1P84I

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
55
structure length
55
Chain Sequence
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
total genus 17
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1p84I00
1SQVJ 1SQXJ 1NTMJ 1NU1J 1SQBJ 3H1LJ 3H1HJ 2FYUJ 1EZVI 3H1JJ 3L73J 4D6TJ 1L0LJ 1SQQJ 1P84I 3H1KJ 1KYOI 2IBZI 3L74J 1PP9J 3CWBJ 1L0NJ 2BCCJ 3L71J 3TGUJ 1SQPJ 3L72J 1BGYJ 5KLVJ 3CXHI 1BE3J 3CX5I 3L70J 1NTKJ 4PD4I 1NTZJ 3L75J 4U3FJ 3H1IJ 1KB9I 1BCCJ 3BCCJ
chains in the Genus database with same CATH superfamily
1Z56A 1G1IA 1URQC 1FZGA 1FJKA 4TLFA 1ZMEC 3L72G 1U7MA 3H1LJ 2JDIH 3BRVB 1DD4A 3AE1C 3MD0A 1KB9E 1ZRTE 2E75C 3H1KD 3SSUA 2Q3EA 3VOPA 1KC8Q 3GF7A 3Q2YA 4PD4H 2CK3H 3HD7D 2K1AA 1PIXA 2FYUD 3T97B 4L76A 1NWQA 3H1LE 3I56P 2OARA 2IBZG 2ZVOB 5KAFH 2R44A 1N2DC 2ITAA 3L73G 2NPSC 2XKMA 2KXPB 3CWBE 3A3YB 1T8ZA 3S4RA 3JC22 1KFMA 4N78E 3L75D 3NXSA 1X79B 3AE3C 1SQBD 2NPSB 1Y8AA 3F89A 3RK3E 1OZHA 2FXOA 2BEQD 1NGMB 1S1CX 3TGUE 3L75J 3IN6A 1OW8A 2KK7A 4KT0J 1RF0A 1H0TA 1P84H 1RY3A 2O01J 2MKVA 5H2FE 5KAFE 3PLNA 1G1JA 2Z5IA 3M0DA 3WUTA 1NU1J 2JJLA 5AVXB 1LT9B 3MGNA 1PL5A 2M8RA 3M0DC 3FXDA 3TNUA 1PP9D 4ZKUA 1KQGB 1H88A 2I1KA 2W83C 3CL3D 3CX5E 3H1KJ 3WU2H 2WSSH 1S9KD 3CMEP 2WMMA 4IFDK 1LT9C 2E74D 1SFCC 1GK6A 1JMMA 3L74J 1PP9J 3LW5H 1PPJD 4GIFA 5AVZB 1NOHA 2XDJA 1MZ9A 1LT9A 3IFMA 3TNUB 2O01N 4IL6H 1M1JC 3RL0C 1SQVK 3GW6A 5APYA 3P32A 3FWNA 3VN0A 4Z1MH 2XNDH 2HR3A 3CLQA 2OTLP 1IZNB 1JCCA 4U3FD 4D6TE 1SQPD 3OAKA 1QL2A 2FYZA 2IYPA 1CSBA 2E76C 3NFQA 4CPGA 1H0TB 1GD2E 3V2NA 3RGUA 1NTZG 3H1HE 4IOIH 5L8RJ 2NPSA 2GUVA 1OXZA 1VDFA 3L71J 2QSIA 1SQVE 3MTUE 2O1KA 1L0ND 1QGKB 1S5LX 3BCCD 5APWA 1KD1Q 1K8AQ 5AVWB 2IFNA 1X0TA 1LJ2A 3BASA 2PRRA 3H1JE 1SQQJ 1ZR2A 1BGYE 1OVVA 1RE4A 2E5YA 2ZJSE 3L72D 5APSA 1QVGO 1VQ9P 1AJYA 3L70D 3T97A 4GKGA 2E75B 2WVRA 4LGDE 1LTTC 1GTWA 1T3JA 1QEXA 1JY2N 5CJ4A 2OTKE 5CCGD 1S5LH 5BU8B 1JY3O 2FYUG 1VF5C 1KQFB 2FFDC 2H89C 2OQQA 1NU1K 1BGYJ 3E7KA 1UIIA 2AXTE 4YTPC 2I8DA 2Y9YA 3VMZA 1FZCB 2RH0A 3H32B 1JCDA 2Y0EA 3QWOC 4DJGA 3TK1A 2N1TB 1NHLA 1YQ3C 2AEJA 1KZUB 3Q1MA 2WITA 2B87B 2YO2A 2J59M 3CCRP 2KNCB 2WSFH 1FE6A 2Z5HA 1NTKK 1IO4A 3GG2A 4WY4C 1IK9A 1RF0C 1SQPG 4GOEA 4W80A 4D6TJ 1KYOD 3H25A 1KN7A 1OX3A 1QX8A 2Q7CA 1LNQA 1KILE 1LWUA 1PGOA 2BEZF 4UB6E 3HRNA 2M0BA 1FZBA 3TF5A 2IBZI 1NKZB 3C9IA 3JCUE 2OYHC 1EZVE 2NRGA 1S4XA 2P7JA 2C0WA 1FBMA 2WPSA 4JPZB 5EFWB 4YXWH 4OGQC 2WT7A 2E75D 3HD7A 1GDTA 3A0HH 5KTBA 3CXHH 2FFDB 1J2JB 1M8OB 2P1JA 2QIWA 2IFMA 3L74D 1AV1A 3P8CE 4DOJA 3N7NA 1VQ7P 1BCCG 5AW9B 1KYOH 1K9MQ 1VL2A 2KI7B 3RK3D 3USSA 1SS1A 2FKWB 1BE3G 2IZ1A 2OYOA 4XA4A 3H1HD 3OA7A 1NTKD 5KJ7D 1RQUA 1S5LE 1ZN5A 2IPPA 2FY8A 1SQXK 3AEAC 1SFCD 2FYUJ 2IDBA 3AEEC 3KYQA 4RESB 3PJSK 2AXCA 4IFFA 5AVYB 2K3RA 3HTKB 3VTPC 1RF1C 1IK7A 1KILA 5AW3B 3PP5A 4OWFA 5KLVE 1SQQG 4IL6E 1QLED 1ZOYC 2ZFCA 1NU1D 1JO5A 1JM0A 4L74A 1CI6A 1H8AA 1P84D 2ZXEB 2VRSA 4N3YB 2YNYA 1PFIA 3L71G 5B5EE 4BRYA 1IC2A 2OYIB 2I1JA 4OH8B 1HWTC 3WUUA 5GTIE 4C7RA 4HKZH 1M1JB 3A7OA 1PGJA 3AE4C 2A06D 2QJPB 3CXHD 3KZIH 1A02J 2ZT9D 1LP1A 2LKMA 4PJ0H 1SFCB 5H2FH 4EIJA 1J1DC 2WSEH 1LTJB 2AEFA 4LC1A 2QJPC 1KMIZ 3C1LA 3N4XA 2QVAA 2LXBA 4L73A 1VF5B 5KLVK 1KQSO 5APXA 1T6AA 2H43A 1W2EA 1NTME 2M3EA 1AA0A 1D7MA 2E74B 1PP9G 2YMKA 1EDKA 3B5NB 3AE6C 2M5AA 3L74G 4O9BA 3O6QB 4OVNF 2H7HA 1FOSE 1RHZB 3CC7P 3H1KG 1ZRTD 1DEEG 1L0LG 1L4AC 1MUUA 2Q3IA 3M91A 1NTZE 2A45G 2JEEA 3H1HG 1NU1G 4QMAA 5AVTB 5AW5B 1N73A 4C7NB 4YXDC 1MFTA 3CXHI 5APQA 5K5GB 2IBZD 4H44C 1SQVG 1NJIQ 1RH5B 5KJ7C 2R3CA 4HJGH 4M3LA 4PD4E 5AVSB 3RK2C 2KSJA 1ZR4A 1JMBA 1KB9H 1L4AD 2V4HA 4GDOA 3L75G 1YYCA 4PV1C 5CBOA 3MP7B 5CJ0A 3CCQP 2A06G 3CD6P 1E5WA 1GZLA 3A0HE 1L0LK 1T3UA 2W6JH 4LLHA 2ZXXA 2BCCE 3GHGC 5M1BA 5E79E 3V2RA 3VMXA 1YJ9P 2G3AA 1GU4A 3RL0B 3FX0A 4HYTB 4R4LA 1N7LA 1OMIA 3OW2O 2O01H 4OGQB 1P84I 4NPDA 1Q81Q 3KQGA 3H1ID 2D2CD 5BU5A 1ZP0C 2HODB 3HE4A 3BRTB 1QVFO 4KJMA 2WSFJ 4JBZA 1URQB 2KLVA 1G2CA 3GMAA 5KAIH 4RKUJ 2A45I 1LTJC 1N86A 3G3ZA 1GL2D 4JYBA 3SWFA 3CCUP 1YJNP 1SVFA 5DJUB 3H1LG 3MHVA 4ZMDA 1VQ4P 5KLVJ 1RE3C 1KILC 2YKPA 3L73E 1H89A 1SQBK 1SQVD 2K9JB 2W6AA 1LTGC 1RE3A 2OYIC 3CX5I 1VQPP 4BWNA 3CCVP 3RBZA 5GTHH 2OYHA 4IFMA 5AW4B 4U3FG 1DX7A 4WVZA 2WPQA 1FZFA 5GTIH 2M3BA 2ZVNB 3L70G 2WSEJ 4WY4B 4EOTA 1Q86Q 2PP6A 2QE7H 2DW3A 5CBNA 4K3AA 5AW8B 1L0LD 4B86A 2QEXP 4EI2A 3CCSP 2WZ7A 3V4QA 2R5DA 1FZCC 1AVYA 1GK4A 2AEMA 4H13B 1YI2P 3M0AA 3M06A 2KS1A 1L0NG 3GF3A 3QH9A 5AVQB 3SFEC 1RE4C 1JTHA 1PV3A 1NTZK 1R5SA 2K37A 3HE5B 2IZ0A 2POHA 1KYOI 1E79H 5AVUB 4AQRD 1YBKA 1SQXE 4BXLA 3D6ZA 4RJTA 1SP4A 1IFMA 2WPRA 3H1KE 3AE5C 4RO0A 1K73Q 5AVVB 2HYNA 3SWYA 3HUSB 3G4SP 3CCJP 1MV8A 3AE8C 2JR8A 1JB0J 2A45H 1NTKJ 2D2CC 3WMM0 2QA4P 4JQ0D 3H1IG 4U3FJ 3G71P 4N6JA 3PHLA 3F5HA 2HG5D 2N9BA 2K9YA 1DH3A 2O1JA 1GL2A 2OGUA 1KV4A 1BE3D 4C46A 1GL2C 3M9BA 5KLVG 1QL1A 2R32A 1SQBJ 2MJZA 3H1JJ 2KIKA 2BCCG 5CHXA 1FDMA 1LTSC 3CWBG 3L36A 1LGHB 3GHGA 3WU2E 1MKMA 4KHXA 3L71E 4H13D 4WB4A 3Q5SA 3BVHA 4MN4C 4H44D 1BDDA 2E74C 1NO4A 4HB1A 3U59A 2HPCB 3U1AA 3PRJA 3RK2D 1SQPK 1USDA 1Y9BA 2N1TD 3ZDMA 3I55P 1ZXGA 3FGAD 1ZV8A 3M9QA 2Q9IA 3VP8A 3WUVA 1X9VA 2WSCH 1NTKE 3MZWB 3Q5PA 2P58A 4PD4I 1NH4A 1M56D 2KUBA 1GW3A 3AEDC 3HUSC 3A5TA 4EDFA 1N7SC 2H88C 2WWWA 4A7PA 3L74E 5KAIE 1N7SA 2HFED 1FAVA 1L4AA 1SQVJ 1OVUA 2N9YB 4HH2A 2W27A 1UIXA 1PPJG 2AXTH 2Q6QA 2RMZA 4NPFX 1M90Q 1NTMJ 1ZLLA 2B89A 3RK3C 3H1HJ 2YKQA 1EZVI 2BASA 2P10A 2QJKC 1L0LJ 2Y0DA 4I6MC 1S72P 2CPBA 4GOFA 1A02F 5APTA 1RQVA 2L5GB 2QJKB 2V7QJ 3K5BA 1KILD 3RK2B 1FZAA 2K88A 5AW6B 4OGQD 3AEFC 3II6A 3V5BA 2QM8A 1EDLA 2QM7A 4I7ZC 3TGUJ 1SQXG 2B88A 1NYHA 2KB7P 1SQQD 3L37A 1L4AB 2C9LY 1N7SB 3BCCG 2YO3A 3AEBC 2FXMA 1N8RQ 1OWAA 2G8YA 3EFFK 3M9HA 5APUA 1Y47A 1FDIA 1BCCE 3IR9A 1VPCA 2WQYC 2ZYDA 5KLIC 3NMDA 4WWIA 1NVOA 4PD4D 4GT1A 3ITKA 1AQ5A 1L2PA 1FOSF 1IFIA 1JOCA 4EYYQ 2FYUE 1HUCA 5CMZA 4H0LB 1NTZD 1K04A 1OW6A 5KLVD 3AE7C 3UIAA 2HPCA 2IBZE 2FXPA 2GUSA 2XU6A 3A0BE 2J58A 3BATA 1RF1B 4PJ0E 3GHGB 3B5ND 2B9BA 2O3JA 5BVZA 1YTZT 3H1JD 2XV5A 1VQLP 3KDPB 5AVRB 1VQ5P 2ZYGA 5TISE 1NTMK 3V4WA 1AQTA 1BE3J 2WPVB 2QRXA 5AW7B 4AUWA 3KXDA 2FYNB 1GL2B 2PAJA 5CCHA 1BSNA 3S1KA 3B8EB 1FZCA 1P84E 2ZT9C 2SPZA 1BCCJ 1EQ7A 1SQBE 1WT6A 2KZIA 1T2KC 3LIEA 3RBXA 2KYVA 1USEA 2KSEA 2PGDA 2YIUB 2QG4A 3HUSA 3RL0D 4DT0A 3D70A 2JO1A 2RKLA 2WTYA 2RN0A 1EZVD 1JY3N 2P67A 3H1LD 4DCKA 2Q1KA 1PPJE 1JNMA 4U7JA 1VQOP 2XZRA 2KZJA 4NPEA 1AVOA 3HE5A 1EXJA 1YHQP 1JTHB 1PP9E 1VQ6P 3AE9C 1WRGA 2KS1B 1HVVA 1OVRA 2YXQB 1WMKA 1KYOE 2FYNC 1S3JA 1SQPJ 3H1IE 4Y28J 4D6TG 3CC4P 1IFJA 3I5CA 1KTMA 1LTAC 4XFJA 1KFNA 2HLOA 5AW1B 2OYHB 3IF4A 1RF1A 3CCMP 1FU1A 1W5CE 4WY4A 1U7JA 3RK3B 4ASVA 4ZNCA 1HBWA 3SWKA 3A2AA 3L73D 1FJPA 3V2QA 4TT3H 2JKVA 2NZ2A 5CCGA 1YTZI 3L75E 2K9JA 3MUDC 1VF5D 1KORA 5TISH 1LTBC 4YPCA 1BGYG 2LR2A 5CCGC 3CX5D 3E1IA 1NKNA 5B66H 1FC2C 1JUNA 1VQNP 3HD7C 3CWBD 1G2CB 3R2PA 1URQA 1JY2O 1DEBA 3PH0A 1M57D 1GU5A 5C39A 2J5UA 2HODA 3HE4B 1X8YA 4JF7A 4K35A 5KLIB 1JEKA 3FXEA 3L72E 1T2KD 1CW5A 3U1CA 1KB9D 2NPSD 1NAYA 2L91A 2E76D 1NTMD 3VP9A 1J1EC 1PZQA 1S9KE 2YIUC 3TSIA 3IAOA 4Y99B 1EC5A 3O8ZA 1N73C 3CC2P 2W6BA 3P8MC 2JWDA 1NTZJ 2BCCD 3S9OA 1S2EA 1BSHA 1YQ4C 4I7ZB 5TJHA 1EXIA 5E79H 1N7SD 1FS0E 3KPEA 2QJYC 3KHUA 4H13C 2IX7C 3BCCJ 1SQPE 4N78D 4U3FE 5DJTB 4D6TD 3L4FA 2OTJP 4IL6X 3LW5J 3L71D 4C7NA 1N73B 3L70E 1SQXJ 1Q2NA 2D2CB 3GLMA 3LIDA 3R4YA 3TGUG 3CCLP 3TYYA 1VQKP 1NU1E 1AFOA 1SLQA 3CPWO 2CPSA 1IFDA 4Y99C 1EZVG 3BCCE 3O6QA 3OJAB 1L0NE 1IFNA 2M5AB 2E76B 3B5NA 4UB8E 3CX5H 1MFZA 3AECC 3EWKA 2YXRB 3KZIE 3L35A 4H0LD 3TDKA 1SQQK 2KOGA 1BGYD 1NTMG 3W67A 1R5LA 2A06E 1LTJA 4XE5B 1OFCX 3EQ2A 2W90A 1OIPA 3CI9A 2FBWC 1HTLC 1SFCA 2XNXA 5APVA 3W68A 5B5EH 1LP1B 3V2PA 1DD3A 1LTIC 1M1JA 1NAFA 1Q90D 4UB6H 1L0LE 2YMYA 3V6IA 2E42A 1TU3F 3CCEP 1BE3E 4ZKPA 2OYIA 1IJDB 5KKZB 3VMAA 4BRYB 1YITP 1U57A 2R5BA 2JWAA 3P7KA 1CI6B 1PGQA 2C0XA 3RL0g 1OW7A 2LXCB 2WSCJ 1L0NK 3L73J 1SQXD 2GA1A 4PV1D 5AW2B 1LWUC 3D6YA 2W8ZA 1KILB 1SQQE 3HTKA 3B71A 5KJ7A 1X22A 4DZOA 2R3SA 2FYUK 4UB8H 1Q7YQ 3CWBJ 2PFXA 2N1TC 2ZAEB 2KP8A 2BCCJ 3E1RA 3H1JG 1ZW0A 1HGZA 1SQBG 1URQD 3C8VA 3SFDC 2C9NY 1JY2P 2E5TA 2QJYB 3B4SA 3L72J 3TGUD 1K05A 3CXHE 1DIPA 1J1EB 2IYOA 5CCHD 3Q5RA 1BDCA 3JSVC 3PTZA 1HJ0A 3H1IJ 4L75A 1HJBA 1YIJP 1NTKG 3AE2C 2KLUA 3MIWA 1VQ8P 5AW0B 3VYIA 1LT1A 2FFDA 2YKOA 4PV1B 1JY3P 3HD7B 4ASWA 2WT7B 3P8CD 2Y9ZA 1FDOA 4WBAA 1FZEA 2Y0CA 1GW4A 5GTHE 1HGVA 2ZT9B 2H8PD 4H44B 3A0BH 4I1LA 1XTGB 3D71A 1M1KQ 1EDIA 3ABVC 4W7YA 1HF9A 4JYCA 3H6PA 4GODA 1LWUB 2P2UA 1L0NJ 1M7LA 3FWLA 3MUDA 2Q5UA 1IFPA 3JCUH 4I2LC 3G9RA 3CMAP 3Q3DA 1Q82Q 2GM4A 2ZYAA 4H0LC 3VMYA 1KQLA 4AYCA 5B66E 3B5NC 3AEGC 1YJWP 1EDJA 1PGPA 2KNCA 4WY4D 2E43A 1HH0A 3L70J 2B87A 2UWJE 5CCHC 5KKZC 1R8EA 1BCCD 1GMJA 2JP3A 2N1TA 1KB9I 1J1DB 4R4MA 1VQMP 1W2BO 2Z4EA 3H32A 3EFGA 1XTCC 1CZQA 3G6EP 4W7ZA 2V7QH 3NTNA
chains in the Genus database with same CATH topology
1SQVJ 1SQXJ 1NTMJ 1NU1J 1SQBJ 3H1LJ 3H1HJ 2FYUJ 1EZVI 3H1JJ 3L73J 4D6TJ 1L0LJ 1SQQJ 1P84I 3H1KJ 1KYOI 2IBZI 3L74J 1PP9J 3CWBJ 1L0NJ 2BCCJ 3L71J 3TGUJ 1SQPJ 3L72J 1BGYJ 5KLVJ 3CXHI 1BE3J 3CX5I 3L70J 1NTKJ 4PD4I 1NTZJ 3L75J 4U3FJ 3H1IJ 1KB9I 1BCCJ 3BCCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQV J;  1SQX J;  1NTM J;  1NU1 J;  1SQB J;  3H1L J;  3H1H J;  2FYU J;  1EZV I;  3H1J J;  3L73 J;  4D6T J;  1L0L J;  1SQQ J;  1P84 I;  3H1K J;  1KYO I;  2IBZ I;  3L74 J;  1PP9 J;  3CWB J;  1L0N J;  2BCC J;  3L71 J;  3TGU J;  1SQP J;  3L72 J;  1BGY J;  5KLV J;  3CXH I;  1BE3 J;  3CX5 I;  3L70 J;  1NTK J;  4PD4 I;  1NTZ J;  3L75 J;  4U3F J;  3H1I J;  1KB9 I;  1BCC J;  3BCC J; 
#chains in the Genus database with same CATH topology
 1Z56 A;  1G1I A;  1URQ C;  1FZG A;  1FJK A;  4TLF A;  1ZME C;  3L72 G;  1U7M A;  3H1L J;  2JDI H;  3BRV B;  1DD4 A;  3AE1 C;  3MD0 A;  1KB9 E;  1ZRT E;  2E75 C;  3H1K D;  3SSU A;  2Q3E A;  3VOP A;  1KC8 Q;  3GF7 A;  3Q2Y A;  4PD4 H;  2CK3 H;  3HD7 D;  2K1A A;  1PIX A;  2FYU D;  3T97 B;  4L76 A;  1NWQ A;  3H1L E;  3I56 P;  2OAR A;  2IBZ G;  2ZVO B;  5KAF H;  2R44 A;  1N2D C;  2ITA A;  3L73 G;  2NPS C;  2XKM A;  2KXP B;  3CWB E;  3A3Y B;  1T8Z A;  3S4R A;  3JC2 2;  1KFM A;  4N78 E;  3L75 D;  3NXS A;  1X79 B;  3AE3 C;  1SQB D;  2NPS B;  1Y8A A;  3F89 A;  3RK3 E;  1OZH A;  2FXO A;  2BEQ D;  1NGM B;  1S1C X;  3TGU E;  3L75 J;  3IN6 A;  1OW8 A;  2KK7 A;  4KT0 J;  1RF0 A;  1H0T A;  1P84 H;  1RY3 A;  2O01 J;  2MKV A;  5H2F E;  5KAF E;  3PLN A;  1G1J A;  2Z5I A;  3M0D A;  3WUT A;  1NU1 J;  2JJL A;  5AVX B;  1LT9 B;  3MGN A;  1PL5 A;  2M8R A;  3M0D C;  3FXD A;  3TNU A;  1PP9 D;  4ZKU A;  1KQG B;  1H88 A;  2I1K A;  2W83 C;  3CL3 D;  3CX5 E;  3H1K J;  3WU2 H;  2WSS H;  1S9K D;  3CME P;  2WMM A;  4IFD K;  1LT9 C;  2E74 D;  1SFC C;  1GK6 A;  1JMM A;  3L74 J;  1PP9 J;  3LW5 H;  1PPJ D;  4GIF A;  5AVZ B;  1NOH A;  2XDJ A;  1MZ9 A;  1LT9 A;  3IFM A;  3TNU B;  2O01 N;  4IL6 H;  1M1J C;  3RL0 C;  1SQV K;  3GW6 A;  5APY A;  3P32 A;  3FWN A;  3VN0 A;  4Z1M H;  2XND H;  2HR3 A;  3CLQ A;  2OTL P;  1IZN B;  1JCC A;  4U3F D;  4D6T E;  1SQP D;  3OAK A;  1QL2 A;  2FYZ A;  2IYP A;  1CSB A;  2E76 C;  3NFQ A;  4CPG A;  1H0T B;  1GD2 E;  3V2N A;  3RGU A;  1NTZ G;  3H1H E;  4IOI H;  5L8R J;  2NPS A;  2GUV A;  1OXZ A;  1VDF A;  3L71 J;  2QSI A;  1SQV E;  3MTU E;  2O1K A;  1L0N D;  1QGK B;  1S5L X;  3BCC D;  5APW A;  1KD1 Q;  1K8A Q;  5AVW B;  2IFN A;  1X0T A;  1LJ2 A;  3BAS A;  2PRR A;  3H1J E;  1SQQ J;  1ZR2 A;  1BGY E;  1OVV A;  1RE4 A;  2E5Y A;  2ZJS E;  3L72 D;  5APS A;  1QVG O;  1VQ9 P;  1AJY A;  3L70 D;  3T97 A;  4GKG A;  2E75 B;  2WVR A;  4LGD E;  1LTT C;  1GTW A;  1T3J A;  1QEX A;  1JY2 N;  5CJ4 A;  2OTK E;  5CCG D;  1S5L H;  5BU8 B;  1JY3 O;  2FYU G;  1VF5 C;  1KQF B;  2FFD C;  2H89 C;  2OQQ A;  1NU1 K;  1BGY J;  3E7K A;  1UII A;  2AXT E;  4YTP C;  2I8D A;  2Y9Y A;  3VMZ A;  1FZC B;  2RH0 A;  3H32 B;  1JCD A;  2Y0E A;  3QWO C;  4DJG A;  3TK1 A;  2N1T B;  1NHL A;  1YQ3 C;  2AEJ A;  1KZU B;  3Q1M A;  2WIT A;  2B87 B;  2YO2 A;  2J59 M;  3CCR P;  2KNC B;  2WSF H;  1FE6 A;  2Z5H A;  1NTK K;  1IO4 A;  3GG2 A;  4WY4 C;  1IK9 A;  1RF0 C;  1SQP G;  4GOE A;  4W80 A;  4D6T J;  1KYO D;  3H25 A;  1KN7 A;  1OX3 A;  1QX8 A;  2Q7C A;  1LNQ A;  1KIL E;  1LWU A;  1PGO A;  2BEZ F;  4UB6 E;  3HRN A;  2M0B A;  1FZB A;  3TF5 A;  2IBZ I;  1NKZ B;  3C9I A;  3JCU E;  2OYH C;  1EZV E;  2NRG A;  1S4X A;  2P7J A;  2C0W A;  1FBM A;  2WPS A;  4JPZ B;  5EFW B;  4YXW H;  4OGQ C;  2WT7 A;  2E75 D;  3HD7 A;  1GDT A;  3A0H H;  5KTB A;  3CXH H;  2FFD B;  1J2J B;  1M8O B;  2P1J A;  2QIW A;  2IFM A;  3L74 D;  1AV1 A;  3P8C E;  4DOJ A;  3N7N A;  1VQ7 P;  1BCC G;  5AW9 B;  1KYO H;  1K9M Q;  1VL2 A;  2KI7 B;  3RK3 D;  3USS A;  1SS1 A;  2FKW B;  1BE3 G;  2IZ1 A;  2OYO A;  4XA4 A;  3H1H D;  3OA7 A;  1NTK D;  5KJ7 D;  1RQU A;  1S5L E;  1ZN5 A;  2IPP A;  2FY8 A;  1SQX K;  3AEA C;  1SFC D;  2FYU J;  2IDB A;  3AEE C;  3KYQ A;  4RES B;  3PJS K;  2AXC A;  4IFF A;  5AVY B;  2K3R A;  3HTK B;  3VTP C;  1RF1 C;  1IK7 A;  1KIL A;  5AW3 B;  3PP5 A;  4OWF A;  5KLV E;  1SQQ G;  4IL6 E;  1QLE D;  1ZOY C;  2ZFC A;  1NU1 D;  1JO5 A;  1JM0 A;  4L74 A;  1CI6 A;  1H8A A;  1P84 D;  2ZXE B;  2VRS A;  4N3Y B;  2YNY A;  1PFI A;  3L71 G;  5B5E E;  4BRY A;  1IC2 A;  2OYI B;  2I1J A;  4OH8 B;  1HWT C;  3WUU A;  5GTI E;  4C7R A;  4HKZ H;  1M1J B;  3A7O A;  1PGJ A;  3AE4 C;  2A06 D;  2QJP B;  3CXH D;  3KZI H;  1A02 J;  2ZT9 D;  1LP1 A;  2LKM A;  4PJ0 H;  1SFC B;  5H2F H;  4EIJ A;  1J1D C;  2WSE H;  1LTJ B;  2AEF A;  4LC1 A;  2QJP C;  1KMI Z;  3C1L A;  3N4X A;  2QVA A;  2LXB A;  4L73 A;  1VF5 B;  5KLV K;  1KQS O;  5APX A;  1T6A A;  2H43 A;  1W2E A;  1NTM E;  2M3E A;  1AA0 A;  1D7M A;  2E74 B;  1PP9 G;  2YMK A;  1EDK A;  3B5N B;  3AE6 C;  2M5A A;  3L74 G;  4O9B A;  3O6Q B;  4OVN F;  2H7H A;  1FOS E;  1RHZ B;  3CC7 P;  3H1K G;  1ZRT D;  1DEE G;  1L0L G;  1L4A C;  1MUU A;  2Q3I A;  3M91 A;  1NTZ E;  2A45 G;  2JEE A;  3H1H G;  1NU1 G;  4QMA A;  5AVT B;  5AW5 B;  1N73 A;  4C7N B;  4YXD C;  1MFT A;  3CXH I;  5APQ A;  5K5G B;  2IBZ D;  4H44 C;  1SQV G;  1NJI Q;  1RH5 B;  5KJ7 C;  2R3C A;  4HJG H;  4M3L A;  4PD4 E;  5AVS B;  3RK2 C;  2KSJ A;  1ZR4 A;  1JMB A;  1KB9 H;  1L4A D;  2V4H A;  4GDO A;  3L75 G;  1YYC A;  4PV1 C;  5CBO A;  3MP7 B;  5CJ0 A;  3CCQ P;  2A06 G;  3CD6 P;  1E5W A;  1GZL A;  3A0H E;  1L0L K;  1T3U A;  2W6J H;  4LLH A;  2ZXX A;  2BCC E;  3GHG C;  5M1B A;  5E79 E;  3V2R A;  3VMX A;  1YJ9 P;  2G3A A;  1GU4 A;  3RL0 B;  3FX0 A;  4HYT B;  4R4L A;  1N7L A;  1OMI A;  3OW2 O;  2O01 H;  4OGQ B;  1P84 I;  4NPD A;  1Q81 Q;  3KQG A;  3H1I D;  2D2C D;  5BU5 A;  1ZP0 C;  2HOD B;  3HE4 A;  3BRT B;  1QVF O;  4KJM A;  2WSF J;  4JBZ A;  1URQ B;  2KLV A;  1G2C A;  3GMA A;  5KAI H;  4RKU J;  2A45 I;  1LTJ C;  1N86 A;  3G3Z A;  1GL2 D;  4JYB A;  3SWF A;  3CCU P;  1YJN P;  1SVF A;  5DJU B;  3H1L G;  3MHV A;  4ZMD A;  1VQ4 P;  5KLV J;  1RE3 C;  1KIL C;  2YKP A;  3L73 E;  1H89 A;  1SQB K;  1SQV D;  2K9J B;  2W6A A;  1LTG C;  1RE3 A;  2OYI C;  3CX5 I;  1VQP P;  4BWN A;  3CCV P;  3RBZ A;  5GTH H;  2OYH A;  4IFM A;  5AW4 B;  4U3F G;  1DX7 A;  4WVZ A;  2WPQ A;  1FZF A;  5GTI H;  2M3B A;  2ZVN B;  3L70 G;  2WSE J;  4WY4 B;  4EOT A;  1Q86 Q;  2PP6 A;  2QE7 H;  2DW3 A;  5CBN A;  4K3A A;  5AW8 B;  1L0L D;  4B86 A;  2QEX P;  4EI2 A;  3CCS P;  2WZ7 A;  3V4Q A;  2R5D A;  1FZC C;  1AVY A;  1GK4 A;  2AEM A;  4H13 B;  1YI2 P;  3M0A A;  3M06 A;  2KS1 A;  1L0N G;  3GF3 A;  3QH9 A;  5AVQ B;  3SFE C;  1RE4 C;  1JTH A;  1PV3 A;  1NTZ K;  1R5S A;  2K37 A;  3HE5 B;  2IZ0 A;  2POH A;  1KYO I;  1E79 H;  5AVU B;  4AQR D;  1YBK A;  1SQX E;  4BXL A;  3D6Z A;  4RJT A;  1SP4 A;  1IFM A;  2WPR A;  3H1K E;  3AE5 C;  4RO0 A;  1K73 Q;  5AVV B;  2HYN A;  3SWY A;  3HUS B;  3G4S P;  3CCJ P;  1MV8 A;  3AE8 C;  2JR8 A;  1JB0 J;  2A45 H;  1NTK J;  2D2C C;  3WMM 0;  2QA4 P;  4JQ0 D;  3H1I G;  4U3F J;  3G71 P;  4N6J A;  3PHL A;  3F5H A;  2HG5 D;  2N9B A;  2K9Y A;  1DH3 A;  2O1J A;  1GL2 A;  2OGU A;  1KV4 A;  1BE3 D;  4C46 A;  1GL2 C;  3M9B A;  5KLV G;  1QL1 A;  2R32 A;  1SQB J;  2MJZ A;  3H1J J;  2KIK A;  2BCC G;  5CHX A;  1FDM A;  1LTS C;  3CWB G;  3L36 A;  1LGH B;  3GHG A;  3WU2 E;  1MKM A;  4KHX A;  3L71 E;  4H13 D;  4WB4 A;  3Q5S A;  3BVH A;  4MN4 C;  4H44 D;  1BDD A;  2E74 C;  1NO4 A;  4HB1 A;  3U59 A;  2HPC B;  3U1A A;  3PRJ A;  3RK2 D;  1SQP K;  1USD A;  1Y9B A;  2N1T D;  3ZDM A;  3I55 P;  1ZXG A;  3FGA D;  1ZV8 A;  3M9Q A;  2Q9I A;  3VP8 A;  3WUV A;  1X9V A;  2WSC H;  1NTK E;  3MZW B;  3Q5P A;  2P58 A;  4PD4 I;  1NH4 A;  1M56 D;  2KUB A;  1GW3 A;  3AED C;  3HUS C;  3A5T A;  4EDF A;  1N7S C;  2H88 C;  2WWW A;  4A7P A;  3L74 E;  5KAI E;  1N7S A;  2HFE D;  1FAV A;  1L4A A;  1SQV J;  1OVU A;  2N9Y B;  4HH2 A;  2W27 A;  1UIX A;  1PPJ G;  2AXT H;  2Q6Q A;  2RMZ A;  4NPF X;  1M90 Q;  1NTM J;  1ZLL A;  2B89 A;  3RK3 C;  3H1H J;  2YKQ A;  1EZV I;  2BAS A;  2P10 A;  2QJK C;  1L0L J;  2Y0D A;  4I6M C;  1S72 P;  2CPB A;  4GOF A;  1A02 F;  5APT A;  1RQV A;  2L5G B;  2QJK B;  2V7Q J;  3K5B A;  1KIL D;  3RK2 B;  1FZA A;  2K88 A;  5AW6 B;  4OGQ D;  3AEF C;  3II6 A;  3V5B A;  2QM8 A;  1EDL A;  2QM7 A;  4I7Z C;  3TGU J;  1SQX G;  2B88 A;  1NYH A;  2KB7 P;  1SQQ D;  3L37 A;  1L4A B;  2C9L Y;  1N7S B;  3BCC G;  2YO3 A;  3AEB C;  2FXM A;  1N8R Q;  1OWA A;  2G8Y A;  3EFF K;  3M9H A;  5APU A;  1Y47 A;  1FDI A;  1BCC E;  3IR9 A;  1VPC A;  2WQY C;  2ZYD A;  5KLI C;  3NMD A;  4WWI A;  1NVO A;  4PD4 D;  4GT1 A;  3ITK A;  1AQ5 A;  1L2P A;  1FOS F;  1IFI A;  1JOC A;  4EYY Q;  2FYU E;  1HUC A;  5CMZ A;  4H0L B;  1NTZ D;  1K04 A;  1OW6 A;  5KLV D;  3AE7 C;  3UIA A;  2HPC A;  2IBZ E;  2FXP A;  2GUS A;  2XU6 A;  3A0B E;  2J58 A;  3BAT A;  1RF1 B;  4PJ0 E;  3GHG B;  3B5N D;  2B9B A;  2O3J A;  5BVZ A;  1YTZ T;  3H1J D;  2XV5 A;  1VQL P;  3KDP B;  5AVR B;  1VQ5 P;  2ZYG A;  5TIS E;  1NTM K;  3V4W A;  1AQT A;  1BE3 J;  2WPV B;  2QRX A;  5AW7 B;  4AUW A;  3KXD A;  2FYN B;  1GL2 B;  2PAJ A;  5CCH A;  1BSN A;  3S1K A;  3B8E B;  1FZC A;  1P84 E;  2ZT9 C;  2SPZ A;  1BCC J;  1EQ7 A;  1SQB E;  1WT6 A;  2KZI A;  1T2K C;  3LIE A;  3RBX A;  2KYV A;  1USE A;  2KSE A;  2PGD A;  2YIU B;  2QG4 A;  3HUS A;  3RL0 D;  4DT0 A;  3D70 A;  2JO1 A;  2RKL A;  2WTY A;  2RN0 A;  1EZV D;  1JY3 N;  2P67 A;  3H1L D;  4DCK A;  2Q1K A;  1PPJ E;  1JNM A;  4U7J A;  1VQO P;  2XZR A;  2KZJ A;  4NPE A;  1AVO A;  3HE5 A;  1EXJ A;  1YHQ P;  1JTH B;  1PP9 E;  1VQ6 P;  3AE9 C;  1WRG A;  2KS1 B;  1HVV A;  1OVR A;  2YXQ B;  1WMK A;  1KYO E;  2FYN C;  1S3J A;  1SQP J;  3H1I E;  4Y28 J;  4D6T G;  3CC4 P;  1IFJ A;  3I5C A;  1KTM A;  1LTA C;  4XFJ A;  1KFN A;  2HLO A;  5AW1 B;  2OYH B;  3IF4 A;  1RF1 A;  3CCM P;  1FU1 A;  1W5C E;  4WY4 A;  1U7J A;  3RK3 B;  4ASV A;  4ZNC A;  1HBW A;  3SWK A;  3A2A A;  3L73 D;  1FJP A;  3V2Q A;  4TT3 H;  2JKV A;  2NZ2 A;  5CCG A;  1YTZ I;  3L75 E;  2K9J A;  3MUD C;  1VF5 D;  1KOR A;  5TIS H;  1LTB C;  4YPC A;  1BGY G;  2LR2 A;  5CCG C;  3CX5 D;  3E1I A;  1NKN A;  5B66 H;  1FC2 C;  1JUN A;  1VQN P;  3HD7 C;  3CWB D;  1G2C B;  3R2P A;  1URQ A;  1JY2 O;  1DEB A;  3PH0 A;  1M57 D;  1GU5 A;  5C39 A;  2J5U A;  2HOD A;  3HE4 B;  1X8Y A;  4JF7 A;  4K35 A;  5KLI B;  1JEK A;  3FXE A;  3L72 E;  1T2K D;  1CW5 A;  3U1C A;  1KB9 D;  2NPS D;  1NAY A;  2L91 A;  2E76 D;  1NTM D;  3VP9 A;  1J1E C;  1PZQ A;  1S9K E;  2YIU C;  3TSI A;  3IAO A;  4Y99 B;  1EC5 A;  3O8Z A;  1N73 C;  3CC2 P;  2W6B A;  3P8M C;  2JWD A;  1NTZ J;  2BCC D;  3S9O A;  1S2E A;  1BSH A;  1YQ4 C;  4I7Z B;  5TJH A;  1EXI A;  5E79 H;  1N7S D;  1FS0 E;  3KPE A;  2QJY C;  3KHU A;  4H13 C;  2IX7 C;  3BCC J;  1SQP E;  4N78 D;  4U3F E;  5DJT B;  4D6T D;  3L4F A;  2OTJ P;  4IL6 X;  3LW5 J;  3L71 D;  4C7N A;  1N73 B;  3L70 E;  1SQX J;  1Q2N A;  2D2C B;  3GLM A;  3LID A;  3R4Y A;  3TGU G;  3CCL P;  3TYY A;  1VQK P;  1NU1 E;  1AFO A;  1SLQ A;  3CPW O;  2CPS A;  1IFD A;  4Y99 C;  1EZV G;  3BCC E;  3O6Q A;  3OJA B;  1L0N E;  1IFN A;  2M5A B;  2E76 B;  3B5N A;  4UB8 E;  3CX5 H;  1MFZ A;  3AEC C;  3EWK A;  2YXR B;  3KZI E;  3L35 A;  4H0L D;  3TDK A;  1SQQ K;  2KOG A;  1BGY D;  1NTM G;  3W67 A;  1R5L A;  2A06 E;  1LTJ A;  4XE5 B;  1OFC X;  3EQ2 A;  2W90 A;  1OIP A;  3CI9 A;  2FBW C;  1HTL C;  1SFC A;  2XNX A;  5APV A;  3W68 A;  5B5E H;  1LP1 B;  3V2P A;  1DD3 A;  1LTI C;  1M1J A;  1NAF A;  1Q90 D;  4UB6 H;  1L0L E;  2YMY A;  3V6I A;  2E42 A;  1TU3 F;  3CCE P;  1BE3 E;  4ZKP A;  2OYI A;  1IJD B;  5KKZ B;  3VMA A;  4BRY B;  1YIT P;  1U57 A;  2R5B A;  2JWA A;  3P7K A;  1CI6 B;  1PGQ A;  2C0X A;  3RL0 g;  1OW7 A;  2LXC B;  2WSC J;  1L0N K;  3L73 J;  1SQX D;  2GA1 A;  4PV1 D;  5AW2 B;  1LWU C;  3D6Y A;  2W8Z A;  1KIL B;  1SQQ E;  3HTK A;  3B71 A;  5KJ7 A;  1X22 A;  4DZO A;  2R3S A;  2FYU K;  4UB8 H;  1Q7Y Q;  3CWB J;  2PFX A;  2N1T C;  2ZAE B;  2KP8 A;  2BCC J;  3E1R A;  3H1J G;  1ZW0 A;  1HGZ A;  1SQB G;  1URQ D;  3C8V A;  3SFD C;  2C9N Y;  1JY2 P;  2E5T A;  2QJY B;  3B4S A;  3L72 J;  3TGU D;  1K05 A;  3CXH E;  1DIP A;  1J1E B;  2IYO A;  5CCH D;  3Q5R A;  1BDC A;  3JSV C;  3PTZ A;  1HJ0 A;  3H1I J;  4L75 A;  1HJB A;  1YIJ P;  1NTK G;  3AE2 C;  2KLU A;  3MIW A;  1VQ8 P;  5AW0 B;  3VYI A;  1LT1 A;  2FFD A;  2YKO A;  4PV1 B;  1JY3 P;  3HD7 B;  4ASW A;  2WT7 B;  3P8C D;  2Y9Z A;  1FDO A;  4WBA A;  1FZE A;  2Y0C A;  1GW4 A;  5GTH E;  1HGV A;  2ZT9 B;  2H8P D;  4H44 B;  3A0B H;  4I1L A;  1XTG B;  3D71 A;  1M1K Q;  1EDI A;  3ABV C;  4W7Y A;  1HF9 A;  4JYC A;  3H6P A;  4GOD A;  1LWU B;  2P2U A;  1L0N J;  1M7L A;  3FWL A;  3MUD A;  2Q5U A;  1IFP A;  3JCU H;  4I2L C;  3G9R A;  3CMA P;  3Q3D A;  1Q82 Q;  2GM4 A;  2ZYA A;  4H0L C;  3VMY A;  1KQL A;  4AYC A;  5B66 E;  3B5N C;  3AEG C;  1YJW P;  1EDJ A;  1PGP A;  2KNC A;  4WY4 D;  2E43 A;  1HH0 A;  3L70 J;  2B87 A;  2UWJ E;  5CCH C;  5KKZ C;  1R8E A;  1BCC D;  1GMJ A;  2JP3 A;  2N1T A;  1KB9 I;  1J1D B;  4R4M A;  1VQM P;  1W2B O;  2Z4E A;  3H32 A;  3EFG A;  1XTC C;  1CZQ A;  3G6E P;  4W7Z A;  2V7Q H;  3NTN A; 
#chains in the Genus database with same CATH homology
 1SQV J;  1SQX J;  1NTM J;  1NU1 J;  1SQB J;  3H1L J;  3H1H J;  2FYU J;  1EZV I;  3H1J J;  3L73 J;  4D6T J;  1L0L J;  1SQQ J;  1P84 I;  3H1K J;  1KYO I;  2IBZ I;  3L74 J;  1PP9 J;  3CWB J;  1L0N J;  2BCC J;  3L71 J;  3TGU J;  1SQP J;  3L72 J;  1BGY J;  5KLV J;  3CXH I;  1BE3 J;  3CX5 I;  3L70 J;  1NTK J;  4PD4 I;  1NTZ J;  3L75 J;  4U3F J;  3H1I J;  1KB9 I;  1BCC J;  3BCC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...