1NU1J

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
b'VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 19
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1nu1J00
1NTMJ 1BCCJ 1KYOI 1L0NJ 3H1LJ 3CXHI 3L71J 3CWBJ 3L72J 3L73J 1P84I 3TGUJ 5KLVJ 4U3FJ 3BCCJ 1NU1J 1BGYJ 2FYUJ 1L0LJ 3H1JJ 1KB9I 3L75J 4PD4I 3H1IJ 1NTZJ 1SQXJ 3CX5I 3L74J 3H1KJ 1SQPJ 3L70J 1SQVJ 1NTKJ 2BCCJ 1BE3J 1PP9J 2IBZI 1SQBJ 3H1HJ 1SQQJ 4D6TJ 1EZVI
chains in the Genus database with same CATH superfamily
3CCLP 3CCSP 1BGYD 2P58A 3Q1MA 2HPCA 4PJ0E 1MV8A 2FXMA 3BCCG 1AQTA 5B66E 2QJKC 3L75J 2MKVA 3KYQA 3VP9A 2KSEA 1HTLC 5APUA 1GD2E 3B5NC 3WUVA 1NU1K 5KLIC 2XDJA 1LWUC 3HRNA 2FBWC 3L73E 3U59A 1IFDA 5KJ7A 2BEQD 4L73A 1KYOE 4BWNA 3IFMA 2ZFCA 1JY2O 4C7RA 1YJWP 2P67A 3FWNA 2KYVA 3MUDC 1JCDA 3SSUA 3E1RA 3VTPC 4ZKUA 2J58A 2CK3H 1ZN5A 3CCEP 2IBZE 1NTZG 3GHGA 5APXA 1OVVA 1JY3O 1R5SA 1GDTA 4H0LC 1RF0A 3CCJP 4Y99C 3M06A 3L72D 2E74D 3USSA 3O8ZA 5AVQB 2QJYB 4LLHA 2ZJSE 2FKWB 4BXLA 2Q7CA 1N7SC 1AVYA 1NU1E 1JCCA 3CCRP 1JTHB 2Y0EA 2YO3A 2YIUC 2JEEA 1JMMA 1BDDA 3NFQA 1M57D 5AW3B 4A7PA 4Z1MH 2FYUJ 4XFJA 3CXHH 3TNUA 1N73B 1DD3A 1SQVK 2Q1KA 4BRYA 3BASA 4TLFA 3Q5RA 1G2CA 1ZRTD 1S72P 2IPPA 5AW7B 1VQMP 1QGKB 3L71J 2OYHB 3L73J 3TGUJ 1NHLA 1IK9A 3PRJA 2I8DA 1YTZT 3CCQP 1HJ0A 3RBXA 4I7ZB 1YQ3C 2IYOA 1VQPP 3V4QA 2A06G 1ZLLA 3C8VA 3CWBG 2Y0DA 4HJGH 3H1JJ 4H44B 4K35A 2ZVNB 2M0BA 1JY2N 2WT7B 4OWFA 4JF7A 3CCVP 3CX5D 1FZCB 3M91A 2N1TD 1OIPA 1X9VA 3P7KA 3M0DA 1ZR2A 3SWFA 5TJHA 1PGOA 1DIPA 1YBKA 2IZ0A 2JR8A 2QIWA 5APSA 1SFCA 4I2LC 3RK3C 4R4LA 3I55P 1SQXJ 1JY3N 2WSSH 3EQ2A 1WRGA 2QVAA 4UB8H 3BRTB 1H0TB 3V6IA 2H43A 2FYUD 3L4FA 1LTIC 1ZXGA 1HJBA 4GOFA 3HE4A 2BEZF 3HE5B 1KB9I 2QG4A 3L74G 4U3FE 3VYIA 1FDOA 3LIDA 1KILD 2O01N 3KPEA 5DJTB 1SQBG 2V7QH 1SQQG 3L71D 2Y0CA 1VQ8P 3L73D 2M3BA 2E42A 1GL2A 4I6MC 1T8ZA 2R44A 2WQYC 1H8AA 3I56P 3D70A 1IFMA 1KYOD 1L0LG 2RH0A 4WY4D 1R8EA 2NPSB 1NAFA 5CCGC 3AE7C 1IFJA 2QM8A 1JOCA 2ZAEB 3H1HG 1KORA 2IBZD 1KQLA 2KLVA 3H1JD 3GF3A 1FZAA 1DX7A 1VPCA 1URQC 3HD7D 1SQVJ 4KT0J 3RK2C 2Z5IA 3WMM0 4YXWH 3B71A 1YJ9P 1LTBC 2AEJA 1PGPA 1QEXA 1PIXA 1NU1D 5AW8B 5KAIE 1EZVD 5APQA 3G71P 3JCUH 1SQXD 1ZW0A 3R4YA 3M9HA 2KLUA 2ZVOB 4D6TJ 3E7KA 2WPVB 4OGQD 5AW0B 1BCCJ 3H1LJ 4JYBA 1Q90D 2N9YB 3B8EB 1GU4A 3S1KA 3FGAD 3V2RA 2R3CA 4JBZA 3V2PA 5M1BA 2FXOA 2IFMA 2OYIC 4H13C 1M1KQ 3RK3E 1UIIA 1N7LA 3AEEC 3AE4C 1NTMK 2QJKB 2A45H 1VQOP 2KOGA 5L8RJ 2A45G 1FOSF 1JMBA 2AEMA 1L4AC 1BGYE 5KLIB 3B5ND 2JDIH 1JEKA 1L0NK 2WZ7A 1N2DC 4LC1A 2M5AB 2K9YA 3T97B 4YPCA 1FJKA 2E76B 2WPQA 1SQVD 3A0HE 4IL6E 1FZBA 1NTKG 2RMZA 1HGZA 3VP8A 3L70E 1JTHA 4GODA 1QVGO 4JYCA 4DOJA 2OTKE 2OARA 1NTME 1Y47A 4Y99B 2D2CB 4RO0A 4H0LD 3PJSK 3N4XA 1VF5C 2HYNA 2QE7H 1N73A 4D6TD 4PD4D 2W6AA 5CCHA 3CMEP 3WU2H 1PP9G 3H1LD 2DW3A 4CPGA 5H2FE 1LTJB 1N7SD 4HKZH 2W27A 2PP6A 1G1JA 2OYHA 2J5UA 3L72E 3CX5I 2KB7P 2C9NY 1SQPG 2XV5A 3TK1A 2V4HA 4PV1D 3WUUA 1RE4A 5AW2B 2FYZA 1KILC 1YI2P 4DJGA 1AJYA 2FFDB 1WMKA 2AXTE 4TT3H 1VQNP 4M3LA 1DD4A 1RE3C 3RGUA 2P10A 5BU8B 3L75E 1NAYA 1OVUA 2WT7A 1AQ5A 1FZCA 1RQUA 2PAJA 4U3FG 1ZRTE 2WSEJ 1SFCD 3QWOC 2W6JH 1M1JC 1M8OB 1K05A 1TU3F 1MZ9A 3L70J 2BCCJ 2WSCJ 3AE1C 1KMIZ 1KYOI 1YITP 1PPJE 1E79H 1H0TA 2FYUK 1CW5A 1BSNA 2RKLA 4EIJA 2IFNA 3IR9A 4W7YA 1S9KE 4ASWA 3G6EP 2E75C 2IBZI 3KZIE 1AA0A 4I1LA 1KZUB 2JKVA 4EYYQ 1L0NJ 3RK3D 1FDIA 4NPFX 4XA4A 2H89C 2E5YA 1X0TA 4JPZB 2ZT9B 2A45I 3AE3C 2NPSA 2YXRB 4LGDE 3PP5A 2CPBA 5KJ7C 4C7NB 1LT9B 3HUSC 3AEDC 3SFEC 3OAKA 1FC2C 1UIXA 1P84D 3SFDC 2FYUE 3UIAA 1KB9H 3GHGC 3A2AA 1Q86Q 1VQ6P 1YTZI 1RF0C 2WWWA 3FX0A 3LW5H 2KIKA 1KILE 3I5CA 5CCGD 3L71E 1SQXK 3L70D 2BCCD 3TGUE 1U57A 3GW6A 1IFIA 5APYA 2P7JA 1NTMD 2WITA 1J1EB 1W5CE 1SLQA 5E79E 1CSBA 2IYPA 1H89A 1MKMA 1URQD 4XE5B 2K9JB 1BGYG 2W6BA 3RK2D 2C0WA 2JWAA 1K8AQ 3H1JE 1FDMA 2YKOA 3BATA 1L0ND 4GDOA 2E74B 1K73Q 1GZLA 1EXIA 5KLVJ 2KS1B 1K9MQ 4HYTB 3Q3DA 5CBOA 5DJUB 1GU5A 2R5DA 4WVZA 1W2EA 1EZVE 1SQBJ 1SQQJ 1SQXE 4EDFA 3B4SA 5GTHE 2V7QJ 2OQQA 2Z5HA 4PV1C 1S5LH 2M5AA 4UB6E 3CC4P 3L75D 4H13D 1N86A 1N8RQ 3C9IA 2L91A 2YMYA 3ZDMA 2ZYDA 2WSFH 2JP3A 2XKMA 5AVTB 5CHXA 1T3JA 3H1HJ 3H1KE 1OXZA 1LTSC 2HFED 2ZYGA 3L72G 1L4AD 3U1AA 2ITAA 3M0AA 1JM0A 2LXBA 5APVA 3M0DC 1FZEA 3S4RA 1PPJD 3AE5C 2NRGA 1SFCC 1GK6A 1OFCX 3VMZA 1A02J 3CCMP 1DEEG 1OZHA 5APTA 2O1JA 2HR3A 3PLNA 5AVRB 1S9KD 3CC7P 1LTTC 2XNXA 1LTJA 2Y9ZA 5KKZB 2WPRA 3A0BH 3AEAC 2N1TB 1SQVE 5KLVD 2VRSA 3K5BA 1VF5D 1GL2C 2FFDA 2Z4EA 1QL2A 3LIEA 4W7ZA 2WPSA 1VL2A 2FYNC 1LP1B 4D6TE 4PD4E 1L2PA 1BCCE 1J1DB 3H1LE 3A5TA 5AVZB 2KP8A 1QL1A 2HODB 3NMDA 2W83C 1YIJP 2B87B 3H1KJ 2C0XA 1NJIQ 3CX5H 1RF1C 1NKNA 3TGUD 3H6PA 3SWKA 1AVOA 1Q7YQ 4WY4B 1BDCA 1HVVA 2H8PD 1FJPA 1MFZA 1K04A 1KTMA 3RBZA 3MZWB 4PJ0H 3H1IE 3CI9A 5B66H 4ZNCA 3AE2C 1QVFO 1GW3A 2XU6A 2OTLP 1LT1A 1Y8AA 4IFDK 1PGJA 3PH0A 5TISE 2QM7A 2FYUG 3KDPB 3A3YB 1T2KD 3HD7B 3CC2P 3ITKA 1YHQP 1PP9J 4WBAA 3BRVB 3MIWA 3PHLA 1OMIA 1EDKA 2B88A 3L35A 1Y9BA 2XNDH 3L71G 4C7NA 4ZMDA 3L73G 4C46A 2Q3EA 1PL5A 2R32A 1LT9A 1KYOH 1IFPA 2E75D 5BU5A 3MD0A 1RY3A 1SP4A 2SPZA 3TF5A 4GKGA 4OGQB 2QJPC 3EWKA 3MHVA 2GA1A 3V2NA 2FXPA 5C39A 2IBZG 5AW6B 3H1KD 3H1JG 2KNCB 2QJYC 3V2QA 5KJ7D 3HUSB 4Y28J 1IJDB 5AVWB 2KI7B 5AW5B 4U7JA 1SVFA 1FS0E 1BSHA 3FXDA 3JSVC 3L36A 1NU1G 1EZVG 2K9JA 3AEBC 3H1IJ 1SQXG 2QA4P 3B5NB 1VQKP 1QLED 1YJNP 1X22A 5AW4B 1N73C 1LWUB 1P84E 1KQFB 5CCHC 1JUNA 1KQSO 3NTNA 1KD1Q 3FXEA 2KS1A 2OYHC 1NVOA 1BE3J 3IN6A 3R2PA 3AEFC 2J59M 2BCCE 4KHXA 3V5BA 3H32B 1RE4C 3CLQA 1PGQA 2C9LY 1HUCA 4H0LB 4I7ZC 1HGVA 1LTGC 3OW2O 1IFNA 1G2CB 1PV3A 2K37A 4H44C 1BCCD 4AUWA 1N7SB 2E43A 2GM4A 4IFFA 1M90Q 4B86A 3HTKB 1HH0A 3BCCJ 1L0NE 1OW6A 2LR2A 1FZCC 2R3SA 2YIUB 1CZQA 3M9BA 4QMAA 1SQVG 2Y9YA 4PV1B 2W90A 2YO2A 4L74A 1DEBA 5AVUB 3CXHE 1PFIA 5KAFE 3TDKA 4N3YB 1AFOA 3H1ID 3GF7A 2O01H 1FBMA 1HF9A 2WTYA 4RJTA 1G1IA 2YKPA 4YTPC 4D6TG 3RL0D 3ABVC 3H1LG 5KLVK 2N1TA 1SFCB 1QX8A 2I1KA 1BE3D 1ZV8A 1NTZJ 1NH4A 1SQBK 1SQQK 1T2KC 3U1CA 4W80A 1SS1A 2NPSC 5CJ0A 1L0LK 4AQRD 1LP1A 1M56D 1USEA 1EDJA 1HWTC 1U7MA 1ZP0C 3HE5A 2HODA 5TISH 2B87A 5AVSB 1MUUA 3GMAA 2IX7C 3GG2A 3AE6C 4NPEA 3NXSA 1GW4A 1GL2D 2XZRA 3BCCD 3RK3B 1XTGB 4UB8E 4WY4A 5KLVE 4MN4C 1JNMA 5KAIH 1KB9D 3G3ZA 3L74E 1NWQA 2LXCB 1EZVI 1SQBE 1SQQE 1KN7A 1GMJA 2IDBA 2MJZA 1RF1B 2OGUA 2LKMA 1S5LX 3HD7A 1IO4A 5AVYB 1Q81Q 3VMYA 1WT6A 3H25A 3N7NA 1IK7A 3H1HE 3CWBJ 2ZXXA 1NTZD 1M7LA 2WMMA 1EXJA 1D7MA 1CI6B 1KFMA 1YQ4C 2NZ2A 2HLOA 4OH8B 3F5HA 3AEGC 1URQB 3TSIA 4N78E 3RK2B 4GIFA 5AW9B 1AV1A 2YXQB 1P84H 3MP7B 5BVZA 2KNCA 1OW8A 4ASVA 3JCUE 4ZKPA 3S9OA 3HUSA 2E76C 3BVHA 3JC22 5KTBA 3A0HH 3D6YA 1OX3A 4IL6H 1NO4A 2WSEH 2B9BA 3MGNA 1VQLP 2QJPB 1ZR4A 3CXHD 2WSCH 1NTKK 2M3EA 3L74J 3L70G 2BCCG 3B5NA 2D2CC 4GT1A 1NTMG 3CD6P 1LWUA 2OYIB 4H13B 1Z56A 3D6ZA 1IZNB 3VN0A 1OW7A 1L0LJ 1LTJC 3CL3D 4PD4I 3T97A 5H2FH 1S3JA 1X8YA 3MUDA 3D71A 2RN0A 2A06D 3CWBD 1S4XA 2KXPB 3AE8C 1L0NG 2N9BA 1L4AB 1VQ4P 3O6QB 3H32A 3RL0C 3CMAP 2CPSA 4HH2A 5KAFH 1SQPK 2POHA 3RL0g 2FFDC 5CCHD 3W67A 2AXTH 5B5EE 3Q5PA 1LNQA 3OA7A 1NTKE 3P8CE 1N7SA 4N6JA 1RH5B 1RHZB 3HTKA 3IF4A 3L75G 4KJMA 3W68A 5APWA 1FAVA 1PP9E 3Q5SA 1VF5B 2QRXA 3WU2E 1HBWA 4DT0A 3L74D 2K88A 1FZGA 2E5TA 2GUVA 4H44D 3AECC 1SQBD 1SQQD 1NGMB 5AVXB 1PPJG 1SQPE 5CJ4A 1L0LD 1GTWA 4RESB 2IZ1A 1NU1J 3KZIH 3OJAB 3L37A 2HG5D 1OVRA 3Q2YA 1KILB 3H1HD 2Q3IA 3KQGA 4WB4A 3SWYA 5AW1B 2ZT9C 1VQ5P 5CMZA 5KLVG 5K5GB 4GOEA 1JB0J 2G3AA 1LT9C 1T6AA 1NTKJ 1U7JA 4N78D 3VMXA 3EFFK 1M1JB 2KZIA 1P84I 3P32A 1E5WA 3MTUE 1KQGB 4L76A 3V4WA 2NPSD 2O3JA 2P1JA 5GTIE 1EC5A 4EI2A 2YNYA 2HPCB 1BE3E 3AE9C 2K1AA 2WVRA 3TGUG 2E75B 1LJ2A 1J1EC 2G8YA 2KZJA 5E79H 1FU1A 1RF1A 1SQPJ 2M8RA 1MFTA 5EFWB 1S2EA 1W2BO 1OWAA 1LTAC 4HB1A 3CPWO 2UWJE 2E74C 3PTZA 1NTZK 5CCGA 1EDIA 1GK4A 1R5LA 2O01J 3BCCE 1KV4A 3IAOA 1H88A 3C1LA 1YYCA 1VQ7P 1CI6A 1FE6A 2PFXA 4IFMA 3CXHI 2FY8A 1KB9E 4U3FJ 4DZOA 2AXCA 1URQA 2H7HA 3GHGB 1NTKD 5GTHH 2H88C 2O1KA 2PGDA 3P8CD 2YKQA 4UB6H 4R4MA 1RQVA 4K3AA 4JQ0D 3VOPA 2Q5UA 1PZQA 1PP9D 3H1KG 2JWDA 4WWIA 3M9QA 1NTZE 3P8MC 4L75A 3E1IA 3CCUP 3KHUA 5B5EH 3TNUB 4BRYB 2OYIA 1SQPD 1KC8Q 2B89A 2E76D 4O9BA 2P2UA 3TYYA 2QSIA 1FZFA 2AEFA 5KKZC 2JO1A 2I1JA 1L4AA 1NYHA 4IOIH 3GLMA 1EDLA 2N1TC 3O6QA 1A02F 1T3UA 2OTJP 2D2CD 4EOTA 1VQ9P 1S5LE 3F89A 4NPDA 2R5BA 3II6A 2BASA 2W8ZA 1EQ7A 4U3FD 1ZOYC 4AYCA 1LGHB 3WUTA 3LW5J 5AVVB 1J1DC 1ZMEC 4PD4H 3RL0B 1XTCC 2OYOA 1BCCG 2KUBA 2QEXP 4YXDC 1BGYJ 2JJLA 2A06E 3CWBE 3VMAA 1X79B 2KK7A 1Q82Q 4WY4C 2Q9IA 2ZYAA 3HE4B 1JO5A 3A0BE 1NOHA 1USDA 3QH9A 2Q6QA 3H1IG 3G4SP 3KXDA 1KILA 4DCKA 1GL2B 1JY2P 3A7OA 1NTMJ 3HD7C 5GTIH 1RE3A 2K3RA 1Q2NA 4RKUJ 5CBNA 1KFNA 4IL6X 2FYNB 1S1CX 4OVNF 1BE3G 1JY3P 2GUSA 3EFGA 2ZXEB 1FOSE 2WSFJ 2YMKA 1J2JB 1IC2A 2PRRA 3L72J 3FWLA 4OGQC 1M1JA 1DH3A 3CX5E 1NKZB 2KSJA 2L5GB 1L0LE 3G9RA 2ZT9D 1VDFA
chains in the Genus database with same CATH topology
1NTMJ 1BCCJ 1KYOI 1L0NJ 3H1LJ 3CXHI 3L71J 3CWBJ 3L72J 3L73J 1P84I 3TGUJ 5KLVJ 4U3FJ 3BCCJ 1NU1J 1BGYJ 2FYUJ 1L0LJ 3H1JJ 1KB9I 3L75J 4PD4I 3H1IJ 1NTZJ 1SQXJ 3CX5I 3L74J 3H1KJ 1SQPJ 3L70J 1SQVJ 1NTKJ 2BCCJ 1BE3J 1PP9J 2IBZI 1SQBJ 3H1HJ 1SQQJ 4D6TJ 1EZVI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTM J;  1BCC J;  1KYO I;  1L0N J;  3H1L J;  3CXH I;  3L71 J;  3CWB J;  3L72 J;  3L73 J;  1P84 I;  3TGU J;  5KLV J;  4U3F J;  3BCC J;  1NU1 J;  1BGY J;  2FYU J;  1L0L J;  3H1J J;  1KB9 I;  3L75 J;  4PD4 I;  3H1I J;  1NTZ J;  1SQX J;  3CX5 I;  3L74 J;  3H1K J;  1SQP J;  3L70 J;  1SQV J;  1NTK J;  2BCC J;  1BE3 J;  1PP9 J;  2IBZ I;  1SQB J;  3H1H J;  1SQQ J;  4D6T J;  1EZV I; 
#chains in the Genus database with same CATH topology
 3CCL P;  3CCS P;  1BGY D;  2P58 A;  3Q1M A;  2HPC A;  4PJ0 E;  1MV8 A;  2FXM A;  3BCC G;  1AQT A;  5B66 E;  2QJK C;  3L75 J;  2MKV A;  3KYQ A;  3VP9 A;  2KSE A;  1HTL C;  5APU A;  1GD2 E;  3B5N C;  3WUV A;  1NU1 K;  5KLI C;  2XDJ A;  1LWU C;  3HRN A;  2FBW C;  3L73 E;  3U59 A;  1IFD A;  5KJ7 A;  2BEQ D;  4L73 A;  1KYO E;  4BWN A;  3IFM A;  2ZFC A;  1JY2 O;  4C7R A;  1YJW P;  2P67 A;  3FWN A;  2KYV A;  3MUD C;  1JCD A;  3SSU A;  3E1R A;  3VTP C;  4ZKU A;  2J58 A;  2CK3 H;  1ZN5 A;  3CCE P;  2IBZ E;  1NTZ G;  3GHG A;  5APX A;  1OVV A;  1JY3 O;  1R5S A;  1GDT A;  4H0L C;  1RF0 A;  3CCJ P;  4Y99 C;  3M06 A;  3L72 D;  2E74 D;  3USS A;  3O8Z A;  5AVQ B;  2QJY B;  4LLH A;  2ZJS E;  2FKW B;  4BXL A;  2Q7C A;  1N7S C;  1AVY A;  1NU1 E;  1JCC A;  3CCR P;  1JTH B;  2Y0E A;  2YO3 A;  2YIU C;  2JEE A;  1JMM A;  1BDD A;  3NFQ A;  1M57 D;  5AW3 B;  4A7P A;  4Z1M H;  2FYU J;  4XFJ A;  3CXH H;  3TNU A;  1N73 B;  1DD3 A;  1SQV K;  2Q1K A;  4BRY A;  3BAS A;  4TLF A;  3Q5R A;  1G2C A;  1ZRT D;  1S72 P;  2IPP A;  5AW7 B;  1VQM P;  1QGK B;  3L71 J;  2OYH B;  3L73 J;  3TGU J;  1NHL A;  1IK9 A;  3PRJ A;  2I8D A;  1YTZ T;  3CCQ P;  1HJ0 A;  3RBX A;  4I7Z B;  1YQ3 C;  2IYO A;  1VQP P;  3V4Q A;  2A06 G;  1ZLL A;  3C8V A;  3CWB G;  2Y0D A;  4HJG H;  3H1J J;  4H44 B;  4K35 A;  2ZVN B;  2M0B A;  1JY2 N;  2WT7 B;  4OWF A;  4JF7 A;  3CCV P;  3CX5 D;  1FZC B;  3M91 A;  2N1T D;  1OIP A;  1X9V A;  3P7K A;  3M0D A;  1ZR2 A;  3SWF A;  5TJH A;  1PGO A;  1DIP A;  1YBK A;  2IZ0 A;  2JR8 A;  2QIW A;  5APS A;  1SFC A;  4I2L C;  3RK3 C;  4R4L A;  3I55 P;  1SQX J;  1JY3 N;  2WSS H;  3EQ2 A;  1WRG A;  2QVA A;  4UB8 H;  3BRT B;  1H0T B;  3V6I A;  2H43 A;  2FYU D;  3L4F A;  1LTI C;  1ZXG A;  1HJB A;  4GOF A;  3HE4 A;  2BEZ F;  3HE5 B;  1KB9 I;  2QG4 A;  3L74 G;  4U3F E;  3VYI A;  1FDO A;  3LID A;  1KIL D;  2O01 N;  3KPE A;  5DJT B;  1SQB G;  2V7Q H;  1SQQ G;  3L71 D;  2Y0C A;  1VQ8 P;  3L73 D;  2M3B A;  2E42 A;  1GL2 A;  4I6M C;  1T8Z A;  2R44 A;  2WQY C;  1H8A A;  3I56 P;  3D70 A;  1IFM A;  1KYO D;  1L0L G;  2RH0 A;  4WY4 D;  1R8E A;  2NPS B;  1NAF A;  5CCG C;  3AE7 C;  1IFJ A;  2QM8 A;  1JOC A;  2ZAE B;  3H1H G;  1KOR A;  2IBZ D;  1KQL A;  2KLV A;  3H1J D;  3GF3 A;  1FZA A;  1DX7 A;  1VPC A;  1URQ C;  3HD7 D;  1SQV J;  4KT0 J;  3RK2 C;  2Z5I A;  3WMM 0;  4YXW H;  3B71 A;  1YJ9 P;  1LTB C;  2AEJ A;  1PGP A;  1QEX A;  1PIX A;  1NU1 D;  5AW8 B;  5KAI E;  1EZV D;  5APQ A;  3G71 P;  3JCU H;  1SQX D;  1ZW0 A;  3R4Y A;  3M9H A;  2KLU A;  2ZVO B;  4D6T J;  3E7K A;  2WPV B;  4OGQ D;  5AW0 B;  1BCC J;  3H1L J;  4JYB A;  1Q90 D;  2N9Y B;  3B8E B;  1GU4 A;  3S1K A;  3FGA D;  3V2R A;  2R3C A;  4JBZ A;  3V2P A;  5M1B A;  2FXO A;  2IFM A;  2OYI C;  4H13 C;  1M1K Q;  3RK3 E;  1UII A;  1N7L A;  3AEE C;  3AE4 C;  1NTM K;  2QJK B;  2A45 H;  1VQO P;  2KOG A;  5L8R J;  2A45 G;  1FOS F;  1JMB A;  2AEM A;  1L4A C;  1BGY E;  5KLI B;  3B5N D;  2JDI H;  1JEK A;  1L0N K;  2WZ7 A;  1N2D C;  4LC1 A;  2M5A B;  2K9Y A;  3T97 B;  4YPC A;  1FJK A;  2E76 B;  2WPQ A;  1SQV D;  3A0H E;  4IL6 E;  1FZB A;  1NTK G;  2RMZ A;  1HGZ A;  3VP8 A;  3L70 E;  1JTH A;  4GOD A;  1QVG O;  4JYC A;  4DOJ A;  2OTK E;  2OAR A;  1NTM E;  1Y47 A;  4Y99 B;  2D2C B;  4RO0 A;  4H0L D;  3PJS K;  3N4X A;  1VF5 C;  2HYN A;  2QE7 H;  1N73 A;  4D6T D;  4PD4 D;  2W6A A;  5CCH A;  3CME P;  3WU2 H;  1PP9 G;  3H1L D;  2DW3 A;  4CPG A;  5H2F E;  1LTJ B;  1N7S D;  4HKZ H;  2W27 A;  2PP6 A;  1G1J A;  2OYH A;  2J5U A;  3L72 E;  3CX5 I;  2KB7 P;  2C9N Y;  1SQP G;  2XV5 A;  3TK1 A;  2V4H A;  4PV1 D;  3WUU A;  1RE4 A;  5AW2 B;  2FYZ A;  1KIL C;  1YI2 P;  4DJG A;  1AJY A;  2FFD B;  1WMK A;  2AXT E;  4TT3 H;  1VQN P;  4M3L A;  1DD4 A;  1RE3 C;  3RGU A;  2P10 A;  5BU8 B;  3L75 E;  1NAY A;  1OVU A;  2WT7 A;  1AQ5 A;  1FZC A;  1RQU A;  2PAJ A;  4U3F G;  1ZRT E;  2WSE J;  1SFC D;  3QWO C;  2W6J H;  1M1J C;  1M8O B;  1K05 A;  1TU3 F;  1MZ9 A;  3L70 J;  2BCC J;  2WSC J;  3AE1 C;  1KMI Z;  1KYO I;  1YIT P;  1PPJ E;  1E79 H;  1H0T A;  2FYU K;  1CW5 A;  1BSN A;  2RKL A;  4EIJ A;  2IFN A;  3IR9 A;  4W7Y A;  1S9K E;  4ASW A;  3G6E P;  2E75 C;  2IBZ I;  3KZI E;  1AA0 A;  4I1L A;  1KZU B;  2JKV A;  4EYY Q;  1L0N J;  3RK3 D;  1FDI A;  4NPF X;  4XA4 A;  2H89 C;  2E5Y A;  1X0T A;  4JPZ B;  2ZT9 B;  2A45 I;  3AE3 C;  2NPS A;  2YXR B;  4LGD E;  3PP5 A;  2CPB A;  5KJ7 C;  4C7N B;  1LT9 B;  3HUS C;  3AED C;  3SFE C;  3OAK A;  1FC2 C;  1UIX A;  1P84 D;  3SFD C;  2FYU E;  3UIA A;  1KB9 H;  3GHG C;  3A2A A;  1Q86 Q;  1VQ6 P;  1YTZ I;  1RF0 C;  2WWW A;  3FX0 A;  3LW5 H;  2KIK A;  1KIL E;  3I5C A;  5CCG D;  3L71 E;  1SQX K;  3L70 D;  2BCC D;  3TGU E;  1U57 A;  3GW6 A;  1IFI A;  5APY A;  2P7J A;  1NTM D;  2WIT A;  1J1E B;  1W5C E;  1SLQ A;  5E79 E;  1CSB A;  2IYP A;  1H89 A;  1MKM A;  1URQ D;  4XE5 B;  2K9J B;  1BGY G;  2W6B A;  3RK2 D;  2C0W A;  2JWA A;  1K8A Q;  3H1J E;  1FDM A;  2YKO A;  3BAT A;  1L0N D;  4GDO A;  2E74 B;  1K73 Q;  1GZL A;  1EXI A;  5KLV J;  2KS1 B;  1K9M Q;  4HYT B;  3Q3D A;  5CBO A;  5DJU B;  1GU5 A;  2R5D A;  4WVZ A;  1W2E A;  1EZV E;  1SQB J;  1SQQ J;  1SQX E;  4EDF A;  3B4S A;  5GTH E;  2V7Q J;  2OQQ A;  2Z5H A;  4PV1 C;  1S5L H;  2M5A A;  4UB6 E;  3CC4 P;  3L75 D;  4H13 D;  1N86 A;  1N8R Q;  3C9I A;  2L91 A;  2YMY A;  3ZDM A;  2ZYD A;  2WSF H;  2JP3 A;  2XKM A;  5AVT B;  5CHX A;  1T3J A;  3H1H J;  3H1K E;  1OXZ A;  1LTS C;  2HFE D;  2ZYG A;  3L72 G;  1L4A D;  3U1A A;  2ITA A;  3M0A A;  1JM0 A;  2LXB A;  5APV A;  3M0D C;  1FZE A;  3S4R A;  1PPJ D;  3AE5 C;  2NRG A;  1SFC C;  1GK6 A;  1OFC X;  3VMZ A;  1A02 J;  3CCM P;  1DEE G;  1OZH A;  5APT A;  2O1J A;  2HR3 A;  3PLN A;  5AVR B;  1S9K D;  3CC7 P;  1LTT C;  2XNX A;  1LTJ A;  2Y9Z A;  5KKZ B;  2WPR A;  3A0B H;  3AEA C;  2N1T B;  1SQV E;  5KLV D;  2VRS A;  3K5B A;  1VF5 D;  1GL2 C;  2FFD A;  2Z4E A;  1QL2 A;  3LIE A;  4W7Z A;  2WPS A;  1VL2 A;  2FYN C;  1LP1 B;  4D6T E;  4PD4 E;  1L2P A;  1BCC E;  1J1D B;  3H1L E;  3A5T A;  5AVZ B;  2KP8 A;  1QL1 A;  2HOD B;  3NMD A;  2W83 C;  1YIJ P;  2B87 B;  3H1K J;  2C0X A;  1NJI Q;  3CX5 H;  1RF1 C;  1NKN A;  3TGU D;  3H6P A;  3SWK A;  1AVO A;  1Q7Y Q;  4WY4 B;  1BDC A;  1HVV A;  2H8P D;  1FJP A;  1MFZ A;  1K04 A;  1KTM A;  3RBZ A;  3MZW B;  4PJ0 H;  3H1I E;  3CI9 A;  5B66 H;  4ZNC A;  3AE2 C;  1QVF O;  1GW3 A;  2XU6 A;  2OTL P;  1LT1 A;  1Y8A A;  4IFD K;  1PGJ A;  3PH0 A;  5TIS E;  2QM7 A;  2FYU G;  3KDP B;  3A3Y B;  1T2K D;  3HD7 B;  3CC2 P;  3ITK A;  1YHQ P;  1PP9 J;  4WBA A;  3BRV B;  3MIW A;  3PHL A;  1OMI A;  1EDK A;  2B88 A;  3L35 A;  1Y9B A;  2XND H;  3L71 G;  4C7N A;  4ZMD A;  3L73 G;  4C46 A;  2Q3E A;  1PL5 A;  2R32 A;  1LT9 A;  1KYO H;  1IFP A;  2E75 D;  5BU5 A;  3MD0 A;  1RY3 A;  1SP4 A;  2SPZ A;  3TF5 A;  4GKG A;  4OGQ B;  2QJP C;  3EWK A;  3MHV A;  2GA1 A;  3V2N A;  2FXP A;  5C39 A;  2IBZ G;  5AW6 B;  3H1K D;  3H1J G;  2KNC B;  2QJY C;  3V2Q A;  5KJ7 D;  3HUS B;  4Y28 J;  1IJD B;  5AVW B;  2KI7 B;  5AW5 B;  4U7J A;  1SVF A;  1FS0 E;  1BSH A;  3FXD A;  3JSV C;  3L36 A;  1NU1 G;  1EZV G;  2K9J A;  3AEB C;  3H1I J;  1SQX G;  2QA4 P;  3B5N B;  1VQK P;  1QLE D;  1YJN P;  1X22 A;  5AW4 B;  1N73 C;  1LWU B;  1P84 E;  1KQF B;  5CCH C;  1JUN A;  1KQS O;  3NTN A;  1KD1 Q;  3FXE A;  2KS1 A;  2OYH C;  1NVO A;  1BE3 J;  3IN6 A;  3R2P A;  3AEF C;  2J59 M;  2BCC E;  4KHX A;  3V5B A;  3H32 B;  1RE4 C;  3CLQ A;  1PGQ A;  2C9L Y;  1HUC A;  4H0L B;  4I7Z C;  1HGV A;  1LTG C;  3OW2 O;  1IFN A;  1G2C B;  1PV3 A;  2K37 A;  4H44 C;  1BCC D;  4AUW A;  1N7S B;  2E43 A;  2GM4 A;  4IFF A;  1M90 Q;  4B86 A;  3HTK B;  1HH0 A;  3BCC J;  1L0N E;  1OW6 A;  2LR2 A;  1FZC C;  2R3S A;  2YIU B;  1CZQ A;  3M9B A;  4QMA A;  1SQV G;  2Y9Y A;  4PV1 B;  2W90 A;  2YO2 A;  4L74 A;  1DEB A;  5AVU B;  3CXH E;  1PFI A;  5KAF E;  3TDK A;  4N3Y B;  1AFO A;  3H1I D;  3GF7 A;  2O01 H;  1FBM A;  1HF9 A;  2WTY A;  4RJT A;  1G1I A;  2YKP A;  4YTP C;  4D6T G;  3RL0 D;  3ABV C;  3H1L G;  5KLV K;  2N1T A;  1SFC B;  1QX8 A;  2I1K A;  1BE3 D;  1ZV8 A;  1NTZ J;  1NH4 A;  1SQB K;  1SQQ K;  1T2K C;  3U1C A;  4W80 A;  1SS1 A;  2NPS C;  5CJ0 A;  1L0L K;  4AQR D;  1LP1 A;  1M56 D;  1USE A;  1EDJ A;  1HWT C;  1U7M A;  1ZP0 C;  3HE5 A;  2HOD A;  5TIS H;  2B87 A;  5AVS B;  1MUU A;  3GMA A;  2IX7 C;  3GG2 A;  3AE6 C;  4NPE A;  3NXS A;  1GW4 A;  1GL2 D;  2XZR A;  3BCC D;  3RK3 B;  1XTG B;  4UB8 E;  4WY4 A;  5KLV E;  4MN4 C;  1JNM A;  5KAI H;  1KB9 D;  3G3Z A;  3L74 E;  1NWQ A;  2LXC B;  1EZV I;  1SQB E;  1SQQ E;  1KN7 A;  1GMJ A;  2IDB A;  2MJZ A;  1RF1 B;  2OGU A;  2LKM A;  1S5L X;  3HD7 A;  1IO4 A;  5AVY B;  1Q81 Q;  3VMY A;  1WT6 A;  3H25 A;  3N7N A;  1IK7 A;  3H1H E;  3CWB J;  2ZXX A;  1NTZ D;  1M7L A;  2WMM A;  1EXJ A;  1D7M A;  1CI6 B;  1KFM A;  1YQ4 C;  2NZ2 A;  2HLO A;  4OH8 B;  3F5H A;  3AEG C;  1URQ B;  3TSI A;  4N78 E;  3RK2 B;  4GIF A;  5AW9 B;  1AV1 A;  2YXQ B;  1P84 H;  3MP7 B;  5BVZ A;  2KNC A;  1OW8 A;  4ASV A;  3JCU E;  4ZKP A;  3S9O A;  3HUS A;  2E76 C;  3BVH A;  3JC2 2;  5KTB A;  3A0H H;  3D6Y A;  1OX3 A;  4IL6 H;  1NO4 A;  2WSE H;  2B9B A;  3MGN A;  1VQL P;  2QJP B;  1ZR4 A;  3CXH D;  2WSC H;  1NTK K;  2M3E A;  3L74 J;  3L70 G;  2BCC G;  3B5N A;  2D2C C;  4GT1 A;  1NTM G;  3CD6 P;  1LWU A;  2OYI B;  4H13 B;  1Z56 A;  3D6Z A;  1IZN B;  3VN0 A;  1OW7 A;  1L0L J;  1LTJ C;  3CL3 D;  4PD4 I;  3T97 A;  5H2F H;  1S3J A;  1X8Y A;  3MUD A;  3D71 A;  2RN0 A;  2A06 D;  3CWB D;  1S4X A;  2KXP B;  3AE8 C;  1L0N G;  2N9B A;  1L4A B;  1VQ4 P;  3O6Q B;  3H32 A;  3RL0 C;  3CMA P;  2CPS A;  4HH2 A;  5KAF H;  1SQP K;  2POH A;  3RL0 g;  2FFD C;  5CCH D;  3W67 A;  2AXT H;  5B5E E;  3Q5P A;  1LNQ A;  3OA7 A;  1NTK E;  3P8C E;  1N7S A;  4N6J A;  1RH5 B;  1RHZ B;  3HTK A;  3IF4 A;  3L75 G;  4KJM A;  3W68 A;  5APW A;  1FAV A;  1PP9 E;  3Q5S A;  1VF5 B;  2QRX A;  3WU2 E;  1HBW A;  4DT0 A;  3L74 D;  2K88 A;  1FZG A;  2E5T A;  2GUV A;  4H44 D;  3AEC C;  1SQB D;  1SQQ D;  1NGM B;  5AVX B;  1PPJ G;  1SQP E;  5CJ4 A;  1L0L D;  1GTW A;  4RES B;  2IZ1 A;  1NU1 J;  3KZI H;  3OJA B;  3L37 A;  2HG5 D;  1OVR A;  3Q2Y A;  1KIL B;  3H1H D;  2Q3I A;  3KQG A;  4WB4 A;  3SWY A;  5AW1 B;  2ZT9 C;  1VQ5 P;  5CMZ A;  5KLV G;  5K5G B;  4GOE A;  1JB0 J;  2G3A A;  1LT9 C;  1T6A A;  1NTK J;  1U7J A;  4N78 D;  3VMX A;  3EFF K;  1M1J B;  2KZI A;  1P84 I;  3P32 A;  1E5W A;  3MTU E;  1KQG B;  4L76 A;  3V4W A;  2NPS D;  2O3J A;  2P1J A;  5GTI E;  1EC5 A;  4EI2 A;  2YNY A;  2HPC B;  1BE3 E;  3AE9 C;  2K1A A;  2WVR A;  3TGU G;  2E75 B;  1LJ2 A;  1J1E C;  2G8Y A;  2KZJ A;  5E79 H;  1FU1 A;  1RF1 A;  1SQP J;  2M8R A;  1MFT A;  5EFW B;  1S2E A;  1W2B O;  1OWA A;  1LTA C;  4HB1 A;  3CPW O;  2UWJ E;  2E74 C;  3PTZ A;  1NTZ K;  5CCG A;  1EDI A;  1GK4 A;  1R5L A;  2O01 J;  3BCC E;  1KV4 A;  3IAO A;  1H88 A;  3C1L A;  1YYC A;  1VQ7 P;  1CI6 A;  1FE6 A;  2PFX A;  4IFM A;  3CXH I;  2FY8 A;  1KB9 E;  4U3F J;  4DZO A;  2AXC A;  1URQ A;  2H7H A;  3GHG B;  1NTK D;  5GTH H;  2H88 C;  2O1K A;  2PGD A;  3P8C D;  2YKQ A;  4UB6 H;  4R4M A;  1RQV A;  4K3A A;  4JQ0 D;  3VOP A;  2Q5U A;  1PZQ A;  1PP9 D;  3H1K G;  2JWD A;  4WWI A;  3M9Q A;  1NTZ E;  3P8M C;  4L75 A;  3E1I A;  3CCU P;  3KHU A;  5B5E H;  3TNU B;  4BRY B;  2OYI A;  1SQP D;  1KC8 Q;  2B89 A;  2E76 D;  4O9B A;  2P2U A;  3TYY A;  2QSI A;  1FZF A;  2AEF A;  5KKZ C;  2JO1 A;  2I1J A;  1L4A A;  1NYH A;  4IOI H;  3GLM A;  1EDL A;  2N1T C;  3O6Q A;  1A02 F;  1T3U A;  2OTJ P;  2D2C D;  4EOT A;  1VQ9 P;  1S5L E;  3F89 A;  4NPD A;  2R5B A;  3II6 A;  2BAS A;  2W8Z A;  1EQ7 A;  4U3F D;  1ZOY C;  4AYC A;  1LGH B;  3WUT A;  3LW5 J;  5AVV B;  1J1D C;  1ZME C;  4PD4 H;  3RL0 B;  1XTC C;  2OYO A;  1BCC G;  2KUB A;  2QEX P;  4YXD C;  1BGY J;  2JJL A;  2A06 E;  3CWB E;  3VMA A;  1X79 B;  2KK7 A;  1Q82 Q;  4WY4 C;  2Q9I A;  2ZYA A;  3HE4 B;  1JO5 A;  3A0B E;  1NOH A;  1USD A;  3QH9 A;  2Q6Q A;  3H1I G;  3G4S P;  3KXD A;  1KIL A;  4DCK A;  1GL2 B;  1JY2 P;  3A7O A;  1NTM J;  3HD7 C;  5GTI H;  1RE3 A;  2K3R A;  1Q2N A;  4RKU J;  5CBN A;  1KFN A;  4IL6 X;  2FYN B;  1S1C X;  4OVN F;  1BE3 G;  1JY3 P;  2GUS A;  3EFG A;  2ZXE B;  1FOS E;  2WSF J;  2YMK A;  1J2J B;  1IC2 A;  2PRR A;  3L72 J;  3FWL A;  4OGQ C;  1M1J A;  1DH3 A;  3CX5 E;  1NKZ B;  2KSJ A;  2L5G B;  1L0L E;  3G9R A;  2ZT9 D;  1VDF A; 
#chains in the Genus database with same CATH homology
 1NTM J;  1BCC J;  1KYO I;  1L0N J;  3H1L J;  3CXH I;  3L71 J;  3CWB J;  3L72 J;  3L73 J;  1P84 I;  3TGU J;  5KLV J;  4U3F J;  3BCC J;  1NU1 J;  1BGY J;  2FYU J;  1L0L J;  3H1J J;  1KB9 I;  3L75 J;  4PD4 I;  3H1I J;  1NTZ J;  1SQX J;  3CX5 I;  3L74 J;  3H1K J;  1SQP J;  3L70 J;  1SQV J;  1NTK J;  2BCC J;  1BE3 J;  1PP9 J;  2IBZ I;  1SQB J;  3H1H J;  1SQQ J;  4D6T J;  1EZV I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...