1NU1J

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 19
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1nu1J00
3H1LJ 1KB9I 3L70J 1P84I 1SQXJ 4U3FJ 1SQPJ 1L0NJ 3L73J 3L75J 2FYUJ 4D6TJ 3CWBJ 3L74J 3H1HJ 2IBZI 3CXHI 3H1KJ 3L71J 3BCCJ 3CX5I 3H1IJ 1NU1J 1L0LJ 2BCCJ 1BE3J 4PD4I 1PP9J 1KYOI 5KLVJ 1BCCJ 3L72J 3H1JJ 1SQVJ 1SQQJ 1BGYJ 3TGUJ 1NTZJ 1NTKJ 1EZVI 1SQBJ 1NTMJ
chains in the Genus database with same CATH superfamily
3M91A 3CC2P 3VYIA 1W2BO 1FZAA 1MFTA 2M3EA 4TT3H 2J58A 1DIPA 2HFED 5CJ0A 1RE4C 1BCCG 3RGUA 1OX3A 3M9HA 2M3BA 1A02F 1T2KC 2HG5D 2XV5A 1FE6A 3JCUH 3L75G 5E79H 2WVRA 1PFIA 2E5TA 3H1IG 1IFDA 1KFNA 1J1DC 5AW1B 1N73A 1K9MQ 2QJPC 4GOEA 5M1BA 1ZMEC 1ZV8A 1DX7A 3RK3C 2ZJSE 3ITKA 2E76B 1YITP 1SQXD 1WT6A 3CPWO 2P2UA 2HODB 1FDIA 1PP9J 1X0TA 2WWWA 2C0XA 1SQQJ 2QM8A 2FYUK 1RH5B 2RKLA 2QA4P 3L73G 1FDOA 1GK6A 1LTJC 4U3FE 5CBOA 3U59A 4B86A 1EDIA 1BE3G 3L74E 2QG4A 3MP7B 2KXPB 1NKZB 1HBWA 2BCCE 3AEBC 1EZVI 1FZBA 5TJHA 1BGYE 3H1LG 5H2FH 1GW3A 4ASVA 2P67A 4ZKUA 1IFMA 2BEZF 4DT0A 4AQRD 3V2QA 4WY4C 1PPJD 2LKMA 3V6IA 1SQBJ 2W83C 2O1KA 4I1LA 1OW6A 3Q2YA 2B88A 5GTIE 3CCSP 1DEEG 3TK1A 3GMAA 2I1JA 1KB9H 3RBZA 2Y0EA 2NZ2A 1YYCA 3H1KE 1RY3A 2N9BA 4EDFA 3A5TA 1NTMK 1KYOE 2ZXEB 2JWAA 3WUUA 3L70G 2FYUG 1NJIQ 2H7HA 1LP1A 2P1JA 3VP8A 2ZYGA 1QGKB 1BCCD 3H1JG 3TDKA 2RN0A 3TGUG 2QJKC 3R4YA 1VF5D 4DZOA 1LTAC 2Q3EA 1L4AD 5CCGC 2WSFJ 2M5AA 1KZUB 3BCCG 3H1ID 3CC7P 1MUUA 4UB8H 3H25A 2Z5IA 2B87B 1IK7A 3CX5E 1H0TA 1HGZA 3N4XA 2E75D 4DCKA 4D6TE 1N8RQ 4YPCA 1GL2C 2QM7A 1H0TB 1RF1A 1NTMG 1NTZE 1QVGO 3FWLA 1GDTA 3L73D 2AXTH 1NU1K 3B5NC 4H13C 3V4QA 1GU4A 1NAFA 2XU6A 3OAKA 4YXDC 4EI2A 1SQQK 3M0AA 4GKGA 1SP4A 5AW3B 4KJMA 1ZOYC 1VF5B 3EFGA 3H1LD 5E79E 1Z56A 1KC8Q 4XFJA 1SQPE 1L4AB 1VQKP 3L71J 2FBWC 4IFDK 2KK7A 2FFDB 2OYIB 3I56P 3MTUE 4KT0J 1KILE 2ITAA 2Q3IA 4RESB 3O6QB 2OYHC 2E75B 2W6AA 2R44A 1HGVA 3P8CD 3PTZA 1JY2P 1NTKJ 1SQBK 4JYBA 5AVYB 1H88A 3HTKA 3EFFK 5DJUB 3L75J 3AECC 2A45H 2Q9IA 3B71A 2K1AA 1NU1G 3CWBE 1PP9G 4W7ZA 1L0LE 3H1JD 1R5SA 2YMKA 2G3AA 2R3CA 3TGUD 1ZR4A 1LWUB 2ZVNB 3GLMA 5H2FE 1NKNA 1X79B 2FY8A 1VDFA 3CX5I 3BCCD 4JQ0D 1YTZT 3AE1C 3Q5SA 3V4WA 1R5LA 3GW6A 4ZKPA 1OW7A 4H0LD 3MZWB 1E5WA 3AEGC 3IFMA 4DOJA 3KXDA 3L4FA 2OTJP 3AEFC 3WUVA 1BE3J 1KB9E 1OW8A 1S5LX 3CCUP 1L2PA 1LTSC 3H32B 3AEEC 1KILA 1SQBG 1J1EC 2H89C 4BXLA 4I6MC 1M1JC 4GOFA 1RF0C 1VQ9P 4K35A 3G9RA 1VQOP 2IBZD 3H1HE 3IF4A 4L75A 4PD4D 3L72D 4OGQD 3AE5C 1T3UA 4BWNA 1EZVG 1QLED 4D6TJ 5K5GB 3CLQA 1JMBA 2NPSA 1OXZA 1W2EA 1N7SA 3PHLA 2WT7A 3D70A 4UB8E 4Z1MH 1SQVG 2FYNB 3OW2O 1NTZJ 1Q90D 1X9VA 4H0LB 3A7OA 3L70J 2FYUJ 3CCEP 1URQC 1OIPA 2CK3H 2O1JA 1L0NE 1JUNA 1ZRTD 2HPCA 2UWJE 3MD0A 1EQ7A 4WBAA 1H89A 1T2KD 3KPEA 4JBZA 3HUSA 4PV1C 1AA0A 1K73Q 3F89A 3HE4A 3MUDA 2AXTE 4RJTA 2SPZA 3S1KA 3BCCJ 2HPCB 1YQ3C 1OZHA 4QMAA 1PP9D 2E74C 2OGUA 5B66H 1D7MA 3RK3D 1JCCA 1SQQD 3TNUA 1NTKK 1YBKA 4A7PA 4OGQB 1Q82Q 1CI6B 2WQYC 1OVUA 2IFMA 3VOPA 1JTHB 2G8YA 1N7SC 2K9JB 5KJ7D 1M7LA 3A3YB 3RL0C 2IFNA 5AW2B 1NTMJ 1VL2A 1JY3O 1KQSO 1N2DC 1DD4A 3VMAA 2YO2A 1L0LJ 1YJ9P 2V4HA 3HD7D 1N7LA 3V2PA 2WPVB 2O01N 5AVRB 1ZLLA 1AQTA 1SQBD 1GD2E 3AEAC 4U3FG 2N1TC 1KFMA 2R32A 3AE4C 3L74G 4L76A 4WWIA 1SQXE 1X22A 5APXA 3WMM0 2QJPB 4M3LA 2QVAA 2BCCG 4WY4D 2WTYA 2GUSA 3MIWA 3ABVC 1BGYG 3RK3B 1FDMA 5KJ7A 2E42A 1NTKG 1OWAA 1VQLP 2WSEH 1K8AQ 1EZVD 1ZP0C 4LGDE 1LT9C 2HODA 1DH3A 2YNYA 4O9BA 1PIXA 1XTCC 3HD7A 1S1CX 4I7ZB 1LTJB 1FZCC 3OA7A 3B8EB 3CMEP 2B89A 2WITA 1FBMA 3H1HJ 1SFCC 3H1KG 1NU1J 1DEBA 2J59M 3HD7B 4OWFA 3PLNA 1NTZK 3OJAB 1S9KD 1MKMA 4RKUJ 1PPJE 5CCGD 1RQVA 2D2CD 2Y9YA 2ZAEB 2JR8A 3Q3DA 4C46A 3BASA 5DJTB 1UIIA 4GT1A 4IOIH 5AW5B 4WY4B 1NGMB 2N9YB 5C39A 4IL6X 4WVZA 4U7JA 1SQPK 3H6PA 2POHA 5CCHD 1L0NJ 2BASA 4I2LC 1GL2D 2Y9ZA 3EWKA 3NFQA 2AEJA 1SVFA 2IX7C 2R5DA 4OH8B 1W5CE 1N73C 5EFWB 3C9IA 3HE5B 1GU5A 3B5ND 5APQA 4D6TG 3FWNA 3I5CA 3L71D 1FC2C 3PRJA 2QJKB 2A45I 2ZYAA 2OARA 3CI9A 1NTZG 2IZ0A 1EC5A 3KYQA 1JY3N 2D2CB 5CCHA 1L0LK 5B5EH 5B66E 3CXHD 1SQVJ 3AE7C 1FJKA 5KKZB 1NTKD 2AEFA 2B87A 1SQPG 2ZVOB 1PGPA 3L75D 1KORA 3RL0g 1GL2B 3L73E 2H88C 4TLFA 4NPDA 3AE2C 4NPEA 4KHXA 2K88A 2CPSA 3FX0A 2KNCA 3D6YA 1MFZA 1IJDB 3B5NB 5CMZA 3SSUA 2KP8A 3H1KD 3LIEA 1DD3A 5AW8B 5APWA 2JKVA 3E1IA 1IFJA 2KNCB 1EDKA 3D6ZA 1FZGA 3CCJP 2E43A 2Q6QA 3PP5A 3CWBG 1AJYA 2WMMA 1L4AA 1L0LG 1BE3D 4HH2A 2FFDA 3Q5RA 2OYIA 3P8CE 2OYHB 2W8ZA 2Y0DA 5CBNA 3O6QA 1EXJA 1E79H 1VQ4P 2WPRA 4LC1A 2M0BA 2OYOA 1NOHA 1H8AA 3C8VA 4Y99C 3H1JE 2IYPA 3TGUE 4U3FJ 1L0NK 2BEQD 4D6TD 3L74J 1JCDA 1QL2A 1P84D 3N7NA 2BCCJ 1KYOI 2YXRB 5BU5A 4ZMDA 1BGYJ 2JP3A 1SLQA 1Y9BA 2GA1A 2V7QH 1NTZD 2VRSA 3IR9A 2QRXA 3P7KA 3FGAD 1RF1C 1A02J 1LWUA 3U1AA 3L70D 2PGDA 1MZ9A 2FYUD 1HH0A 2AEMA 3SWKA 3H1HG 1PGJA 3B4SA 1KMIZ 3CCVP 1NWQA 3LIDA 2WSCJ 1NYHA 2FFDC 1CSBA 1URQD 1LGHB 1ZR2A 2M8RA 1PGOA 2QIWA 3H1KJ 1RE3A 4OVNF 2KS1B 3AE3C 1SQVK 2IBZE 1J1EB 4PV1D 3H32A 5KAFE 5TISE 3I55P 2O01H 3L72E 1M1JB 1TU3F 1L0NG 3LW5J 2E74D 2CPBA 5AVZB 1NHLA 4H44C 3CMAP 2YXQB 3M9QA 4N6JA 3AE9C 4AYCA 2FXPA 2Y0CA 3A0HH 3KQGA 1ZXGA 3SWFA 1QVFO 2KIKA 1OVRA 1NTMD 5APTA 2JDIH 3V2RA 3BRVB 5B5EE 4HB1A 1L0LD 1ZRTE 4L74A 1URQB 1QL1A 1EDJA 4Y28J 2YKQA 4NPFX 1KQLA 2YKOA 2IDBA 4XA4A 1PP9E 1M57D 2ZT9C 3CXHH 1G2CB 4PV1B 3RK3E 1SQQE 3K5BA 1GTWA 1BDDA 1JOCA 4JF7A 4WB4A 3KDPB 1LTGC 3EQ2A 2E74B 4GDOA 3L37A 1ZW0A 4MN4C 3RK2C 2Z5HA 3W67A 2A06E 2L91A 2A45G 1CI6A 1KILC 1SQPJ 3G6EP 3H1HD 2WSSH 1RHZB 4N78D 2W90A 3T97A 1JTHA 1NU1D 3GHGA 1FAVA 2K9JA 5KLVE 1Y47A 2FYNC 5KLIC 3V2NA 1SFCD 1Q2NA 1IFNA 4H0LC 1SQBE 3O8ZA 2NPSC 3M0DA 4DJGA 3T97B 3GHGB 2E5YA 1RE4A 5CJ4A 4C7NB 5AVSB 1KB9I 2H43A 1IZNB 3NXSA 1L0ND 3CWBJ 5KAIH 1FU1A 1KV4A 2PFXA 4L73A 5AVUB 2XZRA 3GF3A 3NMDA 2KB7P 1K04A 1PPJG 3BRTB 2YIUC 1S3JA 1T8ZA 3HUSC 1VPCA 3MUDC 1J1DB 1FOSF 1YJWP 1P84H 1JO5A 3FXEA 1MV8A 1S5LH 3AE8C 2OQQA 2QEXP 1FZEA 1FZCB 5AW6B 3VN0A 1S9KE 1IC2A 1SFCB 2FXMA 1BSHA 1LTJA 3PH0A 3R2PA 3M0DC 2YKPA 2FKWB 3P32A 3WU2E 3BVHA 5AVXB 5APYA 3VMXA 1NO4A 1SQVD 2KLUA 1LJ2A 4ZNCA 2QJYC 2MKVA 1Q81Q 2KYVA 4UB6H 1R8EA 1HWTC 1VQPP 4WY4A 3C1LA 5AVQB 2HLOA 3A0HE 4C7RA 1G1JA 1NAYA 1CW5A 1IO4A 1AVYA 4RO0A 3QH9A 3E1RA 3L36A 1N73B 1HJBA 1K05A 3P8MC 3L71E 4HYTB 2O3JA 1FOSE 3G3ZA 1BSNA 1YIJP 1VQ6P 5KJ7C 5GTHH 3U1CA 3S9OA 4I7ZC 4EIJA 3HE5A 1JY2O 3SFDC 2ZXXA 2E76C 2KSJA 2P58A 4IFFA 1HTLC 3HD7C 3CXHE 1VQNP 4PJ0H 4PD4H 5TISH 5KAFH 1BCCE 3VMZA 1GW4A 1NTKE 5CCGA 4H13D 1YJNP 3D71A 3L75E 1LTTC 5KLVJ 4EYYQ 2K3RA 3H1IE 4N3YB 4LLHA 2R3SA 3G4SP 3M06A 2XKMA 3IN6A 4U3FD 2Q5UA 1PV3A 3II6A 1JEKA 3CL3D 3WUTA 1WMKA 3L74D 1AFOA 1PGQA 4W7YA 1YQ4C 3UIAA 1GL2A 2BCCD 3NTNA 3VMYA 2JWDA 3W68A 1YTZI 1S4XA 1BGYD 1HF9A 2LR2A 1M56D 2FXOA 5AW9B 2OTLP 1N86A 2Z4EA 3L35A 3VTPC 3B5NA 3VP9A 2I8DA 2KLVA 2V7QJ 1JY3P 1IFPA 1BE3E 1EDLA 5AW7B 1SQXJ 1QEXA 2PAJA 4H13B 5KAIE 3H1LE 2KI7B 1LP1B 2D2CC 5AW4B 1XTGB 3CCQP 2GUVA 5KTBA 2XNXA 1KD1Q 3PJSK 3GF7A 1KYOD 2LXBA 2C9NY 1KTMA 5KKZC 2OYHA 1LT1A 2KUBA 3USSA 1LTBC 2M5AB 2KZJA 5CCHC 3MGNA 4XE5B 3GG2A 1P84E 2O01J 2IYOA 3TF5A 1S5LE 4Y99B 1LNQA 3Q5PA 1EXIA 1PL5A 4H44D 2JEEA 1U57A 2H8PD 3L70E 3CXHI 1KN7A 1OVVA 2FYUE 2IBZG 1T6AA 3A0BH 5AW0B 1OFCX 3L72G 3CX5D 1M1KQ 1RF1B 1NVOA 1JB0J 3IAOA 1PZQA 2IPPA 2HR3A 4IL6H 1NH4A 5L8RJ 3JCUE 1CZQA 1JNMA 1USEA 2MJZA 1AVOA 1JY2N 1ZN5A 2W6JH 2XDJA 2PRRA 3QWOC 3CCRP 1KQFB 2RMZA 4UB6E 2ZFCA 3BCCE 2QE7H 1S2EA 3KZIH 1RQUA 2HYNA 2AXCA 3AEDC 1U7JA 4YTPC 1VF5C 1FZFA 2YO3A 2ZT9D 5KLVK 1L4AC 2WPSA 2KS1A 2Q7CA 1BCCJ 2WSFH 3KHUA 4K3AA 2JO1A 3S4RA 2OYIC 5GTHE 5BU8B 1M1JA 4H44B 1IFIA 1RF0A 1SQPD 1NTME 1AV1A 2C9LY 1T3JA 3RK2D 3H1IJ 3A2AA 1JM0A 4R4MA 3WU2H 2E75C 1SQQG 4R4LA 1KILD 2W27A 3HTKB 4PJ0E 4PD4E 1IK9A 4BRYA 1U7MA 1VQ8P 2QSIA 2KSEA 1AQ5A 2C0WA 1X8YA 4HJGH 3SFEC 2A06G 4IFMA 3CD6P 2ZYDA 4BRYB 1SQXK 1P84I 2NPSD 3L73J 1N7SD 1URQA 1LWUC 1S72P 3BATA 3CWBD 2RH0A 1M90Q 2LXCB 4YXWH 2ZT9B 5KLVG 1FJPA 3RL0D 2KZIA 3ZDMA 1YHQP 1GK4A 1G2CA 3H1LJ 3RBXA 2XNDH 1JMMA 3HRNA 2KOGA 3RK2B 4W80A 2Q1KA 1J2JB 1RE3C 1YI2P 5BVZA 2IZ1A 4N78E 1GMJA 1NU1E 1Q86Q 3JSVC 1KILB 2L5GB 2N1TD 4GODA 1FS0E 1WRGA 2WZ7A 1VQ5P 3V5BA 4JPZB 1KB9D 3CCMP 1HJ0A 1Q7YQ 5AVWB 2FYZA 2K37A 1UIXA 2YMYA 2PP6A 3F5HA 2W6BA 3AE6C 5KLIB 2WSEJ 5APVA 1USDA 2GM4A 2WSCH 3G71P 5GTIH 2NPSB 2P10A 3JC22 1SQXG 1VQMP 1N7SB 1QX8A 1VQ7P 2P7JA 2WT7B 2JJLA 3H1JJ 3RL0B 5AVTB 3TGUJ 4C7NA 3TSIA 1KYOH 3CCLP 2DW3A 2N1TA 1M8OB 1OMIA 2B9BA 2IBZI 4EOTA 4HKZH 4PD4I 3LW5H 3SWYA 1BDCA 3M9BA 3A0BE 2YIUB 5APUA 1Y8AA 3HUSB 2N1TB 1HVVA 4IL6E 3HE4B 3FXDA 1LT9A 1G1IA 2R5BA 3CC4P 1HUCA 1EZVE 2K9YA 1SS1A 3TYYA 1GZLA 1KQGB 4CPGA 4ASWA 3TNUB 3Q1MA 2NRGA 2A06D 2OTKE 4JYCA 5AVVB 3CX5H 1SQVE 1FZCA 4AUWA 3KZIE 4GIFA 2E76D 1LT9B 1LTIC 4OGQC 3E7KA 1SFCA 2WPQA 5APSA 2J5UA 3L71G 3MHVA 5KLVD 3GHGC 2I1KA 3L72J 2QJYB 5CHXA
chains in the Genus database with same CATH topology
3H1LJ 1KB9I 3L70J 1P84I 1SQXJ 4U3FJ 1SQPJ 1L0NJ 3L73J 3L75J 2FYUJ 4D6TJ 3CWBJ 3L74J 3H1HJ 2IBZI 3CXHI 3H1KJ 3L71J 3BCCJ 3CX5I 3H1IJ 1NU1J 1L0LJ 2BCCJ 1BE3J 4PD4I 1PP9J 1KYOI 5KLVJ 1BCCJ 3L72J 3H1JJ 1SQVJ 1SQQJ 1BGYJ 3TGUJ 1NTZJ 1NTKJ 1EZVI 1SQBJ 1NTMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1L J;  1KB9 I;  3L70 J;  1P84 I;  1SQX J;  4U3F J;  1SQP J;  1L0N J;  3L73 J;  3L75 J;  2FYU J;  4D6T J;  3CWB J;  3L74 J;  3H1H J;  2IBZ I;  3CXH I;  3H1K J;  3L71 J;  3BCC J;  3CX5 I;  3H1I J;  1NU1 J;  1L0L J;  2BCC J;  1BE3 J;  4PD4 I;  1PP9 J;  1KYO I;  5KLV J;  1BCC J;  3L72 J;  3H1J J;  1SQV J;  1SQQ J;  1BGY J;  3TGU J;  1NTZ J;  1NTK J;  1EZV I;  1SQB J;  1NTM J; 
#chains in the Genus database with same CATH topology
 3M91 A;  3CC2 P;  3VYI A;  1W2B O;  1FZA A;  1MFT A;  2M3E A;  4TT3 H;  2J58 A;  1DIP A;  2HFE D;  5CJ0 A;  1RE4 C;  1BCC G;  3RGU A;  1OX3 A;  3M9H A;  2M3B A;  1A02 F;  1T2K C;  2HG5 D;  2XV5 A;  1FE6 A;  3JCU H;  3L75 G;  5E79 H;  2WVR A;  1PFI A;  2E5T A;  3H1I G;  1IFD A;  1KFN A;  1J1D C;  5AW1 B;  1N73 A;  1K9M Q;  2QJP C;  4GOE A;  5M1B A;  1ZME C;  1ZV8 A;  1DX7 A;  3RK3 C;  2ZJS E;  3ITK A;  2E76 B;  1YIT P;  1SQX D;  1WT6 A;  3CPW O;  2P2U A;  2HOD B;  1FDI A;  1PP9 J;  1X0T A;  2WWW A;  2C0X A;  1SQQ J;  2QM8 A;  2FYU K;  1RH5 B;  2RKL A;  2QA4 P;  3L73 G;  1FDO A;  1GK6 A;  1LTJ C;  4U3F E;  5CBO A;  3U59 A;  4B86 A;  1EDI A;  1BE3 G;  3L74 E;  2QG4 A;  3MP7 B;  2KXP B;  1NKZ B;  1HBW A;  2BCC E;  3AEB C;  1EZV I;  1FZB A;  5TJH A;  1BGY E;  3H1L G;  5H2F H;  1GW3 A;  4ASV A;  2P67 A;  4ZKU A;  1IFM A;  2BEZ F;  4DT0 A;  4AQR D;  3V2Q A;  4WY4 C;  1PPJ D;  2LKM A;  3V6I A;  1SQB J;  2W83 C;  2O1K A;  4I1L A;  1OW6 A;  3Q2Y A;  2B88 A;  5GTI E;  3CCS P;  1DEE G;  3TK1 A;  3GMA A;  2I1J A;  1KB9 H;  3RBZ A;  2Y0E A;  2NZ2 A;  1YYC A;  3H1K E;  1RY3 A;  2N9B A;  4EDF A;  3A5T A;  1NTM K;  1KYO E;  2ZXE B;  2JWA A;  3WUU A;  3L70 G;  2FYU G;  1NJI Q;  2H7H A;  1LP1 A;  2P1J A;  3VP8 A;  2ZYG A;  1QGK B;  1BCC D;  3H1J G;  3TDK A;  2RN0 A;  3TGU G;  2QJK C;  3R4Y A;  1VF5 D;  4DZO A;  1LTA C;  2Q3E A;  1L4A D;  5CCG C;  2WSF J;  2M5A A;  1KZU B;  3BCC G;  3H1I D;  3CC7 P;  1MUU A;  4UB8 H;  3H25 A;  2Z5I A;  2B87 B;  1IK7 A;  3CX5 E;  1H0T A;  1HGZ A;  3N4X A;  2E75 D;  4DCK A;  4D6T E;  1N8R Q;  4YPC A;  1GL2 C;  2QM7 A;  1H0T B;  1RF1 A;  1NTM G;  1NTZ E;  1QVG O;  3FWL A;  1GDT A;  3L73 D;  2AXT H;  1NU1 K;  3B5N C;  4H13 C;  3V4Q A;  1GU4 A;  1NAF A;  2XU6 A;  3OAK A;  4YXD C;  4EI2 A;  1SQQ K;  3M0A A;  4GKG A;  1SP4 A;  5AW3 B;  4KJM A;  1ZOY C;  1VF5 B;  3EFG A;  3H1L D;  5E79 E;  1Z56 A;  1KC8 Q;  4XFJ A;  1SQP E;  1L4A B;  1VQK P;  3L71 J;  2FBW C;  4IFD K;  2KK7 A;  2FFD B;  2OYI B;  3I56 P;  3MTU E;  4KT0 J;  1KIL E;  2ITA A;  2Q3I A;  4RES B;  3O6Q B;  2OYH C;  2E75 B;  2W6A A;  2R44 A;  1HGV A;  3P8C D;  3PTZ A;  1JY2 P;  1NTK J;  1SQB K;  4JYB A;  5AVY B;  1H88 A;  3HTK A;  3EFF K;  5DJU B;  3L75 J;  3AEC C;  2A45 H;  2Q9I A;  3B71 A;  2K1A A;  1NU1 G;  3CWB E;  1PP9 G;  4W7Z A;  1L0L E;  3H1J D;  1R5S A;  2YMK A;  2G3A A;  2R3C A;  3TGU D;  1ZR4 A;  1LWU B;  2ZVN B;  3GLM A;  5H2F E;  1NKN A;  1X79 B;  2FY8 A;  1VDF A;  3CX5 I;  3BCC D;  4JQ0 D;  1YTZ T;  3AE1 C;  3Q5S A;  3V4W A;  1R5L A;  3GW6 A;  4ZKP A;  1OW7 A;  4H0L D;  3MZW B;  1E5W A;  3AEG C;  3IFM A;  4DOJ A;  3KXD A;  3L4F A;  2OTJ P;  3AEF C;  3WUV A;  1BE3 J;  1KB9 E;  1OW8 A;  1S5L X;  3CCU P;  1L2P A;  1LTS C;  3H32 B;  3AEE C;  1KIL A;  1SQB G;  1J1E C;  2H89 C;  4BXL A;  4I6M C;  1M1J C;  4GOF A;  1RF0 C;  1VQ9 P;  4K35 A;  3G9R A;  1VQO P;  2IBZ D;  3H1H E;  3IF4 A;  4L75 A;  4PD4 D;  3L72 D;  4OGQ D;  3AE5 C;  1T3U A;  4BWN A;  1EZV G;  1QLE D;  4D6T J;  5K5G B;  3CLQ A;  1JMB A;  2NPS A;  1OXZ A;  1W2E A;  1N7S A;  3PHL A;  2WT7 A;  3D70 A;  4UB8 E;  4Z1M H;  1SQV G;  2FYN B;  3OW2 O;  1NTZ J;  1Q90 D;  1X9V A;  4H0L B;  3A7O A;  3L70 J;  2FYU J;  3CCE P;  1URQ C;  1OIP A;  2CK3 H;  2O1J A;  1L0N E;  1JUN A;  1ZRT D;  2HPC A;  2UWJ E;  3MD0 A;  1EQ7 A;  4WBA A;  1H89 A;  1T2K D;  3KPE A;  4JBZ A;  3HUS A;  4PV1 C;  1AA0 A;  1K73 Q;  3F89 A;  3HE4 A;  3MUD A;  2AXT E;  4RJT A;  2SPZ A;  3S1K A;  3BCC J;  2HPC B;  1YQ3 C;  1OZH A;  4QMA A;  1PP9 D;  2E74 C;  2OGU A;  5B66 H;  1D7M A;  3RK3 D;  1JCC A;  1SQQ D;  3TNU A;  1NTK K;  1YBK A;  4A7P A;  4OGQ B;  1Q82 Q;  1CI6 B;  2WQY C;  1OVU A;  2IFM A;  3VOP A;  1JTH B;  2G8Y A;  1N7S C;  2K9J B;  5KJ7 D;  1M7L A;  3A3Y B;  3RL0 C;  2IFN A;  5AW2 B;  1NTM J;  1VL2 A;  1JY3 O;  1KQS O;  1N2D C;  1DD4 A;  3VMA A;  2YO2 A;  1L0L J;  1YJ9 P;  2V4H A;  3HD7 D;  1N7L A;  3V2P A;  2WPV B;  2O01 N;  5AVR B;  1ZLL A;  1AQT A;  1SQB D;  1GD2 E;  3AEA C;  4U3F G;  2N1T C;  1KFM A;  2R32 A;  3AE4 C;  3L74 G;  4L76 A;  4WWI A;  1SQX E;  1X22 A;  5APX A;  3WMM 0;  2QJP B;  4M3L A;  2QVA A;  2BCC G;  4WY4 D;  2WTY A;  2GUS A;  3MIW A;  3ABV C;  1BGY G;  3RK3 B;  1FDM A;  5KJ7 A;  2E42 A;  1NTK G;  1OWA A;  1VQL P;  2WSE H;  1K8A Q;  1EZV D;  1ZP0 C;  4LGD E;  1LT9 C;  2HOD A;  1DH3 A;  2YNY A;  4O9B A;  1PIX A;  1XTC C;  3HD7 A;  1S1C X;  4I7Z B;  1LTJ B;  1FZC C;  3OA7 A;  3B8E B;  3CME P;  2B89 A;  2WIT A;  1FBM A;  3H1H J;  1SFC C;  3H1K G;  1NU1 J;  1DEB A;  2J59 M;  3HD7 B;  4OWF A;  3PLN A;  1NTZ K;  3OJA B;  1S9K D;  1MKM A;  4RKU J;  1PPJ E;  5CCG D;  1RQV A;  2D2C D;  2Y9Y A;  2ZAE B;  2JR8 A;  3Q3D A;  4C46 A;  3BAS A;  5DJT B;  1UII A;  4GT1 A;  4IOI H;  5AW5 B;  4WY4 B;  1NGM B;  2N9Y B;  5C39 A;  4IL6 X;  4WVZ A;  4U7J A;  1SQP K;  3H6P A;  2POH A;  5CCH D;  1L0N J;  2BAS A;  4I2L C;  1GL2 D;  2Y9Z A;  3EWK A;  3NFQ A;  2AEJ A;  1SVF A;  2IX7 C;  2R5D A;  4OH8 B;  1W5C E;  1N73 C;  5EFW B;  3C9I A;  3HE5 B;  1GU5 A;  3B5N D;  5APQ A;  4D6T G;  3FWN A;  3I5C A;  3L71 D;  1FC2 C;  3PRJ A;  2QJK B;  2A45 I;  2ZYA A;  2OAR A;  3CI9 A;  1NTZ G;  2IZ0 A;  1EC5 A;  3KYQ A;  1JY3 N;  2D2C B;  5CCH A;  1L0L K;  5B5E H;  5B66 E;  3CXH D;  1SQV J;  3AE7 C;  1FJK A;  5KKZ B;  1NTK D;  2AEF A;  2B87 A;  1SQP G;  2ZVO B;  1PGP A;  3L75 D;  1KOR A;  3RL0 g;  1GL2 B;  3L73 E;  2H88 C;  4TLF A;  4NPD A;  3AE2 C;  4NPE A;  4KHX A;  2K88 A;  2CPS A;  3FX0 A;  2KNC A;  3D6Y A;  1MFZ A;  1IJD B;  3B5N B;  5CMZ A;  3SSU A;  2KP8 A;  3H1K D;  3LIE A;  1DD3 A;  5AW8 B;  5APW A;  2JKV A;  3E1I A;  1IFJ A;  2KNC B;  1EDK A;  3D6Z A;  1FZG A;  3CCJ P;  2E43 A;  2Q6Q A;  3PP5 A;  3CWB G;  1AJY A;  2WMM A;  1L4A A;  1L0L G;  1BE3 D;  4HH2 A;  2FFD A;  3Q5R A;  2OYI A;  3P8C E;  2OYH B;  2W8Z A;  2Y0D A;  5CBN A;  3O6Q A;  1EXJ A;  1E79 H;  1VQ4 P;  2WPR A;  4LC1 A;  2M0B A;  2OYO A;  1NOH A;  1H8A A;  3C8V A;  4Y99 C;  3H1J E;  2IYP A;  3TGU E;  4U3F J;  1L0N K;  2BEQ D;  4D6T D;  3L74 J;  1JCD A;  1QL2 A;  1P84 D;  3N7N A;  2BCC J;  1KYO I;  2YXR B;  5BU5 A;  4ZMD A;  1BGY J;  2JP3 A;  1SLQ A;  1Y9B A;  2GA1 A;  2V7Q H;  1NTZ D;  2VRS A;  3IR9 A;  2QRX A;  3P7K A;  3FGA D;  1RF1 C;  1A02 J;  1LWU A;  3U1A A;  3L70 D;  2PGD A;  1MZ9 A;  2FYU D;  1HH0 A;  2AEM A;  3SWK A;  3H1H G;  1PGJ A;  3B4S A;  1KMI Z;  3CCV P;  1NWQ A;  3LID A;  2WSC J;  1NYH A;  2FFD C;  1CSB A;  1URQ D;  1LGH B;  1ZR2 A;  2M8R A;  1PGO A;  2QIW A;  3H1K J;  1RE3 A;  4OVN F;  2KS1 B;  3AE3 C;  1SQV K;  2IBZ E;  1J1E B;  4PV1 D;  3H32 A;  5KAF E;  5TIS E;  3I55 P;  2O01 H;  3L72 E;  1M1J B;  1TU3 F;  1L0N G;  3LW5 J;  2E74 D;  2CPB A;  5AVZ B;  1NHL A;  4H44 C;  3CMA P;  2YXQ B;  3M9Q A;  4N6J A;  3AE9 C;  4AYC A;  2FXP A;  2Y0C A;  3A0H H;  3KQG A;  1ZXG A;  3SWF A;  1QVF O;  2KIK A;  1OVR A;  1NTM D;  5APT A;  2JDI H;  3V2R A;  3BRV B;  5B5E E;  4HB1 A;  1L0L D;  1ZRT E;  4L74 A;  1URQ B;  1QL1 A;  1EDJ A;  4Y28 J;  2YKQ A;  4NPF X;  1KQL A;  2YKO A;  2IDB A;  4XA4 A;  1PP9 E;  1M57 D;  2ZT9 C;  3CXH H;  1G2C B;  4PV1 B;  3RK3 E;  1SQQ E;  3K5B A;  1GTW A;  1BDD A;  1JOC A;  4JF7 A;  4WB4 A;  3KDP B;  1LTG C;  3EQ2 A;  2E74 B;  4GDO A;  3L37 A;  1ZW0 A;  4MN4 C;  3RK2 C;  2Z5H A;  3W67 A;  2A06 E;  2L91 A;  2A45 G;  1CI6 A;  1KIL C;  1SQP J;  3G6E P;  3H1H D;  2WSS H;  1RHZ B;  4N78 D;  2W90 A;  3T97 A;  1JTH A;  1NU1 D;  3GHG A;  1FAV A;  2K9J A;  5KLV E;  1Y47 A;  2FYN C;  5KLI C;  3V2N A;  1SFC D;  1Q2N A;  1IFN A;  4H0L C;  1SQB E;  3O8Z A;  2NPS C;  3M0D A;  4DJG A;  3T97 B;  3GHG B;  2E5Y A;  1RE4 A;  5CJ4 A;  4C7N B;  5AVS B;  1KB9 I;  2H43 A;  1IZN B;  3NXS A;  1L0N D;  3CWB J;  5KAI H;  1FU1 A;  1KV4 A;  2PFX A;  4L73 A;  5AVU B;  2XZR A;  3GF3 A;  3NMD A;  2KB7 P;  1K04 A;  1PPJ G;  3BRT B;  2YIU C;  1S3J A;  1T8Z A;  3HUS C;  1VPC A;  3MUD C;  1J1D B;  1FOS F;  1YJW P;  1P84 H;  1JO5 A;  3FXE A;  1MV8 A;  1S5L H;  3AE8 C;  2OQQ A;  2QEX P;  1FZE A;  1FZC B;  5AW6 B;  3VN0 A;  1S9K E;  1IC2 A;  1SFC B;  2FXM A;  1BSH A;  1LTJ A;  3PH0 A;  3R2P A;  3M0D C;  2YKP A;  2FKW B;  3P32 A;  3WU2 E;  3BVH A;  5AVX B;  5APY A;  3VMX A;  1NO4 A;  1SQV D;  2KLU A;  1LJ2 A;  4ZNC A;  2QJY C;  2MKV A;  1Q81 Q;  2KYV A;  4UB6 H;  1R8E A;  1HWT C;  1VQP P;  4WY4 A;  3C1L A;  5AVQ B;  2HLO A;  3A0H E;  4C7R A;  1G1J A;  1NAY A;  1CW5 A;  1IO4 A;  1AVY A;  4RO0 A;  3QH9 A;  3E1R A;  3L36 A;  1N73 B;  1HJB A;  1K05 A;  3P8M C;  3L71 E;  4HYT B;  2O3J A;  1FOS E;  3G3Z A;  1BSN A;  1YIJ P;  1VQ6 P;  5KJ7 C;  5GTH H;  3U1C A;  3S9O A;  4I7Z C;  4EIJ A;  3HE5 A;  1JY2 O;  3SFD C;  2ZXX A;  2E76 C;  2KSJ A;  2P58 A;  4IFF A;  1HTL C;  3HD7 C;  3CXH E;  1VQN P;  4PJ0 H;  4PD4 H;  5TIS H;  5KAF H;  1BCC E;  3VMZ A;  1GW4 A;  1NTK E;  5CCG A;  4H13 D;  1YJN P;  3D71 A;  3L75 E;  1LTT C;  5KLV J;  4EYY Q;  2K3R A;  3H1I E;  4N3Y B;  4LLH A;  2R3S A;  3G4S P;  3M06 A;  2XKM A;  3IN6 A;  4U3F D;  2Q5U A;  1PV3 A;  3II6 A;  1JEK A;  3CL3 D;  3WUT A;  1WMK A;  3L74 D;  1AFO A;  1PGQ A;  4W7Y A;  1YQ4 C;  3UIA A;  1GL2 A;  2BCC D;  3NTN A;  3VMY A;  2JWD A;  3W68 A;  1YTZ I;  1S4X A;  1BGY D;  1HF9 A;  2LR2 A;  1M56 D;  2FXO A;  5AW9 B;  2OTL P;  1N86 A;  2Z4E A;  3L35 A;  3VTP C;  3B5N A;  3VP9 A;  2I8D A;  2KLV A;  2V7Q J;  1JY3 P;  1IFP A;  1BE3 E;  1EDL A;  5AW7 B;  1SQX J;  1QEX A;  2PAJ A;  4H13 B;  5KAI E;  3H1L E;  2KI7 B;  1LP1 B;  2D2C C;  5AW4 B;  1XTG B;  3CCQ P;  2GUV A;  5KTB A;  2XNX A;  1KD1 Q;  3PJS K;  3GF7 A;  1KYO D;  2LXB A;  2C9N Y;  1KTM A;  5KKZ C;  2OYH A;  1LT1 A;  2KUB A;  3USS A;  1LTB C;  2M5A B;  2KZJ A;  5CCH C;  3MGN A;  4XE5 B;  3GG2 A;  1P84 E;  2O01 J;  2IYO A;  3TF5 A;  1S5L E;  4Y99 B;  1LNQ A;  3Q5P A;  1EXI A;  1PL5 A;  4H44 D;  2JEE A;  1U57 A;  2H8P D;  3L70 E;  3CXH I;  1KN7 A;  1OVV A;  2FYU E;  2IBZ G;  1T6A A;  3A0B H;  5AW0 B;  1OFC X;  3L72 G;  3CX5 D;  1M1K Q;  1RF1 B;  1NVO A;  1JB0 J;  3IAO A;  1PZQ A;  2IPP A;  2HR3 A;  4IL6 H;  1NH4 A;  5L8R J;  3JCU E;  1CZQ A;  1JNM A;  1USE A;  2MJZ A;  1AVO A;  1JY2 N;  1ZN5 A;  2W6J H;  2XDJ A;  2PRR A;  3QWO C;  3CCR P;  1KQF B;  2RMZ A;  4UB6 E;  2ZFC A;  3BCC E;  2QE7 H;  1S2E A;  3KZI H;  1RQU A;  2HYN A;  2AXC A;  3AED C;  1U7J A;  4YTP C;  1VF5 C;  1FZF A;  2YO3 A;  2ZT9 D;  5KLV K;  1L4A C;  2WPS A;  2KS1 A;  2Q7C A;  1BCC J;  2WSF H;  3KHU A;  4K3A A;  2JO1 A;  3S4R A;  2OYI C;  5GTH E;  5BU8 B;  1M1J A;  4H44 B;  1IFI A;  1RF0 A;  1SQP D;  1NTM E;  1AV1 A;  2C9L Y;  1T3J A;  3RK2 D;  3H1I J;  3A2A A;  1JM0 A;  4R4M A;  3WU2 H;  2E75 C;  1SQQ G;  4R4L A;  1KIL D;  2W27 A;  3HTK B;  4PJ0 E;  4PD4 E;  1IK9 A;  4BRY A;  1U7M A;  1VQ8 P;  2QSI A;  2KSE A;  1AQ5 A;  2C0W A;  1X8Y A;  4HJG H;  3SFE C;  2A06 G;  4IFM A;  3CD6 P;  2ZYD A;  4BRY B;  1SQX K;  1P84 I;  2NPS D;  3L73 J;  1N7S D;  1URQ A;  1LWU C;  1S72 P;  3BAT A;  3CWB D;  2RH0 A;  1M90 Q;  2LXC B;  4YXW H;  2ZT9 B;  5KLV G;  1FJP A;  3RL0 D;  2KZI A;  3ZDM A;  1YHQ P;  1GK4 A;  1G2C A;  3H1L J;  3RBX A;  2XND H;  1JMM A;  3HRN A;  2KOG A;  3RK2 B;  4W80 A;  2Q1K A;  1J2J B;  1RE3 C;  1YI2 P;  5BVZ A;  2IZ1 A;  4N78 E;  1GMJ A;  1NU1 E;  1Q86 Q;  3JSV C;  1KIL B;  2L5G B;  2N1T D;  4GOD A;  1FS0 E;  1WRG A;  2WZ7 A;  1VQ5 P;  3V5B A;  4JPZ B;  1KB9 D;  3CCM P;  1HJ0 A;  1Q7Y Q;  5AVW B;  2FYZ A;  2K37 A;  1UIX A;  2YMY A;  2PP6 A;  3F5H A;  2W6B A;  3AE6 C;  5KLI B;  2WSE J;  5APV A;  1USD A;  2GM4 A;  2WSC H;  3G71 P;  5GTI H;  2NPS B;  2P10 A;  3JC2 2;  1SQX G;  1VQM P;  1N7S B;  1QX8 A;  1VQ7 P;  2P7J A;  2WT7 B;  2JJL A;  3H1J J;  3RL0 B;  5AVT B;  3TGU J;  4C7N A;  3TSI A;  1KYO H;  3CCL P;  2DW3 A;  2N1T A;  1M8O B;  1OMI A;  2B9B A;  2IBZ I;  4EOT A;  4HKZ H;  4PD4 I;  3LW5 H;  3SWY A;  1BDC A;  3M9B A;  3A0B E;  2YIU B;  5APU A;  1Y8A A;  3HUS B;  2N1T B;  1HVV A;  4IL6 E;  3HE4 B;  3FXD A;  1LT9 A;  1G1I A;  2R5B A;  3CC4 P;  1HUC A;  1EZV E;  2K9Y A;  1SS1 A;  3TYY A;  1GZL A;  1KQG B;  4CPG A;  4ASW A;  3TNU B;  3Q1M A;  2NRG A;  2A06 D;  2OTK E;  4JYC A;  5AVV B;  3CX5 H;  1SQV E;  1FZC A;  4AUW A;  3KZI E;  4GIF A;  2E76 D;  1LT9 B;  1LTI C;  4OGQ C;  3E7K A;  1SFC A;  2WPQ A;  5APS A;  2J5U A;  3L71 G;  3MHV A;  5KLV D;  3GHG C;  2I1K A;  3L72 J;  2QJY B;  5CHX A; 
#chains in the Genus database with same CATH homology
 3H1L J;  1KB9 I;  3L70 J;  1P84 I;  1SQX J;  4U3F J;  1SQP J;  1L0N J;  3L73 J;  3L75 J;  2FYU J;  4D6T J;  3CWB J;  3L74 J;  3H1H J;  2IBZ I;  3CXH I;  3H1K J;  3L71 J;  3BCC J;  3CX5 I;  3H1I J;  1NU1 J;  1L0L J;  2BCC J;  1BE3 J;  4PD4 I;  1PP9 J;  1KYO I;  5KLV J;  1BCC J;  3L72 J;  3H1J J;  1SQV J;  1SQQ J;  1BGY J;  3TGU J;  1NTZ J;  1NTK J;  1EZV I;  1SQB J;  1NTM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...