1NU1J

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 19
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1nu1J00
1BE3J 1P84I 3H1KJ 3H1IJ 3L70J 1SQVJ 1BGYJ 1KB9I 1SQPJ 1SQBJ 4D6TJ 3H1HJ 1KYOI 1SQXJ 3CXHI 3H1JJ 4U3FJ 4PD4I 3CX5I 1BCCJ 1L0NJ 3BCCJ 2FYUJ 3L74J 1PP9J 3CWBJ 3L72J 5KLVJ 1NTMJ 3L71J 3L73J 1NU1J 1EZVI 2BCCJ 2IBZI 3H1LJ 3TGUJ 1NTZJ 3L75J 1SQQJ 1NTKJ 1L0LJ
chains in the Genus database with same CATH superfamily
4GKGA 2E76C 2AEFA 2QRXA 2W27A 2ZYGA 1SQPG 2ZAEB 1BDDA 2HODA 4U3FG 3OW2O 4ZKPA 3CMEP 1KB9D 2BCCJ 5GTHH 3TYYA 3TNUB 2FYUD 2KI7B 2N1TD 1XTGB 2P58A 1GU5A 4HH2A 1BSNA 1BE3E 1N86A 1K04A 1A02F 1L0NG 5KLVJ 4H44D 1OZHA 3A7OA 1NO4A 1LTJB 2KOGA 5AW6B 4R4LA 4PV1D 4OGQD 2ITAA 3AE7C 3L72G 2QJYB 2AXCA 2YIUB 1RF1B 2PFXA 4W7YA 2QJKB 3G4SP 2BCCE 3KXDA 4ZMDA 4NPFX 4EOTA 1FZCC 1EZVE 4B86A 2K1AA 3HTKB 3S4RA 2P10A 2WQYC 1M1JB 1AQTA 3QH9A 3TK1A 3AE6C 5KLVE 3TGUJ 3BRVB 3A3YB 1SQQK 1ZN5A 3T97B 3V4QA 3PLNA 2QG4A 3Q5SA 2B88A 3B5ND 3HE5B 2LXCB 1NKZB 2I1KA 1GW4A 3O6QB 1SQVJ 1NTKK 3U1CA 1GDTA 2O3JA 4PJ0H 4DT0A 1BCCG 1KQFB 5CCHC 1K9MQ 3IN6A 3W67A 3M0DA 3G71P 2E74D 5KKZB 2AEMA 1LWUA 1SFCB 1M90Q 3H1IJ 5KLIC 3D70A 3TGUE 1EC5A 1FJPA 3GF3A 1YI2P 4H0LB 2CK3H 3BCCG 1H89A 3CWBJ 3PHLA 2SPZA 1S1CX 1IFDA 1JO5A 5GTHE 1LP1A 1W2EA 3H1KG 3LW5H 2KS1A 1BGYG 2B87A 3EFGA 1T2KD 3BRTB 1VQPP 1TU3F 1FC2C 2ZFCA 2V7QH 1W5CE 4HYTB 1K8AQ 3HE4B 3M0DC 3H1IE 1CI6A 1JTHA 2K3RA 5M1BA 2ZXEB 1NTMG 2ZT9B 3S9OA 4YXWH 3KZIH 2R32A 5CMZA 1GMJA 1OW7A 1KZUB 3HD7B 4GOFA 2M5AB 5AVWB 2YO2A 1N7SA 2R44A 2K37A 1JY3O 2B9BA 1LTAC 3OAKA 4EDFA 1Y8AA 2OTLP 2WPSA 1SQPJ 2IYOA 1SQXG 2NPSB 3GHGB 4U3FJ 5CCGC 2C0WA 1GU4A 2C0XA 1J1EC 3L71G 3LW5J 3VYIA 3O8ZA 3TF5A 3RK3B 4C46A 1J2JB 3C1LA 5KAIH 1GL2A 1X79B 3WUTA 2Q7CA 3AE2C 3RK2C 2Z4EA 1L0NJ 1FZAA 3RL0C 3AEAC 2N1TB 2LR2A 3AE4C 3G3ZA 5APVA 1FAVA 2GUVA 2QJPC 5AVYB 4H44B 1SLQA 4L73A 1VQKP 1N7SC 3P7KA 2J59M 1YHQP 1SQQD 2RMZA 1J1DC 4QMAA 1SQPE 3AEDC 3L72J 5TISH 1LT9B 4U3FE 1CSBA 1KD1Q 3A0HE 1N73A 4OGQB 3CXHD 1IC2A 2Y0CA 2M3BA 3V2RA 2YXQB 4YTPC 1X8YA 2M3EA 5CCHD 1EDJA 2FYUG 2NZ2A 3SFEC 2A45I 3KDPB 4DCKA 4GIFA 3VOPA 1L0NE 5KLVK 1FOSE 2P7JA 1AQ5A 4ASWA 3RBZA 3Q5RA 3IAOA 1UIXA 5AW5B 3USSA 4YPCA 3V5BA 4NPEA 3KZIE 3L72E 1NTZJ 2AEJA 3JCUE 3B5NB 5DJTB 3H1LD 1NGMB 3BATA 1G1JA 1BCCJ 4I7ZB 1N73C 1BDCA 5AW4B 1PFIA 2V4HA 2H89C 4RKUJ 2FXOA 2N9BA 2IBZG 1PPJD 2K9JB 5B66H 2E74B 3CCMP 2Q3IA 1SQBG 1KB9I 3MZWB 2IFMA 1S2EA 2YMKA 4AYCA 3BCCJ 3VP8A 4EIJA 2FFDB 2Q6QA 4ZKUA 2PP6A 5APWA 2A45H 3H32A 3H1KJ 4H0LD 3KHUA 1ZOYC 1NTZE 2HG5D 5KAIE 3QWOC 1SQVK 2OYIA 4U7JA 1ZLLA 4CPGA 1DH3A 1FS0E 1BCCE 1M56D 4UB6E 1KYOD 4PD4E 1L0LJ 2YKOA 4N3YB 2OQQA 1JY2O 3CC4P 5BU5A 5APUA 3VN0A 1M7LA 2JJLA 3LIDA 2E76B 5CCGD 5CJ4A 2GUSA 2Y9ZA 3V2PA 1ZXGA 5TISE 1NTMJ 2W6BA 2E43A 3BCCE 1VDFA 3CX5H 3SWFA 1URQA 1RF0A 2BASA 1KQLA 1KILE 1USDA 3AE3C 3RBXA 2OARA 1AFOA 2ZT9D 3H1KE 2OTJP 1BE3D 3RL0D 1BGYE 3Q3DA 2Y0EA 1QL2A 4UB8E 5AW0B 1KB9H 3OJAB 2ZXXA 3HD7D 4JQ0D 2QSIA 3WUUA 1KN7A 2AXTE 1KQSO 2G3AA 3NMDA 5H2FH 2OYIC 1S9KE 1IK7A 1SS1A 2O1KA 1KTMA 1ZP0C 3I55P 1MZ9A 1VQMP 1Q82Q 2IFNA 1SQXJ 3AEEC 1BSHA 2QVAA 4IL6H 2PGDA 3L75G 4C7NB 4WY4C 1EDKA 1NTME 1QVGO 2HODB 1EZVD 1R5LA 1FZCB 1URQC 2YKPA 4DJGA 1RF0C 4OH8B 3RK3D 3FX0A 3JC22 5CBNA 3WMM0 2CPSA 3AE5C 5B66E 1WT6A 4Y28J 1Y47A 1QGKB 1VQNP 1JUNA 1IZNB 1SQPK 3CCQP 1SQXE 2MKVA 1Q90D 4W7ZA 4GODA 1NYHA 4L75A 3PJSK 3TNUA 1LGHB 1RQUA 3CCEP 5AVUB 1DIPA 1NJIQ 1VQLP 3H1HJ 2OYHB 2WMMA 3HUSA 2FYUJ 1ZMEC 1IK9A 1L0NK 2D2CC 4R4MA 1FE6A 1QVFO 1HGVA 2J58A 1YITP 5GTIH 1HH0A 4IL6X 3TGUD 5KLIB 3D6YA 2W83C 3TDKA 1OW8A 2KNCA 2XV5A 4Y99B 2KSJA 1T3JA 3CX5E 4TLFA 3L4FA 1P84I 3Q2YA 4C7RA 3WU2H 5AVVB 1YJWP 2GA1A 1SQVD 3W68A 3H1HE 1VF5C 1M1JA 2FYUE 3CD6P 2W6AA 5H2FE 3GF7A 2WPRA 5DJUB 2WPVB 2L91A 3HUSC 2QM8A 1SQBJ 3T97A 5AVQB 3H1ID 3A0BH 1UIIA 1KILA 1Z56A 1U7JA 4IL6E 4IFMA 3CWBD 3CC2P 2R3CA 1NTZK 1FJKA 3Q5PA 4D6TG 2KK7A 4RESB 4JPZB 4IOIH 2YIUC 2E5TA 3R4YA 5AW7B 2HPCB 3L73J 1SFCA 5AW9B 3MUDA 3V6IA 5CHXA 2FY8A 2KS1B 2B87B 5KAFH 1JM0A 2XKMA 2IBZE 3CXHI 5KJ7A 3GLMA 1PGJA 1GD2E 1NHLA 1SQBE 1YJ9P 1KMIZ 1ZR4A 1YJNP 4WY4D 1NU1G 5AVSB 1J1EB 1NOHA 2E76D 1QX8A 3E1RA 1H8AA 1MUUA 1KILC 2CPBA 3CC7P 4EI2A 1JTHB 3L74G 1LWUC 4I6MC 3RK2B 1RH5B 2IDBA 3RL0B 3IR9A 1USEA 4A7PA 3L70J 3L73E 3HE4A 1L0LK 2QJPB 3KPEA 2Q9IA 3E7KA 1PL5A 3MUDC 5APQA 2FYZA 1WMKA 1FZBA 1P84D 1J1DB 2IX7C 2XNXA 4U3FD 1NTMK 1JY2P 2YMYA 3FGAD 3L75J 3BASA 1FOSF 1U57A 2QE7H 3VMXA 2WZ7A 5KJ7C 3WU2E 3PTZA 2WITA 3M9QA 2M5AA 2QA4P 2FKWB 1IO4A 3H1JG 2R5BA 3CCUP 1L4AA 3MP7B 2A45G 3CXHH 2I1JA 1L0ND 4Z1MH 1X0TA 1SP4A 4LC1A 4N6JA 2NPSA 3L70E 1OVVA 3GHGA 2IZ1A 2VRSA 4PJ0E 1SQXK 1JMMA 1NAFA 1OIPA 2V7QJ 4GDOA 2O01H 1FBMA 2WWWA 3L72D 1FDOA 2W90A 4IFDK 3L75E 4H13C 1YQ4C 2WSCH 3LIEA 1VQ4P 1KYOI 1JCDA 3CI9A 1VF5D 2N1TA 3L36A 1N73B 3V2NA 1NAYA 3AEBC 1FZGA 2ZVNB 3WUVA 5KAFE 3E1IA 1L4AC 1NTKD 2JDIH 3AE8C 2YKQA 3FWNA 2BEZF 1LT9A 1IFJA 2W6JH 3JSVC 3FWLA 3CPWO 1GL2C 4TT3H 2NRGA 1HWTC 3UIAA 3GHGC 3ZDMA 4DOJA 1X9VA 4JYBA 1GK6A 1NTZD 2FYNC 3P8CD 2WPQA 2QIWA 2RN0A 2KYVA 2FYUK 1DD3A 2H88C 3AE1C 2WTYA 1JEKA 2YXRB 1BCCD 4BWNA 4PD4D 1D7MA 1RQVA 3B4SA 3VMAA 1HF9A 4MN4C 2O01J 1KYOH 1LT1A 4JBZA 4BRYA 1EZVI 1YTZI 1EQ7A 2Z5IA 2WSCJ 2Q5UA 3B5NA 2ZVOB 1LNQA 2YNYA 1W2BO 3MD0A 4D6TJ 5AW2B 3V2QA 3H1KD 1ZRTD 4PV1C 2KP8A 2BEQD 3AEFC 4LLHA 3SSUA 3U1AA 3A2AA 3NTNA 1AVOA 3C9IA 3VMZA 3TSIA 1SQVG 2KB7P 1PGPA 1XTCC 1BGYJ 1S9KD 1L0LD 2OYIB 4NPDA 1YIJP 1FU1A 1SQBK 1H0TA 3F89A 2QEXP 3AE9C 1DD4A 3VP9A 3S1KA 1FZEA 3KQGA 2E75C 3RGUA 1NU1J 1M1KQ 2A06D 1PP9D 1GW3A 1IFPA 1NTMD 2FXPA 4WY4B 1S4XA 5AVRB 3K5BA 5TJHA 4ASVA 3CWBG 3L74J 4JYCA 4D6TE 1IJDB 2OTKE 2R3SA 4WBAA 3BVHA 1URQB 5AVTB 2JWAA 3RK2D 3M9BA 4I1LA 3M06A 4XA4A 3FXDA 1K05A 1G2CB 3IF4A 1VQ5P 4ZNCA 3GW6A 2C9NY 1NU1E 1N7SD 4H13D 2RKLA 3H1JJ 2KSEA 5KTBA 1OX3A 3V4WA 3L71J 3CCRP 4RO0A 3I5CA 3L74E 2XNDH 5AVZB 2D2CB 3N7NA 1YTZT 2WT7A 2E42A 2BCCD 2WSSH 4IFFA 1KQGB 4WVZA 3D71A 1VQ9P 4GOEA 1VL2A 4L74A 1GL2D 5KLVD 3CX5D 1OWAA 5APXA 3CCLP 1MKMA 2RH0A 3ITKA 1H88A 3C8VA 4GT1A 1RE3A 1RY3A 1JY3P 3B71A 4W80A 1FZCA 2Y9YA 3H1JE 3H1HD 4M3LA 4AUWA 4YXDC 2H8PD 1VF5B 3L71E 2QM7A 4LGDE 1IFMA 1LTBC 3R2PA 3A5TA 5EFWB 3D6ZA 1PIXA 3HUSB 1K73Q 1LTGC 1KV4A 5BVZA 1NVOA 1MFZA 3U59A 2PAJA 5APTA 2W8ZA 3EFFK 1JB0J 1LTJA 3SFDC 1HBWA 2OYHA 1DEBA 1JCCA 2KZJA 2KNCB 4XE5B 2WSFH 4N78E 1CW5A 5CCHA 5L8RJ 5APSA 1SQQG 1A02J 5BU8B 1RF1A 1RE3C 2Q1KA 3CCJP 3P32A 1QLED 5CBOA 2IBZD 3RK3E 4KT0J 2GM4A 2E75D 3HTKA 1SQBD 1M57D 1EDLA 1QEXA 1KB9E 2KIKA 2ZYDA 5APYA 1NTKG 1KFNA 3GG2A 1DEEG 1HJBA 1NWQA 4L76A 2XU6A 1E5WA 1GZLA 2KZIA 5K5GB 1T8ZA 1JNMA 2Y0DA 1KILB 2P67A 2JWDA 2K9YA 3HE5A 3MHVA 1NTZG 2JO1A 1LTJC 1YQ3C 1LWUB 2YO3A 2OYHC 3O6QA 3L73D 3RL0g 4K35A 2QJYC 2ZJSE 2IPPA 3ABVC 3AEGC 1RF1C 1LTSC 2PRRA 2XZRA 1LTTC 2QJKC 3H1LG 1EDIA 1LP1B 3VTPC 4Y99C 1NH4A 3GMAA 2WSFJ 3M9HA 1M1JC 1P84H 3N4XA 1PPJG 2HPCA 1HVVA 3A0HH 3B8EB 3CMAP 2B89A 1MV8A 4O9BA 1YBKA 5B5EH 4WB4A 1U7MA 1SQVE 2MJZA 3L70D 1CI6B 2M0BA 1T3UA 1URQD 2IYPA 1RHZB 2IZ0A 3KYQA 1JOCA 5CCGA 1Q7YQ 1IFNA 3Q1MA 1L0LG 2G8YA 1MFTA 3II6A 1NU1K 1PGQA 1JY3N 5GTIE 3L75D 3M0AA 1X22A 1EXIA 2A06G 4DZOA 4PD4I 5AW8B 1PP9G 5KKZC 3MTUE 1N7SB 4H13B 1SFCC 2HYNA 1Q2NA 1SQPD 3CWBE 1Y9BA 3M91A 3JCUH 2L5GB 2JP3A 3CCVP 3HD7A 4H0LC 3L37A 2J5UA 4WWIA 1VQ8P 5E79H 1AJYA 1L4AB 2D2CD 2H7HA 3CLQA 1BE3G 1AA0A 3NXSA 4OVNF 4OWFA 1AVYA 1GL2B 2KUBA 1OFCX 5C39A 1KFMA 1OXZA 2FYNB 1E79H 3A0BE 2P1JA 1VQ6P 1VQOP 2ZT9C 1VQ7P 2P2UA 2LXBA 1CZQA 1IFIA 4UB6H 2KLUA 3HD7C 1HGZA 2BCCG 4PD4H 1ZR2A 2O01N 1EZVG 2K88A 4RJTA 3OA7A 1P84E 1S5LH 5KLVG 3PH0A 1GK4A 1S72P 4BXLA 1PZQA 4XFJA 4PV1B 2WSEH 1SQQJ 1QL1A 2M8RA 2NPSC 5B5EE 1EXJA 1Q86Q 2LKMA 1GTWA 3H1HG 1JMBA 1HTLC 2HFED 4UB8H 1KC8Q 3RK3C 4AQRD 2AXTH 1KORA 1NTKJ 3SWYA 1OMIA 2E75B 2HR3A 3FXEA 2N1TC 4K3AA 1Q81Q 1N2DC 2Q3EA 1PV3A 3IFMA 4EYYQ 4BRYB 4D6TD 4H44C 3EWKA 2O1JA 3TGUG 2R5DA 5AW1B 3BCCD 1S3JA 1SVFA 2DW3A 1SQQE 1KILD 1LT9C 3CX5I 3F5HA 4OGQC 5E79E 1BGYD 3AECC 1R5SA 3H6PA 3CXHE 3H1LJ 3H25A 3VMYA 1HUCA 1L2PA 1T6AA 3H32B 1S5LX 4KHXA 2K9JA 2JR8A 1PGOA 1M8OB 1NTKE 1NU1D 1FDIA 4I2LC 3CCSP 5CJ0A 1RE4A 2N9YB 1H0TB 1SFCD 1ZW0A 2WSEJ 1JY2N 2FFDA 1OVUA 3L74D 3G9RA 3H1IG 1OVRA 5KJ7D 1AV1A 1LJ2A 3HRNA 1R8EA 3P8CE 1VPCA 1FDMA 3CL3D 3G6EP 3SWKA 1OW6A 1WRGA 4HKZH 3L73G 3B5NC 2XDJA 2HLOA 1ZV8A 2Z5HA 3H1LE 4WY4A 4I7ZC 2POHA 1N8RQ 4KJMA 5AW3B 1FZFA 4JF7A 1NKNA 3NFQA 2ZYAA 1PP9J 1S5LE 3L35A 1SQXD 3H1JD 2E74C 2IBZI 1G1IA 1PPJE 2FBWC 2KLVA 1RE4C 3L71D 1LTIC 4HB1A 2C9LY 1ZRTE 2OYOA 3EQ2A 2E5YA 2FFDC 2OGUA 3MGNA 1YYCA 3PP5A 2WVRA 1N7LA 2FXMA 1G2CA 3MIWA 2H43A 2I8DA 3I56P 2JKVA 3PRJA 3L70G 1BE3J 1HJ0A 2KXPB 1L0LE 2WT7B 1L4AD 5AVXB 1T2KC 4HJGH 3P8MC 2A06E 4N78D 2UWJE 1KYOE 1PP9E 2JEEA 4C7NA 1DX7A 2NPSD
chains in the Genus database with same CATH topology
1BE3J 1P84I 3H1KJ 3H1IJ 3L70J 1SQVJ 1BGYJ 1KB9I 1SQPJ 1SQBJ 4D6TJ 3H1HJ 1KYOI 1SQXJ 3CXHI 3H1JJ 4U3FJ 4PD4I 3CX5I 1BCCJ 1L0NJ 3BCCJ 2FYUJ 3L74J 1PP9J 3CWBJ 3L72J 5KLVJ 1NTMJ 3L71J 3L73J 1NU1J 1EZVI 2BCCJ 2IBZI 3H1LJ 3TGUJ 1NTZJ 3L75J 1SQQJ 1NTKJ 1L0LJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE3 J;  1P84 I;  3H1K J;  3H1I J;  3L70 J;  1SQV J;  1BGY J;  1KB9 I;  1SQP J;  1SQB J;  4D6T J;  3H1H J;  1KYO I;  1SQX J;  3CXH I;  3H1J J;  4U3F J;  4PD4 I;  3CX5 I;  1BCC J;  1L0N J;  3BCC J;  2FYU J;  3L74 J;  1PP9 J;  3CWB J;  3L72 J;  5KLV J;  1NTM J;  3L71 J;  3L73 J;  1NU1 J;  1EZV I;  2BCC J;  2IBZ I;  3H1L J;  3TGU J;  1NTZ J;  3L75 J;  1SQQ J;  1NTK J;  1L0L J; 
#chains in the Genus database with same CATH topology
 4GKG A;  2E76 C;  2AEF A;  2QRX A;  2W27 A;  2ZYG A;  1SQP G;  2ZAE B;  1BDD A;  2HOD A;  4U3F G;  3OW2 O;  4ZKP A;  3CME P;  1KB9 D;  2BCC J;  5GTH H;  3TYY A;  3TNU B;  2FYU D;  2KI7 B;  2N1T D;  1XTG B;  2P58 A;  1GU5 A;  4HH2 A;  1BSN A;  1BE3 E;  1N86 A;  1K04 A;  1A02 F;  1L0N G;  5KLV J;  4H44 D;  1OZH A;  3A7O A;  1NO4 A;  1LTJ B;  2KOG A;  5AW6 B;  4R4L A;  4PV1 D;  4OGQ D;  2ITA A;  3AE7 C;  3L72 G;  2QJY B;  2AXC A;  2YIU B;  1RF1 B;  2PFX A;  4W7Y A;  2QJK B;  3G4S P;  2BCC E;  3KXD A;  4ZMD A;  4NPF X;  4EOT A;  1FZC C;  1EZV E;  4B86 A;  2K1A A;  3HTK B;  3S4R A;  2P10 A;  2WQY C;  1M1J B;  1AQT A;  3QH9 A;  3TK1 A;  3AE6 C;  5KLV E;  3TGU J;  3BRV B;  3A3Y B;  1SQQ K;  1ZN5 A;  3T97 B;  3V4Q A;  3PLN A;  2QG4 A;  3Q5S A;  2B88 A;  3B5N D;  3HE5 B;  2LXC B;  1NKZ B;  2I1K A;  1GW4 A;  3O6Q B;  1SQV J;  1NTK K;  3U1C A;  1GDT A;  2O3J A;  4PJ0 H;  4DT0 A;  1BCC G;  1KQF B;  5CCH C;  1K9M Q;  3IN6 A;  3W67 A;  3M0D A;  3G71 P;  2E74 D;  5KKZ B;  2AEM A;  1LWU A;  1SFC B;  1M90 Q;  3H1I J;  5KLI C;  3D70 A;  3TGU E;  1EC5 A;  1FJP A;  3GF3 A;  1YI2 P;  4H0L B;  2CK3 H;  3BCC G;  1H89 A;  3CWB J;  3PHL A;  2SPZ A;  1S1C X;  1IFD A;  1JO5 A;  5GTH E;  1LP1 A;  1W2E A;  3H1K G;  3LW5 H;  2KS1 A;  1BGY G;  2B87 A;  3EFG A;  1T2K D;  3BRT B;  1VQP P;  1TU3 F;  1FC2 C;  2ZFC A;  2V7Q H;  1W5C E;  4HYT B;  1K8A Q;  3HE4 B;  3M0D C;  3H1I E;  1CI6 A;  1JTH A;  2K3R A;  5M1B A;  2ZXE B;  1NTM G;  2ZT9 B;  3S9O A;  4YXW H;  3KZI H;  2R32 A;  5CMZ A;  1GMJ A;  1OW7 A;  1KZU B;  3HD7 B;  4GOF A;  2M5A B;  5AVW B;  2YO2 A;  1N7S A;  2R44 A;  2K37 A;  1JY3 O;  2B9B A;  1LTA C;  3OAK A;  4EDF A;  1Y8A A;  2OTL P;  2WPS A;  1SQP J;  2IYO A;  1SQX G;  2NPS B;  3GHG B;  4U3F J;  5CCG C;  2C0W A;  1GU4 A;  2C0X A;  1J1E C;  3L71 G;  3LW5 J;  3VYI A;  3O8Z A;  3TF5 A;  3RK3 B;  4C46 A;  1J2J B;  3C1L A;  5KAI H;  1GL2 A;  1X79 B;  3WUT A;  2Q7C A;  3AE2 C;  3RK2 C;  2Z4E A;  1L0N J;  1FZA A;  3RL0 C;  3AEA C;  2N1T B;  2LR2 A;  3AE4 C;  3G3Z A;  5APV A;  1FAV A;  2GUV A;  2QJP C;  5AVY B;  4H44 B;  1SLQ A;  4L73 A;  1VQK P;  1N7S C;  3P7K A;  2J59 M;  1YHQ P;  1SQQ D;  2RMZ A;  1J1D C;  4QMA A;  1SQP E;  3AED C;  3L72 J;  5TIS H;  1LT9 B;  4U3F E;  1CSB A;  1KD1 Q;  3A0H E;  1N73 A;  4OGQ B;  3CXH D;  1IC2 A;  2Y0C A;  2M3B A;  3V2R A;  2YXQ B;  4YTP C;  1X8Y A;  2M3E A;  5CCH D;  1EDJ A;  2FYU G;  2NZ2 A;  3SFE C;  2A45 I;  3KDP B;  4DCK A;  4GIF A;  3VOP A;  1L0N E;  5KLV K;  1FOS E;  2P7J A;  1AQ5 A;  4ASW A;  3RBZ A;  3Q5R A;  3IAO A;  1UIX A;  5AW5 B;  3USS A;  4YPC A;  3V5B A;  4NPE A;  3KZI E;  3L72 E;  1NTZ J;  2AEJ A;  3JCU E;  3B5N B;  5DJT B;  3H1L D;  1NGM B;  3BAT A;  1G1J A;  1BCC J;  4I7Z B;  1N73 C;  1BDC A;  5AW4 B;  1PFI A;  2V4H A;  2H89 C;  4RKU J;  2FXO A;  2N9B A;  2IBZ G;  1PPJ D;  2K9J B;  5B66 H;  2E74 B;  3CCM P;  2Q3I A;  1SQB G;  1KB9 I;  3MZW B;  2IFM A;  1S2E A;  2YMK A;  4AYC A;  3BCC J;  3VP8 A;  4EIJ A;  2FFD B;  2Q6Q A;  4ZKU A;  2PP6 A;  5APW A;  2A45 H;  3H32 A;  3H1K J;  4H0L D;  3KHU A;  1ZOY C;  1NTZ E;  2HG5 D;  5KAI E;  3QWO C;  1SQV K;  2OYI A;  4U7J A;  1ZLL A;  4CPG A;  1DH3 A;  1FS0 E;  1BCC E;  1M56 D;  4UB6 E;  1KYO D;  4PD4 E;  1L0L J;  2YKO A;  4N3Y B;  2OQQ A;  1JY2 O;  3CC4 P;  5BU5 A;  5APU A;  3VN0 A;  1M7L A;  2JJL A;  3LID A;  2E76 B;  5CCG D;  5CJ4 A;  2GUS A;  2Y9Z A;  3V2P A;  1ZXG A;  5TIS E;  1NTM J;  2W6B A;  2E43 A;  3BCC E;  1VDF A;  3CX5 H;  3SWF A;  1URQ A;  1RF0 A;  2BAS A;  1KQL A;  1KIL E;  1USD A;  3AE3 C;  3RBX A;  2OAR A;  1AFO A;  2ZT9 D;  3H1K E;  2OTJ P;  1BE3 D;  3RL0 D;  1BGY E;  3Q3D A;  2Y0E A;  1QL2 A;  4UB8 E;  5AW0 B;  1KB9 H;  3OJA B;  2ZXX A;  3HD7 D;  4JQ0 D;  2QSI A;  3WUU A;  1KN7 A;  2AXT E;  1KQS O;  2G3A A;  3NMD A;  5H2F H;  2OYI C;  1S9K E;  1IK7 A;  1SS1 A;  2O1K A;  1KTM A;  1ZP0 C;  3I55 P;  1MZ9 A;  1VQM P;  1Q82 Q;  2IFN A;  1SQX J;  3AEE C;  1BSH A;  2QVA A;  4IL6 H;  2PGD A;  3L75 G;  4C7N B;  4WY4 C;  1EDK A;  1NTM E;  1QVG O;  2HOD B;  1EZV D;  1R5L A;  1FZC B;  1URQ C;  2YKP A;  4DJG A;  1RF0 C;  4OH8 B;  3RK3 D;  3FX0 A;  3JC2 2;  5CBN A;  3WMM 0;  2CPS A;  3AE5 C;  5B66 E;  1WT6 A;  4Y28 J;  1Y47 A;  1QGK B;  1VQN P;  1JUN A;  1IZN B;  1SQP K;  3CCQ P;  1SQX E;  2MKV A;  1Q90 D;  4W7Z A;  4GOD A;  1NYH A;  4L75 A;  3PJS K;  3TNU A;  1LGH B;  1RQU A;  3CCE P;  5AVU B;  1DIP A;  1NJI Q;  1VQL P;  3H1H J;  2OYH B;  2WMM A;  3HUS A;  2FYU J;  1ZME C;  1IK9 A;  1L0N K;  2D2C C;  4R4M A;  1FE6 A;  1QVF O;  1HGV A;  2J58 A;  1YIT P;  5GTI H;  1HH0 A;  4IL6 X;  3TGU D;  5KLI B;  3D6Y A;  2W83 C;  3TDK A;  1OW8 A;  2KNC A;  2XV5 A;  4Y99 B;  2KSJ A;  1T3J A;  3CX5 E;  4TLF A;  3L4F A;  1P84 I;  3Q2Y A;  4C7R A;  3WU2 H;  5AVV B;  1YJW P;  2GA1 A;  1SQV D;  3W68 A;  3H1H E;  1VF5 C;  1M1J A;  2FYU E;  3CD6 P;  2W6A A;  5H2F E;  3GF7 A;  2WPR A;  5DJU B;  2WPV B;  2L91 A;  3HUS C;  2QM8 A;  1SQB J;  3T97 A;  5AVQ B;  3H1I D;  3A0B H;  1UII A;  1KIL A;  1Z56 A;  1U7J A;  4IL6 E;  4IFM A;  3CWB D;  3CC2 P;  2R3C A;  1NTZ K;  1FJK A;  3Q5P A;  4D6T G;  2KK7 A;  4RES B;  4JPZ B;  4IOI H;  2YIU C;  2E5T A;  3R4Y A;  5AW7 B;  2HPC B;  3L73 J;  1SFC A;  5AW9 B;  3MUD A;  3V6I A;  5CHX A;  2FY8 A;  2KS1 B;  2B87 B;  5KAF H;  1JM0 A;  2XKM A;  2IBZ E;  3CXH I;  5KJ7 A;  3GLM A;  1PGJ A;  1GD2 E;  1NHL A;  1SQB E;  1YJ9 P;  1KMI Z;  1ZR4 A;  1YJN P;  4WY4 D;  1NU1 G;  5AVS B;  1J1E B;  1NOH A;  2E76 D;  1QX8 A;  3E1R A;  1H8A A;  1MUU A;  1KIL C;  2CPB A;  3CC7 P;  4EI2 A;  1JTH B;  3L74 G;  1LWU C;  4I6M C;  3RK2 B;  1RH5 B;  2IDB A;  3RL0 B;  3IR9 A;  1USE A;  4A7P A;  3L70 J;  3L73 E;  3HE4 A;  1L0L K;  2QJP B;  3KPE A;  2Q9I A;  3E7K A;  1PL5 A;  3MUD C;  5APQ A;  2FYZ A;  1WMK A;  1FZB A;  1P84 D;  1J1D B;  2IX7 C;  2XNX A;  4U3F D;  1NTM K;  1JY2 P;  2YMY A;  3FGA D;  3L75 J;  3BAS A;  1FOS F;  1U57 A;  2QE7 H;  3VMX A;  2WZ7 A;  5KJ7 C;  3WU2 E;  3PTZ A;  2WIT A;  3M9Q A;  2M5A A;  2QA4 P;  2FKW B;  1IO4 A;  3H1J G;  2R5B A;  3CCU P;  1L4A A;  3MP7 B;  2A45 G;  3CXH H;  2I1J A;  1L0N D;  4Z1M H;  1X0T A;  1SP4 A;  4LC1 A;  4N6J A;  2NPS A;  3L70 E;  1OVV A;  3GHG A;  2IZ1 A;  2VRS A;  4PJ0 E;  1SQX K;  1JMM A;  1NAF A;  1OIP A;  2V7Q J;  4GDO A;  2O01 H;  1FBM A;  2WWW A;  3L72 D;  1FDO A;  2W90 A;  4IFD K;  3L75 E;  4H13 C;  1YQ4 C;  2WSC H;  3LIE A;  1VQ4 P;  1KYO I;  1JCD A;  3CI9 A;  1VF5 D;  2N1T A;  3L36 A;  1N73 B;  3V2N A;  1NAY A;  3AEB C;  1FZG A;  2ZVN B;  3WUV A;  5KAF E;  3E1I A;  1L4A C;  1NTK D;  2JDI H;  3AE8 C;  2YKQ A;  3FWN A;  2BEZ F;  1LT9 A;  1IFJ A;  2W6J H;  3JSV C;  3FWL A;  3CPW O;  1GL2 C;  4TT3 H;  2NRG A;  1HWT C;  3UIA A;  3GHG C;  3ZDM A;  4DOJ A;  1X9V A;  4JYB A;  1GK6 A;  1NTZ D;  2FYN C;  3P8C D;  2WPQ A;  2QIW A;  2RN0 A;  2KYV A;  2FYU K;  1DD3 A;  2H88 C;  3AE1 C;  2WTY A;  1JEK A;  2YXR B;  1BCC D;  4BWN A;  4PD4 D;  1D7M A;  1RQV A;  3B4S A;  3VMA A;  1HF9 A;  4MN4 C;  2O01 J;  1KYO H;  1LT1 A;  4JBZ A;  4BRY A;  1EZV I;  1YTZ I;  1EQ7 A;  2Z5I A;  2WSC J;  2Q5U A;  3B5N A;  2ZVO B;  1LNQ A;  2YNY A;  1W2B O;  3MD0 A;  4D6T J;  5AW2 B;  3V2Q A;  3H1K D;  1ZRT D;  4PV1 C;  2KP8 A;  2BEQ D;  3AEF C;  4LLH A;  3SSU A;  3U1A A;  3A2A A;  3NTN A;  1AVO A;  3C9I A;  3VMZ A;  3TSI A;  1SQV G;  2KB7 P;  1PGP A;  1XTC C;  1BGY J;  1S9K D;  1L0L D;  2OYI B;  4NPD A;  1YIJ P;  1FU1 A;  1SQB K;  1H0T A;  3F89 A;  2QEX P;  3AE9 C;  1DD4 A;  3VP9 A;  3S1K A;  1FZE A;  3KQG A;  2E75 C;  3RGU A;  1NU1 J;  1M1K Q;  2A06 D;  1PP9 D;  1GW3 A;  1IFP A;  1NTM D;  2FXP A;  4WY4 B;  1S4X A;  5AVR B;  3K5B A;  5TJH A;  4ASV A;  3CWB G;  3L74 J;  4JYC A;  4D6T E;  1IJD B;  2OTK E;  2R3S A;  4WBA A;  3BVH A;  1URQ B;  5AVT B;  2JWA A;  3RK2 D;  3M9B A;  4I1L A;  3M06 A;  4XA4 A;  3FXD A;  1K05 A;  1G2C B;  3IF4 A;  1VQ5 P;  4ZNC A;  3GW6 A;  2C9N Y;  1NU1 E;  1N7S D;  4H13 D;  2RKL A;  3H1J J;  2KSE A;  5KTB A;  1OX3 A;  3V4W A;  3L71 J;  3CCR P;  4RO0 A;  3I5C A;  3L74 E;  2XND H;  5AVZ B;  2D2C B;  3N7N A;  1YTZ T;  2WT7 A;  2E42 A;  2BCC D;  2WSS H;  4IFF A;  1KQG B;  4WVZ A;  3D71 A;  1VQ9 P;  4GOE A;  1VL2 A;  4L74 A;  1GL2 D;  5KLV D;  3CX5 D;  1OWA A;  5APX A;  3CCL P;  1MKM A;  2RH0 A;  3ITK A;  1H88 A;  3C8V A;  4GT1 A;  1RE3 A;  1RY3 A;  1JY3 P;  3B71 A;  4W80 A;  1FZC A;  2Y9Y A;  3H1J E;  3H1H D;  4M3L A;  4AUW A;  4YXD C;  2H8P D;  1VF5 B;  3L71 E;  2QM7 A;  4LGD E;  1IFM A;  1LTB C;  3R2P A;  3A5T A;  5EFW B;  3D6Z A;  1PIX A;  3HUS B;  1K73 Q;  1LTG C;  1KV4 A;  5BVZ A;  1NVO A;  1MFZ A;  3U59 A;  2PAJ A;  5APT A;  2W8Z A;  3EFF K;  1JB0 J;  1LTJ A;  3SFD C;  1HBW A;  2OYH A;  1DEB A;  1JCC A;  2KZJ A;  2KNC B;  4XE5 B;  2WSF H;  4N78 E;  1CW5 A;  5CCH A;  5L8R J;  5APS A;  1SQQ G;  1A02 J;  5BU8 B;  1RF1 A;  1RE3 C;  2Q1K A;  3CCJ P;  3P32 A;  1QLE D;  5CBO A;  2IBZ D;  3RK3 E;  4KT0 J;  2GM4 A;  2E75 D;  3HTK A;  1SQB D;  1M57 D;  1EDL A;  1QEX A;  1KB9 E;  2KIK A;  2ZYD A;  5APY A;  1NTK G;  1KFN A;  3GG2 A;  1DEE G;  1HJB A;  1NWQ A;  4L76 A;  2XU6 A;  1E5W A;  1GZL A;  2KZI A;  5K5G B;  1T8Z A;  1JNM A;  2Y0D A;  1KIL B;  2P67 A;  2JWD A;  2K9Y A;  3HE5 A;  3MHV A;  1NTZ G;  2JO1 A;  1LTJ C;  1YQ3 C;  1LWU B;  2YO3 A;  2OYH C;  3O6Q A;  3L73 D;  3RL0 g;  4K35 A;  2QJY C;  2ZJS E;  2IPP A;  3ABV C;  3AEG C;  1RF1 C;  1LTS C;  2PRR A;  2XZR A;  1LTT C;  2QJK C;  3H1L G;  1EDI A;  1LP1 B;  3VTP C;  4Y99 C;  1NH4 A;  3GMA A;  2WSF J;  3M9H A;  1M1J C;  1P84 H;  3N4X A;  1PPJ G;  2HPC A;  1HVV A;  3A0H H;  3B8E B;  3CMA P;  2B89 A;  1MV8 A;  4O9B A;  1YBK A;  5B5E H;  4WB4 A;  1U7M A;  1SQV E;  2MJZ A;  3L70 D;  1CI6 B;  2M0B A;  1T3U A;  1URQ D;  2IYP A;  1RHZ B;  2IZ0 A;  3KYQ A;  1JOC A;  5CCG A;  1Q7Y Q;  1IFN A;  3Q1M A;  1L0L G;  2G8Y A;  1MFT A;  3II6 A;  1NU1 K;  1PGQ A;  1JY3 N;  5GTI E;  3L75 D;  3M0A A;  1X22 A;  1EXI A;  2A06 G;  4DZO A;  4PD4 I;  5AW8 B;  1PP9 G;  5KKZ C;  3MTU E;  1N7S B;  4H13 B;  1SFC C;  2HYN A;  1Q2N A;  1SQP D;  3CWB E;  1Y9B A;  3M91 A;  3JCU H;  2L5G B;  2JP3 A;  3CCV P;  3HD7 A;  4H0L C;  3L37 A;  2J5U A;  4WWI A;  1VQ8 P;  5E79 H;  1AJY A;  1L4A B;  2D2C D;  2H7H A;  3CLQ A;  1BE3 G;  1AA0 A;  3NXS A;  4OVN F;  4OWF A;  1AVY A;  1GL2 B;  2KUB A;  1OFC X;  5C39 A;  1KFM A;  1OXZ A;  2FYN B;  1E79 H;  3A0B E;  2P1J A;  1VQ6 P;  1VQO P;  2ZT9 C;  1VQ7 P;  2P2U A;  2LXB A;  1CZQ A;  1IFI A;  4UB6 H;  2KLU A;  3HD7 C;  1HGZ A;  2BCC G;  4PD4 H;  1ZR2 A;  2O01 N;  1EZV G;  2K88 A;  4RJT A;  3OA7 A;  1P84 E;  1S5L H;  5KLV G;  3PH0 A;  1GK4 A;  1S72 P;  4BXL A;  1PZQ A;  4XFJ A;  4PV1 B;  2WSE H;  1SQQ J;  1QL1 A;  2M8R A;  2NPS C;  5B5E E;  1EXJ A;  1Q86 Q;  2LKM A;  1GTW A;  3H1H G;  1JMB A;  1HTL C;  2HFE D;  4UB8 H;  1KC8 Q;  3RK3 C;  4AQR D;  2AXT H;  1KOR A;  1NTK J;  3SWY A;  1OMI A;  2E75 B;  2HR3 A;  3FXE A;  2N1T C;  4K3A A;  1Q81 Q;  1N2D C;  2Q3E A;  1PV3 A;  3IFM A;  4EYY Q;  4BRY B;  4D6T D;  4H44 C;  3EWK A;  2O1J A;  3TGU G;  2R5D A;  5AW1 B;  3BCC D;  1S3J A;  1SVF A;  2DW3 A;  1SQQ E;  1KIL D;  1LT9 C;  3CX5 I;  3F5H A;  4OGQ C;  5E79 E;  1BGY D;  3AEC C;  1R5S A;  3H6P A;  3CXH E;  3H1L J;  3H25 A;  3VMY A;  1HUC A;  1L2P A;  1T6A A;  3H32 B;  1S5L X;  4KHX A;  2K9J A;  2JR8 A;  1PGO A;  1M8O B;  1NTK E;  1NU1 D;  1FDI A;  4I2L C;  3CCS P;  5CJ0 A;  1RE4 A;  2N9Y B;  1H0T B;  1SFC D;  1ZW0 A;  2WSE J;  1JY2 N;  2FFD A;  1OVU A;  3L74 D;  3G9R A;  3H1I G;  1OVR A;  5KJ7 D;  1AV1 A;  1LJ2 A;  3HRN A;  1R8E A;  3P8C E;  1VPC A;  1FDM A;  3CL3 D;  3G6E P;  3SWK A;  1OW6 A;  1WRG A;  4HKZ H;  3L73 G;  3B5N C;  2XDJ A;  2HLO A;  1ZV8 A;  2Z5H A;  3H1L E;  4WY4 A;  4I7Z C;  2POH A;  1N8R Q;  4KJM A;  5AW3 B;  1FZF A;  4JF7 A;  1NKN A;  3NFQ A;  2ZYA A;  1PP9 J;  1S5L E;  3L35 A;  1SQX D;  3H1J D;  2E74 C;  2IBZ I;  1G1I A;  1PPJ E;  2FBW C;  2KLV A;  1RE4 C;  3L71 D;  1LTI C;  4HB1 A;  2C9L Y;  1ZRT E;  2OYO A;  3EQ2 A;  2E5Y A;  2FFD C;  2OGU A;  3MGN A;  1YYC A;  3PP5 A;  2WVR A;  1N7L A;  2FXM A;  1G2C A;  3MIW A;  2H43 A;  2I8D A;  3I56 P;  2JKV A;  3PRJ A;  3L70 G;  1BE3 J;  1HJ0 A;  2KXP B;  1L0L E;  2WT7 B;  1L4A D;  5AVX B;  1T2K C;  4HJG H;  3P8M C;  2A06 E;  4N78 D;  2UWJ E;  1KYO E;  1PP9 E;  2JEE A;  4C7N A;  1DX7 A;  2NPS D; 
#chains in the Genus database with same CATH homology
 1BE3 J;  1P84 I;  3H1K J;  3H1I J;  3L70 J;  1SQV J;  1BGY J;  1KB9 I;  1SQP J;  1SQB J;  4D6T J;  3H1H J;  1KYO I;  1SQX J;  3CXH I;  3H1J J;  4U3F J;  4PD4 I;  3CX5 I;  1BCC J;  1L0N J;  3BCC J;  2FYU J;  3L74 J;  1PP9 J;  3CWB J;  3L72 J;  5KLV J;  1NTM J;  3L71 J;  3L73 J;  1NU1 J;  1EZV I;  2BCC J;  2IBZ I;  3H1L J;  3TGU J;  1NTZ J;  3L75 J;  1SQQ J;  1NTK J;  1L0L J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...