1P84I

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
55
structure length
55
Chain Sequence
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
total genus 17
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1p84I00
1KYOI 1NTKJ 3H1LJ 2FYUJ 1BGYJ 3H1HJ 1SQVJ 3BCCJ 1EZVI 4U3FJ 3CWBJ 1L0NJ 4PD4I 1NTMJ 1KB9I 3H1IJ 1NU1J 1NTZJ 3L71J 4D6TJ 1BCCJ 1PP9J 1SQPJ 3L70J 3CX5I 1SQXJ 1BE3J 2BCCJ 1SQBJ 1SQQJ 3TGUJ 3H1KJ 3L75J 2IBZI 3L74J 5KLVJ 1L0LJ 3H1JJ 3L72J 3CXHI 3L73J 1P84I
chains in the Genus database with same CATH superfamily
1GL2C 2B9BA 1S5LE 2DW3A 3H1LJ 3HD7C 1SQQK 3L71D 3L72G 3NFQA 4GT1A 1LTJC 3N7NA 5KKZB 1J1EB 1X22A 2JWDA 2LXBA 3G3ZA 3RK2C 2YXQB 2KP8A 1Q82Q 3B5NB 2WT7A 3SFDC 4PV1C 3L75D 1KILE 3WUUA 2HPCA 2RH0A 2ITAA 3BASA 4W7ZA 3M0DC 5AW9B 1SQXD 5DJUB 1MFTA 3A0HE 1LP1A 3H1JD 2R3CA 4IOIH 3CPWO 3H1KG 2O3JA 3AEDC 5KLIC 2ZYAA 3I56P 2OYIB 3H1HG 3KXDA 3QWOC 4BXLA 3L70E 2BCCE 2N1TD 3W68A 3EQ2A 3TSIA 1HWTC 2HFED 1KQLA 3GMAA 3V2RA 3HUSC 1U7MA 3H1KJ 3L75E 1CW5A 3JC22 5BVZA 3RK3D 2W8ZA 1EDLA 2M3BA 2M8RA 3FXDA 1J2JB 2JDIH 2YO2A 3PLNA 3U1CA 2IZ1A 3L73J 4IL6E 2J58A 1FZGA 3K5BA 4H44C 5AW7B 5AW6B 2IPPA 3HD7A 2A45I 2H43A 1M7LA 2R32A 1FU1A 2YKOA 1LGHB 4PD4D 3CCJP 2QG4A 1W2EA 1BGYE 2C0WA 2W6JH 2POHA 1IZNB 1X8YA 3L4FA 2QJYB 3H32B 2Z5IA 5CCHD 3A5TA 3CWBE 1OFCX 1USEA 1RF1C 2WSCH 4WY4D 2N1TA 4Y99C 3RL0g 1S9KD 1YI2P 1FOSF 1S72P 3PJSK 2M5AA 2JR8A 1PFIA 1VQKP 2WMMA 3AE8C 3L70J 4H0LB 5KAIE 1LT9C 3HE5B 1SFCB 3H1KE 4RESB 3V4QA 2E75D 3HRNA 3L70G 2E74B 3RGUA 3G4SP 5KJ7C 4H13B 3L73E 3S9OA 2WPVB 3U1AA 2ZT9B 1K04A 3A3YB 3FX0A 3MIWA 4K35A 3SWKA 1JY3O 4R4MA 4IL6X 1DX7A 3D6YA 2Z5HA 1BGYJ 1G2CB 2AEMA 2D2CC 4WY4B 1KB9D 1N8RQ 1A02F 1VQ6P 3ITKA 2B89A 1E79H 1NU1K 3PTZA 1L0NJ 5E79H 1QVFO 1EDIA 2E76B 1Z56A 2WZ7A 2IZ0A 2KOGA 3H1HD 2OTLP 1M1JA 1VDFA 3V6IA 2OYHA 3RL0D 3U59A 1S3JA 1CSBA 2CPSA 2NPSA 1L0NG 1NTZE 3VMZA 1PP9E 1YBKA 1GMJA 3GF3A 2A06G 2QJPC 1HBWA 1FBMA 1KFMA 2QVAA 3R4YA 4H13D 4JPZB 1VQOP 3TGUJ 1BCCD 1NTZK 1NTZG 1S2EA 1BSHA 4IL6H 1LWUC 3TNUB 3I5CA 1HJ0A 5K5GB 1JTHB 3CCSP 1CI6A 2HODB 3IAOA 3L72E 4N6JA 5AW8B 5EFWB 1OWAA 2WSFH 1X9VA 4LC1A 1DIPA 1HUCA 2Q3IA 3CLQA 3IF4A 3H32A 1M1KQ 1PPJE 2ZYGA 5APSA 2HG5D 3Q5SA 3HE4A 2XV5A 1GW4A 3PHLA 3F5HA 3VP8A 3I55P 1WMKA 2BASA 3SSUA 3VP9A 2W6BA 4C7NB 3CMAP 2WITA 2OARA 4B86A 2IFNA 5AW5B 5AW4B 2Q3EA 3AE4C 3H1JG 1JY3N 1SQXG 2YMYA 1JOCA 1VQ7P 1PP9J 1NU1E 3C9IA 3O8ZA 3AE9C 3TYYA 1VQ8P 3E7KA 3HE4B 3KHUA 3P32A 1HTLC 2E42A 3RK3B 4PV1D 1K8AQ 2KB7P 2K9JB 2WSFJ 3AE2C 3H1JE 4OVNF 5GTIH 3Q3DA 4UB6H 5KJ7A 1SQBK 2NRGA 2XU6A 1KILD 2YMKA 2Y9ZA 1JTHA 5APTA 1GU5A 1N73C 1N2DC 1VQ5P 2KI7B 3H1LE 3S1KA 3BVHA 3A0BH 2O01N 4I6MC 4WBAA 3FGAD 3II6A 1GL2A 1Q90D 1RE3C 2PRRA 4EOTA 1YJ9P 2NPSB 1KYOD 1VL2A 1BSNA 1QX8A 2G8YA 2K3RA 1SQVD 3VN0A 3TDKA 4JQ0D 5CCGD 1L4AA 1K05A 1BDCA 3GW6A 1NU1J 3G9RA 1YHQP 1PGOA 5APQA 2K1AA 1BDDA 5B5EE 1FZEA 2IBZD 1LJ2A 1J1DC 3L74G 4EIJA 1G2CA 1GZLA 2PP6A 3CCUP 2XKMA 5AVSB 2QEXP 2JKVA 2A45H 4TLFA 4ZKPA 1PGPA 1PV3A 5TISH 3O6QA 2QJKB 2ZJSE 2Q9IA 1D7MA 4W80A 2KLVA 5H2FE 2R3SA 3BRVB 3H1KD 3LW5H 5M1BA 1IO4A 1AQ5A 1OW6A 1IFPA 3BCCD 3P7KA 4O9BA 4N78D 1SQVG 3L36A 2OQQA 1AV1A 1S5LX 3GLMA 4C7NA 3MD0A 3V2QA 1OX3A 1YJNP 4EI2A 3V4WA 3OW2O 1LTAC 1SP4A 1XTGB 2I1KA 1IFJA 1KFNA 3AEEC 2IX7C 3CWBJ 1IC2A 1Q2NA 2RMZA 3H25A 3G71P 2N1TB 1N7SD 1KQGB 2MKVA 3CWBG 5KKZC 1S5LH 3B71A 2N9BA 3C1LA 3TF5A 3MP7B 2AEJA 4L74A 3RK2B 3IN6A 1KILB 4PD4E 2KZIA 2ZVOB 1JY2O 3EFFK 2KS1B 3KZIE 4UB6E 1OVVA 1WRGA 4DCKA 1RF0C 1SQQE 5BU5A 5CCGA 1PPJG 3HD7B 2PGDA 3FXEA 1SQBG 2ZXEB 4IFDK 5KAFH 2YNYA 1HH0A 1LT1A 1ZP0C 3O6QB 4UB8H 5AVUB 3HD7D 2RKLA 2D2CB 1AQTA 3ZDMA 3HUSB 1YYCA 3L70D 3T97B 1P84D 1ZW0A 2C0XA 2N1TC 3H1HE 1SLQA 4GOEA 2E76C 1GK6A 3M0DA 2OYIC 1UIXA 3A7OA 3L74D 1VPCA 5CCHA 5CMZA 1NTMJ 2YXRB 1RE4A 1PIXA 2WPQA 1IJDB 1P84E 3OJAB 5DJTB 1G1IA 2HPCB 1PGQA 1GL2D 1NTZJ 2QJPB 2WT7B 4GIFA 4IFMA 1GDTA 1LNQA 5AW1B 3TK1A 1VQMP 2QIWA 1BE3J 3AEGC 3P8CD 3TGUE 1QVGO 1SQQJ 3GHGB 2A45G 5AVWB 5H2FH 1EC5A 1L4AD 2FYNB 4Y99B 3CCQP 3L74J 3PP5A 5KLVJ 1L0ND 1L0NK 1E5WA 3D6ZA 2HR3A 3CXHI 3G6EP 2I1JA 2W83C 2WSEJ 3CCRP 1G1JA 5CHXA 2KIKA 4XA4A 2WSCJ 4I7ZC 3IFMA 1EZVI 2LR2A 3H1ID 2JJLA 2QRXA 2O1JA 2KS1A 1DH3A 4PD4I 2E5YA 1RE4C 2V7QH 5KJ7D 5AVYB 5KLVD 2R44A 1GU4A 1L0LK 1YQ3C 1USDA 1WT6A 2BCCD 2NPSD 3H1IE 3KZIH 2ZVNB 4JBZA 3GF7A 3SWYA 1BE3E 1IFMA 3NMDA 2IYOA 3WUVA 1K9MQ 1H89A 2UWJE 1HVVA 1PPJD 1R5SA 1RH5B 1SQXE 2K9YA 3H1LG 3LW5J 1JM0A 3LIDA 4UB8E 1LTBC 2WVRA 3L74E 2OTKE 5KLVE 3RK3C 2FY8A 3AE5C 1FZAA 1W5CE 4OGQB 3QH9A 4DT0A 1KQSO 4JYCA 5AVTB 1M90Q 1M56D 1NVOA 2P58A 1VF5D 3KQGA 4WY4A 3CI9A 1H88A 4H44B 1P84H 1SQVE 1M1JC 3BCCE 3H1LD 3RK3E 1DD3A 2OYHC 1AFOA 2A06D 3AE6C 3VMXA 4A7PA 5CCHC 2H88C 2QM7A 1URQD 4U3FG 3PRJA 3RL0B 1A02J 1SQXK 1XTCC 1QGKB 2XDJA 1YJWP 1QL2A 1RY3A 1KYOE 3P8MC 4Z1MH 1EZVD 1SQPJ 1FOSE 2I8DA 3CX5I 1SQXJ 1W2BO 2E74D 1NH4A 2M3EA 1NJIQ 1PL5A 1UIIA 2E75B 1J1DB 1JMBA 2AEFA 2JO1A 3AEBC 2VRSA 2Y0EA 4H0LC 4BWNA 1X79B 2MJZA 5APXA 1RQUA 2HLOA 3KPEA 2CK3H 2G3AA 2ZT9D 4QMAA 5APWA 3AECC 1EXIA 1LTJA 2B88A 1FJKA 2GUSA 3M9BA 4L75A 2M5AB 3AE3C 3B5ND 4U3FD 1NU1D 1OZHA 3CC7P 4H13C 3GG2A 3D71A 1EDJA 2FXOA 1KB9H 2SPZA 3AE7C 3WUTA 3HE5A 4IFFA 4WB4A 3BCCJ 1Y47A 1NAYA 2Y0DA 1HGZA 1LTIC 1OIPA 2YKPA 1FZCA 1NTKK 5GTIE 1IK9A 1SQPK 3MTUE 4DOJA 4I1LA 1PGJA 3NXSA 1IFNA 4YTPC 3WU2E 4EDFA 1URQB 2FXMA 3BCCG 1NOHA 4TT3H 2WPSA 1SQPE 2XZRA 1KILC 3A0BE 2H89C 4N78E 4ZMDA 1BCCE 5AVQB 3VMAA 1SVFA 2AXTE 2P7JA 1AA0A 2NZ2A 2FFDC 3CMEP 1JUNA 1GW3A 2E76D 1HJBA 1H0TA 1M8OB 4NPFX 4WWIA 3UIAA 2Q5UA 4OGQD 1RF0A 1FAVA 2BEQD 3RBZA 1Y9BA 1T2KC 2J59M 1P84I 3EWKA 3VYIA 1U57A 5B5EH 3WMM0 1L4AB 1JB0J 1NTKJ 1SQBD 3CCLP 2IBZE 3H1HJ 1N7SA 3PH0A 4N3YB 2B87A 3JCUH 5GTHE 1VQNP 2QM8A 3L37A 3B5NA 4RJTA 2IBZG 1NTME 1KYOH 1YTZT 1GL2B 1SFCD 4AYCA 3L72D 3L71G 1EXJA 3CCEP 1FDMA 1JO5A 1KV4A 3V5BA 1ZRTE 4Y28J 3M0AA 1MUUA 5AVVB 1VQ4P 1YQ4C 3VMYA 2ZYDA 1BCCJ 3L73G 2FYUD 1KQFB 4D6TJ 4NPDA 1SQVK 1GD2E 1M57D 1SS1A 1EQ7A 1SQBJ 1NTZD 1QL1A 3B4SA 2K37A 3C8VA 1LTTC 1RQVA 3Q2YA 1ZOYC 1T3JA 2W27A 3MUDC 1ZRTD 3KDPB 4JYBA 2IBZI 2FYNC 2N9YB 3AEAC 3CX5H 3HUSA 3T97A 5B66H 4EYYQ 4GOFA 1R8EA 1NTMD 3M9QA 2Q6QA 1JCCA 4WY4C 1LWUA 3BRTB 1IK7A 3RL0C 2P10A 4HH2A 3CC2P 5KTBA 2P1JA 1QLED 2P67A 4H44D 4I7ZB 4PD4H 1YITP 2FYUJ 3CL3D 1NWQA 1JY2P 4U7JA 4BRYA 1ZR4A 1BE3D 3AEFC 3WU2H 4ZKUA 3RK2D 5KAFE 1Q7YQ 1SFCA 2FBWC 1KD1Q 2KZJA 5BU8B 1DD4A 2E43A 3CCVP 1KC8Q 1JY3P 3H1IJ 4LLHA 4D6TE 4LGDE 1NTMG 2ZFCA 1KN7A 3HTKB 2CPBA 1TU3F 2QJYC 1MFZA 2QA4P 1VF5C 1Q81Q 3V2NA 2W6AA 4XE5B 3H1IG 1U7JA 5C39A 2JWAA 1PP9D 2D2CD 2J5UA 3SFEC 2M0BA 3EFGA 1PZQA 3H6PA 4R4LA 4C7RA 4C46A 1JNMA 4ASVA 2BEZF 4D6TG 3Q5PA 1K73Q 2R5BA 3FWLA 1L0LJ 2FFDB 1FS0E 1RE3A 2KUBA 2O01H 2XNXA 3B8EB 3JCUE 4I2LC 5GTHH 1J1EC 2FYUE 3GHGC 5TJHA 2AXCA 2GA1A 2E74C 1M1JB 2OYHB 3P8CE 3OAKA 1HGVA 1MZ9A 1S1CX 1SQVJ 1PP9G 3CXHH 3JSVC 5KAIH 1GK4A 2ZXXA 4HYTB 2Q7CA 1SFCC 2GUVA 3TGUG 2QE7H 1SQPG 1OW8A 1ZMEC 2JEEA 3SWFA 5L8RJ 1VF5B 3L73D 3W67A 4M3LA 4GDOA 1L0LD 1X0TA 3FWNA 3M9HA 4DJGA 2YIUC 1NYHA 1AVYA 2Y0CA 2OYIA 2B87B 1S4XA 5KLIB 1N7LA 1FZBA 1LTGC 5B66E 1NHLA 2Y9YA 1L4AC 3CX5E 4RO0A 4HKZH 5AVRB 2WTYA 1NGMB 4AUWA 1OVRA 2C9LY 1EDKA 1RHZB 3V2PA 1OVUA 2E75C 2JP3A 2KSEA 4PJ0E 1EZVG 2LKMA 4WVZA 5E79E 4KHXA 2C9NY 2WWWA 3MHVA 4GKGA 4NPEA 3D70A 1NAFA 4XFJA 5AW0B 1LT9A 2FYZA 1YTZI 5AVZB 2LXCB 2W90A 3M91A 4KJMA 3L75G 3S4RA 1SQPD 3IR9A 1FE6A 2V7QJ 2FKWB 2FXPA 2K9JA 4K3AA 1OMIA 1BCCG 4BRYB 1ZN5A 1VQPP 4U3FJ 1LTSC 1S9KE 5CJ0A 2Z4EA 1RF1B 2L91A 1AVOA 1MKMA 2O1KA 4OGQC 2IDBA 1VQLP 1NU1G 1LWUB 1T3UA 3E1RA 1URQA 1JEKA 3L35A 3Q5RA 1FDOA 3CWBD 4L73A 5KLVK 2KK7A 3RBXA 2WQYC 3R2PA 1LT9B 1FZCB 4YXWH 3ABVC 4ASWA 2Q1KA 1BGYD 2L5GB 2WSEH 2PFXA 2KNCA 2QJKC 1NTKG 3GHGA 5AVXB 5AW3B 2YO3A 4H0LD 1Q86Q 1ZV8A 5APVA 2ZT9C 1LTJB 1JMMA 1Y8AA 4MN4C 1IFIA 2R5DA 1IFDA 4YXDC 1T8ZA 2OGUA 1YIJP 4RKUJ 1NTMK 1OW7A 2GM4A 1N86A 5KLVG 2PAJA 2KSJA 1NTKE 3CXHE 4YPCA 1KYOI 1EZVE 5AW2B 1LP1B 3VOPA 4JF7A 4AQRD 1CI6B 2HODA 2HYNA 2XNDH 3MGNA 5APUA 3TGUD 1N7SB 1AJYA 2WSSH 4U3FE 1BE3G 3A2AA 3NTNA 3TNUA 1T6AA 1NTKD 3CXHD 3KYQA 1ZLLA 2WPRA 1FZCC 1QEXA 4DZOA 4OH8B 1BGYG 1L0NE 1NO4A 3CD6P 1HF9A 3CCMP 1KB9I 4CPGA 2H7HA 3F89A 3Q1MA 2IYPA 2KYVA 4ZNCA 5CCGC 3L71E 1KB9E 2NPSC 1DEEG 1OXZA 3MZWB 1SQBE 3N4XA 3A0HH 2FFDA 4PJ0H 1H0TB 1FDIA 1N73A 1NKZB 1KILA 2E5TA 2O01J 3BATA 5APYA 1URQC 2IFMA 5CBNA 4HJGH 2YKQA 2KLUA 1SQQD 2FYUG 4W7YA 1ZR2A 1FZFA 2V4HA 3L72J 1H8AA 1MV8A 3MUDA 1N7SC 5CJ4A 2AXTH 1FC2C 1KTMA 4D6TD 2YIUB 1NKNA 1DEBA 1GTWA 3AE1C 2OTJP 1FJPA 2H8PD 1JY2N 4OWFA 3HTKA 2OYOA 4HB1A 4GODA 2KNCB 3VTPC 1KMIZ 5TISE 3E1IA 1L2PA 1R5LA 2BCCG 1ZXGA 3OA7A 1L0LG 1KZUB 3B5NC 2KXPB 3L71J 2FYUK 4PV1B 2QSIA 1SQQG 3CC4P 3LIEA 5CBOA 2K88A 1JCDA 2RN0A 2BCCJ 1VQ9P 1RF1A 2P2UA 2ZAEB 3L75J 4KT0J 2A06E 1N73B 1T2KD 1CZQA 1L0LE 3H1JJ 3CX5D 3M06A 3USSA 4L76A 1KORA
chains in the Genus database with same CATH topology
1KYOI 1NTKJ 3H1LJ 2FYUJ 1BGYJ 3H1HJ 1SQVJ 3BCCJ 1EZVI 4U3FJ 3CWBJ 1L0NJ 4PD4I 1NTMJ 1KB9I 3H1IJ 1NU1J 1NTZJ 3L71J 4D6TJ 1BCCJ 1PP9J 1SQPJ 3L70J 3CX5I 1SQXJ 1BE3J 2BCCJ 1SQBJ 1SQQJ 3TGUJ 3H1KJ 3L75J 2IBZI 3L74J 5KLVJ 1L0LJ 3H1JJ 3L72J 3CXHI 3L73J 1P84I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYO I;  1NTK J;  3H1L J;  2FYU J;  1BGY J;  3H1H J;  1SQV J;  3BCC J;  1EZV I;  4U3F J;  3CWB J;  1L0N J;  4PD4 I;  1NTM J;  1KB9 I;  3H1I J;  1NU1 J;  1NTZ J;  3L71 J;  4D6T J;  1BCC J;  1PP9 J;  1SQP J;  3L70 J;  3CX5 I;  1SQX J;  1BE3 J;  2BCC J;  1SQB J;  1SQQ J;  3TGU J;  3H1K J;  3L75 J;  2IBZ I;  3L74 J;  5KLV J;  1L0L J;  3H1J J;  3L72 J;  3CXH I;  3L73 J;  1P84 I; 
#chains in the Genus database with same CATH topology
 1GL2 C;  2B9B A;  1S5L E;  2DW3 A;  3H1L J;  3HD7 C;  1SQQ K;  3L71 D;  3L72 G;  3NFQ A;  4GT1 A;  1LTJ C;  3N7N A;  5KKZ B;  1J1E B;  1X22 A;  2JWD A;  2LXB A;  3G3Z A;  3RK2 C;  2YXQ B;  2KP8 A;  1Q82 Q;  3B5N B;  2WT7 A;  3SFD C;  4PV1 C;  3L75 D;  1KIL E;  3WUU A;  2HPC A;  2RH0 A;  2ITA A;  3BAS A;  4W7Z A;  3M0D C;  5AW9 B;  1SQX D;  5DJU B;  1MFT A;  3A0H E;  1LP1 A;  3H1J D;  2R3C A;  4IOI H;  3CPW O;  3H1K G;  2O3J A;  3AED C;  5KLI C;  2ZYA A;  3I56 P;  2OYI B;  3H1H G;  3KXD A;  3QWO C;  4BXL A;  3L70 E;  2BCC E;  2N1T D;  3W68 A;  3EQ2 A;  3TSI A;  1HWT C;  2HFE D;  1KQL A;  3GMA A;  3V2R A;  3HUS C;  1U7M A;  3H1K J;  3L75 E;  1CW5 A;  3JC2 2;  5BVZ A;  3RK3 D;  2W8Z A;  1EDL A;  2M3B A;  2M8R A;  3FXD A;  1J2J B;  2JDI H;  2YO2 A;  3PLN A;  3U1C A;  2IZ1 A;  3L73 J;  4IL6 E;  2J58 A;  1FZG A;  3K5B A;  4H44 C;  5AW7 B;  5AW6 B;  2IPP A;  3HD7 A;  2A45 I;  2H43 A;  1M7L A;  2R32 A;  1FU1 A;  2YKO A;  1LGH B;  4PD4 D;  3CCJ P;  2QG4 A;  1W2E A;  1BGY E;  2C0W A;  2W6J H;  2POH A;  1IZN B;  1X8Y A;  3L4F A;  2QJY B;  3H32 B;  2Z5I A;  5CCH D;  3A5T A;  3CWB E;  1OFC X;  1USE A;  1RF1 C;  2WSC H;  4WY4 D;  2N1T A;  4Y99 C;  3RL0 g;  1S9K D;  1YI2 P;  1FOS F;  1S72 P;  3PJS K;  2M5A A;  2JR8 A;  1PFI A;  1VQK P;  2WMM A;  3AE8 C;  3L70 J;  4H0L B;  5KAI E;  1LT9 C;  3HE5 B;  1SFC B;  3H1K E;  4RES B;  3V4Q A;  2E75 D;  3HRN A;  3L70 G;  2E74 B;  3RGU A;  3G4S P;  5KJ7 C;  4H13 B;  3L73 E;  3S9O A;  2WPV B;  3U1A A;  2ZT9 B;  1K04 A;  3A3Y B;  3FX0 A;  3MIW A;  4K35 A;  3SWK A;  1JY3 O;  4R4M A;  4IL6 X;  1DX7 A;  3D6Y A;  2Z5H A;  1BGY J;  1G2C B;  2AEM A;  2D2C C;  4WY4 B;  1KB9 D;  1N8R Q;  1A02 F;  1VQ6 P;  3ITK A;  2B89 A;  1E79 H;  1NU1 K;  3PTZ A;  1L0N J;  5E79 H;  1QVF O;  1EDI A;  2E76 B;  1Z56 A;  2WZ7 A;  2IZ0 A;  2KOG A;  3H1H D;  2OTL P;  1M1J A;  1VDF A;  3V6I A;  2OYH A;  3RL0 D;  3U59 A;  1S3J A;  1CSB A;  2CPS A;  2NPS A;  1L0N G;  1NTZ E;  3VMZ A;  1PP9 E;  1YBK A;  1GMJ A;  3GF3 A;  2A06 G;  2QJP C;  1HBW A;  1FBM A;  1KFM A;  2QVA A;  3R4Y A;  4H13 D;  4JPZ B;  1VQO P;  3TGU J;  1BCC D;  1NTZ K;  1NTZ G;  1S2E A;  1BSH A;  4IL6 H;  1LWU C;  3TNU B;  3I5C A;  1HJ0 A;  5K5G B;  1JTH B;  3CCS P;  1CI6 A;  2HOD B;  3IAO A;  3L72 E;  4N6J A;  5AW8 B;  5EFW B;  1OWA A;  2WSF H;  1X9V A;  4LC1 A;  1DIP A;  1HUC A;  2Q3I A;  3CLQ A;  3IF4 A;  3H32 A;  1M1K Q;  1PPJ E;  2ZYG A;  5APS A;  2HG5 D;  3Q5S A;  3HE4 A;  2XV5 A;  1GW4 A;  3PHL A;  3F5H A;  3VP8 A;  3I55 P;  1WMK A;  2BAS A;  3SSU A;  3VP9 A;  2W6B A;  4C7N B;  3CMA P;  2WIT A;  2OAR A;  4B86 A;  2IFN A;  5AW5 B;  5AW4 B;  2Q3E A;  3AE4 C;  3H1J G;  1JY3 N;  1SQX G;  2YMY A;  1JOC A;  1VQ7 P;  1PP9 J;  1NU1 E;  3C9I A;  3O8Z A;  3AE9 C;  3TYY A;  1VQ8 P;  3E7K A;  3HE4 B;  3KHU A;  3P32 A;  1HTL C;  2E42 A;  3RK3 B;  4PV1 D;  1K8A Q;  2KB7 P;  2K9J B;  2WSF J;  3AE2 C;  3H1J E;  4OVN F;  5GTI H;  3Q3D A;  4UB6 H;  5KJ7 A;  1SQB K;  2NRG A;  2XU6 A;  1KIL D;  2YMK A;  2Y9Z A;  1JTH A;  5APT A;  1GU5 A;  1N73 C;  1N2D C;  1VQ5 P;  2KI7 B;  3H1L E;  3S1K A;  3BVH A;  3A0B H;  2O01 N;  4I6M C;  4WBA A;  3FGA D;  3II6 A;  1GL2 A;  1Q90 D;  1RE3 C;  2PRR A;  4EOT A;  1YJ9 P;  2NPS B;  1KYO D;  1VL2 A;  1BSN A;  1QX8 A;  2G8Y A;  2K3R A;  1SQV D;  3VN0 A;  3TDK A;  4JQ0 D;  5CCG D;  1L4A A;  1K05 A;  1BDC A;  3GW6 A;  1NU1 J;  3G9R A;  1YHQ P;  1PGO A;  5APQ A;  2K1A A;  1BDD A;  5B5E E;  1FZE A;  2IBZ D;  1LJ2 A;  1J1D C;  3L74 G;  4EIJ A;  1G2C A;  1GZL A;  2PP6 A;  3CCU P;  2XKM A;  5AVS B;  2QEX P;  2JKV A;  2A45 H;  4TLF A;  4ZKP A;  1PGP A;  1PV3 A;  5TIS H;  3O6Q A;  2QJK B;  2ZJS E;  2Q9I A;  1D7M A;  4W80 A;  2KLV A;  5H2F E;  2R3S A;  3BRV B;  3H1K D;  3LW5 H;  5M1B A;  1IO4 A;  1AQ5 A;  1OW6 A;  1IFP A;  3BCC D;  3P7K A;  4O9B A;  4N78 D;  1SQV G;  3L36 A;  2OQQ A;  1AV1 A;  1S5L X;  3GLM A;  4C7N A;  3MD0 A;  3V2Q A;  1OX3 A;  1YJN P;  4EI2 A;  3V4W A;  3OW2 O;  1LTA C;  1SP4 A;  1XTG B;  2I1K A;  1IFJ A;  1KFN A;  3AEE C;  2IX7 C;  3CWB J;  1IC2 A;  1Q2N A;  2RMZ A;  3H25 A;  3G71 P;  2N1T B;  1N7S D;  1KQG B;  2MKV A;  3CWB G;  5KKZ C;  1S5L H;  3B71 A;  2N9B A;  3C1L A;  3TF5 A;  3MP7 B;  2AEJ A;  4L74 A;  3RK2 B;  3IN6 A;  1KIL B;  4PD4 E;  2KZI A;  2ZVO B;  1JY2 O;  3EFF K;  2KS1 B;  3KZI E;  4UB6 E;  1OVV A;  1WRG A;  4DCK A;  1RF0 C;  1SQQ E;  5BU5 A;  5CCG A;  1PPJ G;  3HD7 B;  2PGD A;  3FXE A;  1SQB G;  2ZXE B;  4IFD K;  5KAF H;  2YNY A;  1HH0 A;  1LT1 A;  1ZP0 C;  3O6Q B;  4UB8 H;  5AVU B;  3HD7 D;  2RKL A;  2D2C B;  1AQT A;  3ZDM A;  3HUS B;  1YYC A;  3L70 D;  3T97 B;  1P84 D;  1ZW0 A;  2C0X A;  2N1T C;  3H1H E;  1SLQ A;  4GOE A;  2E76 C;  1GK6 A;  3M0D A;  2OYI C;  1UIX A;  3A7O A;  3L74 D;  1VPC A;  5CCH A;  5CMZ A;  1NTM J;  2YXR B;  1RE4 A;  1PIX A;  2WPQ A;  1IJD B;  1P84 E;  3OJA B;  5DJT B;  1G1I A;  2HPC B;  1PGQ A;  1GL2 D;  1NTZ J;  2QJP B;  2WT7 B;  4GIF A;  4IFM A;  1GDT A;  1LNQ A;  5AW1 B;  3TK1 A;  1VQM P;  2QIW A;  1BE3 J;  3AEG C;  3P8C D;  3TGU E;  1QVG O;  1SQQ J;  3GHG B;  2A45 G;  5AVW B;  5H2F H;  1EC5 A;  1L4A D;  2FYN B;  4Y99 B;  3CCQ P;  3L74 J;  3PP5 A;  5KLV J;  1L0N D;  1L0N K;  1E5W A;  3D6Z A;  2HR3 A;  3CXH I;  3G6E P;  2I1J A;  2W83 C;  2WSE J;  3CCR P;  1G1J A;  5CHX A;  2KIK A;  4XA4 A;  2WSC J;  4I7Z C;  3IFM A;  1EZV I;  2LR2 A;  3H1I D;  2JJL A;  2QRX A;  2O1J A;  2KS1 A;  1DH3 A;  4PD4 I;  2E5Y A;  1RE4 C;  2V7Q H;  5KJ7 D;  5AVY B;  5KLV D;  2R44 A;  1GU4 A;  1L0L K;  1YQ3 C;  1USD A;  1WT6 A;  2BCC D;  2NPS D;  3H1I E;  3KZI H;  2ZVN B;  4JBZ A;  3GF7 A;  3SWY A;  1BE3 E;  1IFM A;  3NMD A;  2IYO A;  3WUV A;  1K9M Q;  1H89 A;  2UWJ E;  1HVV A;  1PPJ D;  1R5S A;  1RH5 B;  1SQX E;  2K9Y A;  3H1L G;  3LW5 J;  1JM0 A;  3LID A;  4UB8 E;  1LTB C;  2WVR A;  3L74 E;  2OTK E;  5KLV E;  3RK3 C;  2FY8 A;  3AE5 C;  1FZA A;  1W5C E;  4OGQ B;  3QH9 A;  4DT0 A;  1KQS O;  4JYC A;  5AVT B;  1M90 Q;  1M56 D;  1NVO A;  2P58 A;  1VF5 D;  3KQG A;  4WY4 A;  3CI9 A;  1H88 A;  4H44 B;  1P84 H;  1SQV E;  1M1J C;  3BCC E;  3H1L D;  3RK3 E;  1DD3 A;  2OYH C;  1AFO A;  2A06 D;  3AE6 C;  3VMX A;  4A7P A;  5CCH C;  2H88 C;  2QM7 A;  1URQ D;  4U3F G;  3PRJ A;  3RL0 B;  1A02 J;  1SQX K;  1XTC C;  1QGK B;  2XDJ A;  1YJW P;  1QL2 A;  1RY3 A;  1KYO E;  3P8M C;  4Z1M H;  1EZV D;  1SQP J;  1FOS E;  2I8D A;  3CX5 I;  1SQX J;  1W2B O;  2E74 D;  1NH4 A;  2M3E A;  1NJI Q;  1PL5 A;  1UII A;  2E75 B;  1J1D B;  1JMB A;  2AEF A;  2JO1 A;  3AEB C;  2VRS A;  2Y0E A;  4H0L C;  4BWN A;  1X79 B;  2MJZ A;  5APX A;  1RQU A;  2HLO A;  3KPE A;  2CK3 H;  2G3A A;  2ZT9 D;  4QMA A;  5APW A;  3AEC C;  1EXI A;  1LTJ A;  2B88 A;  1FJK A;  2GUS A;  3M9B A;  4L75 A;  2M5A B;  3AE3 C;  3B5N D;  4U3F D;  1NU1 D;  1OZH A;  3CC7 P;  4H13 C;  3GG2 A;  3D71 A;  1EDJ A;  2FXO A;  1KB9 H;  2SPZ A;  3AE7 C;  3WUT A;  3HE5 A;  4IFF A;  4WB4 A;  3BCC J;  1Y47 A;  1NAY A;  2Y0D A;  1HGZ A;  1LTI C;  1OIP A;  2YKP A;  1FZC A;  1NTK K;  5GTI E;  1IK9 A;  1SQP K;  3MTU E;  4DOJ A;  4I1L A;  1PGJ A;  3NXS A;  1IFN A;  4YTP C;  3WU2 E;  4EDF A;  1URQ B;  2FXM A;  3BCC G;  1NOH A;  4TT3 H;  2WPS A;  1SQP E;  2XZR A;  1KIL C;  3A0B E;  2H89 C;  4N78 E;  4ZMD A;  1BCC E;  5AVQ B;  3VMA A;  1SVF A;  2AXT E;  2P7J A;  1AA0 A;  2NZ2 A;  2FFD C;  3CME P;  1JUN A;  1GW3 A;  2E76 D;  1HJB A;  1H0T A;  1M8O B;  4NPF X;  4WWI A;  3UIA A;  2Q5U A;  4OGQ D;  1RF0 A;  1FAV A;  2BEQ D;  3RBZ A;  1Y9B A;  1T2K C;  2J59 M;  1P84 I;  3EWK A;  3VYI A;  1U57 A;  5B5E H;  3WMM 0;  1L4A B;  1JB0 J;  1NTK J;  1SQB D;  3CCL P;  2IBZ E;  3H1H J;  1N7S A;  3PH0 A;  4N3Y B;  2B87 A;  3JCU H;  5GTH E;  1VQN P;  2QM8 A;  3L37 A;  3B5N A;  4RJT A;  2IBZ G;  1NTM E;  1KYO H;  1YTZ T;  1GL2 B;  1SFC D;  4AYC A;  3L72 D;  3L71 G;  1EXJ A;  3CCE P;  1FDM A;  1JO5 A;  1KV4 A;  3V5B A;  1ZRT E;  4Y28 J;  3M0A A;  1MUU A;  5AVV B;  1VQ4 P;  1YQ4 C;  3VMY A;  2ZYD A;  1BCC J;  3L73 G;  2FYU D;  1KQF B;  4D6T J;  4NPD A;  1SQV K;  1GD2 E;  1M57 D;  1SS1 A;  1EQ7 A;  1SQB J;  1NTZ D;  1QL1 A;  3B4S A;  2K37 A;  3C8V A;  1LTT C;  1RQV A;  3Q2Y A;  1ZOY C;  1T3J A;  2W27 A;  3MUD C;  1ZRT D;  3KDP B;  4JYB A;  2IBZ I;  2FYN C;  2N9Y B;  3AEA C;  3CX5 H;  3HUS A;  3T97 A;  5B66 H;  4EYY Q;  4GOF A;  1R8E A;  1NTM D;  3M9Q A;  2Q6Q A;  1JCC A;  4WY4 C;  1LWU A;  3BRT B;  1IK7 A;  3RL0 C;  2P10 A;  4HH2 A;  3CC2 P;  5KTB A;  2P1J A;  1QLE D;  2P67 A;  4H44 D;  4I7Z B;  4PD4 H;  1YIT P;  2FYU J;  3CL3 D;  1NWQ A;  1JY2 P;  4U7J A;  4BRY A;  1ZR4 A;  1BE3 D;  3AEF C;  3WU2 H;  4ZKU A;  3RK2 D;  5KAF E;  1Q7Y Q;  1SFC A;  2FBW C;  1KD1 Q;  2KZJ A;  5BU8 B;  1DD4 A;  2E43 A;  3CCV P;  1KC8 Q;  1JY3 P;  3H1I J;  4LLH A;  4D6T E;  4LGD E;  1NTM G;  2ZFC A;  1KN7 A;  3HTK B;  2CPB A;  1TU3 F;  2QJY C;  1MFZ A;  2QA4 P;  1VF5 C;  1Q81 Q;  3V2N A;  2W6A A;  4XE5 B;  3H1I G;  1U7J A;  5C39 A;  2JWA A;  1PP9 D;  2D2C D;  2J5U A;  3SFE C;  2M0B A;  3EFG A;  1PZQ A;  3H6P A;  4R4L A;  4C7R A;  4C46 A;  1JNM A;  4ASV A;  2BEZ F;  4D6T G;  3Q5P A;  1K73 Q;  2R5B A;  3FWL A;  1L0L J;  2FFD B;  1FS0 E;  1RE3 A;  2KUB A;  2O01 H;  2XNX A;  3B8E B;  3JCU E;  4I2L C;  5GTH H;  1J1E C;  2FYU E;  3GHG C;  5TJH A;  2AXC A;  2GA1 A;  2E74 C;  1M1J B;  2OYH B;  3P8C E;  3OAK A;  1HGV A;  1MZ9 A;  1S1C X;  1SQV J;  1PP9 G;  3CXH H;  3JSV C;  5KAI H;  1GK4 A;  2ZXX A;  4HYT B;  2Q7C A;  1SFC C;  2GUV A;  3TGU G;  2QE7 H;  1SQP G;  1OW8 A;  1ZME C;  2JEE A;  3SWF A;  5L8R J;  1VF5 B;  3L73 D;  3W67 A;  4M3L A;  4GDO A;  1L0L D;  1X0T A;  3FWN A;  3M9H A;  4DJG A;  2YIU C;  1NYH A;  1AVY A;  2Y0C A;  2OYI A;  2B87 B;  1S4X A;  5KLI B;  1N7L A;  1FZB A;  1LTG C;  5B66 E;  1NHL A;  2Y9Y A;  1L4A C;  3CX5 E;  4RO0 A;  4HKZ H;  5AVR B;  2WTY A;  1NGM B;  4AUW A;  1OVR A;  2C9L Y;  1EDK A;  1RHZ B;  3V2P A;  1OVU A;  2E75 C;  2JP3 A;  2KSE A;  4PJ0 E;  1EZV G;  2LKM A;  4WVZ A;  5E79 E;  4KHX A;  2C9N Y;  2WWW A;  3MHV A;  4GKG A;  4NPE A;  3D70 A;  1NAF A;  4XFJ A;  5AW0 B;  1LT9 A;  2FYZ A;  1YTZ I;  5AVZ B;  2LXC B;  2W90 A;  3M91 A;  4KJM A;  3L75 G;  3S4R A;  1SQP D;  3IR9 A;  1FE6 A;  2V7Q J;  2FKW B;  2FXP A;  2K9J A;  4K3A A;  1OMI A;  1BCC G;  4BRY B;  1ZN5 A;  1VQP P;  4U3F J;  1LTS C;  1S9K E;  5CJ0 A;  2Z4E A;  1RF1 B;  2L91 A;  1AVO A;  1MKM A;  2O1K A;  4OGQ C;  2IDB A;  1VQL P;  1NU1 G;  1LWU B;  1T3U A;  3E1R A;  1URQ A;  1JEK A;  3L35 A;  3Q5R A;  1FDO A;  3CWB D;  4L73 A;  5KLV K;  2KK7 A;  3RBX A;  2WQY C;  3R2P A;  1LT9 B;  1FZC B;  4YXW H;  3ABV C;  4ASW A;  2Q1K A;  1BGY D;  2L5G B;  2WSE H;  2PFX A;  2KNC A;  2QJK C;  1NTK G;  3GHG A;  5AVX B;  5AW3 B;  2YO3 A;  4H0L D;  1Q86 Q;  1ZV8 A;  5APV A;  2ZT9 C;  1LTJ B;  1JMM A;  1Y8A A;  4MN4 C;  1IFI A;  2R5D A;  1IFD A;  4YXD C;  1T8Z A;  2OGU A;  1YIJ P;  4RKU J;  1NTM K;  1OW7 A;  2GM4 A;  1N86 A;  5KLV G;  2PAJ A;  2KSJ A;  1NTK E;  3CXH E;  4YPC A;  1KYO I;  1EZV E;  5AW2 B;  1LP1 B;  3VOP A;  4JF7 A;  4AQR D;  1CI6 B;  2HOD A;  2HYN A;  2XND H;  3MGN A;  5APU A;  3TGU D;  1N7S B;  1AJY A;  2WSS H;  4U3F E;  1BE3 G;  3A2A A;  3NTN A;  3TNU A;  1T6A A;  1NTK D;  3CXH D;  3KYQ A;  1ZLL A;  2WPR A;  1FZC C;  1QEX A;  4DZO A;  4OH8 B;  1BGY G;  1L0N E;  1NO4 A;  3CD6 P;  1HF9 A;  3CCM P;  1KB9 I;  4CPG A;  2H7H A;  3F89 A;  3Q1M A;  2IYP A;  2KYV A;  4ZNC A;  5CCG C;  3L71 E;  1KB9 E;  2NPS C;  1DEE G;  1OXZ A;  3MZW B;  1SQB E;  3N4X A;  3A0H H;  2FFD A;  4PJ0 H;  1H0T B;  1FDI A;  1N73 A;  1NKZ B;  1KIL A;  2E5T A;  2O01 J;  3BAT A;  5APY A;  1URQ C;  2IFM A;  5CBN A;  4HJG H;  2YKQ A;  2KLU A;  1SQQ D;  2FYU G;  4W7Y A;  1ZR2 A;  1FZF A;  2V4H A;  3L72 J;  1H8A A;  1MV8 A;  3MUD A;  1N7S C;  5CJ4 A;  2AXT H;  1FC2 C;  1KTM A;  4D6T D;  2YIU B;  1NKN A;  1DEB A;  1GTW A;  3AE1 C;  2OTJ P;  1FJP A;  2H8P D;  1JY2 N;  4OWF A;  3HTK A;  2OYO A;  4HB1 A;  4GOD A;  2KNC B;  3VTP C;  1KMI Z;  5TIS E;  3E1I A;  1L2P A;  1R5L A;  2BCC G;  1ZXG A;  3OA7 A;  1L0L G;  1KZU B;  3B5N C;  2KXP B;  3L71 J;  2FYU K;  4PV1 B;  2QSI A;  1SQQ G;  3CC4 P;  3LIE A;  5CBO A;  2K88 A;  1JCD A;  2RN0 A;  2BCC J;  1VQ9 P;  1RF1 A;  2P2U A;  2ZAE B;  3L75 J;  4KT0 J;  2A06 E;  1N73 B;  1T2K D;  1CZQ A;  1L0L E;  3H1J J;  3CX5 D;  3M06 A;  3USS A;  4L76 A;  1KOR A; 
#chains in the Genus database with same CATH homology
 1KYO I;  1NTK J;  3H1L J;  2FYU J;  1BGY J;  3H1H J;  1SQV J;  3BCC J;  1EZV I;  4U3F J;  3CWB J;  1L0N J;  4PD4 I;  1NTM J;  1KB9 I;  3H1I J;  1NU1 J;  1NTZ J;  3L71 J;  4D6T J;  1BCC J;  1PP9 J;  1SQP J;  3L70 J;  3CX5 I;  1SQX J;  1BE3 J;  2BCC J;  1SQB J;  1SQQ J;  3TGU J;  3H1K J;  3L75 J;  2IBZ I;  3L74 J;  5KLV J;  1L0L J;  3H1J J;  3L72 J;  3CXH I;  3L73 J;  1P84 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...