2LR2A

Designed igg and lanthanide binding probe for solution nmr, mri and luminescence microscopy
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
b'GVDNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDSYIDTNNDGAYEGDELSGSQSANLLAEAKKLNDAQAPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein A
publication title Lanthanide binding and IgG affinity construct: Potential applications in solution NMR, MRI, and luminescence microscopy.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2012-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2lr2A00
2LXBA 1SS1A 2WMMA 1X0TA 1H0TB 5DJTB 3S1KA 1H0TA 1JMBA 5CBOA 3FXDA 3RGUA 1U7JA 4BXLA 1EDJA 2B87B 3FXEA 2SPZA 2B87A 2K3RA 2KI7B 4MN4C 4EYYQ 4KJMA 4NPEA 1OVVA 4HJGH 4GODA 2B88A 2KUBA 5C39A 1U7MA 2UWJE 1OVUA 1BDCA 1JM0A 1EDLA 4IOIH 2OTKE 2Q1KA 2KS1B 4K35A 4WWIA 2M0BA 2ZAEB 1ZXGA 3MHVA 4ASWA 2HR3A 4CPGA 3QWOC 4ASVA 4NPFX 3MZWB 5CBNA 4JBZA 5EFWB 2KZIA 2P58A 4GOEA 1ZW0A 1BDDA 2QRXA 2KIKA 2B89A 1S3JA 2QVAA 4NPDA 1OVRA 2M5AB 2M5AA 4ZMDA 1Y47A 2JWDA 2RKLA 2KZJA 4K3AA 1Q2NA 3PH0A 4HB1A 4GOFA 5DJUB 2LXCB 2R44A 1LP1B 1EDKA 1FC2C 1LP1A 4HKZH 1EDIA 1MFTA 2LR2A 1LT1A 1NVOA 1EC5A 4ZNCA 3ZDMA 5K5GB 2I8DA 1DEEG
chains in the Genus database with same CATH superfamily
1NO4A 2R5BA 4KHXA 3MD0A 2YKQA 1H0TB 2XNDH 1GU4A 4LLHA 1KQGB 1YTZT 1J1DC 3V2NA 3A0BE 1YI2P 3G9RA 5KJ7A 1PPJG 3USSA 2FFDC 2W6JH 1VQ8P 1GL2B 2IFNA 3CC4P 4D6TJ 4GODA 1M8OB 1NTMK 2C0XA 4C7RA 1RF1B 5AW3B 3KPEA 1RQUA 1PFIA 1IFPA 4K35A 5B66E 2N9BA 2KNCA 2I1JA 1MZ9A 1X8YA 1XTCC 3F5HA 5APXA 3N4XA 3TK1A 1VDFA 4QMAA 1HJBA 3H1IE 1VF5D 3KHUA 5CJ4A 1KYOE 1SQPK 3GF3A 1L0NJ 1RY3A 1VL2A 1G2CB 2KYVA 1EZVD 2HFED 5KLVK 4GKGA 1NTKD 5KAIH 5KKZB 3G3ZA 1Q2NA 2IZ1A 4GOFA 1IK7A 1KB9H 1L4AB 5B5EE 3NXSA 1GK4A 3H1LE 3CCUP 3AE1C 2OTJP 4YPCA 1EC5A 2G8YA 3CXHH 1AV1A 1S4XA 2E43A 3RK3D 3RBZA 5AVYB 2JO1A 2A45H 2J58A 1DEEG 1K9MQ 3BRVB 5CCHD 1G1JA 3HE5A 1X0TA 3A7OA 1KILD 3AE7C 3WU2E 1SQQE 1W2EA 3H32B 1KB9D 4KJMA 1VF5C 3MGNA 5AVSB 2O01N 1A02J 2WSEH 3CXHD 3L74D 3W68A 2IBZE 3L70G 1VQ7P 2FXMA 1XTGB 3L75E 3BASA 1P84H 2QA4P 3EFFK 2ZYAA 4LC1A 3AE9C 2KP8A 2KLVA 1MKMA 1KZUB 2KOGA 4PV1B 4WY4A 4WVZA 2QSIA 2YXQB 1SQVE 4UB6E 1AJYA 2FXOA 2NPSB 3D71A 2PP6A 1KORA 1S1CX 4RJTA 2QVAA 5AW2B 2JKVA 5M1BA 1MFZA 1E79H 3RK3C 1SQPD 2WPSA 2H7HA 1P84D 4HB1A 2L91A 4HH2A 5CCHC 4H44D 5KAFE 1DX7A 3FWNA 3KZIE 2B9BA 1YIJP 5KLIC 2C9NY 3P8CD 1J1EB 4RKUJ 1KQFB 3L72E 2V4HA 3CX5I 1DD3A 4M3LA 1LJ2A 2QJKB 3L70J 1GD2E 3LIEA 2D2CC 4D6TD 1H0TA 2WSFH 2YNYA 3A0BH 5TJHA 2OTLP 2HYNA 4NPEA 2FYUG 3V2PA 1PP9D 2QJPB 1YHQP 1LTTC 4PJ0E 1SQQK 2FY8A 4EI2A 1GK6A 2E75B 2QJYB 1RF1A 1BGYG 1KV4A 3B71A 1S5LE 3CPWO 1USEA 5CCGD 1EXJA 4ASWA 4C46A 3CWBD 1SFCC 1KYOH 4H44C 1A02F 3G71P 1JY3O 2KIKA 1BE3G 2AEMA 1KFMA 2GUVA 2JWAA 2FYNC 1JY2P 1IO4A 3WUVA 1URQB 3M0DA 3M0AA 3AEGC 2LXCB 3GF7A 2K9YA 1EDKA 1L4AA 3H1ID 1T3UA 2JEEA 1KYOD 3Q5RA 2FYZA 1NH4A 2OYOA 2FYUJ 1HGVA 3V5BA 5AVXB 4OGQD 1SS1A 3RK2B 2P10A 3LW5J 1BGYJ 1OMIA 1PGJA 3PTZA 2GM4A 2Q3EA 1M1KQ 3H1LD 3H32A 1QVGO 1IFMA 4MN4C 4WY4C 4GT1A 3V2QA 2WSCJ 1HBWA 1H8AA 1VQPP 3HD7A 1PGPA 1JM0A 1VQMP 1JCDA 3A0HE 1BE3J 1EZVG 4WWIA 1M1JA 1OX3A 3M06A 3U1CA 3L4FA 1NTKG 1SQQD 2ZYGA 4UB6H 4H0LD 2KZIA 3AEAC 3CL3D 1KILB 1J2JB 1IFJA 5AW1B 4C7NA 4KT0J 1Y9BA 1YTZI 2RKLA 2Y0EA 1KQLA 1ZR2A 4XFJA 5KAFH 3G6EP 2O01H 2V7QJ 3PLNA 1LWUB 4IL6E 4DT0A 3KZIH 1FU1A 3L70D 4ZNCA 2Q7CA 2K88A 1N73C 1S9KE 1LTJC 4GDOA 2I8DA 2E76C 2IZ0A 5CMZA 3VMZA 5AVWB 1VPCA 5AVTB 2YMYA 2O3JA 3RGUA 3PP5A 2B87B 1NTKJ 1NTMG 4JF7A 2WPVB 2K3RA 3E1RA 4H0LC 3HUSC 1FZGA 4PJ0H 3MUDC 3A2AA 5APQA 3B5NC 3L72D 1S5LH 1SQPG 3VMXA 1BCCE 3VP9A 1ZMEC 3FGAD 3M0DC 4JBZA 1Q82Q 2OYIC 2C9LY 2OYHB 3PJSK 4IFMA 1X9VA 2C0WA 3BVHA 2E5YA 1ZP0C 1FZCC 1SQXE 5KLVG 1RE3A 3U1AA 4YTPC 1YITP 1LTBC 4AUWA 1HH0A 2HPCA 3AEEC 1Q86Q 4ZMDA 1X22A 2QG4A 1QEXA 2MKVA 2DW3A 1URQA 3PH0A 3UIAA 1IJDB 1NTZE 1KN7A 3G4SP 3GHGB 3BATA 3QH9A 3ZDMA 2BEZF 1NTMJ 4Y99C 4L76A 2AXCA 1PP9G 2A06E 1T6AA 2WSEJ 1RE4C 1N86A 1M1JC 1SQPJ 3AEFC 1L2PA 1U7JA 4BXLA 3CWBG 4AQRD 1OW6A 1RQVA 3TYYA 3TGUE 2Z5IA 3L35A 4BWNA 1RF0A 2V7QH 3D70A 1OVUA 5KLVJ 1VQ4P 1ZN5A 5APTA 1UIXA 2JJLA 3CD6P 2NZ2A 4OGQB 2IYPA 1FAVA 3H1IG 5APWA 3CX5E 1N7SB 2P2UA 3WMM0 1NKZB 2J5UA 4NPDA 3NFQA 1OVRA 1PP9J 2M5AB 4I6MC 2M3EA 1SQXK 2IYOA 2R5DA 2H43A 4ZKPA 4DCKA 1AVYA 2J59M 4XE5B 2POHA 2LR2A 3L36A 1GW4A 3M91A 1PPJE 3H1LG 1DD4A 4L73A 3CWBJ 2WSFJ 4H13B 1NTZK 1FJKA 5TISE 3HE4B 1JY3N 5DJTB 2CK3H 2A45I 3FXEA 2B87A 1FOSF 4W7ZA 4W7YA 3H1JE 1SQQG 1OVVA 4EDFA 2KLUA 3H1IJ 1LNQA 3C1LA 2PFXA 1S9KD 2IBZG 1T8ZA 3CC2P 2ZAEB 4I7ZC 5BU5A 3L75G 1DIPA 3QWOC 1KD1Q 4PD4I 3RL0C 4BRYB 4U3FD 2WQYC 4XA4A 2OYHA 1K73Q 3PRJA 1FE6A 1X79B 3H1LJ 2D2CD 2N1TB 1W2BO 1JB0J 3Q5SA 1LT9A 1K8AQ 3W67A 3MP7B 1NTMD 1BCCD 1PV3A 2FXPA 3CCVP 4N78E 2R44A 1JY3P 2JR8A 2YIUC 2KSEA 1FDOA 3GHGA 3IFMA 3H6PA 4TLFA 4YXDC 1SQQJ 1SQXD 1OXZA 3JC22 3FWLA 1IK9A 3JCUE 3L72G 1SFCD 2Y0DA 2P67A 1M57D 3AE5C 1JMBA 2KXPB 1J1DB 3M9HA 3IAOA 1L0LE 2ZT9C 3L75J 5KLVD 1NTZD 1ZRTD 5KJ7C 1JY2N 2FFDB 2KSJA 1E5WA 2RMZA 3P32A 1RHZB 1JNMA 1IFDA 3L71E 1IC2A 1PZQA 2A06D 3L73E 1OZHA 3VN0A 3VTPC 4R4LA 1JUNA 4OVNF 1JEKA 1GL2A 2GA1A 2H8PD 5GTIE 3TGUD 3CX5H 1VQNP 5B66H 2O01J 1N7SA 3BCCD 3AE3C 3N7NA 4UB8E 2M5AA 4WY4D 3L72J 4A7PA 2IFMA 4DZOA 3M9BA 2QEXP 4OH8B 2E74D 1JCCA 1NVOA 1G2CA 5TISH 3KYQA 3D6YA 1SQVK 1Q7YQ 2GUSA 3HE4A 1BGYE 5B5EH 2WMMA 3CCRP 1Q81Q 1BSHA 2Y0CA 3S4RA 2Y9YA 4ZKUA 4N3YB 2QM7A 2WPQA 1SQBE 1VF5B 3VP8A 2XKMA 1HWTC 2G3AA 1PGQA 1VQOP 1L0LK 3PHLA 2NRGA 2QIWA 1BE3E 2QE7H 1JOCA 2Q1KA 2Z4EA 3WU2H 1VQLP 1NWQA 1YJNP 1W5CE 1LT9C 2E76D 1VQ6P 3R4YA 1OWAA 4BRYA 1MV8A 4JQ0D 2E74C 1QGKB 4Z1MH 5APVA 3CC7P 2Q6QA 3O6QB 1AVOA 2N1TA 1S2EA 3RK3B 1SP4A 2E42A 4IFDK 4R4MA 2JWDA 1VQ9P 1SLQA 2CPSA 1HJ0A 5AW0B 1JO5A 2FKWB 2WSSH 1LP1B 3B5ND 2RN0A 2NPSA 5KLIB 2IBZD 2YXRB 3FX0A 5K5GB 2W6AA 3JCUH 1K05A 3K5BA 3E1IA 3L75D 3E7KA 3TSIA 1NU1E 1LTAC 3I5CA 2D2CB 2R32A 1L4AD 3CMAP 2BCCE 2JP3A 1FZEA 1EDJA 4N78D 1M56D 1SQVD 2SPZA 3LIDA 4U3FG 1SVFA 5AW4B 3C9IA 1NAFA 5E79E 1GL2C 2WITA 1CW5A 1U7MA 1HVVA 3H1HE 1RF1C 1SQBK 5BVZA 2ZXXA 1YJWP 4L75A 2HR3A 3CCSP 4ASVA 1SFCB 1BCCG 5L8RJ 3TNUB 5KTBA 1L0LD 1KILE 5AW8B 1UIIA 5AVZB 5GTIH 4H44B 2AEJA 4IFFA 3HD7D 3H1KE 1KQSO 1SQXG 3L74E 2FYNB 3P7KA 4OWFA 3L73D 1FZFA 4L74A 3TF5A 5KKZC 3Q5PA 1L4AC 3IN6A 1EDIA 1MFTA 4EOTA 3V4QA 1NTZG 2H88C 3SWKA 4EIJA 2PGDA 3CI9A 3D6ZA 4U3FJ 3SWYA 2R3CA 2K1AA 2LXBA 2A06G 2Q9IA 4WB4A 4PD4E 3L37A 3FXDA 2ZFCA 1QVFO 3NTNA 5GTHE 4WY4B 1NU1K 2PAJA 1BCCJ 2KI7B 1NJIQ 3TGUG 5H2FE 2CPBA 3P8CE 3HD7C 2E74B 1HUCA 3AE4C 3BCCG 2YMKA 1SQXJ 1OIPA 1YQ3C 1WMKA 3V4WA 3OAKA 4CPGA 3RL0g 4D6TE 2O1JA 5CBNA 1NYHA 1FZAA 2I1KA 5APUA 2KK7A 3ABVC 1NTZJ 1BDDA 3A0HH 5APYA 1Y8AA 1OFCX 2IDBA 3O6QA 1FDIA 4AYCA 1EZVI 3SFEC 1FZBA 1L0NE 5CCHA 1LP1A 2AXTE 1YJ9P 2N9YB 1KILA 3CWBE 4N6JA 1N73B 2YKPA 1LTJB 1QL2A 1KC8Q 1J1EC 1HGZA 2E76B 5APSA 3TGUJ 1OW7A 2Y9ZA 1LTIC 1URQD 5CJ0A 3CCQP 3RL0D 2QJKC 3AEBC 1YBKA 3BCCJ 4IL6H 1LWUA 2W83C 2E5TA 1VQKP 1KB9I 5E79H 1LTSC 2VRSA 3H1JG 4H0LB 3HUSB 1LGHB 1KFNA 5AW5B 1D7MA 1GU5A 3B5NB 3CXHI 4RESB 2QJPC 3OW2O 2Q5UA 1GTWA 3RK2D 1EDLA 2E75C 2QJYC 3OJAB 1NU1D 3CCMP 1GMJA 1ZXGA 3EFGA 1JTHB 2BCCD 3MZWB 1SFCA 3TNUA 2OYIB 1KMIZ 2KB7P 2P7JA 1FZCB 2IPPA 2W6BA 1NHLA 4I2LC 1RE3C 4Y28J 3CMEP 3CCEP 1AQTA 1NOHA 2ZT9D 5AVUB 1EXIA 4O9BA 3H1HD 5KJ7D 1FDMA 1URQC 5AVVB 1P84I 1SQVG 3OA7A 4Y99B 1DEBA 1L0NK 3H1KD 3H1JJ 3H25A 2K37A 3HD7B 2AEFA 3RK2C 4PD4H 1M1JB 5CCGA 2YO3A 5GTHH 1L0LG 3KXDA 4EYYQ 5H2FH 3M9QA 4HJGH 1RF0C 3L70E 3L71G 4IOIH 1USDA 1NGMB 4C7NB 2KS1B 1WT6A 1OW8A 3U59A 3CLQA 3L73G 1VQ5P 1H89A 3AECC 3P8MC 3NMDA 4W80A 3GG2A 4PD4D 3CCJP 3SSUA 1FS0E 2FBWC 3HTKB 1SQVJ 1ZW0A 1KILC 3EQ2A 2QRXA 1CI6B 3R2PA 1LTGC 2W27A 2XU6A 3AE6C 2P1JA 5DJUB 3BRTB 2Z5HA 2AXTH 3C8VA 2IX7C 4HKZH 1LT1A 2LKMA 1LWUC 3VYIA 4HYTB 3T97B 1QL1A 1KYOI 2YKOA 1N73A 1L0LJ 2XDJA 1LTJA 1HTLC 2RH0A 3GMAA 2XZRA 3VOPA 3AE2C 2XNXA 1ZR4A 1Z56A 5CHXA 1R5SA 3L71J 1BSNA 2HG5D 1ZV8A 1HF9A 3V6IA 1T2KD 5AW6B 1L0ND 2WT7B 3L73J 3II6A 2YO2A 3SFDC 3B4SA 4YXWH 1YQ4C 2FYUE 3EWKA 1KTMA 4U7JA 3CX5D 1N7LA 1K04A 1SQBG 3HUSA 4RO0A 5C39A 3KDPB 3MUDA 4JYBA 3B5NA 2M3BA 2K9JB 1IFNA 2W90A 3RBXA 4I7ZB 2M0BA 2WTYA 4TT3H 3I55P 2HPCB 2M8RA 3GW6A 1FBMA 1JTHA 3Q1MA 1PPJD 3RL0B 2XV5A 2OYIA 5EFWB 3WUTA 2OYHC 1FZCA 1GDTA 2HODB 3MTUE 1S5LX 2W8ZA 1YYCA 3CCLP 2QM8A 2IBZI 3Q3DA 1Y47A 2ZYDA 1GL2D 1QX8A 2YIUB 3GLMA 3H1JD 1GW3A 1T2KC 3ITKA 3GHGC 5CCGC 1N7SD 3A3YB 1AFOA 1SQBJ 1H88A 4DOJA 1IFIA 5AW7B 1IZNB 1NU1G 1RE4A 1DH3A 1QLED 1N8RQ 2ZT9B 5CBOA 1AQ5A 2BCCG 4I1LA 3WUUA 4JPZB 4H13D 1U57A 1N2DC 1TU3F 3AE8C 1BDCA 2BASA 2ZJSE 1EZVE 1ZOYC 2OTKE 1FJPA 2KNCB 2FYUK 2KS1A 3H1HG 1NTKE 3I56P 1M90Q 1CSBA 3SWFA 3MHVA 4B86A 2BEQD 2ZVNB 3B8EB 3VMAA 2FFDA 1JY2O 1PGOA 3HRNA 4OGQC 1G1IA 3HTKA 4GOEA 2JDIH 5AVRB 3RK3E 1N7SC 1CI6A 2B89A 5BU8B 3KQGA 1CZQA 3H1KG 3VMYA 3L74G 2MJZA 4K3AA 5KAIE 1NU1J 2A45G 2WPRA 1KB9E 1WRGA 2H89C 1MUUA 2BCCJ 1PIXA 1AA0A 1M7LA 3L71D 4U3FE 3T97A 2N1TD 4UB8H 3CXHE 4H13C 2Q3IA 3F89A 3MIWA 2OARA 1RH5B 2ZVOB 2WWWA 1R5LA 4PV1D 1T3JA 3HE5B 1R8EA 4IL6X 1PL5A 3S1KA 1FOSE 3H1HJ 1NTME 2WT7A 2NPSD 2WZ7A 3O8ZA 2L5GB 1NAYA 2B88A 2R3SA 2KUBA 2OQQA 3LW5H 1GZLA 2HLOA 2UWJE 2PRRA 3JSVC 2K9JA 1SQPE 3TDKA 3H1KJ 1S72P 1P84E 3A5TA 5AW9B 2WSCH 1LT9B 3L74J 4NPFX 4D6TG 5KLVE 2P58A 1ZRTE 2FYUD 4JYCA 1NTKK 2HODA 4GIFA 3IF4A 5AVQB 1S3JA 2N1TC 3Q2YA 1BGYD 1JMMA 3IR9A 2O1KA 4LGDE 4PV1C 3V2RA 2KZJA 2ITAA 1L0NG 1SQBD 3AEDC 1FC2C 1Q90D 3S9OA 2NPSC 2E75D 1PP9E 1EQ7A 1ZLLA 4WBAA 2ZXEB 1BE3D 1NKNA 2WVRA 2OGUA 4DJGA 3BCCE
chains in the Genus database with same CATH topology
2LXBA 1SS1A 2WMMA 1X0TA 1H0TB 5DJTB 3S1KA 1H0TA 1JMBA 5CBOA 3FXDA 3RGUA 1U7JA 4BXLA 1EDJA 2B87B 3FXEA 2SPZA 2B87A 2K3RA 2KI7B 4MN4C 4EYYQ 4KJMA 4NPEA 1OVVA 4HJGH 4GODA 2B88A 2KUBA 5C39A 1U7MA 2UWJE 1OVUA 1BDCA 1JM0A 1EDLA 4IOIH 2OTKE 2Q1KA 2KS1B 4K35A 4WWIA 2M0BA 2ZAEB 1ZXGA 3MHVA 4ASWA 2HR3A 4CPGA 3QWOC 4ASVA 4NPFX 3MZWB 5CBNA 4JBZA 5EFWB 2KZIA 2P58A 4GOEA 1ZW0A 1BDDA 2QRXA 2KIKA 2B89A 1S3JA 2QVAA 4NPDA 1OVRA 2M5AB 2M5AA 4ZMDA 1Y47A 2JWDA 2RKLA 2KZJA 4K3AA 1Q2NA 3PH0A 4HB1A 4GOFA 5DJUB 2LXCB 2R44A 1LP1B 1EDKA 1FC2C 1LP1A 4HKZH 1EDIA 1MFTA 2LR2A 1LT1A 1NVOA 1EC5A 4ZNCA 3ZDMA 5K5GB 2I8DA 1DEEG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXB A;  1SS1 A;  2WMM A;  1X0T A;  1H0T B;  5DJT B;  3S1K A;  1H0T A;  1JMB A;  5CBO A;  3FXD A;  3RGU A;  1U7J A;  4BXL A;  1EDJ A;  2B87 B;  3FXE A;  2SPZ A;  2B87 A;  2K3R A;  2KI7 B;  4MN4 C;  4EYY Q;  4KJM A;  4NPE A;  1OVV A;  4HJG H;  4GOD A;  2B88 A;  2KUB A;  5C39 A;  1U7M A;  2UWJ E;  1OVU A;  1BDC A;  1JM0 A;  1EDL A;  4IOI H;  2OTK E;  2Q1K A;  2KS1 B;  4K35 A;  4WWI A;  2M0B A;  2ZAE B;  1ZXG A;  3MHV A;  4ASW A;  2HR3 A;  4CPG A;  3QWO C;  4ASV A;  4NPF X;  3MZW B;  5CBN A;  4JBZ A;  5EFW B;  2KZI A;  2P58 A;  4GOE A;  1ZW0 A;  1BDD A;  2QRX A;  2KIK A;  2B89 A;  1S3J A;  2QVA A;  4NPD A;  1OVR A;  2M5A B;  2M5A A;  4ZMD A;  1Y47 A;  2JWD A;  2RKL A;  2KZJ A;  4K3A A;  1Q2N A;  3PH0 A;  4HB1 A;  4GOF A;  5DJU B;  2LXC B;  2R44 A;  1LP1 B;  1EDK A;  1FC2 C;  1LP1 A;  4HKZ H;  1EDI A;  1MFT A;  2LR2 A;  1LT1 A;  1NVO A;  1EC5 A;  4ZNC A;  3ZDM A;  5K5G B;  2I8D A;  1DEE G; 
#chains in the Genus database with same CATH topology
 1NO4 A;  2R5B A;  4KHX A;  3MD0 A;  2YKQ A;  1H0T B;  2XND H;  1GU4 A;  4LLH A;  1KQG B;  1YTZ T;  1J1D C;  3V2N A;  3A0B E;  1YI2 P;  3G9R A;  5KJ7 A;  1PPJ G;  3USS A;  2FFD C;  2W6J H;  1VQ8 P;  1GL2 B;  2IFN A;  3CC4 P;  4D6T J;  4GOD A;  1M8O B;  1NTM K;  2C0X A;  4C7R A;  1RF1 B;  5AW3 B;  3KPE A;  1RQU A;  1PFI A;  1IFP A;  4K35 A;  5B66 E;  2N9B A;  2KNC A;  2I1J A;  1MZ9 A;  1X8Y A;  1XTC C;  3F5H A;  5APX A;  3N4X A;  3TK1 A;  1VDF A;  4QMA A;  1HJB A;  3H1I E;  1VF5 D;  3KHU A;  5CJ4 A;  1KYO E;  1SQP K;  3GF3 A;  1L0N J;  1RY3 A;  1VL2 A;  1G2C B;  2KYV A;  1EZV D;  2HFE D;  5KLV K;  4GKG A;  1NTK D;  5KAI H;  5KKZ B;  3G3Z A;  1Q2N A;  2IZ1 A;  4GOF A;  1IK7 A;  1KB9 H;  1L4A B;  5B5E E;  3NXS A;  1GK4 A;  3H1L E;  3CCU P;  3AE1 C;  2OTJ P;  4YPC A;  1EC5 A;  2G8Y A;  3CXH H;  1AV1 A;  1S4X A;  2E43 A;  3RK3 D;  3RBZ A;  5AVY B;  2JO1 A;  2A45 H;  2J58 A;  1DEE G;  1K9M Q;  3BRV B;  5CCH D;  1G1J A;  3HE5 A;  1X0T A;  3A7O A;  1KIL D;  3AE7 C;  3WU2 E;  1SQQ E;  1W2E A;  3H32 B;  1KB9 D;  4KJM A;  1VF5 C;  3MGN A;  5AVS B;  2O01 N;  1A02 J;  2WSE H;  3CXH D;  3L74 D;  3W68 A;  2IBZ E;  3L70 G;  1VQ7 P;  2FXM A;  1XTG B;  3L75 E;  3BAS A;  1P84 H;  2QA4 P;  3EFF K;  2ZYA A;  4LC1 A;  3AE9 C;  2KP8 A;  2KLV A;  1MKM A;  1KZU B;  2KOG A;  4PV1 B;  4WY4 A;  4WVZ A;  2QSI A;  2YXQ B;  1SQV E;  4UB6 E;  1AJY A;  2FXO A;  2NPS B;  3D71 A;  2PP6 A;  1KOR A;  1S1C X;  4RJT A;  2QVA A;  5AW2 B;  2JKV A;  5M1B A;  1MFZ A;  1E79 H;  3RK3 C;  1SQP D;  2WPS A;  2H7H A;  1P84 D;  4HB1 A;  2L91 A;  4HH2 A;  5CCH C;  4H44 D;  5KAF E;  1DX7 A;  3FWN A;  3KZI E;  2B9B A;  1YIJ P;  5KLI C;  2C9N Y;  3P8C D;  1J1E B;  4RKU J;  1KQF B;  3L72 E;  2V4H A;  3CX5 I;  1DD3 A;  4M3L A;  1LJ2 A;  2QJK B;  3L70 J;  1GD2 E;  3LIE A;  2D2C C;  4D6T D;  1H0T A;  2WSF H;  2YNY A;  3A0B H;  5TJH A;  2OTL P;  2HYN A;  4NPE A;  2FYU G;  3V2P A;  1PP9 D;  2QJP B;  1YHQ P;  1LTT C;  4PJ0 E;  1SQQ K;  2FY8 A;  4EI2 A;  1GK6 A;  2E75 B;  2QJY B;  1RF1 A;  1BGY G;  1KV4 A;  3B71 A;  1S5L E;  3CPW O;  1USE A;  5CCG D;  1EXJ A;  4ASW A;  4C46 A;  3CWB D;  1SFC C;  1KYO H;  4H44 C;  1A02 F;  3G71 P;  1JY3 O;  2KIK A;  1BE3 G;  2AEM A;  1KFM A;  2GUV A;  2JWA A;  2FYN C;  1JY2 P;  1IO4 A;  3WUV A;  1URQ B;  3M0D A;  3M0A A;  3AEG C;  2LXC B;  3GF7 A;  2K9Y A;  1EDK A;  1L4A A;  3H1I D;  1T3U A;  2JEE A;  1KYO D;  3Q5R A;  2FYZ A;  1NH4 A;  2OYO A;  2FYU J;  1HGV A;  3V5B A;  5AVX B;  4OGQ D;  1SS1 A;  3RK2 B;  2P10 A;  3LW5 J;  1BGY J;  1OMI A;  1PGJ A;  3PTZ A;  2GM4 A;  2Q3E A;  1M1K Q;  3H1L D;  3H32 A;  1QVG O;  1IFM A;  4MN4 C;  4WY4 C;  4GT1 A;  3V2Q A;  2WSC J;  1HBW A;  1H8A A;  1VQP P;  3HD7 A;  1PGP A;  1JM0 A;  1VQM P;  1JCD A;  3A0H E;  1BE3 J;  1EZV G;  4WWI A;  1M1J A;  1OX3 A;  3M06 A;  3U1C A;  3L4F A;  1NTK G;  1SQQ D;  2ZYG A;  4UB6 H;  4H0L D;  2KZI A;  3AEA C;  3CL3 D;  1KIL B;  1J2J B;  1IFJ A;  5AW1 B;  4C7N A;  4KT0 J;  1Y9B A;  1YTZ I;  2RKL A;  2Y0E A;  1KQL A;  1ZR2 A;  4XFJ A;  5KAF H;  3G6E P;  2O01 H;  2V7Q J;  3PLN A;  1LWU B;  4IL6 E;  4DT0 A;  3KZI H;  1FU1 A;  3L70 D;  4ZNC A;  2Q7C A;  2K88 A;  1N73 C;  1S9K E;  1LTJ C;  4GDO A;  2I8D A;  2E76 C;  2IZ0 A;  5CMZ A;  3VMZ A;  5AVW B;  1VPC A;  5AVT B;  2YMY A;  2O3J A;  3RGU A;  3PP5 A;  2B87 B;  1NTK J;  1NTM G;  4JF7 A;  2WPV B;  2K3R A;  3E1R A;  4H0L C;  3HUS C;  1FZG A;  4PJ0 H;  3MUD C;  3A2A A;  5APQ A;  3B5N C;  3L72 D;  1S5L H;  1SQP G;  3VMX A;  1BCC E;  3VP9 A;  1ZME C;  3FGA D;  3M0D C;  4JBZ A;  1Q82 Q;  2OYI C;  2C9L Y;  2OYH B;  3PJS K;  4IFM A;  1X9V A;  2C0W A;  3BVH A;  2E5Y A;  1ZP0 C;  1FZC C;  1SQX E;  5KLV G;  1RE3 A;  3U1A A;  4YTP C;  1YIT P;  1LTB C;  4AUW A;  1HH0 A;  2HPC A;  3AEE C;  1Q86 Q;  4ZMD A;  1X22 A;  2QG4 A;  1QEX A;  2MKV A;  2DW3 A;  1URQ A;  3PH0 A;  3UIA A;  1IJD B;  1NTZ E;  1KN7 A;  3G4S P;  3GHG B;  3BAT A;  3QH9 A;  3ZDM A;  2BEZ F;  1NTM J;  4Y99 C;  4L76 A;  2AXC A;  1PP9 G;  2A06 E;  1T6A A;  2WSE J;  1RE4 C;  1N86 A;  1M1J C;  1SQP J;  3AEF C;  1L2P A;  1U7J A;  4BXL A;  3CWB G;  4AQR D;  1OW6 A;  1RQV A;  3TYY A;  3TGU E;  2Z5I A;  3L35 A;  4BWN A;  1RF0 A;  2V7Q H;  3D70 A;  1OVU A;  5KLV J;  1VQ4 P;  1ZN5 A;  5APT A;  1UIX A;  2JJL A;  3CD6 P;  2NZ2 A;  4OGQ B;  2IYP A;  1FAV A;  3H1I G;  5APW A;  3CX5 E;  1N7S B;  2P2U A;  3WMM 0;  1NKZ B;  2J5U A;  4NPD A;  3NFQ A;  1OVR A;  1PP9 J;  2M5A B;  4I6M C;  2M3E A;  1SQX K;  2IYO A;  2R5D A;  2H43 A;  4ZKP A;  4DCK A;  1AVY A;  2J59 M;  4XE5 B;  2POH A;  2LR2 A;  3L36 A;  1GW4 A;  3M91 A;  1PPJ E;  3H1L G;  1DD4 A;  4L73 A;  3CWB J;  2WSF J;  4H13 B;  1NTZ K;  1FJK A;  5TIS E;  3HE4 B;  1JY3 N;  5DJT B;  2CK3 H;  2A45 I;  3FXE A;  2B87 A;  1FOS F;  4W7Z A;  4W7Y A;  3H1J E;  1SQQ G;  1OVV A;  4EDF A;  2KLU A;  3H1I J;  1LNQ A;  3C1L A;  2PFX A;  1S9K D;  2IBZ G;  1T8Z A;  3CC2 P;  2ZAE B;  4I7Z C;  5BU5 A;  3L75 G;  1DIP A;  3QWO C;  1KD1 Q;  4PD4 I;  3RL0 C;  4BRY B;  4U3F D;  2WQY C;  4XA4 A;  2OYH A;  1K73 Q;  3PRJ A;  1FE6 A;  1X79 B;  3H1L J;  2D2C D;  2N1T B;  1W2B O;  1JB0 J;  3Q5S A;  1LT9 A;  1K8A Q;  3W67 A;  3MP7 B;  1NTM D;  1BCC D;  1PV3 A;  2FXP A;  3CCV P;  4N78 E;  2R44 A;  1JY3 P;  2JR8 A;  2YIU C;  2KSE A;  1FDO A;  3GHG A;  3IFM A;  3H6P A;  4TLF A;  4YXD C;  1SQQ J;  1SQX D;  1OXZ A;  3JC2 2;  3FWL A;  1IK9 A;  3JCU E;  3L72 G;  1SFC D;  2Y0D A;  2P67 A;  1M57 D;  3AE5 C;  1JMB A;  2KXP B;  1J1D B;  3M9H A;  3IAO A;  1L0L E;  2ZT9 C;  3L75 J;  5KLV D;  1NTZ D;  1ZRT D;  5KJ7 C;  1JY2 N;  2FFD B;  2KSJ A;  1E5W A;  2RMZ A;  3P32 A;  1RHZ B;  1JNM A;  1IFD A;  3L71 E;  1IC2 A;  1PZQ A;  2A06 D;  3L73 E;  1OZH A;  3VN0 A;  3VTP C;  4R4L A;  1JUN A;  4OVN F;  1JEK A;  1GL2 A;  2GA1 A;  2H8P D;  5GTI E;  3TGU D;  3CX5 H;  1VQN P;  5B66 H;  2O01 J;  1N7S A;  3BCC D;  3AE3 C;  3N7N A;  4UB8 E;  2M5A A;  4WY4 D;  3L72 J;  4A7P A;  2IFM A;  4DZO A;  3M9B A;  2QEX P;  4OH8 B;  2E74 D;  1JCC A;  1NVO A;  1G2C A;  5TIS H;  3KYQ A;  3D6Y A;  1SQV K;  1Q7Y Q;  2GUS A;  3HE4 A;  1BGY E;  5B5E H;  2WMM A;  3CCR P;  1Q81 Q;  1BSH A;  2Y0C A;  3S4R A;  2Y9Y A;  4ZKU A;  4N3Y B;  2QM7 A;  2WPQ A;  1SQB E;  1VF5 B;  3VP8 A;  2XKM A;  1HWT C;  2G3A A;  1PGQ A;  1VQO P;  1L0L K;  3PHL A;  2NRG A;  2QIW A;  1BE3 E;  2QE7 H;  1JOC A;  2Q1K A;  2Z4E A;  3WU2 H;  1VQL P;  1NWQ A;  1YJN P;  1W5C E;  1LT9 C;  2E76 D;  1VQ6 P;  3R4Y A;  1OWA A;  4BRY A;  1MV8 A;  4JQ0 D;  2E74 C;  1QGK B;  4Z1M H;  5APV A;  3CC7 P;  2Q6Q A;  3O6Q B;  1AVO A;  2N1T A;  1S2E A;  3RK3 B;  1SP4 A;  2E42 A;  4IFD K;  4R4M A;  2JWD A;  1VQ9 P;  1SLQ A;  2CPS A;  1HJ0 A;  5AW0 B;  1JO5 A;  2FKW B;  2WSS H;  1LP1 B;  3B5N D;  2RN0 A;  2NPS A;  5KLI B;  2IBZ D;  2YXR B;  3FX0 A;  5K5G B;  2W6A A;  3JCU H;  1K05 A;  3K5B A;  3E1I A;  3L75 D;  3E7K A;  3TSI A;  1NU1 E;  1LTA C;  3I5C A;  2D2C B;  2R32 A;  1L4A D;  3CMA P;  2BCC E;  2JP3 A;  1FZE A;  1EDJ A;  4N78 D;  1M56 D;  1SQV D;  2SPZ A;  3LID A;  4U3F G;  1SVF A;  5AW4 B;  3C9I A;  1NAF A;  5E79 E;  1GL2 C;  2WIT A;  1CW5 A;  1U7M A;  1HVV A;  3H1H E;  1RF1 C;  1SQB K;  5BVZ A;  2ZXX A;  1YJW P;  4L75 A;  2HR3 A;  3CCS P;  4ASV A;  1SFC B;  1BCC G;  5L8R J;  3TNU B;  5KTB A;  1L0L D;  1KIL E;  5AW8 B;  1UII A;  5AVZ B;  5GTI H;  4H44 B;  2AEJ A;  4IFF A;  3HD7 D;  3H1K E;  1KQS O;  1SQX G;  3L74 E;  2FYN B;  3P7K A;  4OWF A;  3L73 D;  1FZF A;  4L74 A;  3TF5 A;  5KKZ C;  3Q5P A;  1L4A C;  3IN6 A;  1EDI A;  1MFT A;  4EOT A;  3V4Q A;  1NTZ G;  2H88 C;  3SWK A;  4EIJ A;  2PGD A;  3CI9 A;  3D6Z A;  4U3F J;  3SWY A;  2R3C A;  2K1A A;  2LXB A;  2A06 G;  2Q9I A;  4WB4 A;  4PD4 E;  3L37 A;  3FXD A;  2ZFC A;  1QVF O;  3NTN A;  5GTH E;  4WY4 B;  1NU1 K;  2PAJ A;  1BCC J;  2KI7 B;  1NJI Q;  3TGU G;  5H2F E;  2CPB A;  3P8C E;  3HD7 C;  2E74 B;  1HUC A;  3AE4 C;  3BCC G;  2YMK A;  1SQX J;  1OIP A;  1YQ3 C;  1WMK A;  3V4W A;  3OAK A;  4CPG A;  3RL0 g;  4D6T E;  2O1J A;  5CBN A;  1NYH A;  1FZA A;  2I1K A;  5APU A;  2KK7 A;  3ABV C;  1NTZ J;  1BDD A;  3A0H H;  5APY A;  1Y8A A;  1OFC X;  2IDB A;  3O6Q A;  1FDI A;  4AYC A;  1EZV I;  3SFE C;  1FZB A;  1L0N E;  5CCH A;  1LP1 A;  2AXT E;  1YJ9 P;  2N9Y B;  1KIL A;  3CWB E;  4N6J A;  1N73 B;  2YKP A;  1LTJ B;  1QL2 A;  1KC8 Q;  1J1E C;  1HGZ A;  2E76 B;  5APS A;  3TGU J;  1OW7 A;  2Y9Z A;  1LTI C;  1URQ D;  5CJ0 A;  3CCQ P;  3RL0 D;  2QJK C;  3AEB C;  1YBK A;  3BCC J;  4IL6 H;  1LWU A;  2W83 C;  2E5T A;  1VQK P;  1KB9 I;  5E79 H;  1LTS C;  2VRS A;  3H1J G;  4H0L B;  3HUS B;  1LGH B;  1KFN A;  5AW5 B;  1D7M A;  1GU5 A;  3B5N B;  3CXH I;  4RES B;  2QJP C;  3OW2 O;  2Q5U A;  1GTW A;  3RK2 D;  1EDL A;  2E75 C;  2QJY C;  3OJA B;  1NU1 D;  3CCM P;  1GMJ A;  1ZXG A;  3EFG A;  1JTH B;  2BCC D;  3MZW B;  1SFC A;  3TNU A;  2OYI B;  1KMI Z;  2KB7 P;  2P7J A;  1FZC B;  2IPP A;  2W6B A;  1NHL A;  4I2L C;  1RE3 C;  4Y28 J;  3CME P;  3CCE P;  1AQT A;  1NOH A;  2ZT9 D;  5AVU B;  1EXI A;  4O9B A;  3H1H D;  5KJ7 D;  1FDM A;  1URQ C;  5AVV B;  1P84 I;  1SQV G;  3OA7 A;  4Y99 B;  1DEB A;  1L0N K;  3H1K D;  3H1J J;  3H25 A;  2K37 A;  3HD7 B;  2AEF A;  3RK2 C;  4PD4 H;  1M1J B;  5CCG A;  2YO3 A;  5GTH H;  1L0L G;  3KXD A;  4EYY Q;  5H2F H;  3M9Q A;  4HJG H;  1RF0 C;  3L70 E;  3L71 G;  4IOI H;  1USD A;  1NGM B;  4C7N B;  2KS1 B;  1WT6 A;  1OW8 A;  3U59 A;  3CLQ A;  3L73 G;  1VQ5 P;  1H89 A;  3AEC C;  3P8M C;  3NMD A;  4W80 A;  3GG2 A;  4PD4 D;  3CCJ P;  3SSU A;  1FS0 E;  2FBW C;  3HTK B;  1SQV J;  1ZW0 A;  1KIL C;  3EQ2 A;  2QRX A;  1CI6 B;  3R2P A;  1LTG C;  2W27 A;  2XU6 A;  3AE6 C;  2P1J A;  5DJU B;  3BRT B;  2Z5H A;  2AXT H;  3C8V A;  2IX7 C;  4HKZ H;  1LT1 A;  2LKM A;  1LWU C;  3VYI A;  4HYT B;  3T97 B;  1QL1 A;  1KYO I;  2YKO A;  1N73 A;  1L0L J;  2XDJ A;  1LTJ A;  1HTL C;  2RH0 A;  3GMA A;  2XZR A;  3VOP A;  3AE2 C;  2XNX A;  1ZR4 A;  1Z56 A;  5CHX A;  1R5S A;  3L71 J;  1BSN A;  2HG5 D;  1ZV8 A;  1HF9 A;  3V6I A;  1T2K D;  5AW6 B;  1L0N D;  2WT7 B;  3L73 J;  3II6 A;  2YO2 A;  3SFD C;  3B4S A;  4YXW H;  1YQ4 C;  2FYU E;  3EWK A;  1KTM A;  4U7J A;  3CX5 D;  1N7L A;  1K04 A;  1SQB G;  3HUS A;  4RO0 A;  5C39 A;  3KDP B;  3MUD A;  4JYB A;  3B5N A;  2M3B A;  2K9J B;  1IFN A;  2W90 A;  3RBX A;  4I7Z B;  2M0B A;  2WTY A;  4TT3 H;  3I55 P;  2HPC B;  2M8R A;  3GW6 A;  1FBM A;  1JTH A;  3Q1M A;  1PPJ D;  3RL0 B;  2XV5 A;  2OYI A;  5EFW B;  3WUT A;  2OYH C;  1FZC A;  1GDT A;  2HOD B;  3MTU E;  1S5L X;  2W8Z A;  1YYC A;  3CCL P;  2QM8 A;  2IBZ I;  3Q3D A;  1Y47 A;  2ZYD A;  1GL2 D;  1QX8 A;  2YIU B;  3GLM A;  3H1J D;  1GW3 A;  1T2K C;  3ITK A;  3GHG C;  5CCG C;  1N7S D;  3A3Y B;  1AFO A;  1SQB J;  1H88 A;  4DOJ A;  1IFI A;  5AW7 B;  1IZN B;  1NU1 G;  1RE4 A;  1DH3 A;  1QLE D;  1N8R Q;  2ZT9 B;  5CBO A;  1AQ5 A;  2BCC G;  4I1L A;  3WUU A;  4JPZ B;  4H13 D;  1U57 A;  1N2D C;  1TU3 F;  3AE8 C;  1BDC A;  2BAS A;  2ZJS E;  1EZV E;  1ZOY C;  2OTK E;  1FJP A;  2KNC B;  2FYU K;  2KS1 A;  3H1H G;  1NTK E;  3I56 P;  1M90 Q;  1CSB A;  3SWF A;  3MHV A;  4B86 A;  2BEQ D;  2ZVN B;  3B8E B;  3VMA A;  2FFD A;  1JY2 O;  1PGO A;  3HRN A;  4OGQ C;  1G1I A;  3HTK A;  4GOE A;  2JDI H;  5AVR B;  3RK3 E;  1N7S C;  1CI6 A;  2B89 A;  5BU8 B;  3KQG A;  1CZQ A;  3H1K G;  3VMY A;  3L74 G;  2MJZ A;  4K3A A;  5KAI E;  1NU1 J;  2A45 G;  2WPR A;  1KB9 E;  1WRG A;  2H89 C;  1MUU A;  2BCC J;  1PIX A;  1AA0 A;  1M7L A;  3L71 D;  4U3F E;  3T97 A;  2N1T D;  4UB8 H;  3CXH E;  4H13 C;  2Q3I A;  3F89 A;  3MIW A;  2OAR A;  1RH5 B;  2ZVO B;  2WWW A;  1R5L A;  4PV1 D;  1T3J A;  3HE5 B;  1R8E A;  4IL6 X;  1PL5 A;  3S1K A;  1FOS E;  3H1H J;  1NTM E;  2WT7 A;  2NPS D;  2WZ7 A;  3O8Z A;  2L5G B;  1NAY A;  2B88 A;  2R3S A;  2KUB A;  2OQQ A;  3LW5 H;  1GZL A;  2HLO A;  2UWJ E;  2PRR A;  3JSV C;  2K9J A;  1SQP E;  3TDK A;  3H1K J;  1S72 P;  1P84 E;  3A5T A;  5AW9 B;  2WSC H;  1LT9 B;  3L74 J;  4NPF X;  4D6T G;  5KLV E;  2P58 A;  1ZRT E;  2FYU D;  4JYC A;  1NTK K;  2HOD A;  4GIF A;  3IF4 A;  5AVQ B;  1S3J A;  2N1T C;  3Q2Y A;  1BGY D;  1JMM A;  3IR9 A;  2O1K A;  4LGD E;  4PV1 C;  3V2R A;  2KZJ A;  2ITA A;  1L0N G;  1SQB D;  3AED C;  1FC2 C;  1Q90 D;  3S9O A;  2NPS C;  2E75 D;  1PP9 E;  1EQ7 A;  1ZLL A;  4WBA A;  2ZXE B;  1BE3 D;  1NKN A;  2WVR A;  2OGU A;  4DJG A;  3BCC E; 
#chains in the Genus database with same CATH homology
 2LXB A;  1SS1 A;  2WMM A;  1X0T A;  1H0T B;  5DJT B;  3S1K A;  1H0T A;  1JMB A;  5CBO A;  3FXD A;  3RGU A;  1U7J A;  4BXL A;  1EDJ A;  2B87 B;  3FXE A;  2SPZ A;  2B87 A;  2K3R A;  2KI7 B;  4MN4 C;  4EYY Q;  4KJM A;  4NPE A;  1OVV A;  4HJG H;  4GOD A;  2B88 A;  2KUB A;  5C39 A;  1U7M A;  2UWJ E;  1OVU A;  1BDC A;  1JM0 A;  1EDL A;  4IOI H;  2OTK E;  2Q1K A;  2KS1 B;  4K35 A;  4WWI A;  2M0B A;  2ZAE B;  1ZXG A;  3MHV A;  4ASW A;  2HR3 A;  4CPG A;  3QWO C;  4ASV A;  4NPF X;  3MZW B;  5CBN A;  4JBZ A;  5EFW B;  2KZI A;  2P58 A;  4GOE A;  1ZW0 A;  1BDD A;  2QRX A;  2KIK A;  2B89 A;  1S3J A;  2QVA A;  4NPD A;  1OVR A;  2M5A B;  2M5A A;  4ZMD A;  1Y47 A;  2JWD A;  2RKL A;  2KZJ A;  4K3A A;  1Q2N A;  3PH0 A;  4HB1 A;  4GOF A;  5DJU B;  2LXC B;  2R44 A;  1LP1 B;  1EDK A;  1FC2 C;  1LP1 A;  4HKZ H;  1EDI A;  1MFT A;  2LR2 A;  1LT1 A;  1NVO A;  1EC5 A;  4ZNC A;  3ZDM A;  5K5G B;  2I8D A;  1DEE G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...