1P84I

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
55
structure length
55
Chain Sequence
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 17
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1p84I00
3CX5I 3H1KJ 3L72J 1BGYJ 1EZVI 4D6TJ 3H1IJ 1L0LJ 1NU1J 3BCCJ 3L70J 3L71J 1SQXJ 1NTZJ 1BE3J 3H1HJ 3TGUJ 3CXHI 3H1JJ 1NTKJ 1PP9J 4U3FJ 1P84I 1SQVJ 3L73J 1SQPJ 3L74J 1BCCJ 3CWBJ 2FYUJ 3H1LJ 1KB9I 1SQBJ 1SQQJ 1NTMJ 1L0NJ 3L75J 4PD4I 2BCCJ 2IBZI 1KYOI 5KLVJ
chains in the Genus database with same CATH superfamily
3II6A 3BVHA 3E1IA 3RBZA 3V5BA 1L0LJ 2WT7B 3BCCJ 1HGVA 4W7YA 5CCGD 1SVFA 4K35A 3HD7B 1S5LH 3VN0A 1NU1K 2FFDB 2GUSA 2AEFA 4OVNF 2ZYGA 2P67A 3H32A 2W6AA 4D6TE 4L74A 1RE4A 3MZWB 5AVSB 1EDKA 3VMZA 1IO4A 2FFDC 1DD4A 1AQTA 3H1LG 1GL2A 1G1IA 1L0NJ 2WSCJ 1MUUA 5AW4B 3S1KA 1QL1A 3H6PA 1EZVD 1NJIQ 3Q1MA 3KZIH 2Q3IA 2J5UA 3HE5A 1PP9G 1SQVE 2QJPB 2YKPA 4EOTA 1L2PA 1FS0E 1NTMG 1NGMB 4LLHA 1E5WA 1JM0A 1QVGO 2E5TA 3M91A 4H13D 2E75B 3FX0A 2QJPC 4WVZA 1BDCA 1OVVA 2IBZE 3E7KA 3Q5PA 3MUDA 3FGAD 4H13B 2FYUE 3RGUA 1EDIA 1U7MA 3L72E 1NAFA 1KB9H 1AFOA 1S4XA 2OYHA 3L70E 3CPWO 4H13C 1GMJA 2ZAEB 1L4AD 1KFMA 4H0LB 4NPEA 1ZRTD 2OYIB 3H1KE 1AQ5A 1L4AB 1OZHA 3PRJA 1FZGA 1FZCB 3D70A 4H0LC 1G2CB 1PFIA 2OTLP 4YPCA 1IK9A 5CCGA 2CPBA 1FZAA 2O1JA 2OYIC 2I1JA 1LT9C 2XV5A 4DCKA 1L4AC 3L75G 1USEA 1M90Q 1FZCC 4R4MA 2A06G 5BU8B 3V4WA 2JKVA 2PGDA 3H1HE 3L75D 1FBMA 3H1JG 1BSNA 2W6JH 4IOIH 1S1CX 2QM7A 2K88A 1KYOD 5B5EE 2P10A 1T3UA 4YXDC 1M56D 1IFDA 5KTBA 1BE3E 1L0LG 3A3YB 3BCCG 2JJLA 1VQ6P 1BCCJ 3HE4A 5CCHD 3P8CD 4WY4B 4IL6H 1K04A 1P84E 2ZFCA 1FDMA 2J58A 2AEJA 1PGOA 1SQPK 2KOGA 1JY3N 1QGKB 5C39A 2H8PD 5CBNA 5CHXA 1LGHB 2BCCD 5KLVK 4IFDK 3TSIA 1URQD 4MN4C 1GW3A 2FKWB 1BGYD 3GHGB 4AUWA 5AW0B 3TGUD 2RN0A 2NPSD 1LTGC 2ZJSE 1ZW0A 1L0NG 2Y0CA 5CCHC 3CCQP 3G71P 3L74D 1CI6B 1ZP0C 1LTSC 2GM4A 1ZV8A 4U7JA 1SQQK 1RQUA 4WWIA 1S9KD 1JY2O 3RBXA 1T2KD 1LT9A 1YHQP 1YYCA 2WSFH 1Z56A 4QMAA 4N78D 2NPSC 2JDIH 1SQXE 1YBKA 2E74D 1PPJG 5TISE 3HRNA 5APWA 2KUBA 3NXSA 2KNCB 3AEAC 3BASA 1YIJP 1P84H 3CCVP 5KLVE 4HYTB 1X8YA 2KI7B 2KLUA 3F5HA 2Z4EA 3W67A 3TNUB 1OXZA 1VQ9P 1KB9D 1HJ0A 1VF5B 1KQLA 1SQQE 2AXTE 5L8RJ 2OARA 1KILE 3CMAP 1HVVA 1JY3P 2IZ0A 2N9BA 3H1IJ 1NTMK 1SQBD 1VF5C 3V2QA 4U3FJ 2PAJA 2OYOA 3RK3B 2NRGA 1SQVD 1LTIC 5TISH 1NKZB 2R3SA 2RMZA 2ZXXA 4I1LA 3U59A 1DD3A 5AW2B 4CPGA 1URQA 3M0DA 3GW6A 2Y0EA 3OAKA 2I1KA 4PD4I 2OTJP 2NPSA 2HODA 2FYUD 2JP3A 2YNYA 1PP9E 3TF5A 1JY3O 1BSHA 1EDJA 5AVYB 5KLIC 2AXTH 3L70D 1BCCG 2WWWA 2E76D 1OWAA 3PHLA 1X79B 1NWQA 3EFGA 5KKZB 4Z1MH 1LWUC 5BU5A 5DJUB 3CCUP 3L73E 1KC8Q 3H1KD 1QVFO 5KKZC 3CCLP 3H1LJ 2V7QJ 3M9QA 4H44D 2M3EA 2RH0A 3CX5I 3PH0A 4RKUJ 3AEFC 4H44B 4C7RA 4DZOA 1HUCA 2M3BA 1L0LK 1NTMJ 2R3CA 5CMZA 3VMAA 2AXCA 1QX8A 1GDTA 4H44C 2QJYB 3L71G 3F89A 1FZEA 1RE3C 1KORA 3A5TA 4OH8B 1HBWA 3I55P 1X22A 2ZXEB 2QJYC 1AV1A 4OWFA 4O9BA 3VTPC 1FDIA 5KJ7C 2YIUB 1EXJA 5DJTB 3CWBD 3AE6C 1L0NK 2QSIA 1P84D 3RK2D 3D6YA 2P7JA 4Y28J 2ZT9B 3AE8C 2YIUC 1RHZB 3B8EB 1LWUA 1KFNA 3BCCE 2Z5HA 2ZT9C 3TK1A 2KXPB 3CXHI 3RL0B 2C0WA 1K9MQ 4U3FG 4JQ0D 1OVUA 1UIIA 2YMYA 3RK2C 3S9OA 2GUVA 2YO3A 1LT1A 1M1JA 3L75J 1N7SA 2UWJE 3RL0C 4ZMDA 2N1TB 2K1AA 1U7JA 2NZ2A 2AEMA 3PLNA 3E1RA 2HLOA 2JWAA 3JC22 3I56P 2XDJA 3HUSB 1RF1A 1PGQA 2K9YA 3GLMA 1SQXD 2N1TC 1L0NE 3T97B 4XE5B 1R8EA 3HD7D 1A02F 3TDKA 2FXPA 3SSUA 1GD2E 1RQVA 3NFQA 2WZ7A 5KLVD 3A0BE 4I6MC 2W8ZA 3Q5RA 1JCDA 1DEBA 5AW7B 2BCCJ 1IFMA 2DW3A 3P8MC 4DOJA 3W68A 1BGYJ 3HD7C 5AVQB 3FXDA 5APSA 3L74J 4IL6X 4L76A 1EZVG 1LTJB 3B5NB 1NTZD 3RK3E 1KILB 2Q7CA 1ZOYC 1N73A 3JCUE 3BRVB 1T8ZA 1LTJC 1NTKE 3SFEC 1VQLP 1KILC 4EDFA 2FBWC 3IF4A 1DEEG 2E75D 4LC1A 2WSCH 1SFCA 2FY8A 3FWNA 2YXRB 1N8RQ 1NU1E 2J59M 3CCSP 1JY2N 4C7NA 3A0BH 4ZKUA 3KPEA 3R4YA 1JMMA 4I7ZB 1D7MA 5AVUB 5K5GB 1M57D 2E75C 2FXOA 1JO5A 1EXIA 4PJ0E 1M7LA 1EZVI 4H0LD 4JYBA 1GW4A 2Q6QA 2XNDH 4N3YB 3LW5H 1SQBJ 1MKMA 2WT7A 5AVTB 3L73D 2KZIA 3JCUH 4JPZB 4KHXA 1OW8A 3HD7A 3U1AA 2A45G 3G4SP 1GZLA 5TJHA 2FFDA 1FDOA 1SQVJ 3QWOC 1Y8AA 5AVRB 2JO1A 3OA7A 4EI2A 2O01N 1IFIA 4TLFA 1LNQA 1PV3A 1W2EA 1IJDB 3O8ZA 1ZR4A 1NO4A 1AVYA 1PIXA 1YI2P 2FYUJ 1H89A 4GT1A 3KHUA 1N86A 5AW8B 5APVA 4PJ0H 1JY2P 1NAYA 1LP1B 1AA0A 4WY4D 1VPCA 3CLQA 3AE9C 2JEEA 3KXDA 4HJGH 2A45I 1RY3A 2KLVA 3AE4C 5AVZB 1JTHB 2BCCG 3A0HE 1T6AA 2IX7C 1BGYG 3CCRP 2WSEJ 3TGUG 2KS1B 2O3JA 4WY4C 2H88C 2H89C 3L74G 4GODA 2IYOA 1KYOI 2FYNB 5AVWB 1OW6A 2D2CD 4YTPC 3C8VA 3GHGC 3M9HA 1JCCA 2FYNC 1DX7A 2OGUA 2OYIA 2D2CB 1IK7A 1T3JA 3AEDC 1L4AA 5B5EH 3O6QB 1FZCA 1Q2NA 3GF3A 1G2CA 4N6JA 3H1IE 3L71J 2D2CC 4U3FE 2YMKA 3AE2C 1SQPE 3CWBJ 3M06A 1Q7YQ 2QEXP 1E79H 3HTKB 5GTHE 1IFJA 3PJSK 1VF5D 3A0HH 3D6ZA 2R5BA 1YITP 1EDLA 1ZMEC 4D6TD 1FC2C 3ZDMA 2QG4A 4Y99B 1SQBG 1WRGA 2XU6A 4DT0A 2K3RA 3RK3D 5B66E 1EC5A 2M5AB 1H0TB 4Y99C 4WY4A 3B71A 1SQVG 1H8AA 1JB0J 1NTKD 2K37A 5CCHA 2B87B 3IN6A 4C46A 1ZR2A 1Q82Q 4ZKPA 2IFMA 3GHGA 2E42A 3RK3C 1EZVE 3H1LE 1NU1D 1KB9I 1KMIZ 2FYUG 2SPZA 1CI6A 5AW5B 5CJ4A 2IBZD 3V2NA 5GTHH 1OVRA 1G1JA 3D71A 2MJZA 1S72P 3C9IA 2M8RA 3L72G 1OW7A 4GIFA 1Q81Q 3V2RA 2O01J 3L70G 3SWYA 5AW9B 5APTA 4ASVA 3L72D 1U57A 1LTBC 1NTME 1LJ2A 1JMBA 5H2FE 4AYCA 2PFXA 2WQYC 1VQKP 2KNCA 3H1KG 1MZ9A 2E5YA 1NTZJ 3EQ2A 2W27A 3BRTB 4PV1B 1S5LX 3L36A 1Q90D 1H88A 3VOPA 3IFMA 1FJPA 5EFWB 1FOSE 2B89A 3V4QA 3CMEP 4JBZA 4W80A 4PV1C 4NPFX 3TNUA 1MV8A 3C1LA 3Q5SA 2LKMA 1HWTC 4BWNA 2WITA 5GTIE 1MFTA 3AEBC 3CCEP 1LTAC 4BRYB 3H1HD 2IFNA 5KJ7D 4OGQB 1VQOP 5AW3B 2E43A 2HPCB 1GTWA 2K9JB 1KQGB 1W5CE 3WUTA 2G8YA 1RF0C 4OGQC 1AJYA 5E79E 5H2FH 3CWBG 1BE3D 2I8DA 3L75E 2A06E 1NVOA 2ZT9D 3EFFK 3M9BA 2WVRA 2KB7P 2PRRA 1KYOE 2YKQA 3H1JE 3H32B 3U1CA 1NYHA 2KP8A 3H25A 3RL0D 3Q3DA 2BEZF 1GL2B 1RE4C 1L0LE 3P8CE 1YTZI 1IFNA 1ZLLA 5GTIH 1JOCA 3LIEA 2N1TD 2ITAA 3QH9A 1GL2C 3HE5B 1FOSF 2BCCE 1KN7A 2P58A 1BGYE 1FZBA 1SQXG 3MTUE 1IC2A 1P84I 1K8AQ 3L74E 5E79H 5KAIE 3H1ID 4DJGA 1YJNP 3AE1C 1XTCC 5KLVG 4JF7A 2Q5UA 1SQPD 3HUSC 3BATA 3NTNA 4EYYQ 1SQBK 1YQ4C 2O1KA 1KYOH 3MUDC 4L73A 1RE3A 3N7NA 2OYHB 2VRSA 3CC7P 3L37A 2BEQD 5M1BA 3GMAA 4WB4A 3SFDC 5KJ7A 1SQVK 1N2DC 1MFZA 3P32A 2XKMA 2BASA 4GDOA 2OYHC 1PPJE 3B5ND 1SQQD 1JNMA 1KILD 3TGUJ 1NTZG 3P7KA 3IAOA 3MIWA 3A7OA 3V2PA 5APUA 1LTTC 1USDA 4R4LA 1KZUB 1NKNA 1DH3A 3N4XA 2Y9YA 2WTYA 3JSVC 1KB9E 4M3LA 3G3ZA 2N9YB 2FYUK 1VQ8P 2H7HA 4PD4E 1CSBA 2Y0DA 3B5NC 5CCGC 5KAIH 1SQBE 1X0TA 2Q3EA 1R5LA 3H1LD 3MD0A 1J1EB 3SWKA 1AVOA 2JR8A 4UB8E 1HTLC 1YJ9P 3PTZA 3AE3C 1PZQA 2R44A 2LR2A 3ITKA 2N1TA 1J1EC 3FXEA 1PP9D 3HE4B 3HUSA 4D6TJ 1NTMD 3PP5A 1JEKA 1FJKA 4I7ZC 1PGPA 3KYQA 3CX5E 3L73G 3T97A 1KTMA 3LW5J 1YJWP 1GU4A 5CBOA 1PGJA 2YO2A 2YXQB 3WU2E 2FYZA 2Y9ZA 5KAFE 4PD4H 4XFJA 3L35A 1NTKJ 1VQNP 2KSJA 1Y47A 2ZVOB 1BCCE 3ABVC 3TYYA 1J2JB 4IL6E 1KQSO 3MP7B 3AE5C 2L91A 2ZVNB 4GOFA 1LT9B 1NU1J 1Y9BA 2C9LY 1LTJA 3B5NA 4UB8H 4XA4A 1KILA 2WPRA 1HH0A 4BXLA 4W7ZA 1FZFA 1SS1A 3L72J 3GG2A 3L70J 5CJ0A 1PL5A 1J1DB 1EQ7A 1WT6A 2A06D 3CX5H 3VMXA 3CL3D 3S4RA 2W6BA 3CXHE 3IR9A 3H1JD 1KQFB 3A2AA 1OFCX 1K05A 1YQ3C 1OIPA 3L4FA 3H1KJ 1J1DC 3L71E 2ZYDA 3WU2H 5KAFH 1OX3A 1N7LA 3AEEC 4YXWH 2B9BA 3CWBE 1L0LD 3BCCD 1SQXK 2XNXA 1VQ7P 1NOHA 2P1JA 2QRXA 2WSEH 1FU1A 3H1HJ 1XTGB 2IDBA 1YTZT 4KJMA 3VP8A 3K5BA 1NHLA 2WSFJ 1GK6A 1URQB 1GU5A 4GKGA 4UB6E 1BE3J 2HYNA 1L0ND 1QLED 2NPSB 1VQ5P 2JWDA 2HODB 1X9VA 1URQC 2GA1A 2HFED 1NTZK 3CXHH 3M0DC 2Q1KA 5APYA 2KSEA 2L5GB 3SWFA 2HG5D 4D6TG 3KDPB 1SLQA 2YKOA 4ASWA 1ZXGA 2W83C 2QE7H 5APXA 1PPJD 2E74B 2R32A 1LP1A 2KIKA 2CPSA 1T2KC 4B86A 3AE7C 3V6IA 3WMM0 4RJTA 3CI9A 1WMKA 4L75A 2E74C 4WBAA 2LXCB 1NTKG 2OTKE 1S2EA 3AEGC 1JTHA 3R2PA 2QM8A 4PD4D 1R5SA 2Z5IA 2LXBA 2KS1A 4GOEA 1NTZE 4UB6H 1SQXJ 1VQMP 1NU1G 4IFMA 1FE6A 1M1KQ 2IBZG 4AQRD 3G9RA 1SQPJ 4LGDE 1SP4A 3MHVA 1VQPP 5KLVJ 3EWKA 2KYVA 2POHA 1DIPA 4TT3H 3O6QA 1SQQJ 2MKVA 4HB1A 4A7PA 4RO0A 2IZ1A 4HH2A 2QJKB 4PV1D 2IYPA 5KLIB 3I5CA 3CC2P 3CX5D 2C0XA 1M8OB 2PP6A 3Q2YA 1NH4A 2O01H 1UIXA 3OW2O 1LWUB 5B66H 2C9NY 2QJKC 3HTKA 5APQA 1VDFA 1N7SD 1IFPA 1VL2A 1RH5B 2IBZI 1KD1Q 3FWLA 3WUVA 3M0AA 1OMIA 3CD6P 1BCCD 1M1JB 1HGZA 2HR3A 1N7SB 2XZRA 2IPPA 2E76B 4OGQD 3LIDA 3H1HG 1CZQA 1GK4A 5AW1B 4HKZH 1ZRTE 2WMMA 3VMYA 3G6EP 2V7QH 1M1JC 1S3JA 1RF1B 1N7SC 2E76C 2Q9IA 1H0TA 2M5AA 1KV4A 1FAVA 3CC4P 5BVZA 1BE3G 1TU3F 1PP9J 2R5DA 2QA4P 1RF1C 2WSSH 2H43A 2B87A 3WUUA 1CW5A 4IFFA 2FXMA 2WPSA 4NPDA 1JUNA 1W2BO 3CCJP 3CCMP 3CXHD 4EIJA 4ZNCA 1ZN5A 3L73J 5AVXB 1GL2D 1IZNB 2OQQA 5AVVB 3L71D 2RKLA 3VP9A 2ZYAA 4K3AA 1Q86Q 3UIAA 2G3AA 3NMDA 2M0BA 1N73B 1HF9A 1K73Q 1S5LE 2WPVB 1SFCD 1QL2A 2B88A 2P2UA 2CK3H 3RL0g 1QEXA 3KQGA 5AW6B 1BDDA 1N73C 3RK2B 2KK7A 1A02J 2W90A 2A45H 3H1IG 1SFCB 3TGUE 3USSA 4I2LC 3GF7A 1VQ4P 1SQPG 4C7NB 3VYIA 4JYCA 1SFCC 4U3FD 2QVAA 1S9KE 2QIWA 3OJAB 4KT0J 2V4HA 4RESB 3AECC 3KZIE 3MGNA 3H1JJ 2WPQA 4BRYA 2KZJA 4N78E 1RF0A 2HPCA 1SQQG 1HJBA 2K9JA 1NTKK 3B4SA
chains in the Genus database with same CATH topology
3CX5I 3H1KJ 3L72J 1BGYJ 1EZVI 4D6TJ 3H1IJ 1L0LJ 1NU1J 3BCCJ 3L70J 3L71J 1SQXJ 1NTZJ 1BE3J 3H1HJ 3TGUJ 3CXHI 3H1JJ 1NTKJ 1PP9J 4U3FJ 1P84I 1SQVJ 3L73J 1SQPJ 3L74J 1BCCJ 3CWBJ 2FYUJ 3H1LJ 1KB9I 1SQBJ 1SQQJ 1NTMJ 1L0NJ 3L75J 4PD4I 2BCCJ 2IBZI 1KYOI 5KLVJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CX5 I;  3H1K J;  3L72 J;  1BGY J;  1EZV I;  4D6T J;  3H1I J;  1L0L J;  1NU1 J;  3BCC J;  3L70 J;  3L71 J;  1SQX J;  1NTZ J;  1BE3 J;  3H1H J;  3TGU J;  3CXH I;  3H1J J;  1NTK J;  1PP9 J;  4U3F J;  1P84 I;  1SQV J;  3L73 J;  1SQP J;  3L74 J;  1BCC J;  3CWB J;  2FYU J;  3H1L J;  1KB9 I;  1SQB J;  1SQQ J;  1NTM J;  1L0N J;  3L75 J;  4PD4 I;  2BCC J;  2IBZ I;  1KYO I;  5KLV J; 
#chains in the Genus database with same CATH topology
 3II6 A;  3BVH A;  3E1I A;  3RBZ A;  3V5B A;  1L0L J;  2WT7 B;  3BCC J;  1HGV A;  4W7Y A;  5CCG D;  1SVF A;  4K35 A;  3HD7 B;  1S5L H;  3VN0 A;  1NU1 K;  2FFD B;  2GUS A;  2AEF A;  4OVN F;  2ZYG A;  2P67 A;  3H32 A;  2W6A A;  4D6T E;  4L74 A;  1RE4 A;  3MZW B;  5AVS B;  1EDK A;  3VMZ A;  1IO4 A;  2FFD C;  1DD4 A;  1AQT A;  3H1L G;  1GL2 A;  1G1I A;  1L0N J;  2WSC J;  1MUU A;  5AW4 B;  3S1K A;  1QL1 A;  3H6P A;  1EZV D;  1NJI Q;  3Q1M A;  3KZI H;  2Q3I A;  2J5U A;  3HE5 A;  1PP9 G;  1SQV E;  2QJP B;  2YKP A;  4EOT A;  1L2P A;  1FS0 E;  1NTM G;  1NGM B;  4LLH A;  1E5W A;  1JM0 A;  1QVG O;  2E5T A;  3M91 A;  4H13 D;  2E75 B;  3FX0 A;  2QJP C;  4WVZ A;  1BDC A;  1OVV A;  2IBZ E;  3E7K A;  3Q5P A;  3MUD A;  3FGA D;  4H13 B;  2FYU E;  3RGU A;  1EDI A;  1U7M A;  3L72 E;  1NAF A;  1KB9 H;  1AFO A;  1S4X A;  2OYH A;  3L70 E;  3CPW O;  4H13 C;  1GMJ A;  2ZAE B;  1L4A D;  1KFM A;  4H0L B;  4NPE A;  1ZRT D;  2OYI B;  3H1K E;  1AQ5 A;  1L4A B;  1OZH A;  3PRJ A;  1FZG A;  1FZC B;  3D70 A;  4H0L C;  1G2C B;  1PFI A;  2OTL P;  4YPC A;  1IK9 A;  5CCG A;  2CPB A;  1FZA A;  2O1J A;  2OYI C;  2I1J A;  1LT9 C;  2XV5 A;  4DCK A;  1L4A C;  3L75 G;  1USE A;  1M90 Q;  1FZC C;  4R4M A;  2A06 G;  5BU8 B;  3V4W A;  2JKV A;  2PGD A;  3H1H E;  3L75 D;  1FBM A;  3H1J G;  1BSN A;  2W6J H;  4IOI H;  1S1C X;  2QM7 A;  2K88 A;  1KYO D;  5B5E E;  2P10 A;  1T3U A;  4YXD C;  1M56 D;  1IFD A;  5KTB A;  1BE3 E;  1L0L G;  3A3Y B;  3BCC G;  2JJL A;  1VQ6 P;  1BCC J;  3HE4 A;  5CCH D;  3P8C D;  4WY4 B;  4IL6 H;  1K04 A;  1P84 E;  2ZFC A;  1FDM A;  2J58 A;  2AEJ A;  1PGO A;  1SQP K;  2KOG A;  1JY3 N;  1QGK B;  5C39 A;  2H8P D;  5CBN A;  5CHX A;  1LGH B;  2BCC D;  5KLV K;  4IFD K;  3TSI A;  1URQ D;  4MN4 C;  1GW3 A;  2FKW B;  1BGY D;  3GHG B;  4AUW A;  5AW0 B;  3TGU D;  2RN0 A;  2NPS D;  1LTG C;  2ZJS E;  1ZW0 A;  1L0N G;  2Y0C A;  5CCH C;  3CCQ P;  3G71 P;  3L74 D;  1CI6 B;  1ZP0 C;  1LTS C;  2GM4 A;  1ZV8 A;  4U7J A;  1SQQ K;  1RQU A;  4WWI A;  1S9K D;  1JY2 O;  3RBX A;  1T2K D;  1LT9 A;  1YHQ P;  1YYC A;  2WSF H;  1Z56 A;  4QMA A;  4N78 D;  2NPS C;  2JDI H;  1SQX E;  1YBK A;  2E74 D;  1PPJ G;  5TIS E;  3HRN A;  5APW A;  2KUB A;  3NXS A;  2KNC B;  3AEA C;  3BAS A;  1YIJ P;  1P84 H;  3CCV P;  5KLV E;  4HYT B;  1X8Y A;  2KI7 B;  2KLU A;  3F5H A;  2Z4E A;  3W67 A;  3TNU B;  1OXZ A;  1VQ9 P;  1KB9 D;  1HJ0 A;  1VF5 B;  1KQL A;  1SQQ E;  2AXT E;  5L8R J;  2OAR A;  1KIL E;  3CMA P;  1HVV A;  1JY3 P;  2IZ0 A;  2N9B A;  3H1I J;  1NTM K;  1SQB D;  1VF5 C;  3V2Q A;  4U3F J;  2PAJ A;  2OYO A;  3RK3 B;  2NRG A;  1SQV D;  1LTI C;  5TIS H;  1NKZ B;  2R3S A;  2RMZ A;  2ZXX A;  4I1L A;  3U59 A;  1DD3 A;  5AW2 B;  4CPG A;  1URQ A;  3M0D A;  3GW6 A;  2Y0E A;  3OAK A;  2I1K A;  4PD4 I;  2OTJ P;  2NPS A;  2HOD A;  2FYU D;  2JP3 A;  2YNY A;  1PP9 E;  3TF5 A;  1JY3 O;  1BSH A;  1EDJ A;  5AVY B;  5KLI C;  2AXT H;  3L70 D;  1BCC G;  2WWW A;  2E76 D;  1OWA A;  3PHL A;  1X79 B;  1NWQ A;  3EFG A;  5KKZ B;  4Z1M H;  1LWU C;  5BU5 A;  5DJU B;  3CCU P;  3L73 E;  1KC8 Q;  3H1K D;  1QVF O;  5KKZ C;  3CCL P;  3H1L J;  2V7Q J;  3M9Q A;  4H44 D;  2M3E A;  2RH0 A;  3CX5 I;  3PH0 A;  4RKU J;  3AEF C;  4H44 B;  4C7R A;  4DZO A;  1HUC A;  2M3B A;  1L0L K;  1NTM J;  2R3C A;  5CMZ A;  3VMA A;  2AXC A;  1QX8 A;  1GDT A;  4H44 C;  2QJY B;  3L71 G;  3F89 A;  1FZE A;  1RE3 C;  1KOR A;  3A5T A;  4OH8 B;  1HBW A;  3I55 P;  1X22 A;  2ZXE B;  2QJY C;  1AV1 A;  4OWF A;  4O9B A;  3VTP C;  1FDI A;  5KJ7 C;  2YIU B;  1EXJ A;  5DJT B;  3CWB D;  3AE6 C;  1L0N K;  2QSI A;  1P84 D;  3RK2 D;  3D6Y A;  2P7J A;  4Y28 J;  2ZT9 B;  3AE8 C;  2YIU C;  1RHZ B;  3B8E B;  1LWU A;  1KFN A;  3BCC E;  2Z5H A;  2ZT9 C;  3TK1 A;  2KXP B;  3CXH I;  3RL0 B;  2C0W A;  1K9M Q;  4U3F G;  4JQ0 D;  1OVU A;  1UII A;  2YMY A;  3RK2 C;  3S9O A;  2GUV A;  2YO3 A;  1LT1 A;  1M1J A;  3L75 J;  1N7S A;  2UWJ E;  3RL0 C;  4ZMD A;  2N1T B;  2K1A A;  1U7J A;  2NZ2 A;  2AEM A;  3PLN A;  3E1R A;  2HLO A;  2JWA A;  3JC2 2;  3I56 P;  2XDJ A;  3HUS B;  1RF1 A;  1PGQ A;  2K9Y A;  3GLM A;  1SQX D;  2N1T C;  1L0N E;  3T97 B;  4XE5 B;  1R8E A;  3HD7 D;  1A02 F;  3TDK A;  2FXP A;  3SSU A;  1GD2 E;  1RQV A;  3NFQ A;  2WZ7 A;  5KLV D;  3A0B E;  4I6M C;  2W8Z A;  3Q5R A;  1JCD A;  1DEB A;  5AW7 B;  2BCC J;  1IFM A;  2DW3 A;  3P8M C;  4DOJ A;  3W68 A;  1BGY J;  3HD7 C;  5AVQ B;  3FXD A;  5APS A;  3L74 J;  4IL6 X;  4L76 A;  1EZV G;  1LTJ B;  3B5N B;  1NTZ D;  3RK3 E;  1KIL B;  2Q7C A;  1ZOY C;  1N73 A;  3JCU E;  3BRV B;  1T8Z A;  1LTJ C;  1NTK E;  3SFE C;  1VQL P;  1KIL C;  4EDF A;  2FBW C;  3IF4 A;  1DEE G;  2E75 D;  4LC1 A;  2WSC H;  1SFC A;  2FY8 A;  3FWN A;  2YXR B;  1N8R Q;  1NU1 E;  2J59 M;  3CCS P;  1JY2 N;  4C7N A;  3A0B H;  4ZKU A;  3KPE A;  3R4Y A;  1JMM A;  4I7Z B;  1D7M A;  5AVU B;  5K5G B;  1M57 D;  2E75 C;  2FXO A;  1JO5 A;  1EXI A;  4PJ0 E;  1M7L A;  1EZV I;  4H0L D;  4JYB A;  1GW4 A;  2Q6Q A;  2XND H;  4N3Y B;  3LW5 H;  1SQB J;  1MKM A;  2WT7 A;  5AVT B;  3L73 D;  2KZI A;  3JCU H;  4JPZ B;  4KHX A;  1OW8 A;  3HD7 A;  3U1A A;  2A45 G;  3G4S P;  1GZL A;  5TJH A;  2FFD A;  1FDO A;  1SQV J;  3QWO C;  1Y8A A;  5AVR B;  2JO1 A;  3OA7 A;  4EI2 A;  2O01 N;  1IFI A;  4TLF A;  1LNQ A;  1PV3 A;  1W2E A;  1IJD B;  3O8Z A;  1ZR4 A;  1NO4 A;  1AVY A;  1PIX A;  1YI2 P;  2FYU J;  1H89 A;  4GT1 A;  3KHU A;  1N86 A;  5AW8 B;  5APV A;  4PJ0 H;  1JY2 P;  1NAY A;  1LP1 B;  1AA0 A;  4WY4 D;  1VPC A;  3CLQ A;  3AE9 C;  2JEE A;  3KXD A;  4HJG H;  2A45 I;  1RY3 A;  2KLV A;  3AE4 C;  5AVZ B;  1JTH B;  2BCC G;  3A0H E;  1T6A A;  2IX7 C;  1BGY G;  3CCR P;  2WSE J;  3TGU G;  2KS1 B;  2O3J A;  4WY4 C;  2H88 C;  2H89 C;  3L74 G;  4GOD A;  2IYO A;  1KYO I;  2FYN B;  5AVW B;  1OW6 A;  2D2C D;  4YTP C;  3C8V A;  3GHG C;  3M9H A;  1JCC A;  2FYN C;  1DX7 A;  2OGU A;  2OYI A;  2D2C B;  1IK7 A;  1T3J A;  3AED C;  1L4A A;  5B5E H;  3O6Q B;  1FZC A;  1Q2N A;  3GF3 A;  1G2C A;  4N6J A;  3H1I E;  3L71 J;  2D2C C;  4U3F E;  2YMK A;  3AE2 C;  1SQP E;  3CWB J;  3M06 A;  1Q7Y Q;  2QEX P;  1E79 H;  3HTK B;  5GTH E;  1IFJ A;  3PJS K;  1VF5 D;  3A0H H;  3D6Z A;  2R5B A;  1YIT P;  1EDL A;  1ZME C;  4D6T D;  1FC2 C;  3ZDM A;  2QG4 A;  4Y99 B;  1SQB G;  1WRG A;  2XU6 A;  4DT0 A;  2K3R A;  3RK3 D;  5B66 E;  1EC5 A;  2M5A B;  1H0T B;  4Y99 C;  4WY4 A;  3B71 A;  1SQV G;  1H8A A;  1JB0 J;  1NTK D;  2K37 A;  5CCH A;  2B87 B;  3IN6 A;  4C46 A;  1ZR2 A;  1Q82 Q;  4ZKP A;  2IFM A;  3GHG A;  2E42 A;  3RK3 C;  1EZV E;  3H1L E;  1NU1 D;  1KB9 I;  1KMI Z;  2FYU G;  2SPZ A;  1CI6 A;  5AW5 B;  5CJ4 A;  2IBZ D;  3V2N A;  5GTH H;  1OVR A;  1G1J A;  3D71 A;  2MJZ A;  1S72 P;  3C9I A;  2M8R A;  3L72 G;  1OW7 A;  4GIF A;  1Q81 Q;  3V2R A;  2O01 J;  3L70 G;  3SWY A;  5AW9 B;  5APT A;  4ASV A;  3L72 D;  1U57 A;  1LTB C;  1NTM E;  1LJ2 A;  1JMB A;  5H2F E;  4AYC A;  2PFX A;  2WQY C;  1VQK P;  2KNC A;  3H1K G;  1MZ9 A;  2E5Y A;  1NTZ J;  3EQ2 A;  2W27 A;  3BRT B;  4PV1 B;  1S5L X;  3L36 A;  1Q90 D;  1H88 A;  3VOP A;  3IFM A;  1FJP A;  5EFW B;  1FOS E;  2B89 A;  3V4Q A;  3CME P;  4JBZ A;  4W80 A;  4PV1 C;  4NPF X;  3TNU A;  1MV8 A;  3C1L A;  3Q5S A;  2LKM A;  1HWT C;  4BWN A;  2WIT A;  5GTI E;  1MFT A;  3AEB C;  3CCE P;  1LTA C;  4BRY B;  3H1H D;  2IFN A;  5KJ7 D;  4OGQ B;  1VQO P;  5AW3 B;  2E43 A;  2HPC B;  1GTW A;  2K9J B;  1KQG B;  1W5C E;  3WUT A;  2G8Y A;  1RF0 C;  4OGQ C;  1AJY A;  5E79 E;  5H2F H;  3CWB G;  1BE3 D;  2I8D A;  3L75 E;  2A06 E;  1NVO A;  2ZT9 D;  3EFF K;  3M9B A;  2WVR A;  2KB7 P;  2PRR A;  1KYO E;  2YKQ A;  3H1J E;  3H32 B;  3U1C A;  1NYH A;  2KP8 A;  3H25 A;  3RL0 D;  3Q3D A;  2BEZ F;  1GL2 B;  1RE4 C;  1L0L E;  3P8C E;  1YTZ I;  1IFN A;  1ZLL A;  5GTI H;  1JOC A;  3LIE A;  2N1T D;  2ITA A;  3QH9 A;  1GL2 C;  3HE5 B;  1FOS F;  2BCC E;  1KN7 A;  2P58 A;  1BGY E;  1FZB A;  1SQX G;  3MTU E;  1IC2 A;  1P84 I;  1K8A Q;  3L74 E;  5E79 H;  5KAI E;  3H1I D;  4DJG A;  1YJN P;  3AE1 C;  1XTC C;  5KLV G;  4JF7 A;  2Q5U A;  1SQP D;  3HUS C;  3BAT A;  3NTN A;  4EYY Q;  1SQB K;  1YQ4 C;  2O1K A;  1KYO H;  3MUD C;  4L73 A;  1RE3 A;  3N7N A;  2OYH B;  2VRS A;  3CC7 P;  3L37 A;  2BEQ D;  5M1B A;  3GMA A;  4WB4 A;  3SFD C;  5KJ7 A;  1SQV K;  1N2D C;  1MFZ A;  3P32 A;  2XKM A;  2BAS A;  4GDO A;  2OYH C;  1PPJ E;  3B5N D;  1SQQ D;  1JNM A;  1KIL D;  3TGU J;  1NTZ G;  3P7K A;  3IAO A;  3MIW A;  3A7O A;  3V2P A;  5APU A;  1LTT C;  1USD A;  4R4L A;  1KZU B;  1NKN A;  1DH3 A;  3N4X A;  2Y9Y A;  2WTY A;  3JSV C;  1KB9 E;  4M3L A;  3G3Z A;  2N9Y B;  2FYU K;  1VQ8 P;  2H7H A;  4PD4 E;  1CSB A;  2Y0D A;  3B5N C;  5CCG C;  5KAI H;  1SQB E;  1X0T A;  2Q3E A;  1R5L A;  3H1L D;  3MD0 A;  1J1E B;  3SWK A;  1AVO A;  2JR8 A;  4UB8 E;  1HTL C;  1YJ9 P;  3PTZ A;  3AE3 C;  1PZQ A;  2R44 A;  2LR2 A;  3ITK A;  2N1T A;  1J1E C;  3FXE A;  1PP9 D;  3HE4 B;  3HUS A;  4D6T J;  1NTM D;  3PP5 A;  1JEK A;  1FJK A;  4I7Z C;  1PGP A;  3KYQ A;  3CX5 E;  3L73 G;  3T97 A;  1KTM A;  3LW5 J;  1YJW P;  1GU4 A;  5CBO A;  1PGJ A;  2YO2 A;  2YXQ B;  3WU2 E;  2FYZ A;  2Y9Z A;  5KAF E;  4PD4 H;  4XFJ A;  3L35 A;  1NTK J;  1VQN P;  2KSJ A;  1Y47 A;  2ZVO B;  1BCC E;  3ABV C;  3TYY A;  1J2J B;  4IL6 E;  1KQS O;  3MP7 B;  3AE5 C;  2L91 A;  2ZVN B;  4GOF A;  1LT9 B;  1NU1 J;  1Y9B A;  2C9L Y;  1LTJ A;  3B5N A;  4UB8 H;  4XA4 A;  1KIL A;  2WPR A;  1HH0 A;  4BXL A;  4W7Z A;  1FZF A;  1SS1 A;  3L72 J;  3GG2 A;  3L70 J;  5CJ0 A;  1PL5 A;  1J1D B;  1EQ7 A;  1WT6 A;  2A06 D;  3CX5 H;  3VMX A;  3CL3 D;  3S4R A;  2W6B A;  3CXH E;  3IR9 A;  3H1J D;  1KQF B;  3A2A A;  1OFC X;  1K05 A;  1YQ3 C;  1OIP A;  3L4F A;  3H1K J;  1J1D C;  3L71 E;  2ZYD A;  3WU2 H;  5KAF H;  1OX3 A;  1N7L A;  3AEE C;  4YXW H;  2B9B A;  3CWB E;  1L0L D;  3BCC D;  1SQX K;  2XNX A;  1VQ7 P;  1NOH A;  2P1J A;  2QRX A;  2WSE H;  1FU1 A;  3H1H J;  1XTG B;  2IDB A;  1YTZ T;  4KJM A;  3VP8 A;  3K5B A;  1NHL A;  2WSF J;  1GK6 A;  1URQ B;  1GU5 A;  4GKG A;  4UB6 E;  1BE3 J;  2HYN A;  1L0N D;  1QLE D;  2NPS B;  1VQ5 P;  2JWD A;  2HOD B;  1X9V A;  1URQ C;  2GA1 A;  2HFE D;  1NTZ K;  3CXH H;  3M0D C;  2Q1K A;  5APY A;  2KSE A;  2L5G B;  3SWF A;  2HG5 D;  4D6T G;  3KDP B;  1SLQ A;  2YKO A;  4ASW A;  1ZXG A;  2W83 C;  2QE7 H;  5APX A;  1PPJ D;  2E74 B;  2R32 A;  1LP1 A;  2KIK A;  2CPS A;  1T2K C;  4B86 A;  3AE7 C;  3V6I A;  3WMM 0;  4RJT A;  3CI9 A;  1WMK A;  4L75 A;  2E74 C;  4WBA A;  2LXC B;  1NTK G;  2OTK E;  1S2E A;  3AEG C;  1JTH A;  3R2P A;  2QM8 A;  4PD4 D;  1R5S A;  2Z5I A;  2LXB A;  2KS1 A;  4GOE A;  1NTZ E;  4UB6 H;  1SQX J;  1VQM P;  1NU1 G;  4IFM A;  1FE6 A;  1M1K Q;  2IBZ G;  4AQR D;  3G9R A;  1SQP J;  4LGD E;  1SP4 A;  3MHV A;  1VQP P;  5KLV J;  3EWK A;  2KYV A;  2POH A;  1DIP A;  4TT3 H;  3O6Q A;  1SQQ J;  2MKV A;  4HB1 A;  4A7P A;  4RO0 A;  2IZ1 A;  4HH2 A;  2QJK B;  4PV1 D;  2IYP A;  5KLI B;  3I5C A;  3CC2 P;  3CX5 D;  2C0X A;  1M8O B;  2PP6 A;  3Q2Y A;  1NH4 A;  2O01 H;  1UIX A;  3OW2 O;  1LWU B;  5B66 H;  2C9N Y;  2QJK C;  3HTK A;  5APQ A;  1VDF A;  1N7S D;  1IFP A;  1VL2 A;  1RH5 B;  2IBZ I;  1KD1 Q;  3FWL A;  3WUV A;  3M0A A;  1OMI A;  3CD6 P;  1BCC D;  1M1J B;  1HGZ A;  2HR3 A;  1N7S B;  2XZR A;  2IPP A;  2E76 B;  4OGQ D;  3LID A;  3H1H G;  1CZQ A;  1GK4 A;  5AW1 B;  4HKZ H;  1ZRT E;  2WMM A;  3VMY A;  3G6E P;  2V7Q H;  1M1J C;  1S3J A;  1RF1 B;  1N7S C;  2E76 C;  2Q9I A;  1H0T A;  2M5A A;  1KV4 A;  1FAV A;  3CC4 P;  5BVZ A;  1BE3 G;  1TU3 F;  1PP9 J;  2R5D A;  2QA4 P;  1RF1 C;  2WSS H;  2H43 A;  2B87 A;  3WUU A;  1CW5 A;  4IFF A;  2FXM A;  2WPS A;  4NPD A;  1JUN A;  1W2B O;  3CCJ P;  3CCM P;  3CXH D;  4EIJ A;  4ZNC A;  1ZN5 A;  3L73 J;  5AVX B;  1GL2 D;  1IZN B;  2OQQ A;  5AVV B;  3L71 D;  2RKL A;  3VP9 A;  2ZYA A;  4K3A A;  1Q86 Q;  3UIA A;  2G3A A;  3NMD A;  2M0B A;  1N73 B;  1HF9 A;  1K73 Q;  1S5L E;  2WPV B;  1SFC D;  1QL2 A;  2B88 A;  2P2U A;  2CK3 H;  3RL0 g;  1QEX A;  3KQG A;  5AW6 B;  1BDD A;  1N73 C;  3RK2 B;  2KK7 A;  1A02 J;  2W90 A;  2A45 H;  3H1I G;  1SFC B;  3TGU E;  3USS A;  4I2L C;  3GF7 A;  1VQ4 P;  1SQP G;  4C7N B;  3VYI A;  4JYC A;  1SFC C;  4U3F D;  2QVA A;  1S9K E;  2QIW A;  3OJA B;  4KT0 J;  2V4H A;  4RES B;  3AEC C;  3KZI E;  3MGN A;  3H1J J;  2WPQ A;  4BRY A;  2KZJ A;  4N78 E;  1RF0 A;  2HPC A;  1SQQ G;  1HJB A;  2K9J A;  1NTK K;  3B4S A; 
#chains in the Genus database with same CATH homology
 3CX5 I;  3H1K J;  3L72 J;  1BGY J;  1EZV I;  4D6T J;  3H1I J;  1L0L J;  1NU1 J;  3BCC J;  3L70 J;  3L71 J;  1SQX J;  1NTZ J;  1BE3 J;  3H1H J;  3TGU J;  3CXH I;  3H1J J;  1NTK J;  1PP9 J;  4U3F J;  1P84 I;  1SQV J;  3L73 J;  1SQP J;  3L74 J;  1BCC J;  3CWB J;  2FYU J;  3H1L J;  1KB9 I;  1SQB J;  1SQQ J;  1NTM J;  1L0N J;  3L75 J;  4PD4 I;  2BCC J;  2IBZ I;  1KYO I;  5KLV J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...