2KLVA 2QM8A 3KZIE 3L75G 1H89A 1L0LJ 5AVXB 3GG2A 2KP8A 5C39A 3AE4C 1URQC 2Z5HA 3I5CA 1S5LX 1SVFA 3W68A 3FWLA 2BCCG 1NVOA 3Q2YA 1YHQP 5CCHC 3RBXA 3CWBG 1VF5C 1RF1C 3AE2C 4HKZH 1NYHA 1VF5B 1FAVA 3L70D 1LT9B 1URQD 1QEXA 4RO0A 2D2CB 5GTIH 2KSEA 4DOJA 3O6QB 3M9HA 3MZWB 4PV1D 4GOEA 3MUDA 1BE3E 3D6YA 3L74D 1ZP0C 5APSA 4H13D 4PV1C 4ASVA 2WQYC 2HPCA 2JEEA 1LTJB 3NFQA 1LTAC 2IYPA 1HGVA 1HVVA 1LGHB 1SQQE 3Q3DA 1BE3D 1SFCA 1AFOA 1EZVI 4WVZA 3V2RA 3AE1C 3NXSA 2WSFJ 3U59A 3PJSK 4GKGA 4D6TG 5APWA 3FGAD 1IC2A 1JCCA 1DD3A 1SQQJ 1NTMG 1KB9H 3AE9C 1J1DC 5BU8B 1SQVK 3Q5SA 2KK7A 3H1JD 1J1DB 1JM0A 1JEKA 2HODB 3O8ZA 4W7YA 1FZCA 3H1IE 3VYIA 1OWAA 3TF5A 2WSSH 1FZCC 1L0LG 2YO3A 2Q6QA 4JYCA 3BCCE 4ASWA 1PL5A 1N2DC 1LTIC 2KZIA 3MD0A 1P84I 2FBWC 2FY8A 3PH0A 1L0NE 3PRJA 4EOTA 1LP1A 1P84D 3S1KA 4LLHA 2OYHB 4UB6H 1T8ZA 2CPBA 2QJKB 3HUSA 1M57D 3V6IA 1EZVG 4IL6E 1KFNA 3CCUP 5CBOA 1FS0E 1N73C 3H6PA 2IBZD 1YJNP 4DCKA 2YNYA 3CCRP 1KQLA 1IFJA 1ZRTE 1AQTA 1JO5A 3E1IA 3EFFK 2AEMA 3LW5H 2Y0CA 3H1HD 1YQ3C 3H32A 3L74G 2FYNC 1DEBA 4N78D 3M9QA 1RE3A 2ZJSE 4I2LC 2E42A 1FZAA 1GZLA 4U7JA 3SWYA 2BEQD 3V2NA 4OH8B 1S72P 3NMDA 1VQ8P 3CXHD 1D7MA 3AE3C 1FZCB 3TGUD 5AVRB 3Q5RA 2FXOA 1S2EA 2M8RA 4PJ0E 2I1KA 3AEDC 3AEEC 4Y28J 1YJ9P 1JY2P 2ZVOB 3FXDA 1VQ5P 2LR2A 1NTZJ 2QG4A 3KXDA 3VN0A 3H25A 3GMAA 4D6TD 2PP6A 3L72D 1HWTC 2QJYB 3BCCJ 2KZJA 3PLNA 2JO1A 3L73D 4KJMA 2QJYC 3CX5I 4DZOA 1SQVJ 1EXJA 1VQ4P 1WMKA 3B5NC 3JCUH 5E79E 3JC22 5TISE 1H0TB 2K9JA 3H1ID 1SQPD 4WBAA 1QVGO 1GW3A 2ZFCA 3W67A 2IPPA 1L0NG 1LTSC 1H8AA 1NTKE 3IF4A 3L71J 2E76C 4U3FJ 1M8OB 3CL3D 4IFFA 1X0TA 3TNUB 3M9BA 3B8EB 3H1KD 2AEJA 1U7MA 3H1JJ 2WT7A 3RK2B 3PHLA 4N6JA 3GF3A 1P84E 1NGMB 2FYUD 1G1IA 1SQQD 1XTGB 3CWBJ 3L37A 2B9BA 2RKLA 3KZIH 1FJKA 2ZT9B 1R5SA 5KLVE 2KSJA 3G9RA 4C7NA 1KB9I 1T3UA 4LGDE 2WSEJ 1BE3J 3Q5PA 1Q82Q 5CMZA 3E7KA 2FFDC 1K9MQ 3EQ2A 3SWFA 1FE6A 3V5BA 1P84H 2KOGA 3EFGA 5APQA 3L74J 3CCEP 1MFTA 1KZUB 2IBZG 2P10A 3H1LJ 2ZXXA 1PGOA 2H7HA 1KILD 1LNQA 1BCCD 1MZ9A 2J59M 1AV1A 1Q90D 2NPSB 2XV5A 4IL6X 5AW5B 2CPSA 1NTKD 2WSCH 3V2PA 3VP8A 1KQSO 2O01N 3B5NA 1LT9C 1QL2A 1PP9G 2JP3A 4H44C 5AVWB 3H1HE 2FYUG 1VQ6P 1KILA 1KYOE 1TU3F 2ZT9D 1L0LK 3V4QA 1IO4A 2BCCJ 1KILC 1NAYA 4YXWH 1CW5A 1N7SA 1M90Q 1S1CX 4Z1MH 5AW0B 2XKMA 3NTNA 1L0LD 2PAJA 3CCSP 1JY2O 3BASA 5KAIE 2OARA 5AVQB 1DIPA 1NOHA 2E75B 3P32A 2OYHA 2E75C 1EXIA 3L75D 2KS1B 1OVVA 1OMIA 3WUTA 1MKMA 4BRYA 1YI2P 4YXDC 1HUCA 3L73G 2YKPA 3V4WA 5AVYB 3TNUA 2HLOA 5AW4B 2E74B 1BSNA 3BATA 1PIXA 3TYYA 1NJIQ 1KQFB 1BDDA 5KAIH 2E74C 1EDJA 2QJPC 2KYVA 1ZR2A 3RL0C 2D2CC 3M06A 4Y99C 2N1TD 2QRXA 1QX8A 2IDBA 2V4HA 2I1JA 3M91A 4H44B 5APTA 4RJTA 1LJ2A 2W83C 3ZDMA 5KLVG 2GM4A 1CI6A 1N86A 2QM7A 3F89A 3HD7D 3L72E 2H8PD 2FKWB 3R2PA 4H0LC 5AVTB 1SQXJ 1L2PA 2Y9YA 2IYOA 4AQRD 1MFZA 1L0ND 1ZR4A 4PD4D 1YIJP 5CCGA 1LTJA 1JY2N 2P58A 2WTYA 3RK3B 3PTZA 4GDOA 3VMAA 1QL1A 1DX7A 2K37A 2W6JH 3B71A 3KPEA 4GT1A 3RK3D 1PV3A 1YTZI 1IK9A 2BCCE 4WY4D 3TGUE 5CCGD 3U1CA 1EDIA 2Y9ZA 1S9KE 1QGKB 3GHGC 3BRVB 1IFNA 4L75A 3KHUA 2ZAEB 3WUVA 2FYUE 1NTMJ 1GD2E 2KIKA 2ZT9C 5EFWB 2NRGA 2XDJA 4TLFA 1RE3C 2WZ7A 3G71P 3CXHH 3G4SP 2O3JA 4PJ0H 3A0HH 2Q3EA 1KORA 1BGYJ 1M56D 1HGZA 4BWNA 3CCQP 1LT1A 1UIIA 3OJAB 2W27A 4EDFA 1JB0J 2N1TA 4KHXA 1ZV8A 3P8CE 2E5YA 4HB1A 4EIJA 2FFDA 1L4AC 1SQBK 1IJDB 2JR8A 3HUSB 4L76A 4UB8H 5CCHA 3CC7P 2FYNB 3HUSC 1GW4A 3AECC 4XE5B 1OVRA 5AW3B 2W6AA 4D6TE 1OXZA 1X8YA 2XNDH 5E79H 2JKVA 3H1JG 4B86A 2O1JA 2FYZA 1NTME 3CX5D 3MUDC 4ZKUA 3L70E 4EYYQ 1KQGB 3GHGB 2WMMA 2W8ZA 2H89C 2IFMA 3H1KE 1W2EA 4JQ0D 1KYOI 2C0WA 1S3JA 2A06G 3CX5H 3N7NA 3T97B 2K9YA 3HD7C 4H0LD 1N7SD 1SFCC 1ZLLA 1IFMA 2HODA 2NPSD 2WWWA 2O01H 1LTTC 2E76D 2JWDA 3C1LA 4TT3H 1T2KC 1SQPE 2HFED 3A7OA 1PFIA 1KN7A 2WSCJ 1NTZK 1E5WA 4NPDA 1NU1K 1SQXG 2KUBA 3JSVC 3OAKA 3RL0D 5KJ7C 5M1BA 5L8RJ 3BRTB 1NU1G 1SQXK 1YBKA 1G2CA 2POHA 1KV4A 4WB4A 1EZVE 5CBNA 1NTZE 5KTBA 2AXTE 3ITKA 2L5GB 1WT6A 2Y0DA 3L71G 2E75D 3L35A 1KD1Q 3P8MC 2G3AA 4A7PA 1NTMD 1QVFO 1FZGA 1KB9E 4H0LB 3S9OA 1FU1A 2QEXP 2H43A 4GOFA 4JF7A 3D70A 1NTMK 2AXTH 2OTKE 2ZYGA 2HG5D 3VOPA 1J1EB 3D71A 2M3EA 2IBZI 1K73Q 4L73A 5GTHH 1QLED 2N1TB 4H13B 4H44D 3GW6A 1R8EA 4Y99B 1RH5B 1GL2D 1GU5A 1VPCA 2E43A 2SPZA 5CCGC 1NKZB 1HJBA 2B87A 3H1LG 3MP7B 1KILE 3H1JE 2R3SA 2KNCA 3IR9A 4WY4A 5AVUB 1SQBJ 2L91A 2V7QJ 2H88C 3HE4B 5APXA 1GL2C 2QVAA 3H1KG 2I8DA 3CD6P 2A06E 1UIXA 4RKUJ 1SLQA 2BCCD 1S9KD 1NU1D 2YMYA 2FYUK 2QJKC 4LC1A 3EWKA 4MN4C 1N73A 1SQBD 2LXCB 3SSUA 3CC4P 1M1JA 1R5LA 1ZN5A 5H2FE 1RQVA 3A0BH 1DH3A 1J1EC 1YTZT 1SQXE 1DEEG 2OYOA 1VQKP 2RMZA 2R5BA 3RK2C 4XFJA 5AW8B 4NPFX 1NU1E 2QSIA 4OGQD 3HTKA 3E1RA 2OTJP 1T3JA 3MHVA 3GLMA 1SQPK 2OGUA 4IOIH 1BDCA 1BCCE 5CCHD 3A3YB 1NU1J 1VQPP 1NTZG 1URQB 2Z4EA 3I56P 1CI6B 3IFMA 4UB8E 5KAFH 1GTWA 3WUUA 1LTJC 5CHXA 3CLQA 1PGPA 3AE7C 1IFIA 2C9LY 2M3BA 1FOSF 1RF1B 1SQVG 3FXEA 4JPZB 3VMYA 3L4FA 3T97A 1GDTA 2UWJE 3PP5A 4PD4H 3C9IA 3CCVP 1FDMA 2W6BA 1KTMA 2OYIA 1CSBA 1NHLA 1GK4A 1NTKJ 3GHGA 2ITAA 2NZ2A 3AEAC 3ABVC 2WVRA 1Y9BA 3CX5E 2BEZF 2WPVB 2M5AA 5B66H 1SQBE 1ZXGA 1SS1A 1IFPA 2YXRB 3H1KJ 3H1LD 2KS1A 1XTCC 1LWUB 4PV1B 4W80A 1NH4A 2P2UA 2YIUC 3SWKA 4K3AA 2P1JA 5BU5A 2Q9IA 2FFDB 2O01J 2YXQB 3CCLP 3CMEP 1DD4A 1PGQA 3P8CD 5AVVB 4AUWA 1BCCJ 1JY3P 1M7LA 1AJYA 2K3RA 3AEFC 3RL0g 1YQ4C 5GTIE 1FZBA 3II6A 2V7QH 2IFNA 2K1AA 1S5LE 4OVNF 1VF5D 4I6MC 4YTPC 2PRRA 2Q5UA 1W2BO 2O1KA 1OIPA 3B5NB 1KMIZ 3LIDA 4AYCA 4OGQC 3VTPC 3CCMP 2C9NY 3LW5J 1PPJG 2M0BA 4JYBA 3B5ND 1K04A
chains in the Genus database with same CATH topology
4HH2A 4N3YB 2OYIC 2J58A 5APUA 4XA4A 2OYHC 2Q7CA 1CZQA 1RF0C 4C46A 3OA7A 1MUUA 3WMM0 1NO4A 3KYQA 5AW1B 3M0DC 5CJ4A 3L36A 5AW9B 2WPQA 1L4AB 5KJ7A 2P7JA 1IFDA 1NTKK 3P7KA 1L4AA 2N9BA 2R5DA 3HD7B 5APVA 4I1LA 3V2QA 5AW2B 3MTUE 2GUVA 4IFMA 1KFMA 3U1AA 3VMXA 2WPRA 4GIFA 3MGNA 1GK6A 1NKNA 4IFDK 1N7SB 2JJLA 3HRNA 2YKOA 4M3LA 2YO2A 5CJ0A 3LIEA 1KILB 1VDFA 4ZKPA 1GL2A 3G3ZA 3RL0B 1RF0A 1JTHA 3A2AA 2NPSA 4W7ZA 3MIWA 1JTHB 2MJZA 1WRGA 1SP4A 2A45H 2XZRA 1GL2B 2XNXA 3H32B 3M0DA 5KJ7D 2Q3IA 1FZFA 1H88A 1JY3N 5KLVK 3RK2D 4C7NB 3M0AA 2XU6A 1JOCA 2WT7B 2HYNA 1X9VA 1G1JA 1J2JB 2R3CA 3HD7A 1EQ7A 2Z5IA 1L0NK 1RE4A 1N7LA 3UIAA 1LTBC 3N4XA 2GUSA 2NPSC 1N7SC 1SFCD 3KQGA 5AVSB 1FOSE 1AQ5A 1A02J 1JY3O 1HBWA 3BVHA 3A5TA 2A45I 2HPCB 4C7RA 1M1JB 4RESB 4O9BA 5AW7B 3CI9A 1GU4A 2FXMA 1JCDA 3HE5A 2N1TC 1LT9A 1HH0A 2BASA 4WY4B 3KDPB 2VRSA 1FBMA 2P67A 2A45G 4HYTB 1T2KD 1RY3A 1NAFA 2R32A 1LWUA 1M1JC 2WPSA 1A02F 1JMMA 1NWQA 1JNMA 2OYIB 1L4AD 1RF1A 2YKQA 2LKMA 3VMZA 1G2CB 1URQA 1SQQK 2WITA 3HTKB 1RE4C 4N78E 1SFCB 1LTGC 1X79B 1N73B 2ZXEB 5AVZB 4WY4C 1FJPA 2WSEH 3RK3C 5BVZA 5APYA 1YYCA 1MV8A 3VP9A 1Z56A 1FZEA 5AW6B 1LWUC 1HTLC 1JUNA 2C0XA 2WSFH 3HE4A 3TK1A 3TSIA 2IX7C 2KB7P 2KLVA 2QM8A 1H89A 5AVXB 2KP8A 1URQC 3I5CA 2Z5HA 1SVFA 5CCHC 1RF1C 1FAVA 1LT9B 1URQD 4DOJA 3M9HA 3MUDA 5APSA 2HPCA 2JEEA 1LTJB 3NFQA 1LTAC 1HGVA 1HVVA 1LGHB 1SFCA 1AFOA 3V2RA 3NXSA 3U59A 4GKGA 5APWA 1IC2A 1JCCA 1J1DC 5BU8B 1SQVK 1J1DB 4W7YA 2HODB 3O8ZA 3VYIA 1OWAA 2YO3A 4JYCA 1N2DC 1LTIC 3MD0A 4EOTA 4LLHA 2OYHB 1T8ZA 2CPBA 3HUSA 1KFNA 1N73C 3H6PA 2YNYA 1KQLA 1IFJA 1JO5A 3E1IA 3LW5H 3H32A 1DEBA 4N78D 3M9QA 1RE3A 4I2LC 2E42A 1FZAA 1GZLA 3SWYA 3V2NA 4OH8B 3NMDA 1FZCB 5AVRB 2M8RA 2I1KA 1JY2P 3VN0A 2PP6A 1HWTC 4DZOA 3B5NC 4WBAA 1GW3A 2ZFCA 2IPPA 1LTSC 1H8AA 3TNUB 3CL3D 4IFFA 3M9BA 3B8EB 2WT7A 3RK2B 4N6JA 1G1IA 1XTGB 3L37A 1FJKA 2KSJA 4C7NA 1T3UA 4LGDE 5CMZA 2FFDC 3EQ2A 3SWFA 3V5BA 2KOGA 3EFGA 5APQA 1KZUB 2H7HA 1KILD 1MZ9A 2J59M 2NPSB 2XV5A 3V2PA 5AW5B 3VP8A 2CPSA 2WSCH 3B5NA 1LT9C 1QL2A 5AVWB 1KILA 3V4QA 1L0LK 1IO4A 1KILC 1CW5A 1N7SA 5AW0B 2XKMA 3NTNA 2PAJA 1JY2O 3BASA 2OARA 5AVQB 1NOHA 3P32A 2OYHA 1HUCA 2YKPA 3V4WA 5AVYB 3TNUA 2HLOA 5AW4B 1DH3A 3BATA 3TYYA 2KYVA 1ZR2A 3RL0C 3M06A 4Y99C 2N1TD 3M91A 2I1JA 5APTA 2GM4A 1CI6A 1N86A 2QM7A 3HD7D 2H8PD 2FKWB 3R2PA 5AVTB 4AQRD 1MFZA 1ZR4A 5CCGA 1LTJA 1JY2N 2WTYA 3RK3B 1DX7A 1QL1A 3KPEA 4GT1A 3RK3D 1YTZI 1S9KE 1IK9A 1FZCA 4WY4D 3U1CA 5CCGD 3GHGC 3BRVB 1IFNA 2C9NY 1GD2E 2XDJA 1RE3C 2WZ7A 1HGZA 3OJAB 2W27A 4KHXA 2N1TA 1ZV8A 3P8CE 4EIJA 2FFDA 1L4AC 1SQBK 1IJDB 3HUSB 5CCHA 3HUSC 1GW4A 4XE5B 5AW3B 2W6AA 1OXZA 1X8YA 4B86A 2O1JA 2FYZA 4ZKUA 3GHGB 2IFMA 1W2EA 2C0WA 3N7NA 3HD7C 1N7SD 1SFCC 1ZLLA 1IFMA 2HODA 2NPSD 2WWWA 2O01H 1LTTC 1T2KC 1N73A 1FZCC 2HFED 3A7OA 1PFIA 1NTZK 1E5WA 1NU1K 5KJ7C 3OAKA 3RL0D 3BRTB 1SQXK 1G2CA 2POHA 4WB4A 5KTBA 2L5GB 1WT6A 3L35A 3P8MC 1FZGA 1FU1A 2H43A 4JF7A 1NTMK 2HG5D 3VOPA 1J1EB 2N1TB 4Y99B 1GL2D 1GU5A 1VPCA 2E43A 5CCGC 1NKZB 1HJBA 5AVUB 3IR9A 4WY4A 5APXA 3HE4B 1GL2C 1SLQA 1S9KD 2YMYA 4LC1A 2FYUK 1M1JA 1ZN5A 1J1EC 1YTZT 2R5BA 3RK2C 5AW8B 3HTKA 1T3JA 1SQPK 5CCHD 3A3YB 1URQB 2Z4EA 1CI6B 3IFMA 1GTWA 1LTJC 5CHXA 3CLQA 2C9LY 1IFIA 2M3BA 1FOSF 1RF1B 3VMYA 1GDTA 3L4FA 3T97A 3PP5A 3C9IA 1FDMA 2W6BA 2OYIA 1CSBA 1NHLA 1GK4A 3GHGA 1XTCC 1LWUB 4W80A 1NH4A 2P2UA 5BU5A 2Q9IA 2P1JA 2FFDB 5AVVB 3P8CD 4AUWA 1JY3P 1M7LA 1FZBA 3II6A 2IFNA 4I6MC 2Q5UA 2O1KA 3B5NB 4AYCA 3LIDA 3VTPC 4JYBA 3B5ND 3HE5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T2K D;  3NMD A;  2W27 A;  4KHX A;  5AVR B;  1NAF A;  2R32 A;  4XE5 B;  5APU A;  2WPS A;  5AW3 B;  2W6A A;  1OXZ A;  1X8Y A;  2Q7C A;  1A02 F;  4B86 A;  1CZQ A;  1NWQ A;  4C46 A;  1JNM A;  3VN0 A;  1MUU A;  1HWT C;  5AW1 B;  2WWW A;  4DZO A;  1T2K C;  3L36 A;  5AW9 B;  4JYB A;  2WPQ A;  3A7O A;  3VMZ A;  1G2C B;  2P7J A;  2ZFC A;  3OAK A;  2IPP A;  1H8A A;  3P7K A;  3TNU B;  2N9B A;  2R5D A;  3M9B A;  5APV A;  3B8E B;  2ZXE B;  2WT7 A;  5AVZ B;  5AW2 B;  3L35 A;  3L37 A;  5APY A;  1YYC A;  1MV8 A;  3VMX A;  3P8M C;  2WPR A;  3MGN A;  5AW6 B;  1GK6 A;  4C7N A;  2JJL A;  1JUN A;  4M3L A;  2YO2 A;  5CMZ A;  3LIE A;  3HE4 A;  3TK1 A;  3SWF A;  3V5B A;  5APQ A;  2QM8 A;  1H89 A;  3A2A A;  2H7H A;  5AVX B;  2KP8 A;  2XV5 A;  2Z5H A;  3I5C A;  1GU5 A;  5AW5 B;  1SP4 A;  2E43 A;  1HJB A;  2XZR A;  5AVU B;  5AVW B;  3IR9 A;  3M0D A;  3HE4 B;  5APX A;  1FAV A;  2Q3I A;  3V4Q A;  1H88 A;  1IO4 A;  5AW0 B;  3NTN A;  3M0A A;  3M9H A;  1SLQ A;  4C7N B;  1S9K D;  4LC1 A;  5AVQ B;  5APS A;  2XU6 A;  3P32 A;  2WT7 B;  3NFQ A;  2R5B A;  1HUC A;  1J2J B;  2R3C A;  5AW8 B;  3V4W A;  5AVY B;  3TNU A;  3HTK A;  5AW4 B;  2Z5I A;  3NXS A;  3TYY A;  1DH3 A;  4GKG A;  3A3Y B;  5APW A;  1CI6 B;  3M06 A;  3UIA A;  1GTW A;  3M91 A;  5APT A;  2C9L Y;  3O8Z A;  1FOS F;  3VYI A;  1OWA A;  3VMY A;  1CI6 A;  2YO3 A;  2QM7 A;  3T97 A;  3KQG A;  4JYC A;  5AVS B;  1FOS E;  5AVT B;  1CSB A;  1GK4 A;  4AQR D;  1A02 J;  1MFZ A;  3MD0 A;  1HBW A;  4EOT A;  2WTY A;  3A5T A;  2P2U A;  4RES B;  5AW7 B;  4GT1 A;  5AVV B;  1GU4 A;  1S9K E;  4AUW A;  2YNY A;  2C9N Y;  3HE5 A;  1GD2 E;  1KQL A;  4I6M C;  2BAS A;  2Q5U A;  3KDP B;  4AYC A;  2VRS A;  3LID A;  4I2L C;  3VTP C;  2E42 A;  1GZL A;  2P67 A;  4HYT B;  3HE5 B; 
#chains in the Genus database with same CATH topology
 4HH2 A;  1ZME C;  3L71 D;  2KLU A;  4N3Y B;  3L75 E;  2OYI C;  2J58 A;  2FYU J;  3CWB D;  3H1I J;  1ZW0 A;  1FC2 C;  5KLI B;  5APU A;  5GTH E;  1SQV D;  3QWO C;  4XA4 A;  1E79 H;  2OYH C;  2Q7C A;  2LXB A;  2AXC A;  3CWB E;  1OVU A;  1CZQ A;  4OWF A;  3AEG C;  4KT0 J;  1KYO D;  1RF0 C;  4C46 A;  1NTZ D;  3OA7 A;  1MUU A;  1SQP J;  3WMM 0;  1NO4 A;  3KYQ A;  3SFD C;  4U3F E;  3AE5 C;  5AW1 B;  1AVO A;  1K05 A;  1KYO H;  3L72 G;  2R44 A;  3M0D C;  3L73 J;  5CJ4 A;  3CMA P;  1Q86 Q;  3L36 A;  5AW9 B;  3TDK A;  2WPQ A;  1L0N J;  1L4A B;  3L72 J;  4NPE A;  5KJ7 A;  3Q1M A;  5KKZ B;  4EI2 A;  2P7J A;  4DT0 A;  1IFD A;  1VQM P;  1EDK A;  1VQN P;  1USE A;  2K9J B;  1NTK K;  3P7K A;  1L4A A;  2N9B A;  4BXL A;  2R5D A;  3A0B E;  1BGY D;  4I7Z B;  3HD7 B;  5APV A;  1M1K Q;  4BRY B;  2D2C D;  2G8Y A;  4I1L A;  4PD4 I;  5AW2 B;  3TGU G;  3V2Q A;  3MTU E;  2ZYD A;  2GUV A;  4IFM A;  3R4Y A;  1KFM A;  3U1A A;  1SQX D;  3VMX A;  2Q1K A;  2WPR A;  3H1I G;  3MGN A;  4GIF A;  1GK6 A;  1L0L E;  1PZQ A;  3RK3 E;  1NKN A;  5KAF E;  3HE5 B;  1N7S B;  1HJ0 A;  4IFD K;  4OGQ B;  2JJL A;  3HRN A;  2YKO A;  4M3L A;  2YO2 A;  5CJ0 A;  3LIE A;  1KIL B;  1VDF A;  3IN6 A;  4L74 A;  1GL2 A;  3G3Z A;  4PD4 E;  3RL0 B;  4ZKP A;  4WWI A;  1VQL P;  1RF0 A;  3RBZ A;  1JTH A;  2K88 A;  2NPS A;  2KXP B;  3A2A A;  4W7Z A;  1RHZ B;  3MIW A;  5B66 E;  1JTH B;  2MJZ A;  1WRG A;  1SP4 A;  2N9Y B;  2OQQ A;  3C8V A;  2A45 H;  5DJT B;  2XZR A;  1GL2 B;  3CXH I;  3K5B A;  2XNX A;  3H32 B;  1Y8A A;  3CCJ P;  1RQU A;  3M0D A;  5KJ7 D;  1W5C E;  2Q3I A;  3L70 G;  1FZF A;  1H88 A;  1FDO A;  1JY3 N;  3L74 E;  5K5G B;  5KLV K;  1BGY G;  1T6A A;  4K35 A;  3RK2 D;  4U3F G;  1S4X A;  4C7N B;  1USD A;  3M0A A;  5TIS H;  3I55 P;  4QMA A;  2YIU B;  4R4M A;  2OTL P;  1SQP G;  2XU6 A;  3AE6 C;  1OFC X;  1JOC A;  3AE8 C;  3CXH E;  2WT7 B;  2HYN A;  3S4R A;  1U7J A;  1X9V A;  1G1J A;  1J2J B;  2QIW A;  2R3C A;  3HD7 A;  3IAO A;  4R4L A;  4I7Z C;  1EQ7 A;  2Z5I A;  1L0N K;  1K8A Q;  5TJH A;  1EZV D;  2ZYA A;  1RE4 A;  4CPG A;  1VQO P;  1H0T A;  1N7L A;  3L71 E;  3UIA A;  1YJW P;  1LTB C;  3N4X A;  5B5E E;  2AEF A;  2GUS A;  2NPS C;  3RGU A;  1N7S C;  1SFC D;  1YIT P;  4U3F D;  3KQG A;  2E76 B;  2J5U A;  5AVS B;  1AVY A;  4H13 C;  1FOS E;  1AQ5 A;  2QA4 P;  1A02 J;  1OZH A;  1JY3 O;  1HBW A;  1IK7 A;  4DJG A;  1EC5 A;  1OW6 A;  3L70 J;  2JDI H;  1S5L H;  1NTK G;  5B5E H;  3A5T A;  2A45 I;  3BVH A;  2HPC B;  4C7R A;  1M1J B;  4RES B;  4D6T J;  4O9B A;  1OW8 A;  5AW7 B;  3CI9 A;  1GU4 A;  3WU2 E;  1N8R Q;  1BSH A;  2FXM A;  3A0H E;  3H1L E;  1JCD A;  4ZMD A;  3HE5 A;  2N1T C;  3CPW O;  1Y47 A;  2MKV A;  3QH9 A;  3G6E P;  1LT9 A;  1VL2 A;  2PFX A;  2RN0 A;  5DJU B;  3BCC D;  1HH0 A;  2BAS A;  4WY4 B;  1U57 A;  5KKZ C;  3D6Z A;  1BGY E;  2B87 B;  3KDP B;  2VRS A;  1FBM A;  4IL6 H;  2E5T A;  1Q81 Q;  3WU2 H;  2GA1 A;  2HR3 A;  2P67 A;  2A45 G;  4HYT B;  2Y0E A;  1T2K D;  1KC8 Q;  2ZVN B;  3FWN A;  5KLV J;  4YPC A;  1RY3 A;  1OW7 A;  1PGJ A;  2IBZ E;  3USS A;  4ZNC A;  1PP9 D;  1VQ7 P;  1NAF A;  2R32 A;  1EDL A;  3H1H J;  1LWU A;  3TGU J;  1LP1 B;  1M1J C;  2WPS A;  1AA0 A;  1BCC G;  5KLV D;  1A02 F;  1PP9 E;  2M5A B;  4JBZ A;  1JMM A;  3H1H G;  1Q2N A;  2DW3 A;  2B89 A;  1NWQ A;  1JNM A;  2OYI B;  2PGD A;  2QE7 H;  1L4A D;  2YMK A;  4HJG H;  1HF9 A;  1SQV E;  3F5H A;  2FXP A;  2A06 D;  1RF1 A;  1BE3 G;  2YKQ A;  2LKM A;  5KLI C;  4UB6 E;  1G2C B;  3VMZ A;  1URQ A;  1SQB G;  1SQQ K;  1SQQ G;  3SFE C;  3L73 E;  2CK3 H;  3AEB C;  2E74 D;  2WIT A;  3HTK B;  1RE4 C;  1OX3 A;  5H2F H;  4N78 E;  1IZN B;  1SFC B;  1FDI A;  1LTG C;  1X79 B;  1N73 B;  2ZXE B;  2IZ1 A;  4GOD A;  3JCU E;  5AVZ B;  4WY4 C;  2W90 A;  3CC2 P;  1PP9 J;  1ZRT D;  2IZ0 A;  2WSE H;  3RK3 C;  5APY A;  5BVZ A;  1FJP A;  1YYC A;  1MV8 A;  1PPJ D;  3VP9 A;  2QJP B;  1GMJ A;  1Z56 A;  1FZE A;  1ZOY C;  3B4S A;  3GF7 A;  3O6Q A;  5AW6 B;  1X22 A;  1VQ9 P;  1LWU C;  1KB9 D;  1HTL C;  2RH0 A;  2C0X A;  3BCC G;  1JUN A;  1Q7Y Q;  3FX0 A;  2JWA A;  2B88 A;  1PPJ E;  2WSF H;  1JMB A;  3HE4 A;  2KI7 B;  2KNC B;  3L75 J;  3TK1 A;  3TSI A;  2IX7 C;  3OW2 O;  2KB7 P;  2KLV A;  2QM8 A;  3KZI E;  3L75 G;  1H89 A;  1L0L J;  5AVX B;  3GG2 A;  2KP8 A;  5C39 A;  3AE4 C;  1URQ C;  2Z5H A;  3I5C A;  1S5L X;  1SVF A;  3W68 A;  3FWL A;  2BCC G;  1NVO A;  3Q2Y A;  1YHQ P;  5CCH C;  3RBX A;  3CWB G;  1VF5 C;  1RF1 C;  3AE2 C;  4HKZ H;  1NYH A;  1VF5 B;  1FAV A;  3L70 D;  1LT9 B;  1URQ D;  1QEX A;  4RO0 A;  2D2C B;  5GTI H;  2KSE A;  4DOJ A;  3O6Q B;  3M9H A;  3MZW B;  4PV1 D;  4GOE A;  3MUD A;  1BE3 E;  3D6Y A;  3L74 D;  1ZP0 C;  5APS A;  4H13 D;  4PV1 C;  4ASV A;  2WQY C;  2HPC A;  2JEE A;  1LTJ B;  3NFQ A;  1LTA C;  2IYP A;  1HGV A;  1HVV A;  1LGH B;  1SQQ E;  3Q3D A;  1BE3 D;  1SFC A;  1AFO A;  1EZV I;  4WVZ A;  3V2R A;  3AE1 C;  3NXS A;  2WSF J;  3U59 A;  3PJS K;  4GKG A;  4D6T G;  5APW A;  3FGA D;  1IC2 A;  1JCC A;  1DD3 A;  1SQQ J;  1NTM G;  1KB9 H;  3AE9 C;  1J1D C;  5BU8 B;  1SQV K;  3Q5S A;  2KK7 A;  3H1J D;  1J1D B;  1JM0 A;  1JEK A;  2HOD B;  3O8Z A;  4W7Y A;  1FZC A;  3H1I E;  3VYI A;  1OWA A;  3TF5 A;  2WSS H;  1FZC C;  1L0L G;  2YO3 A;  2Q6Q A;  4JYC A;  3BCC E;  4ASW A;  1PL5 A;  1N2D C;  1LTI C;  2KZI A;  3MD0 A;  1P84 I;  2FBW C;  2FY8 A;  3PH0 A;  1L0N E;  3PRJ A;  4EOT A;  1LP1 A;  1P84 D;  3S1K A;  4LLH A;  2OYH B;  4UB6 H;  1T8Z A;  2CPB A;  2QJK B;  3HUS A;  1M57 D;  3V6I A;  1EZV G;  4IL6 E;  1KFN A;  3CCU P;  5CBO A;  1FS0 E;  1N73 C;  3H6P A;  2IBZ D;  1YJN P;  4DCK A;  2YNY A;  3CCR P;  1KQL A;  1IFJ A;  1ZRT E;  1AQT A;  1JO5 A;  3E1I A;  3EFF K;  2AEM A;  3LW5 H;  2Y0C A;  3H1H D;  1YQ3 C;  3H32 A;  3L74 G;  2FYN C;  1DEB A;  4N78 D;  3M9Q A;  1RE3 A;  2ZJS E;  4I2L C;  2E42 A;  1FZA A;  1GZL A;  4U7J A;  3SWY A;  2BEQ D;  3V2N A;  4OH8 B;  1S72 P;  3NMD A;  1VQ8 P;  3CXH D;  1D7M A;  3AE3 C;  1FZC B;  3TGU D;  5AVR B;  3Q5R A;  2FXO A;  1S2E A;  2M8R A;  4PJ0 E;  2I1K A;  3AED C;  3AEE C;  4Y28 J;  1YJ9 P;  1JY2 P;  2ZVO B;  3FXD A;  1VQ5 P;  2LR2 A;  1NTZ J;  2QG4 A;  3KXD A;  3VN0 A;  3H25 A;  3GMA A;  4D6T D;  2PP6 A;  3L72 D;  1HWT C;  2QJY B;  3BCC J;  2KZJ A;  3PLN A;  2JO1 A;  3L73 D;  4KJM A;  2QJY C;  3CX5 I;  4DZO A;  1SQV J;  1EXJ A;  1VQ4 P;  1WMK A;  3B5N C;  3JCU H;  5E79 E;  3JC2 2;  5TIS E;  1H0T B;  2K9J A;  3H1I D;  1SQP D;  4WBA A;  1QVG O;  1GW3 A;  2ZFC A;  3W67 A;  2IPP A;  1L0N G;  1LTS C;  1H8A A;  1NTK E;  3IF4 A;  3L71 J;  2E76 C;  4U3F J;  1M8O B;  3CL3 D;  4IFF A;  1X0T A;  3TNU B;  3M9B A;  3B8E B;  3H1K D;  2AEJ A;  1U7M A;  3H1J J;  2WT7 A;  3RK2 B;  3PHL A;  4N6J A;  3GF3 A;  1P84 E;  1NGM B;  2FYU D;  1G1I A;  1SQQ D;  1XTG B;  3CWB J;  3L37 A;  2B9B A;  2RKL A;  3KZI H;  1FJK A;  2ZT9 B;  1R5S A;  5KLV E;  2KSJ A;  3G9R A;  4C7N A;  1KB9 I;  1T3U A;  4LGD E;  2WSE J;  1BE3 J;  3Q5P A;  1Q82 Q;  5CMZ A;  3E7K A;  2FFD C;  1K9M Q;  3EQ2 A;  3SWF A;  1FE6 A;  3V5B A;  1P84 H;  2KOG A;  3EFG A;  5APQ A;  3L74 J;  3CCE P;  1MFT A;  1KZU B;  2IBZ G;  2P10 A;  3H1L J;  2ZXX A;  1PGO A;  2H7H A;  1KIL D;  1LNQ A;  1BCC D;  1MZ9 A;  2J59 M;  1AV1 A;  1Q90 D;  2NPS B;  2XV5 A;  4IL6 X;  5AW5 B;  2CPS A;  1NTK D;  2WSC H;  3V2P A;  3VP8 A;  1KQS O;  2O01 N;  3B5N A;  1LT9 C;  1QL2 A;  1PP9 G;  2JP3 A;  4H44 C;  5AVW B;  3H1H E;  2FYU G;  1VQ6 P;  1KIL A;  1KYO E;  1TU3 F;  2ZT9 D;  1L0L K;  3V4Q A;  1IO4 A;  2BCC J;  1KIL C;  1NAY A;  4YXW H;  1CW5 A;  1N7S A;  1M90 Q;  1S1C X;  4Z1M H;  5AW0 B;  2XKM A;  3NTN A;  1L0L D;  2PAJ A;  3CCS P;  1JY2 O;  3BAS A;  5KAI E;  2OAR A;  5AVQ B;  1DIP A;  1NOH A;  2E75 B;  3P32 A;  2OYH A;  2E75 C;  1EXI A;  3L75 D;  2KS1 B;  1OVV A;  1OMI A;  3WUT A;  1MKM A;  4BRY A;  1YI2 P;  4YXD C;  1HUC A;  3L73 G;  2YKP A;  3V4W A;  5AVY B;  3TNU A;  2HLO A;  5AW4 B;  2E74 B;  1BSN A;  3BAT A;  1PIX A;  3TYY A;  1NJI Q;  1KQF B;  1BDD A;  5KAI H;  2E74 C;  1EDJ A;  2QJP C;  2KYV A;  1ZR2 A;  3RL0 C;  2D2C C;  3M06 A;  4Y99 C;  2N1T D;  2QRX A;  1QX8 A;  2IDB A;  2V4H A;  2I1J A;  3M91 A;  4H44 B;  5APT A;  4RJT A;  1LJ2 A;  2W83 C;  3ZDM A;  5KLV G;  2GM4 A;  1CI6 A;  1N86 A;  2QM7 A;  3F89 A;  3HD7 D;  3L72 E;  2H8P D;  2FKW B;  3R2P A;  4H0L C;  5AVT B;  1SQX J;  1L2P A;  2Y9Y A;  2IYO A;  4AQR D;  1MFZ A;  1L0N D;  1ZR4 A;  4PD4 D;  1YIJ P;  5CCG A;  1LTJ A;  1JY2 N;  2P58 A;  2WTY A;  3RK3 B;  3PTZ A;  4GDO A;  3VMA A;  1QL1 A;  1DX7 A;  2K37 A;  2W6J H;  3B71 A;  3KPE A;  4GT1 A;  3RK3 D;  1PV3 A;  1YTZ I;  1IK9 A;  2BCC E;  4WY4 D;  3TGU E;  5CCG D;  3U1C A;  1EDI A;  2Y9Z A;  1S9K E;  1QGK B;  3GHG C;  3BRV B;  1IFN A;  4L75 A;  3KHU A;  2ZAE B;  3WUV A;  2FYU E;  1NTM J;  1GD2 E;  2KIK A;  2ZT9 C;  5EFW B;  2NRG A;  2XDJ A;  4TLF A;  1RE3 C;  2WZ7 A;  3G71 P;  3CXH H;  3G4S P;  2O3J A;  4PJ0 H;  3A0H H;  2Q3E A;  1KOR A;  1BGY J;  1M56 D;  1HGZ A;  4BWN A;  3CCQ P;  1LT1 A;  1UII A;  3OJA B;  2W27 A;  4EDF A;  1JB0 J;  2N1T A;  4KHX A;  1ZV8 A;  3P8C E;  2E5Y A;  4HB1 A;  4EIJ A;  2FFD A;  1L4A C;  1SQB K;  1IJD B;  2JR8 A;  3HUS B;  4L76 A;  4UB8 H;  5CCH A;  3CC7 P;  2FYN B;  3HUS C;  1GW4 A;  3AEC C;  4XE5 B;  1OVR A;  5AW3 B;  2W6A A;  4D6T E;  1OXZ A;  1X8Y A;  2XND H;  5E79 H;  2JKV A;  3H1J G;  4B86 A;  2O1J A;  2FYZ A;  1NTM E;  3CX5 D;  3MUD C;  4ZKU A;  3L70 E;  4EYY Q;  1KQG B;  3GHG B;  2WMM A;  2W8Z A;  2H89 C;  2IFM A;  3H1K E;  1W2E A;  4JQ0 D;  1KYO I;  2C0W A;  1S3J A;  2A06 G;  3CX5 H;  3N7N A;  3T97 B;  2K9Y A;  3HD7 C;  4H0L D;  1N7S D;  1SFC C;  1ZLL A;  1IFM A;  2HOD A;  2NPS D;  2WWW A;  2O01 H;  1LTT C;  2E76 D;  2JWD A;  3C1L A;  4TT3 H;  1T2K C;  1SQP E;  2HFE D;  3A7O A;  1PFI A;  1KN7 A;  2WSC J;  1NTZ K;  1E5W A;  4NPD A;  1NU1 K;  1SQX G;  2KUB A;  3JSV C;  3OAK A;  3RL0 D;  5KJ7 C;  5M1B A;  5L8R J;  3BRT B;  1NU1 G;  1SQX K;  1YBK A;  1G2C A;  2POH A;  1KV4 A;  4WB4 A;  1EZV E;  5CBN A;  1NTZ E;  5KTB A;  2AXT E;  3ITK A;  2L5G B;  1WT6 A;  2Y0D A;  3L71 G;  2E75 D;  3L35 A;  1KD1 Q;  3P8M C;  2G3A A;  4A7P A;  1NTM D;  1QVF O;  1FZG A;  1KB9 E;  4H0L B;  3S9O A;  1FU1 A;  2QEX P;  2H43 A;  4GOF A;  4JF7 A;  3D70 A;  1NTM K;  2AXT H;  2OTK E;  2ZYG A;  2HG5 D;  3VOP A;  1J1E B;  3D71 A;  2M3E A;  2IBZ I;  1K73 Q;  4L73 A;  5GTH H;  1QLE D;  2N1T B;  4H13 B;  4H44 D;  3GW6 A;  1R8E A;  4Y99 B;  1RH5 B;  1GL2 D;  1GU5 A;  1VPC A;  2E43 A;  2SPZ A;  5CCG C;  1NKZ B;  1HJB A;  2B87 A;  3H1L G;  3MP7 B;  1KIL E;  3H1J E;  2R3S A;  2KNC A;  3IR9 A;  4WY4 A;  5AVU B;  1SQB J;  2L91 A;  2V7Q J;  2H88 C;  3HE4 B;  5APX A;  1GL2 C;  2QVA A;  3H1K G;  2I8D A;  3CD6 P;  2A06 E;  1UIX A;  4RKU J;  1SLQ A;  2BCC D;  1S9K D;  1NU1 D;  2YMY A;  2FYU K;  2QJK C;  4LC1 A;  3EWK A;  4MN4 C;  1N73 A;  1SQB D;  2LXC B;  3SSU A;  3CC4 P;  1M1J A;  1R5L A;  1ZN5 A;  5H2F E;  1RQV A;  3A0B H;  1DH3 A;  1J1E C;  1YTZ T;  1SQX E;  1DEE G;  2OYO A;  1VQK P;  2RMZ A;  2R5B A;  3RK2 C;  4XFJ A;  5AW8 B;  4NPF X;  1NU1 E;  2QSI A;  4OGQ D;  3HTK A;  3E1R A;  2OTJ P;  1T3J A;  3MHV A;  3GLM A;  1SQP K;  2OGU A;  4IOI H;  1BDC A;  1BCC E;  5CCH D;  3A3Y B;  1NU1 J;  1VQP P;  1NTZ G;  1URQ B;  2Z4E A;  3I56 P;  1CI6 B;  3IFM A;  4UB8 E;  5KAF H;  1GTW A;  3WUU A;  1LTJ C;  5CHX A;  3CLQ A;  1PGP A;  3AE7 C;  1IFI A;  2C9L Y;  2M3B A;  1FOS F;  1RF1 B;  1SQV G;  3FXE A;  4JPZ B;  3VMY A;  3L4F A;  3T97 A;  1GDT A;  2UWJ E;  3PP5 A;  4PD4 H;  3C9I A;  3CCV P;  1FDM A;  2W6B A;  1KTM A;  2OYI A;  1CSB A;  1NHL A;  1GK4 A;  1NTK J;  3GHG A;  2ITA A;  2NZ2 A;  3AEA C;  3ABV C;  2WVR A;  1Y9B A;  3CX5 E;  2BEZ F;  2WPV B;  2M5A A;  5B66 H;  1SQB E;  1ZXG A;  1SS1 A;  1IFP A;  2YXR B;  3H1K J;  3H1L D;  2KS1 A;  1XTC C;  1LWU B;  4PV1 B;  4W80 A;  1NH4 A;  2P2U A;  2YIU C;  3SWK A;  4K3A A;  2P1J A;  5BU5 A;  2Q9I A;  2FFD B;  2O01 J;  2YXQ B;  3CCL P;  3CME P;  1DD4 A;  1PGQ A;  3P8C D;  5AVV B;  4AUW A;  1BCC J;  1JY3 P;  1M7L A;  1AJY A;  2K3R A;  3AEF C;  3RL0 g;  1YQ4 C;  5GTI E;  1FZB A;  3II6 A;  2V7Q H;  2IFN A;  2K1A A;  1S5L E;  4OVN F;  1VF5 D;  4I6M C;  4YTP C;  2PRR A;  2Q5U A;  1W2B O;  2O1K A;  1OIP A;  3B5N B;  1KMI Z;  3LID A;  4AYC A;  4OGQ C;  3VTP C;  3CCM P;  2C9N Y;  3LW5 J;  1PPJ G;  2M0B A;  4JYB A;  3B5N D;  1K04 A; 
#chains in the Genus database with same CATH homology
 4HH2 A;  4N3Y B;  2OYI C;  2J58 A;  5APU A;  4XA4 A;  2OYH C;  2Q7C A;  1CZQ A;  1RF0 C;  4C46 A;  3OA7 A;  1MUU A;  3WMM 0;  1NO4 A;  3KYQ A;  5AW1 B;  3M0D C;  5CJ4 A;  3L36 A;  5AW9 B;  2WPQ A;  1L4A B;  5KJ7 A;  2P7J A;  1IFD A;  1NTK K;  3P7K A;  1L4A A;  2N9B A;  2R5D A;  3HD7 B;  5APV A;  4I1L A;  3V2Q A;  5AW2 B;  3MTU E;  2GUV A;  4IFM A;  1KFM A;  3U1A A;  3VMX A;  2WPR A;  4GIF A;  3MGN A;  1GK6 A;  1NKN A;  4IFD K;  1N7S B;  2JJL A;  3HRN A;  2YKO A;  4M3L A;  2YO2 A;  5CJ0 A;  3LIE A;  1KIL B;  1VDF A;  4ZKP A;  1GL2 A;  3G3Z A;  3RL0 B;  1RF0 A;  1JTH A;  3A2A A;  2NPS A;  4W7Z A;  3MIW A;  1JTH B;  2MJZ A;  1WRG A;  1SP4 A;  2A45 H;  2XZR A;  1GL2 B;  2XNX A;  3H32 B;  3M0D A;  5KJ7 D;  2Q3I A;  1FZF A;  1H88 A;  1JY3 N;  5KLV K;  3RK2 D;  4C7N B;  3M0A A;  2XU6 A;  1JOC A;  2WT7 B;  2HYN A;  1X9V A;  1G1J A;  1J2J B;  2R3C A;  3HD7 A;  1EQ7 A;  2Z5I A;  1L0N K;  1RE4 A;  1N7L A;  3UIA A;  1LTB C;  3N4X A;  2GUS A;  2NPS C;  1N7S C;  1SFC D;  3KQG A;  5AVS B;  1FOS E;  1AQ5 A;  1A02 J;  1JY3 O;  1HBW A;  3BVH A;  3A5T A;  2A45 I;  2HPC B;  4C7R A;  1M1J B;  4RES B;  4O9B A;  5AW7 B;  3CI9 A;  1GU4 A;  2FXM A;  1JCD A;  3HE5 A;  2N1T C;  1LT9 A;  1HH0 A;  2BAS A;  4WY4 B;  3KDP B;  2VRS A;  1FBM A;  2P67 A;  2A45 G;  4HYT B;  1T2K D;  1RY3 A;  1NAF A;  2R32 A;  1LWU A;  1M1J C;  2WPS A;  1A02 F;  1JMM A;  1NWQ A;  1JNM A;  2OYI B;  1L4A D;  1RF1 A;  2YKQ A;  2LKM A;  3VMZ A;  1G2C B;  1URQ A;  1SQQ K;  2WIT A;  3HTK B;  1RE4 C;  4N78 E;  1SFC B;  1LTG C;  1X79 B;  1N73 B;  2ZXE B;  5AVZ B;  4WY4 C;  1FJP A;  2WSE H;  3RK3 C;  5BVZ A;  5APY A;  1YYC A;  1MV8 A;  3VP9 A;  1Z56 A;  1FZE A;  5AW6 B;  1LWU C;  1HTL C;  1JUN A;  2C0X A;  2WSF H;  3HE4 A;  3TK1 A;  3TSI A;  2IX7 C;  2KB7 P;  2KLV A;  2QM8 A;  1H89 A;  5AVX B;  2KP8 A;  1URQ C;  3I5C A;  2Z5H A;  1SVF A;  5CCH C;  1RF1 C;  1FAV A;  1LT9 B;  1URQ D;  4DOJ A;  3M9H A;  3MUD A;  5APS A;  2HPC A;  2JEE A;  1LTJ B;  3NFQ A;  1LTA C;  1HGV A;  1HVV A;  1LGH B;  1SFC A;  1AFO A;  3V2R A;  3NXS A;  3U59 A;  4GKG A;  5APW A;  1IC2 A;  1JCC A;  1J1D C;  5BU8 B;  1SQV K;  1J1D B;  4W7Y A;  2HOD B;  3O8Z A;  3VYI A;  1OWA A;  2YO3 A;  4JYC A;  1N2D C;  1LTI C;  3MD0 A;  4EOT A;  4LLH A;  2OYH B;  1T8Z A;  2CPB A;  3HUS A;  1KFN A;  1N73 C;  3H6P A;  2YNY A;  1KQL A;  1IFJ A;  1JO5 A;  3E1I A;  3LW5 H;  3H32 A;  1DEB A;  4N78 D;  3M9Q A;  1RE3 A;  4I2L C;  2E42 A;  1FZA A;  1GZL A;  3SWY A;  3V2N A;  4OH8 B;  3NMD A;  1FZC B;  5AVR B;  2M8R A;  2I1K A;  1JY2 P;  3VN0 A;  2PP6 A;  1HWT C;  4DZO A;  3B5N C;  4WBA A;  1GW3 A;  2ZFC A;  2IPP A;  1LTS C;  1H8A A;  3TNU B;  3CL3 D;  4IFF A;  3M9B A;  3B8E B;  2WT7 A;  3RK2 B;  4N6J A;  1G1I A;  1XTG B;  3L37 A;  1FJK A;  2KSJ A;  4C7N A;  1T3U A;  4LGD E;  5CMZ A;  2FFD C;  3EQ2 A;  3SWF A;  3V5B A;  2KOG A;  3EFG A;  5APQ A;  1KZU B;  2H7H A;  1KIL D;  1MZ9 A;  2J59 M;  2NPS B;  2XV5 A;  3V2P A;  5AW5 B;  3VP8 A;  2CPS A;  2WSC H;  3B5N A;  1LT9 C;  1QL2 A;  5AVW B;  1KIL A;  3V4Q A;  1L0L K;  1IO4 A;  1KIL C;  1CW5 A;  1N7S A;  5AW0 B;  2XKM A;  3NTN A;  2PAJ A;  1JY2 O;  3BAS A;  2OAR A;  5AVQ B;  1NOH A;  3P32 A;  2OYH A;  1HUC A;  2YKP A;  3V4W A;  5AVY B;  3TNU A;  2HLO A;  5AW4 B;  1DH3 A;  3BAT A;  3TYY A;  2KYV A;  1ZR2 A;  3RL0 C;  3M06 A;  4Y99 C;  2N1T D;  3M91 A;  2I1J A;  5APT A;  2GM4 A;  1CI6 A;  1N86 A;  2QM7 A;  3HD7 D;  2H8P D;  2FKW B;  3R2P A;  5AVT B;  4AQR D;  1MFZ A;  1ZR4 A;  5CCG A;  1LTJ A;  1JY2 N;  2WTY A;  3RK3 B;  1DX7 A;  1QL1 A;  3KPE A;  4GT1 A;  3RK3 D;  1YTZ I;  1S9K E;  1IK9 A;  1FZC A;  4WY4 D;  3U1C A;  5CCG D;  3GHG C;  3BRV B;  1IFN A;  2C9N Y;  1GD2 E;  2XDJ A;  1RE3 C;  2WZ7 A;  1HGZ A;  3OJA B;  2W27 A;  4KHX A;  2N1T A;  1ZV8 A;  3P8C E;  4EIJ A;  2FFD A;  1L4A C;  1SQB K;  1IJD B;  3HUS B;  5CCH A;  3HUS C;  1GW4 A;  4XE5 B;  5AW3 B;  2W6A A;  1OXZ A;  1X8Y A;  4B86 A;  2O1J A;  2FYZ A;  4ZKU A;  3GHG B;  2IFM A;  1W2E A;  2C0W A;  3N7N A;  3HD7 C;  1N7S D;  1SFC C;  1ZLL A;  1IFM A;  2HOD A;  2NPS D;  2WWW A;  2O01 H;  1LTT C;  1T2K C;  1N73 A;  1FZC C;  2HFE D;  3A7O A;  1PFI A;  1NTZ K;  1E5W A;  1NU1 K;  5KJ7 C;  3OAK A;  3RL0 D;  3BRT B;  1SQX K;  1G2C A;  2POH A;  4WB4 A;  5KTB A;  2L5G B;  1WT6 A;  3L35 A;  3P8M C;  1FZG A;  1FU1 A;  2H43 A;  4JF7 A;  1NTM K;  2HG5 D;  3VOP A;  1J1E B;  2N1T B;  4Y99 B;  1GL2 D;  1GU5 A;  1VPC A;  2E43 A;  5CCG C;  1NKZ B;  1HJB A;  5AVU B;  3IR9 A;  4WY4 A;  5APX A;  3HE4 B;  1GL2 C;  1SLQ A;  1S9K D;  2YMY A;  4LC1 A;  2FYU K;  1M1J A;  1ZN5 A;  1J1E C;  1YTZ T;  2R5B A;  3RK2 C;  5AW8 B;  3HTK A;  1T3J A;  1SQP K;  5CCH D;  3A3Y B;  1URQ B;  2Z4E A;  1CI6 B;  3IFM A;  1GTW A;  1LTJ C;  5CHX A;  3CLQ A;  2C9L Y;  1IFI A;  2M3B A;  1FOS F;  1RF1 B;  3VMY A;  1GDT A;  3L4F A;  3T97 A;  3PP5 A;  3C9I A;  1FDM A;  2W6B A;  2OYI A;  1CSB A;  1NHL A;  1GK4 A;  3GHG A;  1XTC C;  1LWU B;  4W80 A;  1NH4 A;  2P2U A;  5BU5 A;  2Q9I A;  2P1J A;  2FFD B;  5AVV B;  3P8C D;  4AUW A;  1JY3 P;  1M7L A;  1FZB A;  3II6 A;  2IFN A;  4I6M C;  2Q5U A;  2O1K A;  3B5N B;  4AYC A;  3LID A;  3VTP C;  4JYB A;  3B5N D;  3HE5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...