2LR2A

Designed igg and lanthanide binding probe for solution nmr, mri and luminescence microscopy
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
GVDNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDSYIDTNNDGAYEGDELSGSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Immunoglobulin G-binding protein A
publication title Lanthanide binding and IgG affinity construct: Potential applications in solution NMR, MRI, and luminescence microscopy.
pubmed doi rcsb
source organism Artificial gene
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2012-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2lr2A00
1EDLA 2K3RA 2UWJE 4BXLA 4NPEA 2B88A 1MFTA 2HR3A 2QRXA 4HB1A 1X0TA 4HKZH 1EDIA 3MHVA 4MN4C 2KI7B 2M5AA 4GODA 2KS1B 4HJGH 2WMMA 1NVOA 4GOEA 5CBNA 1LP1A 4ZMDA 2OTKE 2M5AB 1ZW0A 2ZAEB 3MZWB 2I8DA 2B87A 1LP1B 1FC2C 4K3AA 2RKLA 2LR2A 2KIKA 2KZJA 5DJTB 1BDCA 4K35A 2B87B 5CBOA 2R44A 4WWIA 3QWOC 1JM0A 2KUBA 1LT1A 2LXBA 4ASVA 1EC5A 4KJMA 4IOIH 1JMBA 2JWDA 4ASWA 1U7MA 2QVAA 4EYYQ 1ZXGA 5EFWB 1OVVA 1S3JA 4NPFX 5DJUB 3ZDMA 3RGUA 1BDDA 5K5GB 1OVRA 4GOFA 1OVUA 1SS1A 1Y47A 2P58A 3FXDA 2B89A 1EDJA 5C39A 2Q1KA 1EDKA 1H0TB 3PH0A 1Q2NA 4NPDA 2LXCB 4CPGA 1U7JA 3FXEA 1H0TA 2KZIA 4ZNCA 3S1KA 4JBZA 2M0BA 1DEEG 2SPZA
chains in the Genus database with same CATH superfamily
1EDLA 3B71A 1NU1K 2YXRB 2WSFJ 1GL2B 5AVWB 4BRYA 5AVZB 3B5NC 4MN4C 5KLVG 2M5AA 2JP3A 2VRSA 4D6TD 1M90Q 4IL6H 2NRGA 1YJWP 2H43A 3M0DA 1VQNP 2W6AA 2R32A 2K9YA 1RH5B 2HLOA 2O1JA 3PLNA 4IL6E 5APUA 3GG2A 3VMYA 1S5LE 1N7SD 4TT3H 2QA4P 1LWUA 1PP9G 3CX5I 3CX5D 4UB8H 5B66H 2E74D 1PPJG 1SQQJ 2P58A 5AW7B 1BCCG 3CCUP 1IK9A 1G2CA 1BGYJ 2WWWA 1PP9D 1FAVA 3N4XA 2YKQA 1GK4A 1PPJD 1YYCA 2AEFA 1NH4A 2GA1A 5B66E 2J5UA 1L0LE 1YIJP 3A7OA 3OA7A 4PJ0H 1W5CE 1GL2A 3M0AA 3L73J 5AW1B 1DEEG 2FFDC 1M1JB 5KLVK 4OGQD 1SQXJ 4XA4A 2XNDH 5GTHE 3H1LE 1SFCB 5KAIH 2Q3EA 1YITP 2E76D 3AEFC 1KN7A 3T97B 2WSEH 1L0NG 2HFED 4BWNA 2G8YA 3G9RA 3L75J 4PJ0E 4U7JA 2IBZG 2FYZA 1PL5A 2V4HA 1L0ND 1AQTA 1KQGB 2ZT9D 5KAIE 2IBZI 2PFXA 2GUVA 2R44A 2IBZD 3U1CA 2Q9IA 4Y28J 5B5EH 4H44D 5CCHC 1PGPA 2JWDA 4TLFA 1S72P 2ZFCA 5EFWB 4AUWA 1PV3A 2M8RA 2JDIH 2A45G 3VMAA 4DZOA 1LT9B 2WITA 4N6JA 2E75B 1RQUA 2KXPB 5B5EE 3WMM0 3Q2YA 2BCCG 1KYOI 1W2BO 3CCJP 2A45I 3L74E 1KYOD 1Z56A 2WSCJ 1M1JA 3MD0A 1DIPA 1AV1A 3L36A 1NU1E 1H0TA 4IFMA 1SQPK 2QG4A 1NJIQ 3IR9A 1SFCA 2ZYAA 3T97A 2WQYC 3BVHA 2KS1B 4GIFA 3V2QA 1NTZK 1Y8AA 2FYNC 3A0HH 1ZW0A 4JYBA 2QJKB 1ZRTD 4C7NB 1NTKK 2AXTH 3VTPC 2XKMA 3GMAA 2Y0EA 4IOIH 2R5DA 3A0HE 4N3YB 4ASWA 4HYTB 1LT9A 1JEKA 1BGYG 1YJNP 3BCCG 5APWA 1OVRA 2AXTE 3M9BA 1SQBE 4PV1C 3HTKB 2HPCB 1SQQD 5L8RJ 3H1IE 1BGYD 1LTGC 1USDA 2HODB 4WY4A 2OYHC 4W7YA 3GHGC 3L73G 3E1IA 1JB0J 1SQXG 1RHZB 4WB4A 1XTCC 5KLVE 1X8YA 4JF7A 3S1KA 4JBZA 4EOTA 3L73D 2E43A 4U3FE 4YXWH 1SQXD 3KPEA 2B88A 2NPSC 2L5GB 2FXMA 1LTIC 3G4SP 3EQ2A 1FZEA 1X0TA 1HUCA 3CC4P 2WTYA 2XZRA 2Z5IA 1KQSO 1BE3E 3P8MC 1GMJA 4C7NA 1ZLLA 3CCEP 2IDBA 3L75D 1VQ9P 3C8VA 4H0LC 4JPZB 3L35A 3MP7B 3NMDA 1JCCA 1SVFA 2LR2A 1EZVG 4JYCA 3CD6P 2MJZA 2KP8A 3EFFK 1BCCE 3TNUB 3OW2O 5AW3B 3LIDA 4WBAA 1JY3N 1RE3A 1KB9H 1USEA 3HTKA 2HPCA 1OVVA 1S3JA 2Y0DA 3L71J 1YTZI 3F89A 2ZVNB 3CXHD 1L4AD 1RF1C 1X9VA 1Q2NA 1E79H 2HYNA 1SQPE 2YKOA 2ZXXA 1FS0E 2FBWC 5AVYB 3G3ZA 3I5CA 1HJBA 2WPSA 4L73A 3TSIA 1Q82Q 3V6IA 4GKGA 3H25A 1NAYA 1LTJC 4OVNF 2FFDB 2QEXP 3B5NA 5CBNA 1P84H 2AEJA 3HE5B 1NTMG 1YTZT 3WUTA 1L0LK 1JY3O 1FC2C 1MFZA 4DT0A 3TNUA 1SQVG 1VQ5P 1FOSE 1A02J 2J58A 5AW9B 1HWTC 2OTJP 5AVTB 2B87B 3V5BA 4XFJA 4R4LA 2B9BA 1P84E 3H32A 1SQVD 2BCCE 1WRGA 1KFMA 2D2CC 2IX7C 1SLQA 3CLQA 1ZP0C 1OMIA 2BEZF 2YIUC 1SS1A 1YQ3C 2FXOA 1M8OB 5AVVB 3AE3C 1QL2A 4RESB 4ZKUA 2P2UA 2FXPA 1KORA 1YQ4C 4R4MA 2M3BA 2Q3IA 1VPCA 2KLUA 1U57A 1J1EC 3CWBJ 3A3YB 1FBMA 1NTZJ 3LW5H 4ZNCA 4EIJA 1OFCX 3HE4B 1RE4C 2FFDA 2C0WA 3MTUE 3FGAD 3A5TA 1R5SA 3FWLA 1NTKJ 4LLHA 2JR8A 5APQA 2K37A 4UB6E 5AW5B 2IFMA 1MKMA 1R8EA 3S9OA 2PGDA 3D71A 2WVRA 3AEEC 2QE7H 3TGUJ 2ZAEB 1S9KE 1Q7YQ 2OARA 2JJLA 2B87A 3V2RA 4AQRD 4H44C 3WU2H 3L37A 2IPPA 3RL0D 3BCCE 1S4XA 3RK2C 1BDCA 2FYNB 2OYIC 1PGOA 1L2PA 3EFGA 3L71G 3KHUA 2YMKA 1HF9A 2KK7A 3AE4C 1PFIA 3VMXA 1S5LH 1U7MA 5CCHA 3HD7C 3H1JJ 3L71D 3WU2E 5APXA 4WY4D 2I1KA 5KJ7C 1ZR4A 3OJAB 5BVZA 2FYUJ 1N8RQ 5CHXA 3AE7C 2ITAA 2CK3H 1VQ4P 1YBKA 4PV1B 2H88C 1Y9BA 4EDFA 1IJDB 1GD2E 3HE4A 1VF5C 4H13D 5AVQB 2OYHB 1E5WA 3GHGB 2IZ1A 2FY8A 5AW2B 2UWJE 1SQBK 4KT0J 3L4FA 3Q5SA 5GTHH 2M3EA 2PP6A 1OX3A 2QRXA 1EZVE 4B86A 4HJGH 1T3UA 1FOSF 5CCGD 3NTNA 2NPSB 2WZ7A 3H1KE 1KILE 2IYOA 3V2NA 2XV5A 1K8AQ 4H0LB 3AECC 3BATA 1R5LA 1NHLA 1JCDA 4YPCA 4ASVA 3RBZA 3UIAA 1JUNA 1RF0C 2WSSH 1BDDA 3CC2P 3RL0g 1FZFA 2HG5D 2ZYGA 3PHLA 3KDPB 1KB9I 3EWKA 2H89C 1KB9D 3CWBG 1YI2P 5C39A 3PH0A 3IN6A 2BEQD 4NPDA 2OYHA 3GHGA 4PD4E 3FXEA 3L70E 3P8CE 1RF1B 3CWBD 1PIXA 1IO4A 1KMIZ 1NTZD 3U59A 2POHA 5BU8B 1IZNB 3RK3E 3OAKA 2QIWA 3B5ND 4LC1A 1L0LJ 3HUSC 1ZV8A 1CZQA 1FDIA 5AVUB 2HR3A 1KV4A 3H1HE 3SFDC 2RMZA 5AW6B 2NPSA 2RH0A 1NTKD 4GOEA 1JOCA 3H1LJ 1ZN5A 3CCQP 3TGUD 1LJ2A 1L0NK 4QMAA 1GZLA 1LTJB 2A06D 4N78E 3V4QA 1T8ZA 3P7KA 1LTBC 1PGQA 1P84I 1H89A 2W83C 2N1TD 3L72E 3GF7A 3Q3DA 3W68A 3QWOC 3BRVB 3D6ZA 3VN0A 3TDKA 2IYPA 2N9BA 1JMBA 2YMYA 2FYUG 1L4AC 1KILC 2WSEJ 2ZJSE 3H1JD 2Z4EA 4Y99C 1Y47A 3U1AA 3IAOA 2D2CB 3CMEP 1AQ5A 2FYUD 2KNCB 1BSNA 1SQQG 2YKPA 1RF1A 5APYA 2YIUB 3Q5PA 2YNYA 1JO5A 1HVVA 1OIPA 3L74J 1OW6A 4D6TE 4OGQB 1CI6B 3A0BH 3CCMP 4NPEA 1NU1J 1J1EB 1AJYA 4HB1A 2E76B 5KLIC 2K88A 4GODA 3CX5H 1AFOA 3A0BE 3RK3C 1URQC 2N9YB 1RQVA 3L75G 2KS1A 2JKVA 3WUVA 1VQMP 1K05A 5CCHD 3IF4A 1NGMB 3CX5E 2H8PD 2LXBA 4H44B 5E79E 3RK2B 2OYIB 1PP9E 5DJUB 3ZDMA 1FZCC 5TJHA 2KNCA 1NAFA 1PPJE 2W8ZA 3CI9A 3MUDC 1K04A 1NWQA 2E5YA 1PGJA 2J59M 3HD7B 3MGNA 1FJKA 1SQBJ 1RY3A 2ZXEB 2KSJA 1ZR2A 3BRTB 3ITKA 1K73Q 3H1IJ 2HODA 1H8AA 4YXDC 1SQXK 5KLVJ 2ZYDA 1VQ7P 1VF5B 1L0LD 1RE4A 1GL2D 2JWAA 3MHVA 1BSHA 1L0NE 4U3FJ 4I1LA 3RL0C 1NO4A 4ZMDA 3I56P 2GUSA 3H1LD 2IBZE 2XNXA 1BE3J 3NXSA 1LP1B 2KIKA 5GTIH 4K35A 2A45H 3FX0A 3G6EP 2W90A 3LIEA 2OYIA 2V7QH 2P10A 4WY4C 1EC5A 3SWKA 1HTLC 3VP9A 1ZXGA 1DD4A 2OTLP 2XU6A 3NFQA 1BCCJ 1N7SC 3HD7A 3SWYA 3HRNA 1KYOE 2P7JA 3MIWA 5GTIE 1WMKA 3QH9A 2E74C 5KJ7A 4RO0A 2B89A 1XTGB 2WPQA 4OWFA 2QJPC 2DW3A 4IFFA 3H6PA 1X79B 1JTHB 1NU1G 3ABVC 1LTAC 3B4SA 1SQPJ 2NPSD 3L74D 1IFIA 4DJGA 1UIXA 3VP8A 2O01H 2PAJA 5CCGC 1YHQP 1LGHB 4OGQC 1GU5A 1NU1D 1IFDA 1SFCD 5APTA 1ZRTE 4UB6H 1MV8A 4H0LD 3KXDA 1LP1A 2E76C 2W6BA 3HUSB 2KOGA 1AVOA 5AVSB 2I8DA 1J2JB 3N7NA 2KZJA 1NTMK 3HE5A 4I2LC 4YTPC 2ZT9C 1JM0A 3CC7P 1SQVK 1EQ7A 4KJMA 2AXCA 1SQQE 5KTBA 3P32A 1BGYE 3IFMA 2V7QJ 1M1KQ 4HH2A 2E5TA 4L75A 1RF0A 2BCCJ 5BU5A 1AA0A 3GF3A 2O01N 1L4AB 1KILB 2K9JB 3H1IG 1JTHA 5AVRB 2AEMA 2E75D 2Q1KA 1IFNA 4Y99B 1S1CX 3KZIH 1SQBD 3L73E 1A02F 2JO1A 2W27A 1T2KD 1SQXE 1G1IA 2O3JA 1N73C 4IL6X 4WVZA 3RBXA 3JC22 1UIIA 3H1ID 2KZIA 1S5LX 1HJ0A 4M3LA 1T6AA 2OYOA 4A7PA 3CCRP 3I55P 1GW4A 2K3RA 4U3FG 3L75E 5KLVD 1MUUA 2OQQA 1QVGO 1N2DC 3HUSA 3KZIE 3B8EB 2YO3A 3SSUA 1BE3G 1TU3F 1KQLA 3D70A 2Q6QA 2O01J 4U3FD 1NKNA 2N1TC 2Q7CA 3CXHH 1G1JA 2WT7B 1NYHA 5KLIB 3Q5RA 1BE3D 2WPVB 1WT6A 4K3AA 3LW5J 5DJTB 3M91A 5AW8B 3RK3B 1URQB 2WSCH 2D2CD 1Q86Q 1KFNA 3BCCJ 3CXHE 3PP5A 1J1DB 2QVAA 1D7MA 3CCSP 4NPFX 2K1AA 1L4AA 1KILA 2K9JA 3RGUA 3C9IA 1BCCD 4UB8E 1KTMA 2C0XA 1CW5A 1M56D 3V4WA 1FZCB 3AEAC 1H0TB 4JQ0D 1Q81Q 1N86A 1W2EA 2LKMA 2KYVA 4W80A 3M06A 1SQPG 3AE6C 2LXCB 4CPGA 1U7JA 1NOHA 1JY2P 4PD4H 2E42A 2WPRA 1IFJA 2PRRA 3R2PA 1VQLP 1HH0A 1QVFO 1SQPD 1VQ6P 1Q90D 3AE9C 4W7ZA 1NTZG 1QLED 2R3CA 4L74A 2QJYC 3II6A 2WT7A 2WMMA 3M0DC 1GTWA 4IFDK 1NTKG 3AE8C 1NTME 4O9BA 1IFMA 3RK2D 1S2EA 4AYCA 1URQA 3RL0B 3KYQA 3TGUG 1SQVE 1FDMA 4GT1A 2A06G 3H1KJ 4Z1MH 3HD7D 2L91A 2CPSA 1LTSC 1LWUC 1FZBA 3CPWO 3AE1C 5KJ7D 2C9LY 4ZKPA 4EI2A 3GLMA 4WY4B 1FZCA 1P84D 4I7ZC 1OVUA 1VQOP 1SP4A 3H1JG 2BCCD 3MUDA 1HGZA 1JY3P 3Q1MA 1CSBA 1EDKA 1EXIA 1N7SB 3CL3D 1VF5D 3C1LA 5AW4B 2E74B 2Q5UA 4H13B 1VQKP 1GL2C 5CJ4A 2QJPB 1PZQA 3PRJA 5KKZB 4GDOA 4OH8B 2P1JA 3F5HA 1DEBA 1T3JA 3L70J 3V2PA 1VQ8P 2MKVA 4HKZH 1EDIA 1KZUB 1QEXA 1NTMJ 1VL2A 2I1JA 1ZOYC 2C9NY 1SQVJ 3H1HJ 3PTZA 3AEBC 4LGDE 1QL1A 4RKUJ 2NZ2A 1M57D 3FWNA 3D6YA 2QM8A 4I6MC 1JY2N 1VDFA 1FZAA 4DCKA 1KD1Q 3L71E 1LTJA 1S9KD 5E79H 3TYYA 3L72J 3BCCD 3R4YA 1X22A 3A2AA 3AEDC 2W6JH 3AE2C 2QM7A 2ZT9B 2H7HA 1J1DC 1IK7A 1OZHA 3PJSK 1N7SA 1KC8Q 2FYUK 1FJPA 3O6QB 3SWFA 1LNQA 1M1JC 1AVYA 1GU4A 5KAFH 1SQQK 4RJTA 2ZVOB 3GW6A 1IFPA 1OW7A 1SFCC 4XE5B 1K9MQ 4DOJA 3KQGA 3B5NB 5TISH 4BXLA 1N73B 2R3SA 1FZGA 1MFTA 1FU1A 5CCGA 3CCVP 5CJ0A 2KB7P 4D6TJ 4C7RA 2IZ0A 1CI6A 2KI7B 2XDJA 3JCUH 3CCLP 1JY2O 3S4RA 5KAFE 1L0LG 1HBWA 3JSVC 1GW3A 3VYIA 1EZVI 3H1KG 3AE5C 5AW0B 3VMZA 1EZVD 2OGUA 2JEEA 5TISE 3H1LG 4KHXA 3H32B 2RKLA 5H2FH 2Z5HA 2N1TB 3CXHI 3M9HA 1N7LA 1QGKB 5CBOA 3JCUE 4WWIA 3H1KD 1LT1A 1JNMA 2GM4A 3AEGC 1KILD 3E7KA 1FDOA 3BASA 5APVA 1LT9C 3WUUA 3SFEC 1QX8A 1H88A 1KB9E 3TF5A 2E75C 2R5BA 5APSA 3O6QA 2FKWB 5K5GB 1OW8A 5H2FE 1KYOH 4GOFA 1T2KC 2G3AA 3FXDA 1PP9J 2KLVA 2RN0A 3CWBE 1NTZE 4PV1D 1OWAA 1NKZB 1OXZA 3W67A 1FE6A 5M1BA 3L70G 2WSFH 3M9QA 2YO2A 1N73A 2M0BA 2Y9ZA 1NTKE 1JMMA 4H13C 3VOPA 4PD4I 3L74G 3E1RA 4PD4D 5KKZC 2YXQB 3H1HG 3L70D 3TGUE 2QJKC 3P8CD 1MZ9A 2A06E 1NVOA 1NTMD 3RK3D 1URQD 2P67A 1ZMEC 1VQPP 4BRYB 2OTKE 2M5AB 2QJYB 1LTTC 2N1TA 3H1HD 3MZWB 1IC2A 1L0NJ 3O8ZA 1GK6A 3L72G 3G71P 2IFNA 1DD3A 1KQFB 2O1KA 2KUBA 3H1JE 2QSIA 4L76A 4N78D 1RE3C 1HGVA 2KSEA 2Y0CA 4EYYQ 2FYUE 3L72D 1YJ9P 1EXJA 1GDTA 3TK1A 3CMAP 3K5BA 1LWUB 3USSA 1EDJA 1DX7A 4I7ZB 4C46A 1G2CB 2BASA 1DH3A 2Y9YA 5CMZA 5AVXB 1SQBG 2CPBA 4D6TG 1M7LA 2SPZA
chains in the Genus database with same CATH topology
1EDLA 2K3RA 2UWJE 4BXLA 4NPEA 2B88A 1MFTA 2HR3A 2QRXA 4HB1A 1X0TA 4HKZH 1EDIA 3MHVA 4MN4C 2KI7B 2M5AA 4GODA 2KS1B 4HJGH 2WMMA 1NVOA 4GOEA 5CBNA 1LP1A 4ZMDA 2OTKE 2M5AB 1ZW0A 2ZAEB 3MZWB 2I8DA 2B87A 1LP1B 1FC2C 4K3AA 2RKLA 2LR2A 2KIKA 2KZJA 5DJTB 1BDCA 4K35A 2B87B 5CBOA 2R44A 4WWIA 3QWOC 1JM0A 2KUBA 1LT1A 2LXBA 4ASVA 1EC5A 4KJMA 4IOIH 1JMBA 2JWDA 4ASWA 1U7MA 2QVAA 4EYYQ 1ZXGA 5EFWB 1OVVA 1S3JA 4NPFX 5DJUB 3ZDMA 3RGUA 1BDDA 5K5GB 1OVRA 4GOFA 1OVUA 1SS1A 1Y47A 2P58A 3FXDA 2B89A 1EDJA 5C39A 2Q1KA 1EDKA 1H0TB 3PH0A 1Q2NA 4NPDA 2LXCB 4CPGA 1U7JA 3FXEA 1H0TA 2KZIA 4ZNCA 3S1KA 4JBZA 2M0BA 1DEEG 2SPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EDL A;  2K3R A;  2UWJ E;  4BXL A;  4NPE A;  2B88 A;  1MFT A;  2HR3 A;  2QRX A;  4HB1 A;  1X0T A;  4HKZ H;  1EDI A;  3MHV A;  4MN4 C;  2KI7 B;  2M5A A;  4GOD A;  2KS1 B;  4HJG H;  2WMM A;  1NVO A;  4GOE A;  5CBN A;  1LP1 A;  4ZMD A;  2OTK E;  2M5A B;  1ZW0 A;  2ZAE B;  3MZW B;  2I8D A;  2B87 A;  1LP1 B;  1FC2 C;  4K3A A;  2RKL A;  2LR2 A;  2KIK A;  2KZJ A;  5DJT B;  1BDC A;  4K35 A;  2B87 B;  5CBO A;  2R44 A;  4WWI A;  3QWO C;  1JM0 A;  2KUB A;  1LT1 A;  2LXB A;  4ASV A;  1EC5 A;  4KJM A;  4IOI H;  1JMB A;  2JWD A;  4ASW A;  1U7M A;  2QVA A;  4EYY Q;  1ZXG A;  5EFW B;  1OVV A;  1S3J A;  4NPF X;  5DJU B;  3ZDM A;  3RGU A;  1BDD A;  5K5G B;  1OVR A;  4GOF A;  1OVU A;  1SS1 A;  1Y47 A;  2P58 A;  3FXD A;  2B89 A;  1EDJ A;  5C39 A;  2Q1K A;  1EDK A;  1H0T B;  3PH0 A;  1Q2N A;  4NPD A;  2LXC B;  4CPG A;  1U7J A;  3FXE A;  1H0T A;  2KZI A;  4ZNC A;  3S1K A;  4JBZ A;  2M0B A;  1DEE G;  2SPZ A; 
#chains in the Genus database with same CATH topology
 1EDL A;  3B71 A;  1NU1 K;  2YXR B;  2WSF J;  1GL2 B;  5AVW B;  4BRY A;  5AVZ B;  3B5N C;  4MN4 C;  5KLV G;  2M5A A;  2JP3 A;  2VRS A;  4D6T D;  1M90 Q;  4IL6 H;  2NRG A;  1YJW P;  2H43 A;  3M0D A;  1VQN P;  2W6A A;  2R32 A;  2K9Y A;  1RH5 B;  2HLO A;  2O1J A;  3PLN A;  4IL6 E;  5APU A;  3GG2 A;  3VMY A;  1S5L E;  1N7S D;  4TT3 H;  2QA4 P;  1LWU A;  1PP9 G;  3CX5 I;  3CX5 D;  4UB8 H;  5B66 H;  2E74 D;  1PPJ G;  1SQQ J;  2P58 A;  5AW7 B;  1BCC G;  3CCU P;  1IK9 A;  1G2C A;  1BGY J;  2WWW A;  1PP9 D;  1FAV A;  3N4X A;  2YKQ A;  1GK4 A;  1PPJ D;  1YYC A;  2AEF A;  1NH4 A;  2GA1 A;  5B66 E;  2J5U A;  1L0L E;  1YIJ P;  3A7O A;  3OA7 A;  4PJ0 H;  1W5C E;  1GL2 A;  3M0A A;  3L73 J;  5AW1 B;  1DEE G;  2FFD C;  1M1J B;  5KLV K;  4OGQ D;  1SQX J;  4XA4 A;  2XND H;  5GTH E;  3H1L E;  1SFC B;  5KAI H;  2Q3E A;  1YIT P;  2E76 D;  3AEF C;  1KN7 A;  3T97 B;  2WSE H;  1L0N G;  2HFE D;  4BWN A;  2G8Y A;  3G9R A;  3L75 J;  4PJ0 E;  4U7J A;  2IBZ G;  2FYZ A;  1PL5 A;  2V4H A;  1L0N D;  1AQT A;  1KQG B;  2ZT9 D;  5KAI E;  2IBZ I;  2PFX A;  2GUV A;  2R44 A;  2IBZ D;  3U1C A;  2Q9I A;  4Y28 J;  5B5E H;  4H44 D;  5CCH C;  1PGP A;  2JWD A;  4TLF A;  1S72 P;  2ZFC A;  5EFW B;  4AUW A;  1PV3 A;  2M8R A;  2JDI H;  2A45 G;  3VMA A;  4DZO A;  1LT9 B;  2WIT A;  4N6J A;  2E75 B;  1RQU A;  2KXP B;  5B5E E;  3WMM 0;  3Q2Y A;  2BCC G;  1KYO I;  1W2B O;  3CCJ P;  2A45 I;  3L74 E;  1KYO D;  1Z56 A;  2WSC J;  1M1J A;  3MD0 A;  1DIP A;  1AV1 A;  3L36 A;  1NU1 E;  1H0T A;  4IFM A;  1SQP K;  2QG4 A;  1NJI Q;  3IR9 A;  1SFC A;  2ZYA A;  3T97 A;  2WQY C;  3BVH A;  2KS1 B;  4GIF A;  3V2Q A;  1NTZ K;  1Y8A A;  2FYN C;  3A0H H;  1ZW0 A;  4JYB A;  2QJK B;  1ZRT D;  4C7N B;  1NTK K;  2AXT H;  3VTP C;  2XKM A;  3GMA A;  2Y0E A;  4IOI H;  2R5D A;  3A0H E;  4N3Y B;  4ASW A;  4HYT B;  1LT9 A;  1JEK A;  1BGY G;  1YJN P;  3BCC G;  5APW A;  1OVR A;  2AXT E;  3M9B A;  1SQB E;  4PV1 C;  3HTK B;  2HPC B;  1SQQ D;  5L8R J;  3H1I E;  1BGY D;  1LTG C;  1USD A;  2HOD B;  4WY4 A;  2OYH C;  4W7Y A;  3GHG C;  3L73 G;  3E1I A;  1JB0 J;  1SQX G;  1RHZ B;  4WB4 A;  1XTC C;  5KLV E;  1X8Y A;  4JF7 A;  3S1K A;  4JBZ A;  4EOT A;  3L73 D;  2E43 A;  4U3F E;  4YXW H;  1SQX D;  3KPE A;  2B88 A;  2NPS C;  2L5G B;  2FXM A;  1LTI C;  3G4S P;  3EQ2 A;  1FZE A;  1X0T A;  1HUC A;  3CC4 P;  2WTY A;  2XZR A;  2Z5I A;  1KQS O;  1BE3 E;  3P8M C;  1GMJ A;  4C7N A;  1ZLL A;  3CCE P;  2IDB A;  3L75 D;  1VQ9 P;  3C8V A;  4H0L C;  4JPZ B;  3L35 A;  3MP7 B;  3NMD A;  1JCC A;  1SVF A;  2LR2 A;  1EZV G;  4JYC A;  3CD6 P;  2MJZ A;  2KP8 A;  3EFF K;  1BCC E;  3TNU B;  3OW2 O;  5AW3 B;  3LID A;  4WBA A;  1JY3 N;  1RE3 A;  1KB9 H;  1USE A;  3HTK A;  2HPC A;  1OVV A;  1S3J A;  2Y0D A;  3L71 J;  1YTZ I;  3F89 A;  2ZVN B;  3CXH D;  1L4A D;  1RF1 C;  1X9V A;  1Q2N A;  1E79 H;  2HYN A;  1SQP E;  2YKO A;  2ZXX A;  1FS0 E;  2FBW C;  5AVY B;  3G3Z A;  3I5C A;  1HJB A;  2WPS A;  4L73 A;  3TSI A;  1Q82 Q;  3V6I A;  4GKG A;  3H25 A;  1NAY A;  1LTJ C;  4OVN F;  2FFD B;  2QEX P;  3B5N A;  5CBN A;  1P84 H;  2AEJ A;  3HE5 B;  1NTM G;  1YTZ T;  3WUT A;  1L0L K;  1JY3 O;  1FC2 C;  1MFZ A;  4DT0 A;  3TNU A;  1SQV G;  1VQ5 P;  1FOS E;  1A02 J;  2J58 A;  5AW9 B;  1HWT C;  2OTJ P;  5AVT B;  2B87 B;  3V5B A;  4XFJ A;  4R4L A;  2B9B A;  1P84 E;  3H32 A;  1SQV D;  2BCC E;  1WRG A;  1KFM A;  2D2C C;  2IX7 C;  1SLQ A;  3CLQ A;  1ZP0 C;  1OMI A;  2BEZ F;  2YIU C;  1SS1 A;  1YQ3 C;  2FXO A;  1M8O B;  5AVV B;  3AE3 C;  1QL2 A;  4RES B;  4ZKU A;  2P2U A;  2FXP A;  1KOR A;  1YQ4 C;  4R4M A;  2M3B A;  2Q3I A;  1VPC A;  2KLU A;  1U57 A;  1J1E C;  3CWB J;  3A3Y B;  1FBM A;  1NTZ J;  3LW5 H;  4ZNC A;  4EIJ A;  1OFC X;  3HE4 B;  1RE4 C;  2FFD A;  2C0W A;  3MTU E;  3FGA D;  3A5T A;  1R5S A;  3FWL A;  1NTK J;  4LLH A;  2JR8 A;  5APQ A;  2K37 A;  4UB6 E;  5AW5 B;  2IFM A;  1MKM A;  1R8E A;  3S9O A;  2PGD A;  3D71 A;  2WVR A;  3AEE C;  2QE7 H;  3TGU J;  2ZAE B;  1S9K E;  1Q7Y Q;  2OAR A;  2JJL A;  2B87 A;  3V2R A;  4AQR D;  4H44 C;  3WU2 H;  3L37 A;  2IPP A;  3RL0 D;  3BCC E;  1S4X A;  3RK2 C;  1BDC A;  2FYN B;  2OYI C;  1PGO A;  1L2P A;  3EFG A;  3L71 G;  3KHU A;  2YMK A;  1HF9 A;  2KK7 A;  3AE4 C;  1PFI A;  3VMX A;  1S5L H;  1U7M A;  5CCH A;  3HD7 C;  3H1J J;  3L71 D;  3WU2 E;  5APX A;  4WY4 D;  2I1K A;  5KJ7 C;  1ZR4 A;  3OJA B;  5BVZ A;  2FYU J;  1N8R Q;  5CHX A;  3AE7 C;  2ITA A;  2CK3 H;  1VQ4 P;  1YBK A;  4PV1 B;  2H88 C;  1Y9B A;  4EDF A;  1IJD B;  1GD2 E;  3HE4 A;  1VF5 C;  4H13 D;  5AVQ B;  2OYH B;  1E5W A;  3GHG B;  2IZ1 A;  2FY8 A;  5AW2 B;  2UWJ E;  1SQB K;  4KT0 J;  3L4F A;  3Q5S A;  5GTH H;  2M3E A;  2PP6 A;  1OX3 A;  2QRX A;  1EZV E;  4B86 A;  4HJG H;  1T3U A;  1FOS F;  5CCG D;  3NTN A;  2NPS B;  2WZ7 A;  3H1K E;  1KIL E;  2IYO A;  3V2N A;  2XV5 A;  1K8A Q;  4H0L B;  3AEC C;  3BAT A;  1R5L A;  1NHL A;  1JCD A;  4YPC A;  4ASV A;  3RBZ A;  3UIA A;  1JUN A;  1RF0 C;  2WSS H;  1BDD A;  3CC2 P;  3RL0 g;  1FZF A;  2HG5 D;  2ZYG A;  3PHL A;  3KDP B;  1KB9 I;  3EWK A;  2H89 C;  1KB9 D;  3CWB G;  1YI2 P;  5C39 A;  3PH0 A;  3IN6 A;  2BEQ D;  4NPD A;  2OYH A;  3GHG A;  4PD4 E;  3FXE A;  3L70 E;  3P8C E;  1RF1 B;  3CWB D;  1PIX A;  1IO4 A;  1KMI Z;  1NTZ D;  3U59 A;  2POH A;  5BU8 B;  1IZN B;  3RK3 E;  3OAK A;  2QIW A;  3B5N D;  4LC1 A;  1L0L J;  3HUS C;  1ZV8 A;  1CZQ A;  1FDI A;  5AVU B;  2HR3 A;  1KV4 A;  3H1H E;  3SFD C;  2RMZ A;  5AW6 B;  2NPS A;  2RH0 A;  1NTK D;  4GOE A;  1JOC A;  3H1L J;  1ZN5 A;  3CCQ P;  3TGU D;  1LJ2 A;  1L0N K;  4QMA A;  1GZL A;  1LTJ B;  2A06 D;  4N78 E;  3V4Q A;  1T8Z A;  3P7K A;  1LTB C;  1PGQ A;  1P84 I;  1H89 A;  2W83 C;  2N1T D;  3L72 E;  3GF7 A;  3Q3D A;  3W68 A;  3QWO C;  3BRV B;  3D6Z A;  3VN0 A;  3TDK A;  2IYP A;  2N9B A;  1JMB A;  2YMY A;  2FYU G;  1L4A C;  1KIL C;  2WSE J;  2ZJS E;  3H1J D;  2Z4E A;  4Y99 C;  1Y47 A;  3U1A A;  3IAO A;  2D2C B;  3CME P;  1AQ5 A;  2FYU D;  2KNC B;  1BSN A;  1SQQ G;  2YKP A;  1RF1 A;  5APY A;  2YIU B;  3Q5P A;  2YNY A;  1JO5 A;  1HVV A;  1OIP A;  3L74 J;  1OW6 A;  4D6T E;  4OGQ B;  1CI6 B;  3A0B H;  3CCM P;  4NPE A;  1NU1 J;  1J1E B;  1AJY A;  4HB1 A;  2E76 B;  5KLI C;  2K88 A;  4GOD A;  3CX5 H;  1AFO A;  3A0B E;  3RK3 C;  1URQ C;  2N9Y B;  1RQV A;  3L75 G;  2KS1 A;  2JKV A;  3WUV A;  1VQM P;  1K05 A;  5CCH D;  3IF4 A;  1NGM B;  3CX5 E;  2H8P D;  2LXB A;  4H44 B;  5E79 E;  3RK2 B;  2OYI B;  1PP9 E;  5DJU B;  3ZDM A;  1FZC C;  5TJH A;  2KNC A;  1NAF A;  1PPJ E;  2W8Z A;  3CI9 A;  3MUD C;  1K04 A;  1NWQ A;  2E5Y A;  1PGJ A;  2J59 M;  3HD7 B;  3MGN A;  1FJK A;  1SQB J;  1RY3 A;  2ZXE B;  2KSJ A;  1ZR2 A;  3BRT B;  3ITK A;  1K73 Q;  3H1I J;  2HOD A;  1H8A A;  4YXD C;  1SQX K;  5KLV J;  2ZYD A;  1VQ7 P;  1VF5 B;  1L0L D;  1RE4 A;  1GL2 D;  2JWA A;  3MHV A;  1BSH A;  1L0N E;  4U3F J;  4I1L A;  3RL0 C;  1NO4 A;  4ZMD A;  3I56 P;  2GUS A;  3H1L D;  2IBZ E;  2XNX A;  1BE3 J;  3NXS A;  1LP1 B;  2KIK A;  5GTI H;  4K35 A;  2A45 H;  3FX0 A;  3G6E P;  2W90 A;  3LIE A;  2OYI A;  2V7Q H;  2P10 A;  4WY4 C;  1EC5 A;  3SWK A;  1HTL C;  3VP9 A;  1ZXG A;  1DD4 A;  2OTL P;  2XU6 A;  3NFQ A;  1BCC J;  1N7S C;  3HD7 A;  3SWY A;  3HRN A;  1KYO E;  2P7J A;  3MIW A;  5GTI E;  1WMK A;  3QH9 A;  2E74 C;  5KJ7 A;  4RO0 A;  2B89 A;  1XTG B;  2WPQ A;  4OWF A;  2QJP C;  2DW3 A;  4IFF A;  3H6P A;  1X79 B;  1JTH B;  1NU1 G;  3ABV C;  1LTA C;  3B4S A;  1SQP J;  2NPS D;  3L74 D;  1IFI A;  4DJG A;  1UIX A;  3VP8 A;  2O01 H;  2PAJ A;  5CCG C;  1YHQ P;  1LGH B;  4OGQ C;  1GU5 A;  1NU1 D;  1IFD A;  1SFC D;  5APT A;  1ZRT E;  4UB6 H;  1MV8 A;  4H0L D;  3KXD A;  1LP1 A;  2E76 C;  2W6B A;  3HUS B;  2KOG A;  1AVO A;  5AVS B;  2I8D A;  1J2J B;  3N7N A;  2KZJ A;  1NTM K;  3HE5 A;  4I2L C;  4YTP C;  2ZT9 C;  1JM0 A;  3CC7 P;  1SQV K;  1EQ7 A;  4KJM A;  2AXC A;  1SQQ E;  5KTB A;  3P32 A;  1BGY E;  3IFM A;  2V7Q J;  1M1K Q;  4HH2 A;  2E5T A;  4L75 A;  1RF0 A;  2BCC J;  5BU5 A;  1AA0 A;  3GF3 A;  2O01 N;  1L4A B;  1KIL B;  2K9J B;  3H1I G;  1JTH A;  5AVR B;  2AEM A;  2E75 D;  2Q1K A;  1IFN A;  4Y99 B;  1S1C X;  3KZI H;  1SQB D;  3L73 E;  1A02 F;  2JO1 A;  2W27 A;  1T2K D;  1SQX E;  1G1I A;  2O3J A;  1N73 C;  4IL6 X;  4WVZ A;  3RBX A;  3JC2 2;  1UII A;  3H1I D;  2KZI A;  1S5L X;  1HJ0 A;  4M3L A;  1T6A A;  2OYO A;  4A7P A;  3CCR P;  3I55 P;  1GW4 A;  2K3R A;  4U3F G;  3L75 E;  5KLV D;  1MUU A;  2OQQ A;  1QVG O;  1N2D C;  3HUS A;  3KZI E;  3B8E B;  2YO3 A;  3SSU A;  1BE3 G;  1TU3 F;  1KQL A;  3D70 A;  2Q6Q A;  2O01 J;  4U3F D;  1NKN A;  2N1T C;  2Q7C A;  3CXH H;  1G1J A;  2WT7 B;  1NYH A;  5KLI B;  3Q5R A;  1BE3 D;  2WPV B;  1WT6 A;  4K3A A;  3LW5 J;  5DJT B;  3M91 A;  5AW8 B;  3RK3 B;  1URQ B;  2WSC H;  2D2C D;  1Q86 Q;  1KFN A;  3BCC J;  3CXH E;  3PP5 A;  1J1D B;  2QVA A;  1D7M A;  3CCS P;  4NPF X;  2K1A A;  1L4A A;  1KIL A;  2K9J A;  3RGU A;  3C9I A;  1BCC D;  4UB8 E;  1KTM A;  2C0X A;  1CW5 A;  1M56 D;  3V4W A;  1FZC B;  3AEA C;  1H0T B;  4JQ0 D;  1Q81 Q;  1N86 A;  1W2E A;  2LKM A;  2KYV A;  4W80 A;  3M06 A;  1SQP G;  3AE6 C;  2LXC B;  4CPG A;  1U7J A;  1NOH A;  1JY2 P;  4PD4 H;  2E42 A;  2WPR A;  1IFJ A;  2PRR A;  3R2P A;  1VQL P;  1HH0 A;  1QVF O;  1SQP D;  1VQ6 P;  1Q90 D;  3AE9 C;  4W7Z A;  1NTZ G;  1QLE D;  2R3C A;  4L74 A;  2QJY C;  3II6 A;  2WT7 A;  2WMM A;  3M0D C;  1GTW A;  4IFD K;  1NTK G;  3AE8 C;  1NTM E;  4O9B A;  1IFM A;  3RK2 D;  1S2E A;  4AYC A;  1URQ A;  3RL0 B;  3KYQ A;  3TGU G;  1SQV E;  1FDM A;  4GT1 A;  2A06 G;  3H1K J;  4Z1M H;  3HD7 D;  2L91 A;  2CPS A;  1LTS C;  1LWU C;  1FZB A;  3CPW O;  3AE1 C;  5KJ7 D;  2C9L Y;  4ZKP A;  4EI2 A;  3GLM A;  4WY4 B;  1FZC A;  1P84 D;  4I7Z C;  1OVU A;  1VQO P;  1SP4 A;  3H1J G;  2BCC D;  3MUD A;  1HGZ A;  1JY3 P;  3Q1M A;  1CSB A;  1EDK A;  1EXI A;  1N7S B;  3CL3 D;  1VF5 D;  3C1L A;  5AW4 B;  2E74 B;  2Q5U A;  4H13 B;  1VQK P;  1GL2 C;  5CJ4 A;  2QJP B;  1PZQ A;  3PRJ A;  5KKZ B;  4GDO A;  4OH8 B;  2P1J A;  3F5H A;  1DEB A;  1T3J A;  3L70 J;  3V2P A;  1VQ8 P;  2MKV A;  4HKZ H;  1EDI A;  1KZU B;  1QEX A;  1NTM J;  1VL2 A;  2I1J A;  1ZOY C;  2C9N Y;  1SQV J;  3H1H J;  3PTZ A;  3AEB C;  4LGD E;  1QL1 A;  4RKU J;  2NZ2 A;  1M57 D;  3FWN A;  3D6Y A;  2QM8 A;  4I6M C;  1JY2 N;  1VDF A;  1FZA A;  4DCK A;  1KD1 Q;  3L71 E;  1LTJ A;  1S9K D;  5E79 H;  3TYY A;  3L72 J;  3BCC D;  3R4Y A;  1X22 A;  3A2A A;  3AED C;  2W6J H;  3AE2 C;  2QM7 A;  2ZT9 B;  2H7H A;  1J1D C;  1IK7 A;  1OZH A;  3PJS K;  1N7S A;  1KC8 Q;  2FYU K;  1FJP A;  3O6Q B;  3SWF A;  1LNQ A;  1M1J C;  1AVY A;  1GU4 A;  5KAF H;  1SQQ K;  4RJT A;  2ZVO B;  3GW6 A;  1IFP A;  1OW7 A;  1SFC C;  4XE5 B;  1K9M Q;  4DOJ A;  3KQG A;  3B5N B;  5TIS H;  4BXL A;  1N73 B;  2R3S A;  1FZG A;  1MFT A;  1FU1 A;  5CCG A;  3CCV P;  5CJ0 A;  2KB7 P;  4D6T J;  4C7R A;  2IZ0 A;  1CI6 A;  2KI7 B;  2XDJ A;  3JCU H;  3CCL P;  1JY2 O;  3S4R A;  5KAF E;  1L0L G;  1HBW A;  3JSV C;  1GW3 A;  3VYI A;  1EZV I;  3H1K G;  3AE5 C;  5AW0 B;  3VMZ A;  1EZV D;  2OGU A;  2JEE A;  5TIS E;  3H1L G;  4KHX A;  3H32 B;  2RKL A;  5H2F H;  2Z5H A;  2N1T B;  3CXH I;  3M9H A;  1N7L A;  1QGK B;  5CBO A;  3JCU E;  4WWI A;  3H1K D;  1LT1 A;  1JNM A;  2GM4 A;  3AEG C;  1KIL D;  3E7K A;  1FDO A;  3BAS A;  5APV A;  1LT9 C;  3WUU A;  3SFE C;  1QX8 A;  1H88 A;  1KB9 E;  3TF5 A;  2E75 C;  2R5B A;  5APS A;  3O6Q A;  2FKW B;  5K5G B;  1OW8 A;  5H2F E;  1KYO H;  4GOF A;  1T2K C;  2G3A A;  3FXD A;  1PP9 J;  2KLV A;  2RN0 A;  3CWB E;  1NTZ E;  4PV1 D;  1OWA A;  1NKZ B;  1OXZ A;  3W67 A;  1FE6 A;  5M1B A;  3L70 G;  2WSF H;  3M9Q A;  2YO2 A;  1N73 A;  2M0B A;  2Y9Z A;  1NTK E;  1JMM A;  4H13 C;  3VOP A;  4PD4 I;  3L74 G;  3E1R A;  4PD4 D;  5KKZ C;  2YXQ B;  3H1H G;  3L70 D;  3TGU E;  2QJK C;  3P8C D;  1MZ9 A;  2A06 E;  1NVO A;  1NTM D;  3RK3 D;  1URQ D;  2P67 A;  1ZME C;  1VQP P;  4BRY B;  2OTK E;  2M5A B;  2QJY B;  1LTT C;  2N1T A;  3H1H D;  3MZW B;  1IC2 A;  1L0N J;  3O8Z A;  1GK6 A;  3L72 G;  3G71 P;  2IFN A;  1DD3 A;  1KQF B;  2O1K A;  2KUB A;  3H1J E;  2QSI A;  4L76 A;  4N78 D;  1RE3 C;  1HGV A;  2KSE A;  2Y0C A;  4EYY Q;  2FYU E;  3L72 D;  1YJ9 P;  1EXJ A;  1GDT A;  3TK1 A;  3CMA P;  3K5B A;  1LWU B;  3USS A;  1EDJ A;  1DX7 A;  4I7Z B;  4C46 A;  1G2C B;  2BAS A;  1DH3 A;  2Y9Y A;  5CMZ A;  5AVX B;  1SQB G;  2CPB A;  4D6T G;  1M7L A;  2SPZ A; 
#chains in the Genus database with same CATH homology
 1EDL A;  2K3R A;  2UWJ E;  4BXL A;  4NPE A;  2B88 A;  1MFT A;  2HR3 A;  2QRX A;  4HB1 A;  1X0T A;  4HKZ H;  1EDI A;  3MHV A;  4MN4 C;  2KI7 B;  2M5A A;  4GOD A;  2KS1 B;  4HJG H;  2WMM A;  1NVO A;  4GOE A;  5CBN A;  1LP1 A;  4ZMD A;  2OTK E;  2M5A B;  1ZW0 A;  2ZAE B;  3MZW B;  2I8D A;  2B87 A;  1LP1 B;  1FC2 C;  4K3A A;  2RKL A;  2LR2 A;  2KIK A;  2KZJ A;  5DJT B;  1BDC A;  4K35 A;  2B87 B;  5CBO A;  2R44 A;  4WWI A;  3QWO C;  1JM0 A;  2KUB A;  1LT1 A;  2LXB A;  4ASV A;  1EC5 A;  4KJM A;  4IOI H;  1JMB A;  2JWD A;  4ASW A;  1U7M A;  2QVA A;  4EYY Q;  1ZXG A;  5EFW B;  1OVV A;  1S3J A;  4NPF X;  5DJU B;  3ZDM A;  3RGU A;  1BDD A;  5K5G B;  1OVR A;  4GOF A;  1OVU A;  1SS1 A;  1Y47 A;  2P58 A;  3FXD A;  2B89 A;  1EDJ A;  5C39 A;  2Q1K A;  1EDK A;  1H0T B;  3PH0 A;  1Q2N A;  4NPD A;  2LXC B;  4CPG A;  1U7J A;  3FXE A;  1H0T A;  2KZI A;  4ZNC A;  3S1K A;  4JBZ A;  2M0B A;  1DEE G;  2SPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...