1P84I

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
55
structure length
55
Chain Sequence
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 17
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1p84I00
1SQPJ 1KB9I 3CXHI 1EZVI 3L74J 3TGUJ 3H1KJ 4PD4I 1L0NJ 2FYUJ 3H1HJ 1BE3J 1KYOI 1SQVJ 3L72J 3H1LJ 1BGYJ 1NTZJ 3H1IJ 3H1JJ 3L70J 5KLVJ 1SQQJ 3L75J 1P84I 1SQBJ 3CX5I 1NU1J 4D6TJ 1SQXJ 3BCCJ 2IBZI 3CWBJ 3L71J 2BCCJ 1NTMJ 1PP9J 1NTKJ 1L0LJ 3L73J 1BCCJ 4U3FJ
chains in the Genus database with same CATH superfamily
1YITP 3GF3A 3G6EP 3W67A 1NTKE 2WSCJ 3Q5RA 2FYUJ 5KLVG 3CCQP 3MZWB 3H1KD 3GF7A 3D6YA 1BSHA 2FFDA 1S4XA 2JR8A 1L4AD 4I1LA 2ZXXA 5KLVE 1SVFA 1X8YA 1KV4A 3CC2P 1N7SC 2AEFA 4BXLA 1Y47A 4C7NA 3V4WA 2M8RA 1PZQA 1IFIA 4K3AA 3A0BE 3W68A 1SQQD 2D2CB 2CK3H 2LXCB 3LW5H 5B5EE 1JCCA 1RY3A 1RF1C 2B89A 1L4AA 1S9KE 3RL0g 1IZNB 4PD4H 3IAOA 3B4SA 2V7QJ 5AVXB 1KILD 1OVVA 3CX5E 2C9LY 1FZCA 1SFCD 1RQUA 2O1JA 1CSBA 2HG5D 2QJPC 1EQ7A 3KYQA 1M1JB 2WITA 1N73B 2E74B 1CZQA 4H0LD 4N3YB 4M3LA 3AECC 5KKZB 3HE4A 3RL0D 3FXEA 2DW3A 3AEFC 1VQ5P 2FYNC 1KILA 1SFCA 4YXWH 5GTHE 2QA4P 1T3JA 1KB9H 3CCMP 1FZAA 2YKOA 1LWUA 1NHLA 3JC22 1L0NK 2ZT9C 1EDIA 1DH3A 3WUVA 2JWDA 1MKMA 1KB9D 3SWKA 2AEJA 1IO4A 3A7OA 4KHXA 2ZVNB 4PD4I 3AEBC 3JCUE 1K9MQ 1J1DB 1LNQA 1H88A 1RE4C 3A0HH 1T2KD 2G3AA 2B87A 3ITKA 2PAJA 2N1TC 1SQVK 3VTPC 4D6TJ 2J58A 3P8CD 4CPGA 1GL2B 1S1CX 1Q2NA 1S5LH 3M0DA 1AA0A 5KJ7C 1NAFA 3L74D 2FY8A 2LXBA 3RK3B 1URQB 3CXHH 2KSJA 2I1JA 4C7RA 1VQ8P 1PFIA 2E43A 1MZ9A 2UWJE 2FYUK 3HTKB 3MUDA 4UB8E 4ZNCA 2P58A 1LTSC 2OYHA 1HTLC 3L73J 3CXHD 1L0NG 3CCLP 1YHQP 1KFNA 2HYNA 1X79B 1KB9I 4H13B 4KJMA 1GK4A 3FGAD 1M90Q 1N7SD 4L75A 1L0NE 1HGZA 5AW2B 4Y99C 2NPSC 1SQVG 3HE5A 1BGYG 3GW6A 1N8RQ 1FOSE 3GHGA 3G71P 1BCCE 1KN7A 3ZDMA 1JY3O 2IPPA 3H32A 2CPBA 1J2JB 1SQVE 2ITAA 5CJ0A 1BGYE 4PV1C 2WT7A 1VL2A 2K3RA 3N7NA 2W83C 3L71D 2FYUG 1N7SA 3BVHA 4L76A 5CCGC 4IL6H 1LP1A 3CXHI 5APQA 2M0BA 1WT6A 2HPCA 2FYUE 2SPZA 3T97A 2A06G 4GOFA 1RF1A 2C9NY 2H43A 2KLUA 2XU6A 1GW4A 2OTKE 2NZ2A 1LTJC 3C1LA 1KD1Q 2A06E 4LGDE 3H1LD 1SS1A 3KPEA 1LGHB 1FOSF 5APTA 4XE5B 1NU1D 2ZT9D 4NPDA 2WVRA 1X9VA 1YJWP 2KS1B 1K8AQ 1J1EC 4I6MC 3CI9A 1LTIC 2YO2A 3WMM0 1JY2N 2Z5HA 3L70J 1VQ6P 3L75D 2WTYA 1OXZA 2N1TD 3V4QA 3H6PA 1DD3A 4L73A 2OTJP 1CW5A 2JJLA 3O6QA 1S2EA 2Q7CA 2WPVB 5E79E 1VDFA 1H0TA 3FWLA 4ASVA 2A45G 4K35A 1SQBD 3CWBJ 1MFZA 1GZLA 1RE4A 3CCVP 3TGUD 1DEEG 2HFED 2FYNB 3E1IA 2N1TA 2D2CC 2IBZD 1IFJA 3S1KA 1H89A 2HODA 1UIIA 1PGJA 3U1AA 3LIDA 1KYOD 2NPSD 3H1JG 1HUCA 2C0WA 3U1CA 2JDIH 3Q1MA 2KUBA 2W6JH 1K04A 4N6JA 3H1JE 4PV1D 1VQ4P 4D6TE 1M1KQ 5KKZC 3VMXA 3CL3D 1NTZJ 3AE4C 3L73G 2NPSA 3WUTA 3PP5A 1RF0C 2YNYA 2IBZI 1T8ZA 1P84H 2KNCB 2HLOA 2L91A 2J59M 2QM7A 1UIXA 3L73E 2WSFH 4JBZA 4N78E 4DT0A 3GG2A 1VF5C 2YKPA 1OVUA 1NTKD 2FXMA 2R5BA 5BU8B 1J1DC 1KC8Q 3H1KJ 5C39A 4Y99B 1YBKA 1VQNP 4TLFA 3RGUA 3OAKA 1GL2C 5KLVD 2POHA 3CD6P 3A0BH 4L74A 2XV5A 1URQC 3AEGC 1LTJA 3WUUA 1KFMA 4R4MA 2QJYC 4DCKA 5B5EH 3P8MC 1SQQJ 5H2FE 1P84I 1U57A 1SQXJ 2FXPA 1PL5A 4H13C 1L2PA 3CX5H 3LW5J 2P67A 4HB1A 1KQGB 4HJGH 4HYTB 1KQLA 2D2CD 1KORA 1MV8A 1JO5A 3D71A 4UB6H 1OWAA 1EDKA 2JP3A 1OX3A 2OTLP 2R32A 2W90A 1YTZT 1NGMB 2WSEH 3CC4P 4H44B 3D70A 1R8EA 5GTHH 5M1BA 3SWFA 2WPRA 1Q7YQ 1NOHA 1USDA 3L70E 1QGKB 1ZV8A 1BE3G 1U7JA 2WQYC 2E74D 3CCRP 3AEAC 1PPJG 2Z5IA 3CWBG 3R2PA 2M5AB 3I55P 3JCUH 4JQ0D 3CX5I 1BE3E 3AE1C 1NTZK 1PPJE 2V4HA 1OFCX 3CWBE 3VMYA 3HUSB 3VN0A 1GK6A 2FYZA 1AQ5A 1BDCA 3B5NA 1M1JA 5AW8B 1N73A 2HR3A 1FZBA 3IN6A 1VQOP 1OW7A 1X0TA 5L8RJ 4UB8H 1A02J 3BRVB 3L74J 2O01H 5KLIC 1S3JA 5CHXA 1RF0A 2Q5UA 2E42A 3L35A 1LTGC 4GODA 4ZKUA 2G8YA 3EFGA 2FXOA 1E5WA 1GL2D 4PD4D 2AXCA 4EI2A 1W2EA 1NTZG 2ZXEB 2FFDB 4W7YA 1HBWA 3A2AA 1M57D 3RK3D 1URQD 1L0ND 1GMJA 1AJYA 3TNUB 1G1IA 1NTZE 2GUVA 1BDDA 1SQQK 2FKWB 4H13D 1SQXK 1JM0A 2O1KA 2JO1A 2C0XA 1GL2A 1FJPA 1EZVG 3RBZA 1HJBA 1ZRTE 1ZN5A 3RBXA 2B88A 2OQQA 1LJ2A 1URQA 3H1KG 1JOCA 5AW6B 1VF5B 3AE6C 1QLED 3HTKA 3VP9A 1EZVE 4WWIA 1AQTA 1HWTC 1YTZI 1LTTC 2FYUD 1RH5B 1FU1A 3II6A 3H1KE 1X22A 3NTNA 2FBWC 3BCCJ 4AYCA 2QJKB 2I8DA 1AVOA 1IFNA 2PRRA 3AE7C 1M8OB 4NPEA 2N9YB 1VQLP 3H1LJ 1SQXG 4OVNF 2L5GB 3H1HD 3S4RA 1ZR2A 3VMZA 2KLVA 2QJYB 3AEDC 3H1ID 1NU1J 3M9BA 1SLQA 3D6ZA 4HH2A 2R44A 1SQXE 1CI6B 3V2NA 2V7QH 2N9BA 5DJTB 2ZVOB 5B66E 1BCCG 2XNDH 1KILE 5AVZB 2GUSA 1OVRA 1JY2O 1ZR4A 2YO3A 4Y28J 1IK7A 1W2BO 2K88A 1QVFO 3L72D 4BRYB 2O3JA 1SQBJ 4LC1A 4U3FJ 1MUUA 4EIJA 3SFEC 3TGUJ 2KZJA 3E7KA 4WB4A 3V2QA 1K73Q 2OYIB 1KMIZ 2KS1A 5AVWB 3AE2C 1KQSO 2K9YA 2KZIA 3FXDA 4ZKPA 1LTBC 5CCHC 2AXTE 4OGQB 4W7ZA 2WSSH 1ZLLA 3OW2O 4KT0J 4A7PA 2LKMA 1OZHA 3AE9C 4XA4A 3SWYA 3H1JD 1JY2P 2Q1KA 3KDPB 1RQVA 3P8CE 1H8AA 3HD7C 4H44C 3VMAA 1Q82Q 2A45I 2ZYGA 5KLIB 2PP6A 4C46A 2IDBA 1FZGA 2BCCD 2R5DA 1LT9B 2K9JB 2QG4A 4JF7A 2WSFJ 5KJ7D 1HF9A 2YXQB 1VQ7P 2W8ZA 5KAFE 1VQMP 2RH0A 3HUSC 1JY3N 2XNXA 2CPSA 1NU1K 2BEZF 3WU2E 1M7LA 2QSIA 1T3UA 3TDKA 5AW5B 5KLVJ 4PJ0E 3SSUA 1PGPA 4GOEA 1IK9A 5KJ7A 4ZMDA 1A02F 3IF4A 2QRXA 4I2LC 1AVYA 2Q3IA 2KNCA 3OA7A 3BCCG 4D6TG 2XDJA 2IYOA 4YXDC 1N86A 1NKNA 5AW3B 2E76C 2FFDC 1PV3A 2AEMA 1OW6A 1SQBK 3H1LG 1L0LD 2R3CA 3TYYA 2YKQA 2O01N 3BCCE 1PGQA 2P10A 4NPFX 1SQPD 3EQ2A 5CCGD 3F5HA 2H89C 4YTPC 2P1JA 3P32A 3H1LE 2KSEA 4DJGA 5AVSB 5AVTB 1NTMJ 3KZIE 1PP9D 1VQ9P 2WPSA 3PLNA 5CCHD 1JMBA 4RKUJ 1IFMA 4LLHA 4MN4C 2ZFCA 1P84D 1JNMA 3Q5PA 3A5TA 1LT1A 2H8PD 2WSEJ 5CCGA 5AW4B 4I7ZB 3FX0A 1R5LA 1QX8A 1K05A 1AFOA 1SQBG 3RK2B 1BE3D 4H44D 2KB7P 2QE7H 2QJKC 4U3FG 3M9HA 5CCHA 1KZUB 3L37A 3NMDA 3TGUG 1PPJD 3M0AA 2OARA 2OGUA 2BEQD 1ZMEC 1SQBE 5K5GB 2IFNA 1G2CB 4WY4B 3CMEP 4U3FE 2KIKA 1SFCC 2I1KA 1NJIQ 3TF5A 3TGUE 3VYIA 3VP8A 3BATA 5AVVB 3I56P 3PJSK 1LWUC 1W5CE 4JPZB 2Z4EA 1YQ3C 3KXDA 1S9KD 2MKVA 4EYYQ 1KYOE 1JUNA 2E75B 3QH9A 4IFFA 3CX5D 3L4FA 5GTIE 1JTHB 1PGOA 3CCSP 4ASWA 3R4YA 2M5AA 5APVA 5KLVK 2LR2A 1FZFA 5KAIE 2W27A 3P7KA 1IJDB 3L70G 3M0DC 2QM8A 3HD7B 2NRGA 3HUSA 2RMZA 1DD4A 2GA1A 2OYHC 1FS0E 2OYIC 3MGNA 5APYA 3KQGA 4W80A 3CLQA 2ZJSE 4OGQC 1EXIA 5BVZA 2KK7A 1IC2A 1NTMK 4HKZH 3GHGC 3MTUE 2WMMA 2K37A 1VQPP 1JB0J 1VF5D 3TNUA 4BWNA 3C8VA 3H1HJ 3M91A 3MHVA 3MD0A 1N2DC 3H1IJ 1TU3F 1Y8AA 4IL6X 1LT9C 1PIXA 5B66H 1SQXD 4YPCA 3Q3DA 1FE6A 3S9OA 4EOTA 2E76B 2YIUC 3I5CA 1EZVI 1IFDA 3TK1A 1XTCC 3L36A 3NFQA 2YXRB 1NTMG 2ZYDA 3MIWA 2K1AA 5APUA 3PTZA 1GD2E 1YJNP 1Y9BA 3B5NB 4C7NB 3CCJP 1WMKA 1DEBA 1BCCD 3E1RA 3ABVC 1NTME 1SP4A 1NYHA 2YMKA 3AE3C 3L72J 1SQVD 4UB6E 1JEKA 1BGYD 3B8EB 1HVVA 1Z56A 3L71J 5APSA 1NWQA 1L4AB 2WSCH 2KI7B 2OYOA 4U7JA 3HRNA 1IFPA 3H25A 4EDFA 1FZCB 2AXTH 4XFJA 3AE8C 3EFFK 1CI6A 5TISE 3PH0A 1RE3C 1Q86Q 1NKZB 3HE4B 1SQQG 2A06D 3V2PA 3UIAA 5AW9B 3H1JJ 3K5BA 3IFMA 2JWAA 1KILB 3PHLA 5CJ4A 3CC7P 1NH4A 1SFCB 1R5SA 3GMAA 2PFXA 5APWA 4BRYA 4OGQD 1SQQE 2Y0CA 1FC2C 3AE5C 1LWUB 1AV1A 2ZAEB 3CMAP 4DZOA 3CCEP 4H0LB 3USSA 3L75J 3CPWO 3VOPA 4I7ZC 1YQ4C 4OH8B 5E79H 3RL0B 2BCCJ 1YIJP 1FDIA 2OYIA 2QVAA 3RK2C 2E5YA 4PD4E 5KAFH 2B87B 1DX7A 2KYVA 4O9BA 4DOJA 3N4XA 2XKMA 1GU5A 3RK3E 3WU2H 3JSVC 1QEXA 5AVRB 2A45H 3G9RA 4WY4C 1NVOA 3KHUA 1G1JA 2MJZA 1HJ0A 5AW0B 2M3EA 4PJ0H 2IZ1A 2Y9ZA 3M9QA 2P7JA 1WRGA 2OYHB 3CCUP 1HH0A 1VPCA 5AVYB 1OW8A 1FBMA 1FDOA 2E75C 4RJTA 2BASA 1OIPA 1KB9E 5CMZA 2XZRA 3GLMA 1HGVA 1LT9A 3BASA 1NO4A 3HE5B 1QL2A 1Q81Q 2K9JA 3GHGB 4RO0A 3L74G 3BCCD 1L0LJ 1U7MA 4D6TD 3H1HG 2P2UA 3O8ZA 4AQRD 4JYBA 3H32B 1SQPJ 3H1IG 3KZIH 1YJ9P 3A0HE 2WWWA 2WT7B 4Z1MH 1FDMA 3L74E 1N7SB 3H1HE 1MFTA 4R4LA 1LP1B 1KQFB 1S5LE 3H1IE 1PP9J 1GTWA 3L73D 3CXHE 4N78D 2HPCB 1JY3P 1NAYA 1EXJA 2Q3EA 3T97B 2YIUB 1RF1B 1ZOYC 1XTGB 3V6IA 4WVZA 1NTKJ 3L72G 2KXPB 3MP7B 3G4SP 2QJPB 2RKLA 1QVGO 1BE3J 1M56D 1YI2P 3L71G 2W6BA 3Q5SA 5BU5A 1RE3A 3L72E 5DJUB 1OMIA 2IZ0A 3IR9A 5KTBA 5H2FH 4U3FD 2YMYA 3L71E 5CBNA 2KOGA 2JKVA 2R3SA 2Y9YA 3EWKA 1BSNA 3RK2D 1FJKA 3QWOC 3TSIA 2IFMA 5TJHA 1KYOH 4IOIH 4IL6E 1FZEA 3O6QB 5GTIH 4GDOA 4WY4D 2ZT9B 4JYCA 2WPQA 1H0TB 3B71A 1GU4A 1USEA 1GW3A 2JEEA 1NU1G 1DIPA 1FAVA 2Q6QA 5KAIH 3B5NC 1M1JC 3Q2YA 3NXSA 2J5UA 1N73C 2E74C 1N7LA 2N1TB 1NU1E 2H88C 2PGDA 2E75D 3L75G 2W6AA 1EDJA 1D7MA 1G2CA 4WY4A 1ZXGA 2BCCG 2HODB 1L4AC 3AEEC 1Q90D 3OJAB 2Y0EA 3L70D 1YYCA 2QIWA 3L75E 1FZCC 1EC5A 5AW7B 2BCCE 1ZW0A 3PRJA 1L0LK 1KYOI 1LTAC 3HD7D 2KP8A 5APXA 1QL1A 1SQPK 2Y0DA 3G3ZA 3M06A 4OWFA 4IFDK 3CWBD 2M3BA 1JTHA 2IBZG 2NPSB 3BRTB 1KILC 5AVUB 4GKGA 2WZ7A 5AW1B 1ZP0C 4GT1A 1E79H 1S72P 2IBZE 2H7HA 2IX7C 3HD7A 1JCDA 3SFDC 1EDLA 1T6AA 3RK3C 4PV1B 4GIFA 4H0LC 1NTKK 2GM4A 5EFWB 1KTMA 4QMAA 2IYPA 3RL0C 2O01J 1L0LG 1JMMA 1SQPG 2B9BA 4B86A 5AVQB 4TT3H 2ZYAA 1L0LE 1L0NJ 1SQPE 3FWNA 1PP9G 4IFMA 1NTZD 1RHZB 1S5LX 1LTJB 2Q9IA 4WBAA 3A3YB 5CBOA 1BCCJ 1NTMD 3LIEA 2QEXP 3MUDC 2E76D 3U59A 1PP9E 4RESB 3V2RA 1SQVJ 1ZRTD 1T2KC 2E5TA 1BGYJ 2RN0A 1NTKG 1VQKP 1J1EB 1P84E 1GDTA 3F89A 3V5BA 3B5ND 3C9IA 2VRSA 4AUWA 1EZVD 5TISH
chains in the Genus database with same CATH topology
1SQPJ 1KB9I 3CXHI 1EZVI 3L74J 3TGUJ 3H1KJ 4PD4I 1L0NJ 2FYUJ 3H1HJ 1BE3J 1KYOI 1SQVJ 3L72J 3H1LJ 1BGYJ 1NTZJ 3H1IJ 3H1JJ 3L70J 5KLVJ 1SQQJ 3L75J 1P84I 1SQBJ 3CX5I 1NU1J 4D6TJ 1SQXJ 3BCCJ 2IBZI 3CWBJ 3L71J 2BCCJ 1NTMJ 1PP9J 1NTKJ 1L0LJ 3L73J 1BCCJ 4U3FJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQP J;  1KB9 I;  3CXH I;  1EZV I;  3L74 J;  3TGU J;  3H1K J;  4PD4 I;  1L0N J;  2FYU J;  3H1H J;  1BE3 J;  1KYO I;  1SQV J;  3L72 J;  3H1L J;  1BGY J;  1NTZ J;  3H1I J;  3H1J J;  3L70 J;  5KLV J;  1SQQ J;  3L75 J;  1P84 I;  1SQB J;  3CX5 I;  1NU1 J;  4D6T J;  1SQX J;  3BCC J;  2IBZ I;  3CWB J;  3L71 J;  2BCC J;  1NTM J;  1PP9 J;  1NTK J;  1L0L J;  3L73 J;  1BCC J;  4U3F J; 
#chains in the Genus database with same CATH topology
 1YIT P;  3GF3 A;  3G6E P;  3W67 A;  1NTK E;  2WSC J;  3Q5R A;  2FYU J;  5KLV G;  3CCQ P;  3MZW B;  3H1K D;  3GF7 A;  3D6Y A;  1BSH A;  2FFD A;  1S4X A;  2JR8 A;  1L4A D;  4I1L A;  2ZXX A;  5KLV E;  1SVF A;  1X8Y A;  1KV4 A;  3CC2 P;  1N7S C;  2AEF A;  4BXL A;  1Y47 A;  4C7N A;  3V4W A;  2M8R A;  1PZQ A;  1IFI A;  4K3A A;  3A0B E;  3W68 A;  1SQQ D;  2D2C B;  2CK3 H;  2LXC B;  3LW5 H;  5B5E E;  1JCC A;  1RY3 A;  1RF1 C;  2B89 A;  1L4A A;  1S9K E;  3RL0 g;  1IZN B;  4PD4 H;  3IAO A;  3B4S A;  2V7Q J;  5AVX B;  1KIL D;  1OVV A;  3CX5 E;  2C9L Y;  1FZC A;  1SFC D;  1RQU A;  2O1J A;  1CSB A;  2HG5 D;  2QJP C;  1EQ7 A;  3KYQ A;  1M1J B;  2WIT A;  1N73 B;  2E74 B;  1CZQ A;  4H0L D;  4N3Y B;  4M3L A;  3AEC C;  5KKZ B;  3HE4 A;  3RL0 D;  3FXE A;  2DW3 A;  3AEF C;  1VQ5 P;  2FYN C;  1KIL A;  1SFC A;  4YXW H;  5GTH E;  2QA4 P;  1T3J A;  1KB9 H;  3CCM P;  1FZA A;  2YKO A;  1LWU A;  1NHL A;  3JC2 2;  1L0N K;  2ZT9 C;  1EDI A;  1DH3 A;  3WUV A;  2JWD A;  1MKM A;  1KB9 D;  3SWK A;  2AEJ A;  1IO4 A;  3A7O A;  4KHX A;  2ZVN B;  4PD4 I;  3AEB C;  3JCU E;  1K9M Q;  1J1D B;  1LNQ A;  1H88 A;  1RE4 C;  3A0H H;  1T2K D;  2G3A A;  2B87 A;  3ITK A;  2PAJ A;  2N1T C;  1SQV K;  3VTP C;  4D6T J;  2J58 A;  3P8C D;  4CPG A;  1GL2 B;  1S1C X;  1Q2N A;  1S5L H;  3M0D A;  1AA0 A;  5KJ7 C;  1NAF A;  3L74 D;  2FY8 A;  2LXB A;  3RK3 B;  1URQ B;  3CXH H;  2KSJ A;  2I1J A;  4C7R A;  1VQ8 P;  1PFI A;  2E43 A;  1MZ9 A;  2UWJ E;  2FYU K;  3HTK B;  3MUD A;  4UB8 E;  4ZNC A;  2P58 A;  1LTS C;  2OYH A;  1HTL C;  3L73 J;  3CXH D;  1L0N G;  3CCL P;  1YHQ P;  1KFN A;  2HYN A;  1X79 B;  1KB9 I;  4H13 B;  4KJM A;  1GK4 A;  3FGA D;  1M90 Q;  1N7S D;  4L75 A;  1L0N E;  1HGZ A;  5AW2 B;  4Y99 C;  2NPS C;  1SQV G;  3HE5 A;  1BGY G;  3GW6 A;  1N8R Q;  1FOS E;  3GHG A;  3G71 P;  1BCC E;  1KN7 A;  3ZDM A;  1JY3 O;  2IPP A;  3H32 A;  2CPB A;  1J2J B;  1SQV E;  2ITA A;  5CJ0 A;  1BGY E;  4PV1 C;  2WT7 A;  1VL2 A;  2K3R A;  3N7N A;  2W83 C;  3L71 D;  2FYU G;  1N7S A;  3BVH A;  4L76 A;  5CCG C;  4IL6 H;  1LP1 A;  3CXH I;  5APQ A;  2M0B A;  1WT6 A;  2HPC A;  2FYU E;  2SPZ A;  3T97 A;  2A06 G;  4GOF A;  1RF1 A;  2C9N Y;  2H43 A;  2KLU A;  2XU6 A;  1GW4 A;  2OTK E;  2NZ2 A;  1LTJ C;  3C1L A;  1KD1 Q;  2A06 E;  4LGD E;  3H1L D;  1SS1 A;  3KPE A;  1LGH B;  1FOS F;  5APT A;  4XE5 B;  1NU1 D;  2ZT9 D;  4NPD A;  2WVR A;  1X9V A;  1YJW P;  2KS1 B;  1K8A Q;  1J1E C;  4I6M C;  3CI9 A;  1LTI C;  2YO2 A;  3WMM 0;  1JY2 N;  2Z5H A;  3L70 J;  1VQ6 P;  3L75 D;  2WTY A;  1OXZ A;  2N1T D;  3V4Q A;  3H6P A;  1DD3 A;  4L73 A;  2OTJ P;  1CW5 A;  2JJL A;  3O6Q A;  1S2E A;  2Q7C A;  2WPV B;  5E79 E;  1VDF A;  1H0T A;  3FWL A;  4ASV A;  2A45 G;  4K35 A;  1SQB D;  3CWB J;  1MFZ A;  1GZL A;  1RE4 A;  3CCV P;  3TGU D;  1DEE G;  2HFE D;  2FYN B;  3E1I A;  2N1T A;  2D2C C;  2IBZ D;  1IFJ A;  3S1K A;  1H89 A;  2HOD A;  1UII A;  1PGJ A;  3U1A A;  3LID A;  1KYO D;  2NPS D;  3H1J G;  1HUC A;  2C0W A;  3U1C A;  2JDI H;  3Q1M A;  2KUB A;  2W6J H;  1K04 A;  4N6J A;  3H1J E;  4PV1 D;  1VQ4 P;  4D6T E;  1M1K Q;  5KKZ C;  3VMX A;  3CL3 D;  1NTZ J;  3AE4 C;  3L73 G;  2NPS A;  3WUT A;  3PP5 A;  1RF0 C;  2YNY A;  2IBZ I;  1T8Z A;  1P84 H;  2KNC B;  2HLO A;  2L91 A;  2J59 M;  2QM7 A;  1UIX A;  3L73 E;  2WSF H;  4JBZ A;  4N78 E;  4DT0 A;  3GG2 A;  1VF5 C;  2YKP A;  1OVU A;  1NTK D;  2FXM A;  2R5B A;  5BU8 B;  1J1D C;  1KC8 Q;  3H1K J;  5C39 A;  4Y99 B;  1YBK A;  1VQN P;  4TLF A;  3RGU A;  3OAK A;  1GL2 C;  5KLV D;  2POH A;  3CD6 P;  3A0B H;  4L74 A;  2XV5 A;  1URQ C;  3AEG C;  1LTJ A;  3WUU A;  1KFM A;  4R4M A;  2QJY C;  4DCK A;  5B5E H;  3P8M C;  1SQQ J;  5H2F E;  1P84 I;  1U57 A;  1SQX J;  2FXP A;  1PL5 A;  4H13 C;  1L2P A;  3CX5 H;  3LW5 J;  2P67 A;  4HB1 A;  1KQG B;  4HJG H;  4HYT B;  1KQL A;  2D2C D;  1KOR A;  1MV8 A;  1JO5 A;  3D71 A;  4UB6 H;  1OWA A;  1EDK A;  2JP3 A;  1OX3 A;  2OTL P;  2R32 A;  2W90 A;  1YTZ T;  1NGM B;  2WSE H;  3CC4 P;  4H44 B;  3D70 A;  1R8E A;  5GTH H;  5M1B A;  3SWF A;  2WPR A;  1Q7Y Q;  1NOH A;  1USD A;  3L70 E;  1QGK B;  1ZV8 A;  1BE3 G;  1U7J A;  2WQY C;  2E74 D;  3CCR P;  3AEA C;  1PPJ G;  2Z5I A;  3CWB G;  3R2P A;  2M5A B;  3I55 P;  3JCU H;  4JQ0 D;  3CX5 I;  1BE3 E;  3AE1 C;  1NTZ K;  1PPJ E;  2V4H A;  1OFC X;  3CWB E;  3VMY A;  3HUS B;  3VN0 A;  1GK6 A;  2FYZ A;  1AQ5 A;  1BDC A;  3B5N A;  1M1J A;  5AW8 B;  1N73 A;  2HR3 A;  1FZB A;  3IN6 A;  1VQO P;  1OW7 A;  1X0T A;  5L8R J;  4UB8 H;  1A02 J;  3BRV B;  3L74 J;  2O01 H;  5KLI C;  1S3J A;  5CHX A;  1RF0 A;  2Q5U A;  2E42 A;  3L35 A;  1LTG C;  4GOD A;  4ZKU A;  2G8Y A;  3EFG A;  2FXO A;  1E5W A;  1GL2 D;  4PD4 D;  2AXC A;  4EI2 A;  1W2E A;  1NTZ G;  2ZXE B;  2FFD B;  4W7Y A;  1HBW A;  3A2A A;  1M57 D;  3RK3 D;  1URQ D;  1L0N D;  1GMJ A;  1AJY A;  3TNU B;  1G1I A;  1NTZ E;  2GUV A;  1BDD A;  1SQQ K;  2FKW B;  4H13 D;  1SQX K;  1JM0 A;  2O1K A;  2JO1 A;  2C0X A;  1GL2 A;  1FJP A;  1EZV G;  3RBZ A;  1HJB A;  1ZRT E;  1ZN5 A;  3RBX A;  2B88 A;  2OQQ A;  1LJ2 A;  1URQ A;  3H1K G;  1JOC A;  5AW6 B;  1VF5 B;  3AE6 C;  1QLE D;  3HTK A;  3VP9 A;  1EZV E;  4WWI A;  1AQT A;  1HWT C;  1YTZ I;  1LTT C;  2FYU D;  1RH5 B;  1FU1 A;  3II6 A;  3H1K E;  1X22 A;  3NTN A;  2FBW C;  3BCC J;  4AYC A;  2QJK B;  2I8D A;  1AVO A;  1IFN A;  2PRR A;  3AE7 C;  1M8O B;  4NPE A;  2N9Y B;  1VQL P;  3H1L J;  1SQX G;  4OVN F;  2L5G B;  3H1H D;  3S4R A;  1ZR2 A;  3VMZ A;  2KLV A;  2QJY B;  3AED C;  3H1I D;  1NU1 J;  3M9B A;  1SLQ A;  3D6Z A;  4HH2 A;  2R44 A;  1SQX E;  1CI6 B;  3V2N A;  2V7Q H;  2N9B A;  5DJT B;  2ZVO B;  5B66 E;  1BCC G;  2XND H;  1KIL E;  5AVZ B;  2GUS A;  1OVR A;  1JY2 O;  1ZR4 A;  2YO3 A;  4Y28 J;  1IK7 A;  1W2B O;  2K88 A;  1QVF O;  3L72 D;  4BRY B;  2O3J A;  1SQB J;  4LC1 A;  4U3F J;  1MUU A;  4EIJ A;  3SFE C;  3TGU J;  2KZJ A;  3E7K A;  4WB4 A;  3V2Q A;  1K73 Q;  2OYI B;  1KMI Z;  2KS1 A;  5AVW B;  3AE2 C;  1KQS O;  2K9Y A;  2KZI A;  3FXD A;  4ZKP A;  1LTB C;  5CCH C;  2AXT E;  4OGQ B;  4W7Z A;  2WSS H;  1ZLL A;  3OW2 O;  4KT0 J;  4A7P A;  2LKM A;  1OZH A;  3AE9 C;  4XA4 A;  3SWY A;  3H1J D;  1JY2 P;  2Q1K A;  3KDP B;  1RQV A;  3P8C E;  1H8A A;  3HD7 C;  4H44 C;  3VMA A;  1Q82 Q;  2A45 I;  2ZYG A;  5KLI B;  2PP6 A;  4C46 A;  2IDB A;  1FZG A;  2BCC D;  2R5D A;  1LT9 B;  2K9J B;  2QG4 A;  4JF7 A;  2WSF J;  5KJ7 D;  1HF9 A;  2YXQ B;  1VQ7 P;  2W8Z A;  5KAF E;  1VQM P;  2RH0 A;  3HUS C;  1JY3 N;  2XNX A;  2CPS A;  1NU1 K;  2BEZ F;  3WU2 E;  1M7L A;  2QSI A;  1T3U A;  3TDK A;  5AW5 B;  5KLV J;  4PJ0 E;  3SSU A;  1PGP A;  4GOE A;  1IK9 A;  5KJ7 A;  4ZMD A;  1A02 F;  3IF4 A;  2QRX A;  4I2L C;  1AVY A;  2Q3I A;  2KNC A;  3OA7 A;  3BCC G;  4D6T G;  2XDJ A;  2IYO A;  4YXD C;  1N86 A;  1NKN A;  5AW3 B;  2E76 C;  2FFD C;  1PV3 A;  2AEM A;  1OW6 A;  1SQB K;  3H1L G;  1L0L D;  2R3C A;  3TYY A;  2YKQ A;  2O01 N;  3BCC E;  1PGQ A;  2P10 A;  4NPF X;  1SQP D;  3EQ2 A;  5CCG D;  3F5H A;  2H89 C;  4YTP C;  2P1J A;  3P32 A;  3H1L E;  2KSE A;  4DJG A;  5AVS B;  5AVT B;  1NTM J;  3KZI E;  1PP9 D;  1VQ9 P;  2WPS A;  3PLN A;  5CCH D;  1JMB A;  4RKU J;  1IFM A;  4LLH A;  4MN4 C;  2ZFC A;  1P84 D;  1JNM A;  3Q5P A;  3A5T A;  1LT1 A;  2H8P D;  2WSE J;  5CCG A;  5AW4 B;  4I7Z B;  3FX0 A;  1R5L A;  1QX8 A;  1K05 A;  1AFO A;  1SQB G;  3RK2 B;  1BE3 D;  4H44 D;  2KB7 P;  2QE7 H;  2QJK C;  4U3F G;  3M9H A;  5CCH A;  1KZU B;  3L37 A;  3NMD A;  3TGU G;  1PPJ D;  3M0A A;  2OAR A;  2OGU A;  2BEQ D;  1ZME C;  1SQB E;  5K5G B;  2IFN A;  1G2C B;  4WY4 B;  3CME P;  4U3F E;  2KIK A;  1SFC C;  2I1K A;  1NJI Q;  3TF5 A;  3TGU E;  3VYI A;  3VP8 A;  3BAT A;  5AVV B;  3I56 P;  3PJS K;  1LWU C;  1W5C E;  4JPZ B;  2Z4E A;  1YQ3 C;  3KXD A;  1S9K D;  2MKV A;  4EYY Q;  1KYO E;  1JUN A;  2E75 B;  3QH9 A;  4IFF A;  3CX5 D;  3L4F A;  5GTI E;  1JTH B;  1PGO A;  3CCS P;  4ASW A;  3R4Y A;  2M5A A;  5APV A;  5KLV K;  2LR2 A;  1FZF A;  5KAI E;  2W27 A;  3P7K A;  1IJD B;  3L70 G;  3M0D C;  2QM8 A;  3HD7 B;  2NRG A;  3HUS A;  2RMZ A;  1DD4 A;  2GA1 A;  2OYH C;  1FS0 E;  2OYI C;  3MGN A;  5APY A;  3KQG A;  4W80 A;  3CLQ A;  2ZJS E;  4OGQ C;  1EXI A;  5BVZ A;  2KK7 A;  1IC2 A;  1NTM K;  4HKZ H;  3GHG C;  3MTU E;  2WMM A;  2K37 A;  1VQP P;  1JB0 J;  1VF5 D;  3TNU A;  4BWN A;  3C8V A;  3H1H J;  3M91 A;  3MHV A;  3MD0 A;  1N2D C;  3H1I J;  1TU3 F;  1Y8A A;  4IL6 X;  1LT9 C;  1PIX A;  5B66 H;  1SQX D;  4YPC A;  3Q3D A;  1FE6 A;  3S9O A;  4EOT A;  2E76 B;  2YIU C;  3I5C A;  1EZV I;  1IFD A;  3TK1 A;  1XTC C;  3L36 A;  3NFQ A;  2YXR B;  1NTM G;  2ZYD A;  3MIW A;  2K1A A;  5APU A;  3PTZ A;  1GD2 E;  1YJN P;  1Y9B A;  3B5N B;  4C7N B;  3CCJ P;  1WMK A;  1DEB A;  1BCC D;  3E1R A;  3ABV C;  1NTM E;  1SP4 A;  1NYH A;  2YMK A;  3AE3 C;  3L72 J;  1SQV D;  4UB6 E;  1JEK A;  1BGY D;  3B8E B;  1HVV A;  1Z56 A;  3L71 J;  5APS A;  1NWQ A;  1L4A B;  2WSC H;  2KI7 B;  2OYO A;  4U7J A;  3HRN A;  1IFP A;  3H25 A;  4EDF A;  1FZC B;  2AXT H;  4XFJ A;  3AE8 C;  3EFF K;  1CI6 A;  5TIS E;  3PH0 A;  1RE3 C;  1Q86 Q;  1NKZ B;  3HE4 B;  1SQQ G;  2A06 D;  3V2P A;  3UIA A;  5AW9 B;  3H1J J;  3K5B A;  3IFM A;  2JWA A;  1KIL B;  3PHL A;  5CJ4 A;  3CC7 P;  1NH4 A;  1SFC B;  1R5S A;  3GMA A;  2PFX A;  5APW A;  4BRY A;  4OGQ D;  1SQQ E;  2Y0C A;  1FC2 C;  3AE5 C;  1LWU B;  1AV1 A;  2ZAE B;  3CMA P;  4DZO A;  3CCE P;  4H0L B;  3USS A;  3L75 J;  3CPW O;  3VOP A;  4I7Z C;  1YQ4 C;  4OH8 B;  5E79 H;  3RL0 B;  2BCC J;  1YIJ P;  1FDI A;  2OYI A;  2QVA A;  3RK2 C;  2E5Y A;  4PD4 E;  5KAF H;  2B87 B;  1DX7 A;  2KYV A;  4O9B A;  4DOJ A;  3N4X A;  2XKM A;  1GU5 A;  3RK3 E;  3WU2 H;  3JSV C;  1QEX A;  5AVR B;  2A45 H;  3G9R A;  4WY4 C;  1NVO A;  3KHU A;  1G1J A;  2MJZ A;  1HJ0 A;  5AW0 B;  2M3E A;  4PJ0 H;  2IZ1 A;  2Y9Z A;  3M9Q A;  2P7J A;  1WRG A;  2OYH B;  3CCU P;  1HH0 A;  1VPC A;  5AVY B;  1OW8 A;  1FBM A;  1FDO A;  2E75 C;  4RJT A;  2BAS A;  1OIP A;  1KB9 E;  5CMZ A;  2XZR A;  3GLM A;  1HGV A;  1LT9 A;  3BAS A;  1NO4 A;  3HE5 B;  1QL2 A;  1Q81 Q;  2K9J A;  3GHG B;  4RO0 A;  3L74 G;  3BCC D;  1L0L J;  1U7M A;  4D6T D;  3H1H G;  2P2U A;  3O8Z A;  4AQR D;  4JYB A;  3H32 B;  1SQP J;  3H1I G;  3KZI H;  1YJ9 P;  3A0H E;  2WWW A;  2WT7 B;  4Z1M H;  1FDM A;  3L74 E;  1N7S B;  3H1H E;  1MFT A;  4R4L A;  1LP1 B;  1KQF B;  1S5L E;  3H1I E;  1PP9 J;  1GTW A;  3L73 D;  3CXH E;  4N78 D;  2HPC B;  1JY3 P;  1NAY A;  1EXJ A;  2Q3E A;  3T97 B;  2YIU B;  1RF1 B;  1ZOY C;  1XTG B;  3V6I A;  4WVZ A;  1NTK J;  3L72 G;  2KXP B;  3MP7 B;  3G4S P;  2QJP B;  2RKL A;  1QVG O;  1BE3 J;  1M56 D;  1YI2 P;  3L71 G;  2W6B A;  3Q5S A;  5BU5 A;  1RE3 A;  3L72 E;  5DJU B;  1OMI A;  2IZ0 A;  3IR9 A;  5KTB A;  5H2F H;  4U3F D;  2YMY A;  3L71 E;  5CBN A;  2KOG A;  2JKV A;  2R3S A;  2Y9Y A;  3EWK A;  1BSN A;  3RK2 D;  1FJK A;  3QWO C;  3TSI A;  2IFM A;  5TJH A;  1KYO H;  4IOI H;  4IL6 E;  1FZE A;  3O6Q B;  5GTI H;  4GDO A;  4WY4 D;  2ZT9 B;  4JYC A;  2WPQ A;  1H0T B;  3B71 A;  1GU4 A;  1USE A;  1GW3 A;  2JEE A;  1NU1 G;  1DIP A;  1FAV A;  2Q6Q A;  5KAI H;  3B5N C;  1M1J C;  3Q2Y A;  3NXS A;  2J5U A;  1N73 C;  2E74 C;  1N7L A;  2N1T B;  1NU1 E;  2H88 C;  2PGD A;  2E75 D;  3L75 G;  2W6A A;  1EDJ A;  1D7M A;  1G2C A;  4WY4 A;  1ZXG A;  2BCC G;  2HOD B;  1L4A C;  3AEE C;  1Q90 D;  3OJA B;  2Y0E A;  3L70 D;  1YYC A;  2QIW A;  3L75 E;  1FZC C;  1EC5 A;  5AW7 B;  2BCC E;  1ZW0 A;  3PRJ A;  1L0L K;  1KYO I;  1LTA C;  3HD7 D;  2KP8 A;  5APX A;  1QL1 A;  1SQP K;  2Y0D A;  3G3Z A;  3M06 A;  4OWF A;  4IFD K;  3CWB D;  2M3B A;  1JTH A;  2IBZ G;  2NPS B;  3BRT B;  1KIL C;  5AVU B;  4GKG A;  2WZ7 A;  5AW1 B;  1ZP0 C;  4GT1 A;  1E79 H;  1S72 P;  2IBZ E;  2H7H A;  2IX7 C;  3HD7 A;  1JCD A;  3SFD C;  1EDL A;  1T6A A;  3RK3 C;  4PV1 B;  4GIF A;  4H0L C;  1NTK K;  2GM4 A;  5EFW B;  1KTM A;  4QMA A;  2IYP A;  3RL0 C;  2O01 J;  1L0L G;  1JMM A;  1SQP G;  2B9B A;  4B86 A;  5AVQ B;  4TT3 H;  2ZYA A;  1L0L E;  1L0N J;  1SQP E;  3FWN A;  1PP9 G;  4IFM A;  1NTZ D;  1RHZ B;  1S5L X;  1LTJ B;  2Q9I A;  4WBA A;  3A3Y B;  5CBO A;  1BCC J;  1NTM D;  3LIE A;  2QEX P;  3MUD C;  2E76 D;  3U59 A;  1PP9 E;  4RES B;  3V2R A;  1SQV J;  1ZRT D;  1T2K C;  2E5T A;  1BGY J;  2RN0 A;  1NTK G;  1VQK P;  1J1E B;  1P84 E;  1GDT A;  3F89 A;  3V5B A;  3B5N D;  3C9I A;  2VRS A;  4AUW A;  1EZV D;  5TIS H; 
#chains in the Genus database with same CATH homology
 1SQP J;  1KB9 I;  3CXH I;  1EZV I;  3L74 J;  3TGU J;  3H1K J;  4PD4 I;  1L0N J;  2FYU J;  3H1H J;  1BE3 J;  1KYO I;  1SQV J;  3L72 J;  3H1L J;  1BGY J;  1NTZ J;  3H1I J;  3H1J J;  3L70 J;  5KLV J;  1SQQ J;  3L75 J;  1P84 I;  1SQB J;  3CX5 I;  1NU1 J;  4D6T J;  1SQX J;  3BCC J;  2IBZ I;  3CWB J;  3L71 J;  2BCC J;  1NTM J;  1PP9 J;  1NTK J;  1L0L J;  3L73 J;  1BCC J;  4U3F J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...