1NU1J

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 19
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1nu1J00
2IBZI 3CWBJ 3L74J 3CX5I 1BE3J 5KLVJ 1P84I 3L75J 3H1JJ 4PD4I 1NTKJ 3L72J 1SQBJ 1KYOI 4D6TJ 3H1IJ 1SQPJ 1BGYJ 3L73J 1NTZJ 2BCCJ 3CXHI 3L70J 3L71J 1NU1J 1SQVJ 1L0NJ 1EZVI 1BCCJ 1SQQJ 2FYUJ 1NTMJ 3H1HJ 3H1KJ 1KB9I 3BCCJ 4U3FJ 1PP9J 3H1LJ 1L0LJ 1SQXJ 3TGUJ
chains in the Genus database with same CATH superfamily
1IFNA 4U3FE 2NPSD 1S1CX 1BE3J 3G9RA 3L75J 2E74C 2YIUB 3UIAA 3P32A 1LTAC 1FDMA 1LT1A 1NKZB 2YIUC 4R4MA 1IFIA 2L91A 1HGVA 4WWIA 4K3AA 1KQFB 5CJ0A 5AW3B 3NFQA 5KTBA 1FZCC 1VDFA 4NPEA 1K8AQ 3CCQP 1IZNB 4M3LA 1EZVD 2WSCJ 3JC22 3PP5A 2E43A 1LT9A 3L75D 1RY3A 3VMXA 3AE9C 1JUNA 3BATA 3EFFK 1H0TB 1L0NJ 2BCCD 2O1JA 5AVVB 1L0LE 1URQD 1W5CE 1PP9G 1BE3D 1VF5B 2JR8A 1M7LA 4PV1D 2L5GB 3CCRP 1JMMA 4WY4C 1GW3A 5KJ7D 2B9BA 1GDTA 2WWWA 1HBWA 3GF3A 1JY3P 3PLNA 1LTJA 3VP8A 1RF1A 3GW6A 1JTHA 3M9QA 2K9JA 1QX8A 4ZMDA 1YTZT 1SFCD 1NTME 3EQ2A 2QA4P 1QVFO 1PGOA 2OYHA 1FDIA 3HTKB 3KDPB 5APWA 2IBZE 3RL0D 3B5ND 1M1JC 1OWAA 3RK2C 5AW8B 1VQMP 3CWBG 4OGQD 3L75G 5B66E 3CC4P 1R5LA 4IFDK 2Q3EA 2R44A 3PTZA 2HLOA 5E79E 1BE3E 2D2CC 5H2FH 2Z4EA 1SS1A 2W8ZA 2JWDA 2M0BA 3L4FA 3VN0A 1SQBG 1NTKE 4Y99C 3P8CD 2N1TC 2QJPB 1GD2E 1S5LH 2ZJSE 2WT7A 1N7SB 3GHGC 2KUBA 3L71G 5APYA 3AE8C 1VQOP 4RJTA 2QRXA 3BCCJ 3TNUB 1FZCB 1NHLA 2FYUD 1MZ9A 2B87A 5KAIE 1NJIQ 1VQ9P 1PP9J 3LW5H 4C7NB 4W7ZA 4L74A 2IBZD 2FYUG 3L74G 3VOPA 3L74E 5BU8B 4KT0J 4JF7A 1NOHA 2M5AB 4DZOA 1NAYA 2IBZI 3L74J 4NPFX 5GTIH 1SP4A 1R8EA 1SQVD 1FZFA 3CI9A 4LC1A 1IC2A 1KYOD 3P7KA 4GT1A 3SWYA 1VQ4P 2C9LY 1NTMK 1NU1D 3ABVC 2AXTE 2YMKA 4D6TJ 3BCCD 1GU5A 1IJDB 1USEA 1ZP0C 2JKVA 1IFPA 1FOSF 1L0NG 1PPJG 3A0HE 1T2KC 1K04A 2XV5A 3VMZA 1AQTA 5AVRB 3W68A 1GL2C 1N8RQ 4NPDA 3M0AA 1Y9BA 4U3FG 1P84H 2NPSC 1OW6A 3L70D 1EXIA 3V2NA 3CC2P 1KFMA 4L73A 2WSEH 4JBZA 1KQLA 5CCGD 1T2KD 5AW6B 4QMAA 3CWBE 1QVGO 2H7HA 2GM4A 3FWNA 3T97A 3H1LJ 5GTIE 1OW7A 1BCCG 1SQQG 2M5AA 1ZN5A 2KZJA 2P2UA 1KYOE 3BASA 3A5TA 1EDJA 1NU1E 1HTLC 2N1TA 2SPZA 1FJKA 2ZYGA 3TYYA 5BU5A 1NKNA 3GHGA 4C46A 1HJBA 1T3JA 1PL5A 4PD4I 1X8YA 2W6AA 3I55P 2A45I 1UIIA 3D71A 3L70E 4PD4D 3USSA 1S5LX 1K73Q 4XA4A 2DW3A 2ZYAA 3G4SP 1L0ND 2BCCJ 1G2CA 1QLED 1L2PA 4H44B 3AE5C 5APQA 2MKVA 3MUDC 4D6TE 3HRNA 3KHUA 2C9NY 1HH0A 1KZUB 1LTTC 4PD4H 1URQB 2FYUJ 1W2EA 2PFXA 3AEEC 3MZWB 2A06E 3A0BH 4C7RA 2OYHB 2G3AA 2M8RA 4B86A 1BSNA 3L75E 4Y99B 3CXHE 5GTHE 3Q3DA 1JTHB 3BVHA 1N73B 1BE3G 1H0TA 1Q90D 1N7LA 1OFCX 2JDIH 2KXPB 5AW0B 5BVZA 2RH0A 1J1EC 1AV1A 1EZVG 3RK3E 3H1LE 2YMYA 1SFCB 2ZVOB 4I7ZC 3WU2E 1FZEA 3Q5PA 5AVSB 3H1JD 2IPPA 4GOEA 4YPCA 5AVYB 1KYOI 3MGNA 4OVNF 4ASWA 3CCSP 1N7SA 1N86A 3AE1C 2HPCB 1SQPJ 1OVVA 2LKMA 1FJPA 3P8CE 1LTGC 2A06D 2W83C 4IOIH 2WPRA 1VF5C 2BEZF 5APTA 4C7NA 2W6BA 1X22A 2E75D 1U7MA 3CXHD 3U1AA 1L0LG 3FXEA 3IR9A 1SQQK 3MIWA 2LR2A 3L35A 3MD0A 2E42A 4EDFA 2ZT9C 4EYYQ 4BXLA 2I1KA 1LTBC 1GMJA 3M0DC 3RK3D 1Q82Q 2OTKE 4UB8E 3D6YA 1SQXJ 1NTZK 2E74D 2IYPA 2KI7B 3BRTB 1KYOH 1JO5A 4JQ0D 4OGQB 4RESB 3JCUH 1CSBA 1L4AA 1KB9H 2V4HA 2VRSA 3CX5I 3PJSK 3TDKA 1CI6B 1JMBA 2PRRA 3HE5B 3M91A 4N78D 2AXCA 3AEAC 1S9KD 3LW5J 2A06G 3M0DA 5B5EH 3G6EP 2KS1A 1N73C 4JYCA 1CZQA 1SQVE 1UIXA 1YIJP 1LTSC 3RL0C 1JOCA 3TGUD 1AJYA 1A02J 3RK3B 2FXMA 2FYNB 1NO4A 2FKWB 1KORA 3M9BA 3QWOC 4I6MC 4PV1B 4CPGA 2ZXXA 3CWBD 4H44C 3HD7B 3H1KD 3W67A 2IX7C 1LP1B 2NZ2A 3B5NA 3HE4A 1J2JB 2R32A 4H0LD 2H89C 5AW4B 2H43A 1S9KE 2J59M 1KILE 3MP7B 3WUVA 2MJZA 2YKPA 3CWBJ 1KFNA 1RF1C 2OTLP 1H89A 1FAVA 1FU1A 3R4YA 2GUSA 4K35A 5AVZB 1G2CB 2QEXP 2J5UA 4EOTA 5KJ7A 2YKOA 1RQUA 5L8RJ 1WRGA 1M1JA 2KIKA 1RF1B 1G1JA 5CCHC 1S5LE 1URQA 1L0NE 5K5GB 5CMZA 2K37A 3A3YB 1RE4C 2JWAA 3GF7A 3JSVC 4TT3H 5CCGC 1DEBA 5TJHA 3SFEC 3WU2H 3CCVP 5AVXB 2C0XA 2YXRB 4XFJA 1R5SA 1JM0A 1NU1J 1PZQA 3AE4C 3IF4A 1SQVJ 3NMDA 3WMM0 1L4AD 1KILD 1ZXGA 2E76C 2ITAA 2R5BA 2PGDA 1ZOYC 1NTKK 1Y8AA 2E76B 2IBZG 2M3EA 2QG4A 1SLQA 1N73A 2YO3A 1PGPA 3A2AA 1SQXD 1KN7A 3WUUA 2KZIA 5KLVE 1DH3A 2FFDB 1JNMA 4BRYB 2Q9IA 2LXBA 4I1LA 2Z5IA 1USDA 3HD7D 4L75A 3F89A 5GTHH 4H13B 2KSEA 3AECC 3V2RA 3CMEP 1NGMB 1YI2P 2OYIC 3H6PA 5B5EE 1YTZI 2KP8A 2OYIA 3WUTA 3H1IG 2FFDC 2Q7CA 2JP3A 4EI2A 1GTWA 2HODB 2ZFCA 2KNCA 2R3SA 1QL1A 2IFNA 2P1JA 1TU3F 4IL6X 5C39A 3V2PA 4AQRD 2N1TD 3E1IA 1X0TA 2JEEA 1NTZG 3L37A 3O8ZA 4N6JA 5KLVD 3D70A 1BSHA 2NPSA 2N1TB 2OYHC 2D2CB 1FC2C 4W7YA 4IFFA 1JY2O 1G1IA 2Z5HA 3AE2C 1P84D 2QJPC 4HB1A 2ZXEB 3BRVB 1KB9D 1L0LK 3L72D 1H8AA 1RE4A 2XZRA 1H88A 5APUA 1JY3O 1ZLLA 2W6JH 5E79H 1HVVA 5H2FE 1NWQA 1SFCC 2POHA 2WPQA 2WSSH 1AA0A 5TISE 5KKZB 3CC7P 2JJLA 2V7QJ 3PRJA 1BGYE 4WVZA 5KLVJ 3KZIH 2IZ1A 2QM8A 2KB7P 3GLMA 1HJ0A 3CL3D 3L72J 1HWTC 1SQBJ 1ZR2A 1EDKA 2YKQA 3EFGA 2QJYC 2P58A 3II6A 2WITA 3OAKA 1RF0C 5AVQB 1YQ4C 2WTYA 4GDOA 3S9OA 1EDIA 3E1RA 1NYHA 3RGUA 1KQGB 1SQBE 2P7JA 3L71J 1KB9E 1JY2N 3C9IA 3L72E 3L73G 2E5TA 3AEDC 3MUDA 4JYBA 1T8ZA 2Q5UA 3B4SA 1QGKB 3QH9A 3R2PA 4WBAA 4HH2A 3TGUE 3AE3C 4U3FJ 4UB8H 2KLUA 2E76D 2IFMA 4LGDE 3VYIA 3ITKA 3TNUA 1QL2A 2RKLA 5CCHD 1PPJE 4I7ZB 1XTCC 1LGHB 3FXDA 3H1KE 2Q1KA 4GOFA 5AVUB 3U59A 5KLIB 3CCLP 1EQ7A 1GL2A 3KYQA 1MV8A 3B5NB 1SVFA 3HE4B 1GK4A 3FX0A 3NTNA 2AEMA 1IO4A 1EXJA 3HUSA 5AVTB 3EWKA 1KILA 4R4LA 2OGUA 1GK6A 2WSFH 3GG2A 1BGYJ 4H13C 5KLVG 4XE5B 1SFCA 3L36A 4YXDC 2HPCA 1YJWP 2R5DA 1U57A 1RQVA 2GUVA 2J58A 3AE7C 2CPBA 2OARA 3MTUE 5APXA 1MKMA 1ZR4A 1DIPA 1NH4A 1EZVI 3OA7A 3S1KA 3OW2O 3U1CA 2FYUK 1BDCA 1S3JA 2XKMA 2OTJP 1PGJA 4IL6E 1KB9I 3KQGA 3VMYA 3CXHH 4OH8B 2K3RA 2H88C 2W90A 2K9JB 4PJ0E 1SQQE 2H8PD 1QEXA 2E74B 1GL2B 1JY2P 1KMIZ 2AEJA 1S4XA 1LT9C 3CLQA 1DD3A 3A0HH 3H1KG 1J1EB 1DD4A 1VQKP 1YQ3C 3V6IA 1SQXE 3JCUE 1NTZE 3IN6A 1NTMD 1IFMA 1NU1K 2CK3H 1SQVK 2P10A 2W27A 2QM7A 3RBXA 3TGUG 1CI6A 1M90Q 3CD6P 1HF9A 1E79H 2BCCG 3H1JG 5KAFE 3H1HD 3H1IJ 4WB4A 2YNYA 4D6TD 1JCCA 1SQPK 2N9YB 4KJMA 3L73J 5KLIC 3CXHI 4DCKA 5CCHA 1Q81Q 1YJ9P 3L70J 1M8OB 1OVUA 1E5WA 4GKGA 2HODA 3SWFA 3Q5SA 1SQPG 1BGYG 1EDLA 2Y0CA 4WY4B 4RKUJ 1OIPA 3HUSC 4L76A 3Q2YA 3H1HJ 2O01N 4Z1MH 3TF5A 1D7MA 3CMAP 3D6ZA 2AEFA 1VL2A 2JO1A 3N4XA 1SQVG 2FYUE 1LP1A 1FZGA 3C8VA 2WQYC 2KLVA 4A7PA 1M1JB 1X79B 4W80A 2P67A 4DT0A 1OMIA 1SQXG 1BDDA 1BGYD 1P84E 2LXCB 3H1HE 3RK2B 4OGQC 3E7KA 1IFDA 1KV4A 2ZAEB 2K9YA 1LT9B 1Y47A 3CX5D 3M06A 3RK2D 3V5BA 1FDOA 3F5HA 3G3ZA 3V4WA 1RF0A 3VMAA 4O9BA 5DJUB 5TISH 1S72P 5CHXA 2YO2A 2FXPA 4H0LB 1VQLP 1SQBD 3I5CA 2Y0DA 3IAOA 4D6TG 2YXQB 2QJKB 1NTMG 2O1KA 1L0NK 4LLHA 4AYCA 1ZRTD 3RK3C 4MN4C 3HD7C 2WSCH 2XDJA 2ZT9D 1GZLA 2I8DA 4YTPC 3M9HA 3T97B 4PV1C 4EIJA 5AW5B 1M56D 3O6QB 5AW7B 3S4RA 3SFDC 1PFIA 4DOJA 1FE6A 1MFZA 1RH5B 2OYOA 1K05A 2PP6A 2QJYB 1ZV8A 3TGUJ 4JPZB 2HR3A 4BRYA 2Y0EA 1J1DC 1T6AA 1P84I 3L71E 1KILB 1L4AB 1PPJD 2I1JA 1AVYA 2O01J 2RMZA 1VPCA 3H1JJ 1KILC 1OXZA 1MFTA 3LIEA 2WT7B 2FFDA 1DX7A 1LTIC 1SQPD 3IFMA 1J1DB 1KQSO 1ZMEC 3H32B 5EFWB 1GL2D 1NVOA 3Q5RA 3VTPC 1NTZJ 2KYVA 1LWUC 4YXWH 1VQPP 2OYIB 4KHXA 1FOSE 3L73E 2ZVNB 1JB0J 3H1HG 1X9VA 2B88A 2G8YA 2WVRA 2KSJA 4GODA 2KOGA 1VQ6P 1MUUA 3KZIE 1LWUB 1T3UA 3SWKA 1YHQP 3AEFC 2V7QH 1SQQD 4H0LC 1XTGB 2HG5D 2IDBA 2AXTH 3P8MC 1OZHA 3L71D 1IK7A 5M1BA 3H25A 3CCJP 2M3BA 4UB6H 5APVA 1OVRA 3PH0A 5CCGA 4AUWA 1NTZD 2FY8A 1AVOA 2QVAA 1ZW0A 4ZKPA 1M1KQ 2B87B 3A7OA 4ZKUA 1HUCA 1AQ5A 3CCUP 1VQNP 1S2EA 3B8EB 1DEEG 3H1LD 4H44D 3H32A 4U7JA 4H13D 3L73D 4TLFA 5DJTB 4ASVA 4RO0A 1Q7YQ 1SQBK 1BCCE 2BCCE 2FBWC 3H1JE 1IFJA 3FWLA 4DJGA 3I56P 3G71P 1NU1G 1NAFA 5APSA 5CBOA 1W2BO 3BCCG 2XNDH 5KAFH 3Q1MA 1EZVE 3RBZA 5CBNA 2CPSA 3TSIA 3K5BA 1JEKA 2C0WA 4UB6E 2KK7A 1VQ7P 2IYOA 2BEQD 1N7SC 1WMKA 3GHGB 3CPWO 3CCEP 2Q3IA 2QJKC 2ZYDA 1RE3A 4HJGH 4I2LC 2OQQA 1L0LJ 1M57D 1OW8A 2FYNC 2Y9ZA 1LJ2A 3N7NA 1LTJC 1EC5A 3CX5H 3HE5A 4PJ0H 3RL0B 2O3JA 3V4QA 2Q6QA 5KKZC 1BCCD 3TK1A 2FYZA 3KPEA 2KS1B 1VF5D 2HFED 3CX5E 1FZBA 1LTJB 1NTKJ 2K88A 3HTKA 4HKZH 2NRGA 3GMAA 4N78E 3RL0g 3CCMP 1VQ5P 1FZAA 1RHZB 2E75C 1N2DC 1PGQA 2QE7H 2XU6A 3HUSB 2WMMA 2KNCB 2QIWA 1IK9A 2WZ7A 3H1ID 3O6QA 3V2QA 1ZRTE 1YITP 2B89A 2HYNA 3HD7A 3ZDMA 5AW1B 1NTKD 2FXOA 3H1LG 1BCCJ 1LNQA 3C1LA 2ZT9B 1N7SD 1NTMJ 2Y9YA 3KXDA 4GIFA 1FS0E 3PHLA 3H1KJ 3AE6C 2NPSB 1KC8Q 3MHVA 3AEBC 1KD1Q 2QSIA 5KAIH 2N9BA 1SQXK 1FZCA 1YBKA 1AFOA 1FBMA 1GW4A 1PV3A 1Q86Q 2A45G 1PP9D 3FGAD 2D2CD 2O01H 3BCCE 3L74D 1K9MQ 2K1AA 1WT6A 3L72G 4BWNA 1JY3N 1GU4A 2A45H 3H1IE 1Z56A 2XNXA 3B5NC 1OX3A 3VP9A 3L70G 1RE3C 5AW2B 1JCDA 4U3FD 2UWJE 2WPVB 4WY4A 3NXSA 4N3YB 4HYTB 5B66H 1A02F 1YYCA 1LWUA 2RN0A 2WPSA 4IL6H 2BASA 1VQ8P 3LIDA 1HGZA 3B71A 2WSEJ 3SSUA 5CJ4A 5AVWB 1YJNP 1SQPE 2R3CA 3AEGC 4Y28J 1SQQJ 4ZNCA 2PAJA 4WY4D 5KJ7C 5KLVK 1PP9E 4OWFA 3OJAB 2E75B 4IFMA 1URQC 1U7JA 2IZ0A 2E5YA 2GA1A 1CW5A 3A0BE 5AW9B 1Q2NA 1PIXA 1L0LD 1KTMA 1NTKG 1L4AC 4PD4E 2WSFJ
chains in the Genus database with same CATH topology
2IBZI 3CWBJ 3L74J 3CX5I 1BE3J 5KLVJ 1P84I 3L75J 3H1JJ 4PD4I 1NTKJ 3L72J 1SQBJ 1KYOI 4D6TJ 3H1IJ 1SQPJ 1BGYJ 3L73J 1NTZJ 2BCCJ 3CXHI 3L70J 3L71J 1NU1J 1SQVJ 1L0NJ 1EZVI 1BCCJ 1SQQJ 2FYUJ 1NTMJ 3H1HJ 3H1KJ 1KB9I 3BCCJ 4U3FJ 1PP9J 3H1LJ 1L0LJ 1SQXJ 3TGUJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IBZ I;  3CWB J;  3L74 J;  3CX5 I;  1BE3 J;  5KLV J;  1P84 I;  3L75 J;  3H1J J;  4PD4 I;  1NTK J;  3L72 J;  1SQB J;  1KYO I;  4D6T J;  3H1I J;  1SQP J;  1BGY J;  3L73 J;  1NTZ J;  2BCC J;  3CXH I;  3L70 J;  3L71 J;  1NU1 J;  1SQV J;  1L0N J;  1EZV I;  1BCC J;  1SQQ J;  2FYU J;  1NTM J;  3H1H J;  3H1K J;  1KB9 I;  3BCC J;  4U3F J;  1PP9 J;  3H1L J;  1L0L J;  1SQX J;  3TGU J; 
#chains in the Genus database with same CATH topology
 1IFN A;  4U3F E;  2NPS D;  1S1C X;  1BE3 J;  3G9R A;  3L75 J;  2E74 C;  2YIU B;  3UIA A;  3P32 A;  1LTA C;  1FDM A;  1LT1 A;  1NKZ B;  2YIU C;  4R4M A;  1IFI A;  2L91 A;  1HGV A;  4WWI A;  4K3A A;  1KQF B;  5CJ0 A;  5AW3 B;  3NFQ A;  5KTB A;  1FZC C;  1VDF A;  4NPE A;  1K8A Q;  3CCQ P;  1IZN B;  4M3L A;  1EZV D;  2WSC J;  3JC2 2;  3PP5 A;  2E43 A;  1LT9 A;  3L75 D;  1RY3 A;  3VMX A;  3AE9 C;  1JUN A;  3BAT A;  3EFF K;  1H0T B;  1L0N J;  2BCC D;  2O1J A;  5AVV B;  1L0L E;  1URQ D;  1W5C E;  1PP9 G;  1BE3 D;  1VF5 B;  2JR8 A;  1M7L A;  4PV1 D;  2L5G B;  3CCR P;  1JMM A;  4WY4 C;  1GW3 A;  5KJ7 D;  2B9B A;  1GDT A;  2WWW A;  1HBW A;  3GF3 A;  1JY3 P;  3PLN A;  1LTJ A;  3VP8 A;  1RF1 A;  3GW6 A;  1JTH A;  3M9Q A;  2K9J A;  1QX8 A;  4ZMD A;  1YTZ T;  1SFC D;  1NTM E;  3EQ2 A;  2QA4 P;  1QVF O;  1PGO A;  2OYH A;  1FDI A;  3HTK B;  3KDP B;  5APW A;  2IBZ E;  3RL0 D;  3B5N D;  1M1J C;  1OWA A;  3RK2 C;  5AW8 B;  1VQM P;  3CWB G;  4OGQ D;  3L75 G;  5B66 E;  3CC4 P;  1R5L A;  4IFD K;  2Q3E A;  2R44 A;  3PTZ A;  2HLO A;  5E79 E;  1BE3 E;  2D2C C;  5H2F H;  2Z4E A;  1SS1 A;  2W8Z A;  2JWD A;  2M0B A;  3L4F A;  3VN0 A;  1SQB G;  1NTK E;  4Y99 C;  3P8C D;  2N1T C;  2QJP B;  1GD2 E;  1S5L H;  2ZJS E;  2WT7 A;  1N7S B;  3GHG C;  2KUB A;  3L71 G;  5APY A;  3AE8 C;  1VQO P;  4RJT A;  2QRX A;  3BCC J;  3TNU B;  1FZC B;  1NHL A;  2FYU D;  1MZ9 A;  2B87 A;  5KAI E;  1NJI Q;  1VQ9 P;  1PP9 J;  3LW5 H;  4C7N B;  4W7Z A;  4L74 A;  2IBZ D;  2FYU G;  3L74 G;  3VOP A;  3L74 E;  5BU8 B;  4KT0 J;  4JF7 A;  1NOH A;  2M5A B;  4DZO A;  1NAY A;  2IBZ I;  3L74 J;  4NPF X;  5GTI H;  1SP4 A;  1R8E A;  1SQV D;  1FZF A;  3CI9 A;  4LC1 A;  1IC2 A;  1KYO D;  3P7K A;  4GT1 A;  3SWY A;  1VQ4 P;  2C9L Y;  1NTM K;  1NU1 D;  3ABV C;  2AXT E;  2YMK A;  4D6T J;  3BCC D;  1GU5 A;  1IJD B;  1USE A;  1ZP0 C;  2JKV A;  1IFP A;  1FOS F;  1L0N G;  1PPJ G;  3A0H E;  1T2K C;  1K04 A;  2XV5 A;  3VMZ A;  1AQT A;  5AVR B;  3W68 A;  1GL2 C;  1N8R Q;  4NPD A;  3M0A A;  1Y9B A;  4U3F G;  1P84 H;  2NPS C;  1OW6 A;  3L70 D;  1EXI A;  3V2N A;  3CC2 P;  1KFM A;  4L73 A;  2WSE H;  4JBZ A;  1KQL A;  5CCG D;  1T2K D;  5AW6 B;  4QMA A;  3CWB E;  1QVG O;  2H7H A;  2GM4 A;  3FWN A;  3T97 A;  3H1L J;  5GTI E;  1OW7 A;  1BCC G;  1SQQ G;  2M5A A;  1ZN5 A;  2KZJ A;  2P2U A;  1KYO E;  3BAS A;  3A5T A;  1EDJ A;  1NU1 E;  1HTL C;  2N1T A;  2SPZ A;  1FJK A;  2ZYG A;  3TYY A;  5BU5 A;  1NKN A;  3GHG A;  4C46 A;  1HJB A;  1T3J A;  1PL5 A;  4PD4 I;  1X8Y A;  2W6A A;  3I55 P;  2A45 I;  1UII A;  3D71 A;  3L70 E;  4PD4 D;  3USS A;  1S5L X;  1K73 Q;  4XA4 A;  2DW3 A;  2ZYA A;  3G4S P;  1L0N D;  2BCC J;  1G2C A;  1QLE D;  1L2P A;  4H44 B;  3AE5 C;  5APQ A;  2MKV A;  3MUD C;  4D6T E;  3HRN A;  3KHU A;  2C9N Y;  1HH0 A;  1KZU B;  1LTT C;  4PD4 H;  1URQ B;  2FYU J;  1W2E A;  2PFX A;  3AEE C;  3MZW B;  2A06 E;  3A0B H;  4C7R A;  2OYH B;  2G3A A;  2M8R A;  4B86 A;  1BSN A;  3L75 E;  4Y99 B;  3CXH E;  5GTH E;  3Q3D A;  1JTH B;  3BVH A;  1N73 B;  1BE3 G;  1H0T A;  1Q90 D;  1N7L A;  1OFC X;  2JDI H;  2KXP B;  5AW0 B;  5BVZ A;  2RH0 A;  1J1E C;  1AV1 A;  1EZV G;  3RK3 E;  3H1L E;  2YMY A;  1SFC B;  2ZVO B;  4I7Z C;  3WU2 E;  1FZE A;  3Q5P A;  5AVS B;  3H1J D;  2IPP A;  4GOE A;  4YPC A;  5AVY B;  1KYO I;  3MGN A;  4OVN F;  4ASW A;  3CCS P;  1N7S A;  1N86 A;  3AE1 C;  2HPC B;  1SQP J;  1OVV A;  2LKM A;  1FJP A;  3P8C E;  1LTG C;  2A06 D;  2W83 C;  4IOI H;  2WPR A;  1VF5 C;  2BEZ F;  5APT A;  4C7N A;  2W6B A;  1X22 A;  2E75 D;  1U7M A;  3CXH D;  3U1A A;  1L0L G;  3FXE A;  3IR9 A;  1SQQ K;  3MIW A;  2LR2 A;  3L35 A;  3MD0 A;  2E42 A;  4EDF A;  2ZT9 C;  4EYY Q;  4BXL A;  2I1K A;  1LTB C;  1GMJ A;  3M0D C;  3RK3 D;  1Q82 Q;  2OTK E;  4UB8 E;  3D6Y A;  1SQX J;  1NTZ K;  2E74 D;  2IYP A;  2KI7 B;  3BRT B;  1KYO H;  1JO5 A;  4JQ0 D;  4OGQ B;  4RES B;  3JCU H;  1CSB A;  1L4A A;  1KB9 H;  2V4H A;  2VRS A;  3CX5 I;  3PJS K;  3TDK A;  1CI6 B;  1JMB A;  2PRR A;  3HE5 B;  3M91 A;  4N78 D;  2AXC A;  3AEA C;  1S9K D;  3LW5 J;  2A06 G;  3M0D A;  5B5E H;  3G6E P;  2KS1 A;  1N73 C;  4JYC A;  1CZQ A;  1SQV E;  1UIX A;  1YIJ P;  1LTS C;  3RL0 C;  1JOC A;  3TGU D;  1AJY A;  1A02 J;  3RK3 B;  2FXM A;  2FYN B;  1NO4 A;  2FKW B;  1KOR A;  3M9B A;  3QWO C;  4I6M C;  4PV1 B;  4CPG A;  2ZXX A;  3CWB D;  4H44 C;  3HD7 B;  3H1K D;  3W67 A;  2IX7 C;  1LP1 B;  2NZ2 A;  3B5N A;  3HE4 A;  1J2J B;  2R32 A;  4H0L D;  2H89 C;  5AW4 B;  2H43 A;  1S9K E;  2J59 M;  1KIL E;  3MP7 B;  3WUV A;  2MJZ A;  2YKP A;  3CWB J;  1KFN A;  1RF1 C;  2OTL P;  1H89 A;  1FAV A;  1FU1 A;  3R4Y A;  2GUS A;  4K35 A;  5AVZ B;  1G2C B;  2QEX P;  2J5U A;  4EOT A;  5KJ7 A;  2YKO A;  1RQU A;  5L8R J;  1WRG A;  1M1J A;  2KIK A;  1RF1 B;  1G1J A;  5CCH C;  1S5L E;  1URQ A;  1L0N E;  5K5G B;  5CMZ A;  2K37 A;  3A3Y B;  1RE4 C;  2JWA A;  3GF7 A;  3JSV C;  4TT3 H;  5CCG C;  1DEB A;  5TJH A;  3SFE C;  3WU2 H;  3CCV P;  5AVX B;  2C0X A;  2YXR B;  4XFJ A;  1R5S A;  1JM0 A;  1NU1 J;  1PZQ A;  3AE4 C;  3IF4 A;  1SQV J;  3NMD A;  3WMM 0;  1L4A D;  1KIL D;  1ZXG A;  2E76 C;  2ITA A;  2R5B A;  2PGD A;  1ZOY C;  1NTK K;  1Y8A A;  2E76 B;  2IBZ G;  2M3E A;  2QG4 A;  1SLQ A;  1N73 A;  2YO3 A;  1PGP A;  3A2A A;  1SQX D;  1KN7 A;  3WUU A;  2KZI A;  5KLV E;  1DH3 A;  2FFD B;  1JNM A;  4BRY B;  2Q9I A;  2LXB A;  4I1L A;  2Z5I A;  1USD A;  3HD7 D;  4L75 A;  3F89 A;  5GTH H;  4H13 B;  2KSE A;  3AEC C;  3V2R A;  3CME P;  1NGM B;  1YI2 P;  2OYI C;  3H6P A;  5B5E E;  1YTZ I;  2KP8 A;  2OYI A;  3WUT A;  3H1I G;  2FFD C;  2Q7C A;  2JP3 A;  4EI2 A;  1GTW A;  2HOD B;  2ZFC A;  2KNC A;  2R3S A;  1QL1 A;  2IFN A;  2P1J A;  1TU3 F;  4IL6 X;  5C39 A;  3V2P A;  4AQR D;  2N1T D;  3E1I A;  1X0T A;  2JEE A;  1NTZ G;  3L37 A;  3O8Z A;  4N6J A;  5KLV D;  3D70 A;  1BSH A;  2NPS A;  2N1T B;  2OYH C;  2D2C B;  1FC2 C;  4W7Y A;  4IFF A;  1JY2 O;  1G1I A;  2Z5H A;  3AE2 C;  1P84 D;  2QJP C;  4HB1 A;  2ZXE B;  3BRV B;  1KB9 D;  1L0L K;  3L72 D;  1H8A A;  1RE4 A;  2XZR A;  1H88 A;  5APU A;  1JY3 O;  1ZLL A;  2W6J H;  5E79 H;  1HVV A;  5H2F E;  1NWQ A;  1SFC C;  2POH A;  2WPQ A;  2WSS H;  1AA0 A;  5TIS E;  5KKZ B;  3CC7 P;  2JJL A;  2V7Q J;  3PRJ A;  1BGY E;  4WVZ A;  5KLV J;  3KZI H;  2IZ1 A;  2QM8 A;  2KB7 P;  3GLM A;  1HJ0 A;  3CL3 D;  3L72 J;  1HWT C;  1SQB J;  1ZR2 A;  1EDK A;  2YKQ A;  3EFG A;  2QJY C;  2P58 A;  3II6 A;  2WIT A;  3OAK A;  1RF0 C;  5AVQ B;  1YQ4 C;  2WTY A;  4GDO A;  3S9O A;  1EDI A;  3E1R A;  1NYH A;  3RGU A;  1KQG B;  1SQB E;  2P7J A;  3L71 J;  1KB9 E;  1JY2 N;  3C9I A;  3L72 E;  3L73 G;  2E5T A;  3AED C;  3MUD A;  4JYB A;  1T8Z A;  2Q5U A;  3B4S A;  1QGK B;  3QH9 A;  3R2P A;  4WBA A;  4HH2 A;  3TGU E;  3AE3 C;  4U3F J;  4UB8 H;  2KLU A;  2E76 D;  2IFM A;  4LGD E;  3VYI A;  3ITK A;  3TNU A;  1QL2 A;  2RKL A;  5CCH D;  1PPJ E;  4I7Z B;  1XTC C;  1LGH B;  3FXD A;  3H1K E;  2Q1K A;  4GOF A;  5AVU B;  3U59 A;  5KLI B;  3CCL P;  1EQ7 A;  1GL2 A;  3KYQ A;  1MV8 A;  3B5N B;  1SVF A;  3HE4 B;  1GK4 A;  3FX0 A;  3NTN A;  2AEM A;  1IO4 A;  1EXJ A;  3HUS A;  5AVT B;  3EWK A;  1KIL A;  4R4L A;  2OGU A;  1GK6 A;  2WSF H;  3GG2 A;  1BGY J;  4H13 C;  5KLV G;  4XE5 B;  1SFC A;  3L36 A;  4YXD C;  2HPC A;  1YJW P;  2R5D A;  1U57 A;  1RQV A;  2GUV A;  2J58 A;  3AE7 C;  2CPB A;  2OAR A;  3MTU E;  5APX A;  1MKM A;  1ZR4 A;  1DIP A;  1NH4 A;  1EZV I;  3OA7 A;  3S1K A;  3OW2 O;  3U1C A;  2FYU K;  1BDC A;  1S3J A;  2XKM A;  2OTJ P;  1PGJ A;  4IL6 E;  1KB9 I;  3KQG A;  3VMY A;  3CXH H;  4OH8 B;  2K3R A;  2H88 C;  2W90 A;  2K9J B;  4PJ0 E;  1SQQ E;  2H8P D;  1QEX A;  2E74 B;  1GL2 B;  1JY2 P;  1KMI Z;  2AEJ A;  1S4X A;  1LT9 C;  3CLQ A;  1DD3 A;  3A0H H;  3H1K G;  1J1E B;  1DD4 A;  1VQK P;  1YQ3 C;  3V6I A;  1SQX E;  3JCU E;  1NTZ E;  3IN6 A;  1NTM D;  1IFM A;  1NU1 K;  2CK3 H;  1SQV K;  2P10 A;  2W27 A;  2QM7 A;  3RBX A;  3TGU G;  1CI6 A;  1M90 Q;  3CD6 P;  1HF9 A;  1E79 H;  2BCC G;  3H1J G;  5KAF E;  3H1H D;  3H1I J;  4WB4 A;  2YNY A;  4D6T D;  1JCC A;  1SQP K;  2N9Y B;  4KJM A;  3L73 J;  5KLI C;  3CXH I;  4DCK A;  5CCH A;  1Q81 Q;  1YJ9 P;  3L70 J;  1M8O B;  1OVU A;  1E5W A;  4GKG A;  2HOD A;  3SWF A;  3Q5S A;  1SQP G;  1BGY G;  1EDL A;  2Y0C A;  4WY4 B;  4RKU J;  1OIP A;  3HUS C;  4L76 A;  3Q2Y A;  3H1H J;  2O01 N;  4Z1M H;  3TF5 A;  1D7M A;  3CMA P;  3D6Z A;  2AEF A;  1VL2 A;  2JO1 A;  3N4X A;  1SQV G;  2FYU E;  1LP1 A;  1FZG A;  3C8V A;  2WQY C;  2KLV A;  4A7P A;  1M1J B;  1X79 B;  4W80 A;  2P67 A;  4DT0 A;  1OMI A;  1SQX G;  1BDD A;  1BGY D;  1P84 E;  2LXC B;  3H1H E;  3RK2 B;  4OGQ C;  3E7K A;  1IFD A;  1KV4 A;  2ZAE B;  2K9Y A;  1LT9 B;  1Y47 A;  3CX5 D;  3M06 A;  3RK2 D;  3V5B A;  1FDO A;  3F5H A;  3G3Z A;  3V4W A;  1RF0 A;  3VMA A;  4O9B A;  5DJU B;  5TIS H;  1S72 P;  5CHX A;  2YO2 A;  2FXP A;  4H0L B;  1VQL P;  1SQB D;  3I5C A;  2Y0D A;  3IAO A;  4D6T G;  2YXQ B;  2QJK B;  1NTM G;  2O1K A;  1L0N K;  4LLH A;  4AYC A;  1ZRT D;  3RK3 C;  4MN4 C;  3HD7 C;  2WSC H;  2XDJ A;  2ZT9 D;  1GZL A;  2I8D A;  4YTP C;  3M9H A;  3T97 B;  4PV1 C;  4EIJ A;  5AW5 B;  1M56 D;  3O6Q B;  5AW7 B;  3S4R A;  3SFD C;  1PFI A;  4DOJ A;  1FE6 A;  1MFZ A;  1RH5 B;  2OYO A;  1K05 A;  2PP6 A;  2QJY B;  1ZV8 A;  3TGU J;  4JPZ B;  2HR3 A;  4BRY A;  2Y0E A;  1J1D C;  1T6A A;  1P84 I;  3L71 E;  1KIL B;  1L4A B;  1PPJ D;  2I1J A;  1AVY A;  2O01 J;  2RMZ A;  1VPC A;  3H1J J;  1KIL C;  1OXZ A;  1MFT A;  3LIE A;  2WT7 B;  2FFD A;  1DX7 A;  1LTI C;  1SQP D;  3IFM A;  1J1D B;  1KQS O;  1ZME C;  3H32 B;  5EFW B;  1GL2 D;  1NVO A;  3Q5R A;  3VTP C;  1NTZ J;  2KYV A;  1LWU C;  4YXW H;  1VQP P;  2OYI B;  4KHX A;  1FOS E;  3L73 E;  2ZVN B;  1JB0 J;  3H1H G;  1X9V A;  2B88 A;  2G8Y A;  2WVR A;  2KSJ A;  4GOD A;  2KOG A;  1VQ6 P;  1MUU A;  3KZI E;  1LWU B;  1T3U A;  3SWK A;  1YHQ P;  3AEF C;  2V7Q H;  1SQQ D;  4H0L C;  1XTG B;  2HG5 D;  2IDB A;  2AXT H;  3P8M C;  1OZH A;  3L71 D;  1IK7 A;  5M1B A;  3H25 A;  3CCJ P;  2M3B A;  4UB6 H;  5APV A;  1OVR A;  3PH0 A;  5CCG A;  4AUW A;  1NTZ D;  2FY8 A;  1AVO A;  2QVA A;  1ZW0 A;  4ZKP A;  1M1K Q;  2B87 B;  3A7O A;  4ZKU A;  1HUC A;  1AQ5 A;  3CCU P;  1VQN P;  1S2E A;  3B8E B;  1DEE G;  3H1L D;  4H44 D;  3H32 A;  4U7J A;  4H13 D;  3L73 D;  4TLF A;  5DJT B;  4ASV A;  4RO0 A;  1Q7Y Q;  1SQB K;  1BCC E;  2BCC E;  2FBW C;  3H1J E;  1IFJ A;  3FWL A;  4DJG A;  3I56 P;  3G71 P;  1NU1 G;  1NAF A;  5APS A;  5CBO A;  1W2B O;  3BCC G;  2XND H;  5KAF H;  3Q1M A;  1EZV E;  3RBZ A;  5CBN A;  2CPS A;  3TSI A;  3K5B A;  1JEK A;  2C0W A;  4UB6 E;  2KK7 A;  1VQ7 P;  2IYO A;  2BEQ D;  1N7S C;  1WMK A;  3GHG B;  3CPW O;  3CCE P;  2Q3I A;  2QJK C;  2ZYD A;  1RE3 A;  4HJG H;  4I2L C;  2OQQ A;  1L0L J;  1M57 D;  1OW8 A;  2FYN C;  2Y9Z A;  1LJ2 A;  3N7N A;  1LTJ C;  1EC5 A;  3CX5 H;  3HE5 A;  4PJ0 H;  3RL0 B;  2O3J A;  3V4Q A;  2Q6Q A;  5KKZ C;  1BCC D;  3TK1 A;  2FYZ A;  3KPE A;  2KS1 B;  1VF5 D;  2HFE D;  3CX5 E;  1FZB A;  1LTJ B;  1NTK J;  2K88 A;  3HTK A;  4HKZ H;  2NRG A;  3GMA A;  4N78 E;  3RL0 g;  3CCM P;  1VQ5 P;  1FZA A;  1RHZ B;  2E75 C;  1N2D C;  1PGQ A;  2QE7 H;  2XU6 A;  3HUS B;  2WMM A;  2KNC B;  2QIW A;  1IK9 A;  2WZ7 A;  3H1I D;  3O6Q A;  3V2Q A;  1ZRT E;  1YIT P;  2B89 A;  2HYN A;  3HD7 A;  3ZDM A;  5AW1 B;  1NTK D;  2FXO A;  3H1L G;  1BCC J;  1LNQ A;  3C1L A;  2ZT9 B;  1N7S D;  1NTM J;  2Y9Y A;  3KXD A;  4GIF A;  1FS0 E;  3PHL A;  3H1K J;  3AE6 C;  2NPS B;  1KC8 Q;  3MHV A;  3AEB C;  1KD1 Q;  2QSI A;  5KAI H;  2N9B A;  1SQX K;  1FZC A;  1YBK A;  1AFO A;  1FBM A;  1GW4 A;  1PV3 A;  1Q86 Q;  2A45 G;  1PP9 D;  3FGA D;  2D2C D;  2O01 H;  3BCC E;  3L74 D;  1K9M Q;  2K1A A;  1WT6 A;  3L72 G;  4BWN A;  1JY3 N;  1GU4 A;  2A45 H;  3H1I E;  1Z56 A;  2XNX A;  3B5N C;  1OX3 A;  3VP9 A;  3L70 G;  1RE3 C;  5AW2 B;  1JCD A;  4U3F D;  2UWJ E;  2WPV B;  4WY4 A;  3NXS A;  4N3Y B;  4HYT B;  5B66 H;  1A02 F;  1YYC A;  1LWU A;  2RN0 A;  2WPS A;  4IL6 H;  2BAS A;  1VQ8 P;  3LID A;  1HGZ A;  3B71 A;  2WSE J;  3SSU A;  5CJ4 A;  5AVW B;  1YJN P;  1SQP E;  2R3C A;  3AEG C;  4Y28 J;  1SQQ J;  4ZNC A;  2PAJ A;  4WY4 D;  5KJ7 C;  5KLV K;  1PP9 E;  4OWF A;  3OJA B;  2E75 B;  4IFM A;  1URQ C;  1U7J A;  2IZ0 A;  2E5Y A;  2GA1 A;  1CW5 A;  3A0B E;  5AW9 B;  1Q2N A;  1PIX A;  1L0L D;  1KTM A;  1NTK G;  1L4A C;  4PD4 E;  2WSF J; 
#chains in the Genus database with same CATH homology
 2IBZ I;  3CWB J;  3L74 J;  3CX5 I;  1BE3 J;  5KLV J;  1P84 I;  3L75 J;  3H1J J;  4PD4 I;  1NTK J;  3L72 J;  1SQB J;  1KYO I;  4D6T J;  3H1I J;  1SQP J;  1BGY J;  3L73 J;  1NTZ J;  2BCC J;  3CXH I;  3L70 J;  3L71 J;  1NU1 J;  1SQV J;  1L0N J;  1EZV I;  1BCC J;  1SQQ J;  2FYU J;  1NTM J;  3H1H J;  3H1K J;  1KB9 I;  3BCC J;  4U3F J;  1PP9 J;  3H1L J;  1L0L J;  1SQX J;  3TGU J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...