1P84I

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
55
structure length
55
Chain Sequence
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
total genus 17
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1p84I00
4U3FJ 1KB9I 3L71J 3CXHI 1SQXJ 1PP9J 3H1JJ 3H1LJ 1BE3J 3CX5I 1L0NJ 2BCCJ 3H1HJ 1NU1J 3L73J 3TGUJ 1SQPJ 3CWBJ 3L72J 3H1KJ 4PD4I 4D6TJ 1KYOI 1L0LJ 2FYUJ 3BCCJ 1SQQJ 3L74J 3H1IJ 3L70J 1NTZJ 1EZVI 1P84I 1SQBJ 5KLVJ 1NTKJ 3L75J 1BGYJ 1SQVJ 2IBZI 1BCCJ 1NTMJ
chains in the Genus database with same CATH superfamily
3RK3B 3GMAA 3H1IE 3C1LA 1L0NJ 1S9KD 3L37A 2HLOA 1QL2A 1KYOE 1YQ4C 1FE6A 2C9NY 3TF5A 2E75B 1GD2E 2E76D 1H89A 3RK2C 1VQMP 2FYUG 2Y9ZA 1H0TB 2XV5A 2K9YA 2V4HA 3RL0B 1EZVI 2WSCH 1JY3N 1S3JA 3FX0A 2K9JA 2ZT9C 1NU1D 4ZNCA 2Q7CA 2IBZD 2M0BA 2PP6A 3L71E 5AVQB 1VPCA 3KXDA 1N7SD 3VOPA 3A0HH 3JSVC 1SQXJ 2N9BA 5KAFE 4NPEA 2BCCJ 4TLFA 4Y99C 1FAVA 2OGUA 1HJBA 4YXWH 1NAYA 2IYPA 2H7HA 3TGUG 2QRXA 1EXIA 3IAOA 1MFZA 1CI6B 2NZ2A 1EDKA 1NHLA 3RK3C 3I5CA 1LTJB 4N6JA 4BRYB 3Q2YA 3H1KE 1EXJA 1M90Q 1G1JA 3SFDC 1FS0E 5KAIH 2WQYC 1OIPA 3RGUA 2FXPA 3C9IA 3B8EB 2OYHA 3CLQA 2C0XA 1GW4A 2E75C 4I2LC 2AXTH 2R5DA 2ZYDA 3HTKB 5CBNA 1VQNP 2K88A 3L4FA 3H1HD 1QX8A 2O01J 2P67A 4H13D 3GHGB 3RL0C 5E79H 2QVAA 4N78D 4RKUJ 1BSHA 2A06E 3B71A 3WMM0 2FYZA 4XFJA 1ZMEC 5AVXB 1NU1E 1N7LA 5KLVJ 2NPSA 3P7KA 3L75J 1W2EA 1GDTA 3HRNA 2IBZE 5KTBA 2HPCA 1RE4C 1JMBA 1CI6A 1SVFA 1EZVD 1LTJA 4DZOA 4BRYA 3L74D 5AW4B 2KZJA 1LGHB 3V6IA 3CC7P 2N1TD 3WU2H 3R4YA 1CW5A 1PGJA 2ZVNB 2JR8A 3B4SA 5APWA 3L70G 1NAFA 1QVGO 2FYUK 3HTKA 3PH0A 1NTZD 5TISE 1LTBC 1M8OB 1Y9BA 4U3FD 1LTJC 1IFIA 2UWJE 3H1JJ 1MZ9A 2QJPB 3Q5PA 3USSA 1LTTC 1J1EB 3MP7B 5APTA 2FBWC 1FOSE 1VQ7P 5GTHH 3CCVP 3BCCJ 2WPVB 1W2BO 1KILD 4R4LA 1S5LX 2I1KA 1OVRA 1N2DC 5CJ0A 1DX7A 3H25A 2K1AA 3GHGC 3NXSA 5CCHA 4PV1B 1PGOA 4LGDE 2KIKA 5B5EH 5CCGA 2WSEH 1OW6A 2XKMA 1SQPG 3KZIH 3O6QB 2WWWA 3Q3DA 1X22A 1KYOI 3HUSB 3KDPB 5APVA 3CD6P 1PPJG 1FDIA 4W7ZA 1BGYJ 3AE3C 4WB4A 3MIWA 3OW2O 5CCHC 2GUVA 1OMIA 1AVOA 2FXOA 5AVYB 2L5GB 2JWAA 1VF5D 1YJNP 1BE3E 2HFED 1L4AB 1PP9G 3L72E 5CHXA 1P84E 3H1HJ 1KQFB 3D70A 3L73D 1NTZE 3M9QA 2FFDB 4GDOA 2HODA 2V7QJ 5DJTB 3V2RA 1SQQK 1VL2A 2WITA 2QJPC 2E43A 1J1EC 1RQVA 3IR9A 1QL1A 2W90A 5GTIE 1K04A 1J1DB 3O6QA 4D6TD 4NPDA 3D6YA 3RBZA 4AYCA 3HUSA 2QIWA 1KFNA 3F5HA 3ZDMA 4PV1C 4EYYQ 1RE3A 4PJ0E 2D2CB 1KORA 3V2NA 3Q1MA 3CWBD 1FU1A 4OGQB 5KLVG 2E42A 3HE5A 1VQPP 1L4AA 4UB8H 4U7JA 1URQD 1IFPA 3H32B 2P1JA 2KS1B 5AW3B 1JY2O 4U3FJ 1L0NK 2ZYGA 2FFDA 3CCQP 3EFGA 1GK4A 3TGUJ 3VN0A 1L0LD 2RMZA 2W27A 1A02J 2IPPA 2R3CA 3H1ID 1SQBK 1KMIZ 4WY4A 3VTPC 3B5NB 3JCUH 5AVTB 3G9RA 2IX7C 1KYOD 1SQQE 3AEGC 3U1CA 1L4AC 1Q81Q 4ASWA 1GL2D 1JUNA 3H1LE 3NMDA 1LP1B 4H0LD 2C9LY 3AECC 2FFDC 1M57D 1X9VA 4I6MC 4JQ0D 2IBZI 5AVZB 3P32A 3O8ZA 2WSFH 3E1RA 1PZQA 3TK1A 4ZMDA 4IFMA 1J1DC 2Z5HA 5KKZB 1QLED 1T2KD 2BEQD 3H32A 4D6TE 2A45G 5TJHA 2XDJA 1SQXK 2P2UA 3L71D 2KUBA 3EWKA 1YQ3C 1LT9A 2YKOA 3BASA 5DJUB 2A45H 1L0NE 2D2CC 3TSIA 2RN0A 1NTKK 3LW5H 3B5NA 1PL5A 4OGQC 1MKMA 3CCEP 4GODA 1SQBE 1ZP0C 1LTGC 1Y8AA 1LT1A 1HWTC 2WT7B 1PGPA 1LP1A 4PD4E 3CC2P 1VQ6P 1FZBA 5H2FH 2OARA 4DOJA 3PLNA 3H1KD 1H88A 1T3UA 2B87B 3CXHE 3NTNA 3B5NC 1IFMA 4GOEA 3V4QA 3H1HG 5APSA 1KN7A 3JC22 4AQRD 1TU3F 5M1BA 3CCLP 1XTCC 1JTHB 1SS1A 1KB9E 2AXCA 2LXCB 2G3AA 2LKMA 1FZFA 4Z1MH 3CWBJ 2JO1A 2WSEJ 2YIUB 1SQXE 5KLVK 2BCCE 1UIXA 5KJ7A 2V7QH 2QJKB 1SQVK 4R4MA 2XNXA 2A06D 5KKZC 1FDOA 1EZVG 2H8PD 5AW6B 1NTKE 3L74G 3AE4C 4RJTA 3BATA 1SQPJ 4C7NB 2WT7A 1RH5B 3S9OA 3TNUB 3HD7D 3G71P 1FJPA 2WMMA 1P84I 2M8RA 1DD4A 1ZW0A 3W68A 1WMKA 2N9YB 2B87A 1J2JB 5KJ7C 1NTZG 1VDFA 2WVRA 2JEEA 3S1KA 1U7MA 1FC2C 4IFFA 3VMYA 3FGAD 4U3FG 2OTJP 4UB6H 4EI2A 1JTHA 2YKQA 4GKGA 1PP9J 3AE7C 3A5TA 3PRJA 2J58A 2W6JH 1YIJP 4EIJA 4ASVA 1H0TA 3PHLA 1RQUA 4KHXA 1DD3A 1KILB 1NO4A 1K9MQ 2CPSA 4OWFA 1RF1B 2Z4EA 1X0TA 1T6AA 2B9BA 3L71J 3L75E 4C7NA 1SQVE 3G3ZA 3TNUA 1SLQA 4JF7A 4I1LA 1EC5A 2B89A 1RE4A 3RL0g 1NTMK 2MJZA 2YIUC 3G6EP 1CSBA 2KK7A 5APUA 2QJKC 5AVUB 4QMAA 3WUVA 1S5LE 1IK9A 3HE4B 2PFXA 1IFDA 1OFCX 1YJWP 3EQ2A 1QVFO 4HJGH 2J5UA 2R44A 4K35A 2E75D 2JJLA 2ZYAA 1T8ZA 1NYHA 4IL6H 1SP4A 2E74B 5B66E 1SFCB 3AE5C 3H1JE 1KILA 4GOFA 1USDA 4JYCA 2OYIB 4JBZA 3L73G 3M9BA 4EDFA 3BCCE 3P8CE 3A0BH 1BE3D 1VQLP 5AW2B 1HVVA 3L72D 2LXBA 1BCCE 1P84D 3ABVC 2I1JA 2ITAA 1R5LA 2WSFJ 1K05A 3GHGA 3V4WA 1KILC 3SWFA 1NU1J 1RF1C 3VP8A 1NTME 3HE4A 3CMAP 3BVHA 2GA1A 1IFJA 3N4XA 2P7JA 4C46A 1NOHA 3TDKA 2NPSD 1FDMA 2K37A 1R5SA 3CWBG 2E5TA 1KQSO 3AEEC 3LIEA 1BGYE 2KLVA 2OTLP 1SFCA 4PD4I 3LW5J 2I8DA 3CCJP 2P58A 3RK3E 3CI9A 1FZCB 2OYIA 3A2AA 2O1KA 1DIPA 1OWAA 1L0LG 1Q82Q 3CXHI 2KYVA 1ZLLA 3H1IG 1X8YA 2E5YA 1JEKA 1BSNA 2YMYA 4WBAA 3AE8C 2E74C 1SFCC 2W6BA 1JOCA 3M91A 5C39A 2FYUE 3A3YB 1KB9I 2Y0DA 1HTLC 1U7JA 2QEXP 3E7KA 2ZFCA 3CCMP 4EOTA 2OYIC 5CBOA 1M7LA 2QSIA 1KYOH 1SQQD 4H0LB 1FZGA 3AEAC 1IFNA 4JYBA 4TT3H 1M1JB 3H1LD 2KB7P 2K3RA 2FYNC 1DH3A 2JKVA 4NPFX 3A0HE 1KZUB 1HGZA 5AW7B 3D71A 2WZ7A 2PGDA 1EQ7A 4L73A 5CCHD 1Y47A 1FZCA 2YKPA 5CCGD 3L71G 2GUSA 2YMKA 1FOSF 1HUCA 1JY2P 1OX3A 3AEFC 5AW8B 3AE9C 4DJGA 2ZXXA 2KXPB 3TGUE 3L74J 1HJ0A 1EDIA 3CCSP 1UIIA 4KT0J 1L0ND 5KAFH 1Q7YQ 1ZR2A 1FZCC 1BE3J 5EFWB 1GW3A 3L72J 3W67A 1NKNA 2KOGA 1Q90D 2AXTE 1SQBD 5CJ4A 1NTZJ 5AW0B 1WT6A 1LNQA 2IFMA 2IFNA 1USEA 5AVVB 3RBXA 3H1KG 4PD4D 3KQGA 1NVOA 1HBWA 5E79E 2QJYB 3BRVB 1IC2A 3QWOC 1JNMA 3M0AA 1GZLA 3CXHD 1Q86Q 1KQLA 4H0LC 2KSEA 2E76B 2VRSA 4A7PA 1M1JC 2W8ZA 1MFTA 1JMMA 2L91A 3KYQA 3U59A 1S2EA 2OQQA 3P8MC 1KB9D 2A06G 1JO5A 2AEMA 3CX5D 1Z56A 2W83C 3WU2E 1VQKP 3V2QA 1NU1G 1T2KC 1SQXD 2WPQA 5BU8B 2BCCD 3ITKA 1SQPK 2M5AB 2IBZG 2JP3A 3CL3D 1AQ5A 2QM8A 3HD7B 3I55P 2H43A 1JY3O 1NTKD 5APYA 1L4AD 1ZV8A 1N7SB 2KS1A 1YTZI 2KNCB 1IJDB 2O01N 1GTWA 1YITP 3L70E 1RF0C 1MV8A 1JB0J 2HG5D 1JM0A 5GTHE 2AEFA 2WSSH 1SQQJ 1PFIA 2OYOA 4WY4D 1LTAC 3H1LJ 4LLHA 3AEBC 2H89C 1ZXGA 1BDCA 3I56P 1E79H 3WUTA 3L73J 2YO3A 1OVUA 4CPGA 1ZRTE 5TISH 2W6AA 4M3LA 2JDIH 3Q5RA 4IFDK 4IL6X 2QJYC 4MN4C 3L35A 3GG2A 4H44D 5L8RJ 3KZIE 3BRTB 2M5AA 2D2CD 1JY2N 4C7RA 4D6TJ 4OGQD 4OVNF 2E76C 3WUUA 3MUDC 2WTYA 3L75D 1SQPE 1N73C 1N7SA 1SQVD 3A7OA 4H13B 1KV4A 1NH4A 4XA4A 1VQOP 1PPJE 3CX5E 1PV3A 4HH2A 1SQBJ 3PJSK 3B5ND 4W7YA 5AW9B 1EDLA 3VYIA 3HD7C 1GMJA 3K5BA 1OW7A 2KSJA 2BASA 1VQ9P 2ZAEB 1N7SC 1L0LJ 1PP9E 2H88C 2N1TB 3H1IJ 3RK2D 1BE3G 4K3AA 1S72P 3H1JD 2OTKE 3L72G 1ZN5A 2XZRA 2Q9IA 2OYHB 1VQ4P 4JPZB 1D7MA 3BCCD 2IZ1A 3P8CD 1YI2P 1G2CB 3CPWO 4O9BA 1LWUB 1ZOYC 2ZT9D 4I7ZB 1M1KQ 1BCCD 1P84H 3S4RA 3FXEA 2J59M 3V5BA 3VMXA 1YBKA 2WPRA 3KPEA 1W5CE 1NU1K 4BWNA 1NWQA 3Q5SA 1FJKA 3G4SP 2KP8A 2IYOA 1GK6A 4DCKA 2Q1KA 2Q6QA 4UB8E 1NTKJ 5KJ7D 1NTMD 2NPSB 5GTIH 2RH0A 1YYCA 3NFQA 2FKWB 2HPCB 5KLVE 4LC1A 3AE2C 4H13C 3M06A 1U57A 3U1AA 2KI7B 2N1TA 3L36A 1BGYD 1GU4A 3GF7A 1S9KE 3JCUE 3RK3D 3CMEP 4PJ0H 2YO2A 1X79B 1EDJA 1NJIQ 1YTZT 1G2CA 2YXQB 1LWUA 1N8RQ 1AVYA 3E1IA 3GLMA 3D6ZA 5AVRB 2N1TC 1SQQG 3M0DA 4ZKUA 2QE7H 3H1KJ 2FYUD 1VF5B 3H1LG 4HKZH 2OYHC 3RL0D 5CMZA 3OJAB 1RF1A 1SQVJ 2YNYA 4IOIH 1LWUC 2Z5IA 4I7ZC 4L74A 2O1JA 2RKLA 3MHVA 3R2PA 2Y9YA 2AEJA 2FYNB 1XTGB 3IN6A 3M0DC 1K8AQ 2O3JA 2BEZF 3SWKA 3VMAA 3CCUP 4D6TG 4W80A 3OAKA 4L76A 2NPSC 3KHUA 1LTIC 5AW5B 4KJMA 2SPZA 2KLUA 3T97B 3SSUA 1PIXA 1JCCA 1T3JA 1L0NG 3OA7A 1K73Q 5H2FE 5APQA 3TGUD 1NGMB 5APXA 1VQ8P 2FY8A 1SQBG 3AE6C 1NTZK 1URQB 2QM7A 2KZIA 1BCCJ 5BU5A 4DT0A 4HB1A 3H1HE 3MTUE 2HODB 3CCRP 4PD4H 1N86A 1WRGA 3IF4A 5AVWB 3V2PA 3VMZA 4N78E 1NTMJ 1VF5C 1CZQA 2DW3A 5K5GB 3CXHH 3CX5I 1GL2B 1FZEA 4RESB 1LTSC 4YTPC 1HH0A 2FXMA 5AVSB 3T97A 3LIDA 1OXZA 4RO0A 1OW8A 1L2PA 2M3EA 2QG4A 1SQXG 2BCCG 1EZVE 3FWNA 3TYYA 1OZHA 3L74E 1NKZB 1KB9H 5CCGC 1JCDA 3CX5H 2E74D 1SFCD 3GW6A 1NTKG 2ZJSE 3HE5B 4N3YB 1PGQA 2HYNA 1DEBA 1URQA 3AEDC 1RHZB 4UB6E 1M56D 1YJ9P 1R8EA 4WVZA 1VQ5P 1AQTA 2WSCJ 4U3FE 4XE5B 2C0WA 2R5BA 2FYUJ 2MKVA 3L70D 1KTMA 4ZKPA 4WY4B 3N7NA 4AUWA 1AA0A 5KAIE 1E5WA 3MGNA 1URQC 2HR3A 1GL2A 1KILE 2CK3H 2G8YA 1FBMA 4B86A 1BDDA 1H8AA 3IFMA 1AV1A 3MZWB 2GM4A 2YXRB 1M1JA 1ZRTD 4H44B 1KFMA 2O01H 1FZAA 3QH9A 3L75G 1SQVG 2CPBA 1S1CX 4PV1D 1HF9A 2M3BA 1GL2C 2Y0EA 1JY3P 5BVZA 5KLIB 4OH8B 1LJ2A 4HYTB 1KD1Q 3HUSC 2R32A 4IL6E 3SFEC 1SQPD 1OVVA 1MUUA 1ZR4A 1N73B 2Q5UA 1LT9B 1QEXA 2Q3EA 1RE3C 3GF3A 4L75A 1RF0A 4GIFA 1QGKB 4BXLA 1PPJD 2KNCA 1IZNB 4WWIA 2Q3IA 2JWDA 2XU6A 3A0BE 3M9HA 3UIAA 1S5LH 3F89A 1L0LK 4YXDC 1HGVA 2WPSA 3EFFK 3L73E 3RK2B 3H1JG 1G1IA 1RY3A 2IDBA 1PP9D 1AJYA 2LR2A 2QA4P 4WY4C 3BCCG 5B66H 2POHA 1IO4A 2A45I 2ZVOB 1A02F 1BCCG 2NRGA 2ZT9B 2PRRA 3FWLA 2PAJA 3H6PA 3AE1C 3C8VA 4YPCA 3MUDA 3CC4P 1N73A 3II6A 4GT1A 2P10A 1GU5A 4H44C 1DEEG 1AFOA 3VP9A 1NTMG 4Y28J 1KQGB 3CWBE 5B5EE 1KC8Q 3SWYA 2ZXEB 4Y99B 3PTZA 2K9JB 3PP5A 2IZ0A 5KLIC 2XNDH 5AW1B 1Q2NA 3MD0A 1BGYG 3HD7A 1S4XA 1IK7A 1YHQP 2B88A 2Y0CA 5KLVD 3L70J 2R3SA 1LT9C 1L0LE 3FXDA
chains in the Genus database with same CATH topology
4U3FJ 1KB9I 3L71J 3CXHI 1SQXJ 1PP9J 3H1JJ 3H1LJ 1BE3J 3CX5I 1L0NJ 2BCCJ 3H1HJ 1NU1J 3L73J 3TGUJ 1SQPJ 3CWBJ 3L72J 3H1KJ 4PD4I 4D6TJ 1KYOI 1L0LJ 2FYUJ 3BCCJ 1SQQJ 3L74J 3H1IJ 3L70J 1NTZJ 1EZVI 1P84I 1SQBJ 5KLVJ 1NTKJ 3L75J 1BGYJ 1SQVJ 2IBZI 1BCCJ 1NTMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U3F J;  1KB9 I;  3L71 J;  3CXH I;  1SQX J;  1PP9 J;  3H1J J;  3H1L J;  1BE3 J;  3CX5 I;  1L0N J;  2BCC J;  3H1H J;  1NU1 J;  3L73 J;  3TGU J;  1SQP J;  3CWB J;  3L72 J;  3H1K J;  4PD4 I;  4D6T J;  1KYO I;  1L0L J;  2FYU J;  3BCC J;  1SQQ J;  3L74 J;  3H1I J;  3L70 J;  1NTZ J;  1EZV I;  1P84 I;  1SQB J;  5KLV J;  1NTK J;  3L75 J;  1BGY J;  1SQV J;  2IBZ I;  1BCC J;  1NTM J; 
#chains in the Genus database with same CATH topology
 3RK3 B;  3GMA A;  3H1I E;  3C1L A;  1L0N J;  1S9K D;  3L37 A;  2HLO A;  1QL2 A;  1KYO E;  1YQ4 C;  1FE6 A;  2C9N Y;  3TF5 A;  2E75 B;  1GD2 E;  2E76 D;  1H89 A;  3RK2 C;  1VQM P;  2FYU G;  2Y9Z A;  1H0T B;  2XV5 A;  2K9Y A;  2V4H A;  3RL0 B;  1EZV I;  2WSC H;  1JY3 N;  1S3J A;  3FX0 A;  2K9J A;  2ZT9 C;  1NU1 D;  4ZNC A;  2Q7C A;  2IBZ D;  2M0B A;  2PP6 A;  3L71 E;  5AVQ B;  1VPC A;  3KXD A;  1N7S D;  3VOP A;  3A0H H;  3JSV C;  1SQX J;  2N9B A;  5KAF E;  4NPE A;  2BCC J;  4TLF A;  4Y99 C;  1FAV A;  2OGU A;  1HJB A;  4YXW H;  1NAY A;  2IYP A;  2H7H A;  3TGU G;  2QRX A;  1EXI A;  3IAO A;  1MFZ A;  1CI6 B;  2NZ2 A;  1EDK A;  1NHL A;  3RK3 C;  3I5C A;  1LTJ B;  4N6J A;  4BRY B;  3Q2Y A;  3H1K E;  1EXJ A;  1M90 Q;  1G1J A;  3SFD C;  1FS0 E;  5KAI H;  2WQY C;  1OIP A;  3RGU A;  2FXP A;  3C9I A;  3B8E B;  2OYH A;  3CLQ A;  2C0X A;  1GW4 A;  2E75 C;  4I2L C;  2AXT H;  2R5D A;  2ZYD A;  3HTK B;  5CBN A;  1VQN P;  2K88 A;  3L4F A;  3H1H D;  1QX8 A;  2O01 J;  2P67 A;  4H13 D;  3GHG B;  3RL0 C;  5E79 H;  2QVA A;  4N78 D;  4RKU J;  1BSH A;  2A06 E;  3B71 A;  3WMM 0;  2FYZ A;  4XFJ A;  1ZME C;  5AVX B;  1NU1 E;  1N7L A;  5KLV J;  2NPS A;  3P7K A;  3L75 J;  1W2E A;  1GDT A;  3HRN A;  2IBZ E;  5KTB A;  2HPC A;  1RE4 C;  1JMB A;  1CI6 A;  1SVF A;  1EZV D;  1LTJ A;  4DZO A;  4BRY A;  3L74 D;  5AW4 B;  2KZJ A;  1LGH B;  3V6I A;  3CC7 P;  2N1T D;  3WU2 H;  3R4Y A;  1CW5 A;  1PGJ A;  2ZVN B;  2JR8 A;  3B4S A;  5APW A;  3L70 G;  1NAF A;  1QVG O;  2FYU K;  3HTK A;  3PH0 A;  1NTZ D;  5TIS E;  1LTB C;  1M8O B;  1Y9B A;  4U3F D;  1LTJ C;  1IFI A;  2UWJ E;  3H1J J;  1MZ9 A;  2QJP B;  3Q5P A;  3USS A;  1LTT C;  1J1E B;  3MP7 B;  5APT A;  2FBW C;  1FOS E;  1VQ7 P;  5GTH H;  3CCV P;  3BCC J;  2WPV B;  1W2B O;  1KIL D;  4R4L A;  1S5L X;  2I1K A;  1OVR A;  1N2D C;  5CJ0 A;  1DX7 A;  3H25 A;  2K1A A;  3GHG C;  3NXS A;  5CCH A;  4PV1 B;  1PGO A;  4LGD E;  2KIK A;  5B5E H;  5CCG A;  2WSE H;  1OW6 A;  2XKM A;  1SQP G;  3KZI H;  3O6Q B;  2WWW A;  3Q3D A;  1X22 A;  1KYO I;  3HUS B;  3KDP B;  5APV A;  3CD6 P;  1PPJ G;  1FDI A;  4W7Z A;  1BGY J;  3AE3 C;  4WB4 A;  3MIW A;  3OW2 O;  5CCH C;  2GUV A;  1OMI A;  1AVO A;  2FXO A;  5AVY B;  2L5G B;  2JWA A;  1VF5 D;  1YJN P;  1BE3 E;  2HFE D;  1L4A B;  1PP9 G;  3L72 E;  5CHX A;  1P84 E;  3H1H J;  1KQF B;  3D70 A;  3L73 D;  1NTZ E;  3M9Q A;  2FFD B;  4GDO A;  2HOD A;  2V7Q J;  5DJT B;  3V2R A;  1SQQ K;  1VL2 A;  2WIT A;  2QJP C;  2E43 A;  1J1E C;  1RQV A;  3IR9 A;  1QL1 A;  2W90 A;  5GTI E;  1K04 A;  1J1D B;  3O6Q A;  4D6T D;  4NPD A;  3D6Y A;  3RBZ A;  4AYC A;  3HUS A;  2QIW A;  1KFN A;  3F5H A;  3ZDM A;  4PV1 C;  4EYY Q;  1RE3 A;  4PJ0 E;  2D2C B;  1KOR A;  3V2N A;  3Q1M A;  3CWB D;  1FU1 A;  4OGQ B;  5KLV G;  2E42 A;  3HE5 A;  1VQP P;  1L4A A;  4UB8 H;  4U7J A;  1URQ D;  1IFP A;  3H32 B;  2P1J A;  2KS1 B;  5AW3 B;  1JY2 O;  4U3F J;  1L0N K;  2ZYG A;  2FFD A;  3CCQ P;  3EFG A;  1GK4 A;  3TGU J;  3VN0 A;  1L0L D;  2RMZ A;  2W27 A;  1A02 J;  2IPP A;  2R3C A;  3H1I D;  1SQB K;  1KMI Z;  4WY4 A;  3VTP C;  3B5N B;  3JCU H;  5AVT B;  3G9R A;  2IX7 C;  1KYO D;  1SQQ E;  3AEG C;  3U1C A;  1L4A C;  1Q81 Q;  4ASW A;  1GL2 D;  1JUN A;  3H1L E;  3NMD A;  1LP1 B;  4H0L D;  2C9L Y;  3AEC C;  2FFD C;  1M57 D;  1X9V A;  4I6M C;  4JQ0 D;  2IBZ I;  5AVZ B;  3P32 A;  3O8Z A;  2WSF H;  3E1R A;  1PZQ A;  3TK1 A;  4ZMD A;  4IFM A;  1J1D C;  2Z5H A;  5KKZ B;  1QLE D;  1T2K D;  2BEQ D;  3H32 A;  4D6T E;  2A45 G;  5TJH A;  2XDJ A;  1SQX K;  2P2U A;  3L71 D;  2KUB A;  3EWK A;  1YQ3 C;  1LT9 A;  2YKO A;  3BAS A;  5DJU B;  2A45 H;  1L0N E;  2D2C C;  3TSI A;  2RN0 A;  1NTK K;  3LW5 H;  3B5N A;  1PL5 A;  4OGQ C;  1MKM A;  3CCE P;  4GOD A;  1SQB E;  1ZP0 C;  1LTG C;  1Y8A A;  1LT1 A;  1HWT C;  2WT7 B;  1PGP A;  1LP1 A;  4PD4 E;  3CC2 P;  1VQ6 P;  1FZB A;  5H2F H;  2OAR A;  4DOJ A;  3PLN A;  3H1K D;  1H88 A;  1T3U A;  2B87 B;  3CXH E;  3NTN A;  3B5N C;  1IFM A;  4GOE A;  3V4Q A;  3H1H G;  5APS A;  1KN7 A;  3JC2 2;  4AQR D;  1TU3 F;  5M1B A;  3CCL P;  1XTC C;  1JTH B;  1SS1 A;  1KB9 E;  2AXC A;  2LXC B;  2G3A A;  2LKM A;  1FZF A;  4Z1M H;  3CWB J;  2JO1 A;  2WSE J;  2YIU B;  1SQX E;  5KLV K;  2BCC E;  1UIX A;  5KJ7 A;  2V7Q H;  2QJK B;  1SQV K;  4R4M A;  2XNX A;  2A06 D;  5KKZ C;  1FDO A;  1EZV G;  2H8P D;  5AW6 B;  1NTK E;  3L74 G;  3AE4 C;  4RJT A;  3BAT A;  1SQP J;  4C7N B;  2WT7 A;  1RH5 B;  3S9O A;  3TNU B;  3HD7 D;  3G71 P;  1FJP A;  2WMM A;  1P84 I;  2M8R A;  1DD4 A;  1ZW0 A;  3W68 A;  1WMK A;  2N9Y B;  2B87 A;  1J2J B;  5KJ7 C;  1NTZ G;  1VDF A;  2WVR A;  2JEE A;  3S1K A;  1U7M A;  1FC2 C;  4IFF A;  3VMY A;  3FGA D;  4U3F G;  2OTJ P;  4UB6 H;  4EI2 A;  1JTH A;  2YKQ A;  4GKG A;  1PP9 J;  3AE7 C;  3A5T A;  3PRJ A;  2J58 A;  2W6J H;  1YIJ P;  4EIJ A;  4ASV A;  1H0T A;  3PHL A;  1RQU A;  4KHX A;  1DD3 A;  1KIL B;  1NO4 A;  1K9M Q;  2CPS A;  4OWF A;  1RF1 B;  2Z4E A;  1X0T A;  1T6A A;  2B9B A;  3L71 J;  3L75 E;  4C7N A;  1SQV E;  3G3Z A;  3TNU A;  1SLQ A;  4JF7 A;  4I1L A;  1EC5 A;  2B89 A;  1RE4 A;  3RL0 g;  1NTM K;  2MJZ A;  2YIU C;  3G6E P;  1CSB A;  2KK7 A;  5APU A;  2QJK C;  5AVU B;  4QMA A;  3WUV A;  1S5L E;  1IK9 A;  3HE4 B;  2PFX A;  1IFD A;  1OFC X;  1YJW P;  3EQ2 A;  1QVF O;  4HJG H;  2J5U A;  2R44 A;  4K35 A;  2E75 D;  2JJL A;  2ZYA A;  1T8Z A;  1NYH A;  4IL6 H;  1SP4 A;  2E74 B;  5B66 E;  1SFC B;  3AE5 C;  3H1J E;  1KIL A;  4GOF A;  1USD A;  4JYC A;  2OYI B;  4JBZ A;  3L73 G;  3M9B A;  4EDF A;  3BCC E;  3P8C E;  3A0B H;  1BE3 D;  1VQL P;  5AW2 B;  1HVV A;  3L72 D;  2LXB A;  1BCC E;  1P84 D;  3ABV C;  2I1J A;  2ITA A;  1R5L A;  2WSF J;  1K05 A;  3GHG A;  3V4W A;  1KIL C;  3SWF A;  1NU1 J;  1RF1 C;  3VP8 A;  1NTM E;  3HE4 A;  3CMA P;  3BVH A;  2GA1 A;  1IFJ A;  3N4X A;  2P7J A;  4C46 A;  1NOH A;  3TDK A;  2NPS D;  1FDM A;  2K37 A;  1R5S A;  3CWB G;  2E5T A;  1KQS O;  3AEE C;  3LIE A;  1BGY E;  2KLV A;  2OTL P;  1SFC A;  4PD4 I;  3LW5 J;  2I8D A;  3CCJ P;  2P58 A;  3RK3 E;  3CI9 A;  1FZC B;  2OYI A;  3A2A A;  2O1K A;  1DIP A;  1OWA A;  1L0L G;  1Q82 Q;  3CXH I;  2KYV A;  1ZLL A;  3H1I G;  1X8Y A;  2E5Y A;  1JEK A;  1BSN A;  2YMY A;  4WBA A;  3AE8 C;  2E74 C;  1SFC C;  2W6B A;  1JOC A;  3M91 A;  5C39 A;  2FYU E;  3A3Y B;  1KB9 I;  2Y0D A;  1HTL C;  1U7J A;  2QEX P;  3E7K A;  2ZFC A;  3CCM P;  4EOT A;  2OYI C;  5CBO A;  1M7L A;  2QSI A;  1KYO H;  1SQQ D;  4H0L B;  1FZG A;  3AEA C;  1IFN A;  4JYB A;  4TT3 H;  1M1J B;  3H1L D;  2KB7 P;  2K3R A;  2FYN C;  1DH3 A;  2JKV A;  4NPF X;  3A0H E;  1KZU B;  1HGZ A;  5AW7 B;  3D71 A;  2WZ7 A;  2PGD A;  1EQ7 A;  4L73 A;  5CCH D;  1Y47 A;  1FZC A;  2YKP A;  5CCG D;  3L71 G;  2GUS A;  2YMK A;  1FOS F;  1HUC A;  1JY2 P;  1OX3 A;  3AEF C;  5AW8 B;  3AE9 C;  4DJG A;  2ZXX A;  2KXP B;  3TGU E;  3L74 J;  1HJ0 A;  1EDI A;  3CCS P;  1UII A;  4KT0 J;  1L0N D;  5KAF H;  1Q7Y Q;  1ZR2 A;  1FZC C;  1BE3 J;  5EFW B;  1GW3 A;  3L72 J;  3W67 A;  1NKN A;  2KOG A;  1Q90 D;  2AXT E;  1SQB D;  5CJ4 A;  1NTZ J;  5AW0 B;  1WT6 A;  1LNQ A;  2IFM A;  2IFN A;  1USE A;  5AVV B;  3RBX A;  3H1K G;  4PD4 D;  3KQG A;  1NVO A;  1HBW A;  5E79 E;  2QJY B;  3BRV B;  1IC2 A;  3QWO C;  1JNM A;  3M0A A;  1GZL A;  3CXH D;  1Q86 Q;  1KQL A;  4H0L C;  2KSE A;  2E76 B;  2VRS A;  4A7P A;  1M1J C;  2W8Z A;  1MFT A;  1JMM A;  2L91 A;  3KYQ A;  3U59 A;  1S2E A;  2OQQ A;  3P8M C;  1KB9 D;  2A06 G;  1JO5 A;  2AEM A;  3CX5 D;  1Z56 A;  2W83 C;  3WU2 E;  1VQK P;  3V2Q A;  1NU1 G;  1T2K C;  1SQX D;  2WPQ A;  5BU8 B;  2BCC D;  3ITK A;  1SQP K;  2M5A B;  2IBZ G;  2JP3 A;  3CL3 D;  1AQ5 A;  2QM8 A;  3HD7 B;  3I55 P;  2H43 A;  1JY3 O;  1NTK D;  5APY A;  1L4A D;  1ZV8 A;  1N7S B;  2KS1 A;  1YTZ I;  2KNC B;  1IJD B;  2O01 N;  1GTW A;  1YIT P;  3L70 E;  1RF0 C;  1MV8 A;  1JB0 J;  2HG5 D;  1JM0 A;  5GTH E;  2AEF A;  2WSS H;  1SQQ J;  1PFI A;  2OYO A;  4WY4 D;  1LTA C;  3H1L J;  4LLH A;  3AEB C;  2H89 C;  1ZXG A;  1BDC A;  3I56 P;  1E79 H;  3WUT A;  3L73 J;  2YO3 A;  1OVU A;  4CPG A;  1ZRT E;  5TIS H;  2W6A A;  4M3L A;  2JDI H;  3Q5R A;  4IFD K;  4IL6 X;  2QJY C;  4MN4 C;  3L35 A;  3GG2 A;  4H44 D;  5L8R J;  3KZI E;  3BRT B;  2M5A A;  2D2C D;  1JY2 N;  4C7R A;  4D6T J;  4OGQ D;  4OVN F;  2E76 C;  3WUU A;  3MUD C;  2WTY A;  3L75 D;  1SQP E;  1N73 C;  1N7S A;  1SQV D;  3A7O A;  4H13 B;  1KV4 A;  1NH4 A;  4XA4 A;  1VQO P;  1PPJ E;  3CX5 E;  1PV3 A;  4HH2 A;  1SQB J;  3PJS K;  3B5N D;  4W7Y A;  5AW9 B;  1EDL A;  3VYI A;  3HD7 C;  1GMJ A;  3K5B A;  1OW7 A;  2KSJ A;  2BAS A;  1VQ9 P;  2ZAE B;  1N7S C;  1L0L J;  1PP9 E;  2H88 C;  2N1T B;  3H1I J;  3RK2 D;  1BE3 G;  4K3A A;  1S72 P;  3H1J D;  2OTK E;  3L72 G;  1ZN5 A;  2XZR A;  2Q9I A;  2OYH B;  1VQ4 P;  4JPZ B;  1D7M A;  3BCC D;  2IZ1 A;  3P8C D;  1YI2 P;  1G2C B;  3CPW O;  4O9B A;  1LWU B;  1ZOY C;  2ZT9 D;  4I7Z B;  1M1K Q;  1BCC D;  1P84 H;  3S4R A;  3FXE A;  2J59 M;  3V5B A;  3VMX A;  1YBK A;  2WPR A;  3KPE A;  1W5C E;  1NU1 K;  4BWN A;  1NWQ A;  3Q5S A;  1FJK A;  3G4S P;  2KP8 A;  2IYO A;  1GK6 A;  4DCK A;  2Q1K A;  2Q6Q A;  4UB8 E;  1NTK J;  5KJ7 D;  1NTM D;  2NPS B;  5GTI H;  2RH0 A;  1YYC A;  3NFQ A;  2FKW B;  2HPC B;  5KLV E;  4LC1 A;  3AE2 C;  4H13 C;  3M06 A;  1U57 A;  3U1A A;  2KI7 B;  2N1T A;  3L36 A;  1BGY D;  1GU4 A;  3GF7 A;  1S9K E;  3JCU E;  3RK3 D;  3CME P;  4PJ0 H;  2YO2 A;  1X79 B;  1EDJ A;  1NJI Q;  1YTZ T;  1G2C A;  2YXQ B;  1LWU A;  1N8R Q;  1AVY A;  3E1I A;  3GLM A;  3D6Z A;  5AVR B;  2N1T C;  1SQQ G;  3M0D A;  4ZKU A;  2QE7 H;  3H1K J;  2FYU D;  1VF5 B;  3H1L G;  4HKZ H;  2OYH C;  3RL0 D;  5CMZ A;  3OJA B;  1RF1 A;  1SQV J;  2YNY A;  4IOI H;  1LWU C;  2Z5I A;  4I7Z C;  4L74 A;  2O1J A;  2RKL A;  3MHV A;  3R2P A;  2Y9Y A;  2AEJ A;  2FYN B;  1XTG B;  3IN6 A;  3M0D C;  1K8A Q;  2O3J A;  2BEZ F;  3SWK A;  3VMA A;  3CCU P;  4D6T G;  4W80 A;  3OAK A;  4L76 A;  2NPS C;  3KHU A;  1LTI C;  5AW5 B;  4KJM A;  2SPZ A;  2KLU A;  3T97 B;  3SSU A;  1PIX A;  1JCC A;  1T3J A;  1L0N G;  3OA7 A;  1K73 Q;  5H2F E;  5APQ A;  3TGU D;  1NGM B;  5APX A;  1VQ8 P;  2FY8 A;  1SQB G;  3AE6 C;  1NTZ K;  1URQ B;  2QM7 A;  2KZI A;  1BCC J;  5BU5 A;  4DT0 A;  4HB1 A;  3H1H E;  3MTU E;  2HOD B;  3CCR P;  4PD4 H;  1N86 A;  1WRG A;  3IF4 A;  5AVW B;  3V2P A;  3VMZ A;  4N78 E;  1NTM J;  1VF5 C;  1CZQ A;  2DW3 A;  5K5G B;  3CXH H;  3CX5 I;  1GL2 B;  1FZE A;  4RES B;  1LTS C;  4YTP C;  1HH0 A;  2FXM A;  5AVS B;  3T97 A;  3LID A;  1OXZ A;  4RO0 A;  1OW8 A;  1L2P A;  2M3E A;  2QG4 A;  1SQX G;  2BCC G;  1EZV E;  3FWN A;  3TYY A;  1OZH A;  3L74 E;  1NKZ B;  1KB9 H;  5CCG C;  1JCD A;  3CX5 H;  2E74 D;  1SFC D;  3GW6 A;  1NTK G;  2ZJS E;  3HE5 B;  4N3Y B;  1PGQ A;  2HYN A;  1DEB A;  1URQ A;  3AED C;  1RHZ B;  4UB6 E;  1M56 D;  1YJ9 P;  1R8E A;  4WVZ A;  1VQ5 P;  1AQT A;  2WSC J;  4U3F E;  4XE5 B;  2C0W A;  2R5B A;  2FYU J;  2MKV A;  3L70 D;  1KTM A;  4ZKP A;  4WY4 B;  3N7N A;  4AUW A;  1AA0 A;  5KAI E;  1E5W A;  3MGN A;  1URQ C;  2HR3 A;  1GL2 A;  1KIL E;  2CK3 H;  2G8Y A;  1FBM A;  4B86 A;  1BDD A;  1H8A A;  3IFM A;  1AV1 A;  3MZW B;  2GM4 A;  2YXR B;  1M1J A;  1ZRT D;  4H44 B;  1KFM A;  2O01 H;  1FZA A;  3QH9 A;  3L75 G;  1SQV G;  2CPB A;  1S1C X;  4PV1 D;  1HF9 A;  2M3B A;  1GL2 C;  2Y0E A;  1JY3 P;  5BVZ A;  5KLI B;  4OH8 B;  1LJ2 A;  4HYT B;  1KD1 Q;  3HUS C;  2R32 A;  4IL6 E;  3SFE C;  1SQP D;  1OVV A;  1MUU A;  1ZR4 A;  1N73 B;  2Q5U A;  1LT9 B;  1QEX A;  2Q3E A;  1RE3 C;  3GF3 A;  4L75 A;  1RF0 A;  4GIF A;  1QGK B;  4BXL A;  1PPJ D;  2KNC A;  1IZN B;  4WWI A;  2Q3I A;  2JWD A;  2XU6 A;  3A0B E;  3M9H A;  3UIA A;  1S5L H;  3F89 A;  1L0L K;  4YXD C;  1HGV A;  2WPS A;  3EFF K;  3L73 E;  3RK2 B;  3H1J G;  1G1I A;  1RY3 A;  2IDB A;  1PP9 D;  1AJY A;  2LR2 A;  2QA4 P;  4WY4 C;  3BCC G;  5B66 H;  2POH A;  1IO4 A;  2A45 I;  2ZVO B;  1A02 F;  1BCC G;  2NRG A;  2ZT9 B;  2PRR A;  3FWL A;  2PAJ A;  3H6P A;  3AE1 C;  3C8V A;  4YPC A;  3MUD A;  3CC4 P;  1N73 A;  3II6 A;  4GT1 A;  2P10 A;  1GU5 A;  4H44 C;  1DEE G;  1AFO A;  3VP9 A;  1NTM G;  4Y28 J;  1KQG B;  3CWB E;  5B5E E;  1KC8 Q;  3SWY A;  2ZXE B;  4Y99 B;  3PTZ A;  2K9J B;  3PP5 A;  2IZ0 A;  5KLI C;  2XND H;  5AW1 B;  1Q2N A;  3MD0 A;  1BGY G;  3HD7 A;  1S4X A;  1IK7 A;  1YHQ P;  2B88 A;  2Y0C A;  5KLV D;  3L70 J;  2R3S A;  1LT9 C;  1L0L E;  3FXD A; 
#chains in the Genus database with same CATH homology
 4U3F J;  1KB9 I;  3L71 J;  3CXH I;  1SQX J;  1PP9 J;  3H1J J;  3H1L J;  1BE3 J;  3CX5 I;  1L0N J;  2BCC J;  3H1H J;  1NU1 J;  3L73 J;  3TGU J;  1SQP J;  3CWB J;  3L72 J;  3H1K J;  4PD4 I;  4D6T J;  1KYO I;  1L0L J;  2FYU J;  3BCC J;  1SQQ J;  3L74 J;  3H1I J;  3L70 J;  1NTZ J;  1EZV I;  1P84 I;  1SQB J;  5KLV J;  1NTK J;  3L75 J;  1BGY J;  1SQV J;  2IBZ I;  1BCC J;  1NTM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...