2LR2A

Designed igg and lanthanide binding probe for solution nmr, mri and luminescence microscopy
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
GVDNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDSYIDTNNDGAYEGDELSGSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein A
publication title Lanthanide binding and IgG affinity construct: Potential applications in solution NMR, MRI, and luminescence microscopy.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2012-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2lr2A00
2P58A 2KS1B 1U7MA 4HKZH 1X0TA 5CBNA 1LP1B 2B88A 1BDDA 2B89A 2KZIA 3S1KA 4MN4C 2K3RA 2LR2A 1JM0A 2Q1KA 3QWOC 1MFTA 5EFWB 1FC2C 4GOFA 1EDIA 4BXLA 3MZWB 2M0BA 1LT1A 2HR3A 3PH0A 1ZXGA 4IOIH 4K3AA 4ZMDA 2UWJE 1H0TA 4HJGH 2JWDA 1OVVA 2B87A 5DJUB 3ZDMA 4CPGA 4WWIA 5CBOA 5K5GB 4NPEA 1DEEG 2KUBA 2ZAEB 2KIKA 4GOEA 1EC5A 2SPZA 4EYYQ 5DJTB 4ASWA 1SS1A 3FXEA 4ASVA 2LXBA 1LP1A 1OVUA 2B87B 2M5AA 4NPDA 2R44A 2RKLA 2QRXA 2KI7B 1BDCA 3MHVA 2OTKE 4NPFX 3FXDA 1EDKA 2KZJA 1EDLA 3RGUA 1S3JA 4JBZA 4GODA 2WMMA 1JMBA 1EDJA 4KJMA 2I8DA 1H0TB 1ZW0A 2M5AB 1U7JA 1Y47A 1OVRA 5C39A 1NVOA 1Q2NA 4ZNCA 2QVAA 4HB1A 4K35A 2LXCB
chains in the Genus database with same CATH superfamily
3TNUB 1OX3A 1U7MA 1BDDA 1Y9BA 1SQPD 2R3CA 3HUSA 1J1DB 2K88A 4DCKA 2JP3A 3CX5E 4WY4A 1QVFO 3L72G 2QG4A 1NTZG 3IF4A 3PH0A 3MGNA 3C1LA 3RL0g 2FXOA 1FU1A 3NXSA 4M3LA 1NKZB 4XA4A 2ZT9B 4DOJA 3VMYA 1OVVA 2PGDA 2Z5HA 4NPEA 5AW3B 3AE7C 3WU2H 3B5NB 1A02F 2ZYDA 1VQ4P 2QJPC 2W6AA 2O01H 3RK2B 2IFMA 1AVOA 2OTKE 4OH8B 2IDBA 1VQNP 1HUCA 1DD4A 3L72D 1VQ5P 1NTZD 3H1IJ 3E7KA 3CCJP 1JY2P 3FWLA 5AVWB 2KS1A 1SQQK 1K05A 1YI2P 3KDPB 1OW6A 1KILC 3GLMA 5BU8B 2L5GB 1M90Q 1N7SD 3PRJA 3EFGA 3BVHA 2WSFH 5BVZA 3Q5PA 2HLOA 4ZKUA 1M1JB 2NPSD 1KORA 1SLQA 4L73A 4AUWA 1W5CE 3AEDC 1GL2D 1KN7A 5CCHC 2WPVB 3CCRP 1MKMA 3WUVA 4LGDE 2N9YB 4Y99B 1WMKA 5CHXA 1JEKA 2OARA 3ZDMA 1KMIZ 5CJ0A 4GOEA 3GF7A 1JOCA 3L75G 3GW6A 3VP8A 1HTLC 1G2CA 2QJKC 1NTKK 1LNQA 1CI6A 1PP9J 1PL5A 1UIXA 2FYNC 3HD7B 3GHGC 3RL0B 1RE3A 3CXHD 1FBMA 2QA4P 3MUDA 4JBZA 4B86A 1L0NE 1JTHB 2M5AB 2FFDC 1R5SA 3PTZA 1PPJG 4PJ0E 5KLVG 1IK9A 1NVOA 3OW2O 1NAFA 3V4WA 3WMM0 1IFIA 2R5BA 2W90A 3O6QA 5KAIH 3L75D 5E79E 5AVXB 2LKMA 3OA7A 1NTKE 1LP1B 1G1IA 3CWBG 2P1JA 4GIFA 3PLNA 4MN4C 2E74B 3WUTA 3U1AA 1RF1B 1SQPE 2OYHA 1BE3J 2Q3IA 3A5TA 1HBWA 1EDIA 4H44D 1Q86Q 1S72P 1PPJD 5KLVD 5AW4B 3VMZA 2IBZI 1SFCC 4OGQD 4UB8E 1IFDA 1BE3E 1GK4A 3U59A 1L0LG 2B87A 3U1CA 2Q7CA 4WY4B 2KUBA 2PAJA 3CWBD 5CJ4A 1AV1A 1FZCB 5AVYB 3QH9A 2QE7H 3TGUG 2JKVA 3H32B 1JY2O 3P7KA 1YJWP 3LIDA 1BCCJ 4N3YB 2WPQA 3L72E 1KD1Q 1SQXJ 3CC7P 1NTZE 1AJYA 1ZW0A 5B5EE 1IFNA 1OFCX 3B8EB 1L0LD 1J1DC 2FYUJ 3A0HE 1BCCE 3A3YB 1LTIC 5KLIC 2JEEA 1Q7YQ 1P84H 2N1TC 4I2LC 2K1AA 2KS1B 3WUUA 3TGUD 5CBNA 4IL6X 1FJKA 2QJPB 3N7NA 4UB6H 1AFOA 2K3RA 1VQKP 3KPEA 2WTYA 1NO4A 2WT7A 5KTBA 4GOFA 2KLUA 1K9MQ 2RN0A 2YKPA 3RK2C 2HPCA 2BASA 1VQLP 5B66H 1GU5A 3L70E 4HJGH 4Y28J 3BATA 5AVRB 1JNMA 1PGOA 3USSA 2FBWC 3PHLA 1CSBA 1LTJA 1JY2N 3A0BH 5TISH 1HJ0A 3E1IA 1KILB 4ASWA 1AA0A 1FE6A 3FXEA 1LTSC 4BRYA 4H0LC 2WQYC 4D6TG 2OTLP 3L74E 4NPFX 4EDFA 1CZQA 3JCUE 1NOHA 1URQA 1HGZA 2XKMA 1NU1J 3CMAP 1EDJA 1PGQA 3HTKA 1M1JC 3MD0A 3P32A 5KLVK 2C9LY 1GTWA 2HG5D 3NMDA 3L75E 3C9IA 3BRTB 2P67A 4PV1D 1SQQG 2YKQA 2QJKB 4D6TD 2P2UA 2KOGA 4XFJA 5KJ7D 2AEJA 3L71J 3KHUA 4EOTA 2FYNB 3GHGB 1KQFB 3L36A 1U57A 2JJLA 2GUSA 1OXZA 3CL3D 4ZMDA 1JCCA 3K5BA 2FFDB 2Y9YA 1PPJE 5KLVE 1VQ8P 1S5LX 1TU3F 1LTTC 4WB4A 5CBOA 1HH0A 5APXA 3N4XA 4IL6E 1P84I 3H6PA 1L0LK 5CCGD 2KSEA 3TDKA 1SQQD 5AW5B 3RBZA 3L35A 1SQVJ 1M57D 4GKGA 3CWBE 2LXBA 3H1KJ 2NPSC 3VYIA 2B87B 5GTHH 1VF5C 1FZAA 2IBZG 1VDFA 2VRSA 1GL2C 1KZUB 4C7RA 1YYCA 1MZ9A 2PP6A 5KAFE 1SQVE 4RJTA 3H1KE 1N7SA 1KYOE 1OVRA 3H1JJ 3H1HJ 1NTMJ 1KV4A 1SQBJ 3IR9A 2YO3A 1SFCB 1L0LE 2XV5A 2E75D 1ZLLA 3AEEC 3HUSC 3V6IA 3SFEC 2IBZD 2B89A 2AXCA 3H1JE 4BWNA 3I55P 1DEBA 2BEZF 4WY4C 2ZT9D 3V2RA 3D6ZA 1FC2C 3G9RA 4OVNF 3JSVC 5AW0B 1Q81Q 3LW5H 3B5ND 5BU5A 2R3SA 2W27A 2HR3A 1LJ2A 4JF7A 1RY3A 1K8AQ 4HYTB 1A02J 1X9VA 2ZXXA 1GZLA 3CCVP 3G4SP 5KLIB 1S2EA 2N1TB 4YPCA 1LTAC 3AE2C 1QL2A 2C0XA 5AVTB 1L4AD 2W6JH 4C46A 3BCCG 1S5LE 5C39A 2FXMA 3LW5J 2JWAA 2KLVA 1URQB 5AVVB 2QVAA 2JDIH 3VMAA 2NZ2A 4K35A 2V4HA 5GTIE 2YXQB 1J2JB 3CCQP 2OYIA 1Q82Q 1X22A 3CCLP 4H0LB 1T6AA 4D6TE 1EZVI 1N2DC 3GG2A 1RH5B 1T3UA 3BCCD 2KYVA 1IJDB 2M0BA 1IK7A 2MKVA 3L73J 4IOIH 4O9BA 1WT6A 1GU4A 1VQ9P 2Q6QA 1FZFA 5E79H 2JWDA 1HGVA 1JB0J 1USDA 3EFFK 2C9NY 4Z1MH 5DJUB 1NJIQ 3HD7D 3V5BA 3RL0D 5K5GB 1BGYG 1EC5A 1KB9E 3L73E 4U3FE 5DJTB 1GDTA 5AW7B 1SQQE 1N73A 4ASVA 2A06G 1RE3C 2HODA 3MUDC 2P7JA 3RK3E 2KNCB 1QGKB 3FXDA 3HE5A 2K37A 2Q9IA 4UB8H 1L0NJ 1JMMA 2FY8A 5AVZB 1Y47A 2WPRA 2E74D 1BGYD 1NU1G 3MP7B 1K04A 3BRVB 3CC4P 1CW5A 1ZMEC 1N7SB 2A06D 1NTKJ 3B71A 2OYHC 4N6JA 5AVSB 3S1KA 3CCEP 3IFMA 1W2EA 2NPSB 2IYOA 1RE4A 1VF5B 1QLED 1SQPJ 1GL2B 3CC2P 1P84D 5B5EH 2JO1A 3V2NA 3A0HH 2QEXP 1LWUA 5APQA 3L71G 1MV8A 2JR8A 4H13C 3H1LG 1FDIA 4W7YA 4PV1C 2FYZA 2W8ZA 4PD4D 1ZRTD 3M91A 1W2BO 2SPZA 5APWA 3CCSP 2DW3A 3R2PA 2WZ7A 3HUSB 3PP5A 4KT0J 3KZIH 1H8AA 2D2CD 2E5TA 3S4RA 3O8ZA 1EDKA 1S1CX 3E1RA 1NKNA 3Q2YA 4GODA 2CPBA 2Y0EA 2WVRA 3L72J 1N7LA 4LLHA 3H1LD 1HVVA 1NTZJ 5KJ7A 1EXJA 2BCCG 3T97A 2WPSA 3L37A 3I56P 3SWKA 4C7NA 2R5DA 5APTA 4GDOA 3RK3C 3G3ZA 4JYBA 4ZKPA 4EIJA 1GW3A 5L8RJ 2FKWB 2RMZA 2XNDH 1MFTA 1MFZA 1ZR2A 2E76C 5CCGA 3D71A 3HRNA 2OYIB 3R4YA 2G3AA 1FOSE 1KILD 2HYNA 1H0TA 2BCCD 3SFDC 1LTJC 3L70J 1PIXA 2FXPA 2XZRA 2AXTH 1FOSF 3FGAD 1EZVG 5AW8B 4RESB 1N8RQ 5AW1B 4IFMA 2QJYB 3TNUA 2H8PD 4W80A 5CCHD 1URQC 2QRXA 1BDCA 1NWQA 3KQGA 3KXDA 3G6EP 1M8OB 3L74J 2Y9ZA 2O3JA 5AW9B 1SP4A 3GF3A 1N73B 1NYHA 4KJMA 2XDJA 1KC8Q 1WRGA 3HE5B 4IL6H 2ZFCA 1OIPA 1EZVD 4HB1A 1ZV8A 4XE5B 1GK6A 3VP9A 2KXPB 1G2CB 1BGYE 1NU1K 3B5NA 1CI6B 2K9YA 4OWFA 3CXHE 3L75J 2KZIA 3AEGC 1JM0A 3H1IG 1R5LA 3CCUP 1N86A 3AE1C 1KYOH 2J5UA 3BASA 1P84E 1L2PA 3W68A 3C8VA 2V7QJ 2UWJE 2E42A 1YJ9P 2M8RA 2J58A 1OZHA 3O6QB 4RO0A 2XU6A 5KLVJ 3HE4A 2A45H 3M0AA 2KIKA 2NRGA 2W83C 1L4AA 2QSIA 3M06A 4EYYQ 1VQPP 4PD4E 2PFXA 3AEAC 5M1BA 3W67A 3G71P 1VQ6P 3H1ID 2OYHB 5B66E 3CWBJ 3M0DA 1AVYA 1ZN5A 1VQMP 3EWKA 1IFJA 2KZJA 1EDLA 1N7SC 5AW6B 1MUUA 2OTJP 3A0BE 2I8DA 1LT9A 2B9BA 2QM7A 4QMAA 2Y0DA 3V4QA 3CX5H 1DD3A 1E79H 4H13B 1L0LJ 1L0NG 4PV1B 1D7MA 2K9JA 3VN0A 1PP9G 1H89A 1NAYA 2B88A 4DT0A 2Y0CA 1YQ4C 3QWOC 1FDOA 3HD7A 3IAOA 3LIEA 1S5LH 2CK3H 2PRRA 4I1LA 1LT1A 1NGMB 1ZXGA 1BSHA 1JCDA 1QX8A 2N1TD 2ZXEB 3TGUE 4AYCA 3PJSK 1KILE 3AE4C 2BCCE 2O01N 5GTIH 1IZNB 2AEMA 1PP9D 2WSCJ 3AE5C 4R4MA 3RK3B 2ZYGA 3M9BA 1RF0A 2YIUB 2ZVNB 1LP1A 1FZBA 2WT7B 2R44A 1BE3G 3RK2D 3MHVA 1E5WA 1HWTC 1RF1A 5APVA 1J1EC 3B4SA 2QIWA 3SWYA 3RGUA 2HPCB 4TT3H 1KYOI 1JMBA 2E76B 3F89A 4IFDK 4N78D 1G1JA 4H44C 3TK1A 2E75B 1LTJB 1KB9H 4ZNCA 2A45I 5GTHE 4IFFA 2E5YA 1LTGC 1X79B 4H0LD 1JUNA 5CMZA 1EZVE 1KFNA 2OYIC 1DH3A 4OGQC 4BRYB 2D2CC 1BE3D 2KSJA 1S9KD 1KQSO 2GA1A 1VQ7P 1SVFA 1FZCA 3Q3DA 1GMJA 1BCCG 3H32A 5EFWB 2KB7P 5TJHA 4D6TJ 1SQXG 2Z4EA 3AE8C 2QJYC 3HTKB 4LC1A 1EXIA 1ZR4A 2FYUG 1YTZT 1JY3P 3A7OA 2IZ1A 3MTUE 3AE9C 3CX5I 4YXWH 1KQGB 5H2FE 1YHQP 2P10A 4L75A 4CPGA 2H89C 1T3JA 1N73C 1USEA 2R32A 5KKZC 4PJ0H 1FZGA 3L70G 1IC2A 4U3FJ 1BCCD 1FAVA 1OVUA 3HE4B 1SQQJ 1SQXD 3H1IE 3A2AA 3SWFA 1VL2A 1L4AB 3L4FA 4TLFA 2FYUD 1GW4A 2YO2A 3ABVC 2Q3EA 1RQUA 2WSSH 1S4XA 2M3EA 1DX7A 3AE3C 5AVUB 1RHZB 1GD2E 3L74G 2O01J 1M7LA 1VF5D 1KTMA 1LT9B 3L70D 2O1JA 2LXCB 2WSEH 3AEFC 3WU2E 1L0NK 1RE4C 2Z5IA 1KILA 1M1KQ 1PFIA 3VOPA 1FDMA 2K9JB 4I7ZC 2G8YA 3AE6C 1LWUC 2H7HA 4U7JA 1X8YA 3MIWA 1T2KD 3V2QA 3L74D 2QM8A 4WVZA 1AQTA 5CCHA 1XTCC 1KB9I 2IBZE 2IFNA 4DZOA 2I1JA 4WWIA 1KFMA 1SQPK 2N9BA 1K73Q 1DEEG 2WSFJ 4WY4D 2AEFA 2YKOA 3Q5RA 1PP9E 1HF9A 1PV3A 1EQ7A 2YXRB 3F5HA 4NPDA 2RKLA 2WSEJ 1JO5A 1NU1D 2OYOA 1OMIA 4WBAA 2M3BA 3VTPC 3GHGA 1FJPA 1PGPA 2YNYA 3KYQA 1QEXA 5KJ7C 2BEQD 2ZVOB 4R4LA 2WWWA 1QL1A 1Q2NA 2FFDA 1YTZI 4N78E 2Q5UA 1YITP 3ITKA 1OW8A 1SQVG 2P58A 2ITAA 2POHA 3H1KG 1X0TA 3L71D 1NTZK 4JYCA 1FS0E 1S9KE 4L74A 5CCGC 2YMYA 4W7ZA 1JY3O 1YIJP 1M56D 1AQ5A 2A45G 2W6BA 1NH4A 1J1EB 2IYPA 3H25A 3AEBC 1VPCA 3JC22 1SQXK 2YIUC 5AW2B 3H1JG 3H1HG 1NTMG 1SQBG 3JCUH 3BCCJ 2WITA 2FYUK 1VQOP 2H88C 1LTBC 4H44B 1SQVD 4YXDC 3P8CD 1SFCA 3CXHH 3H1KD 3IN6A 1KYOD 5KAIE 2I1KA 2IZ0A 2KK7A 3I5CA 1SS1A 4OGQB 3BCCE 2D2CB 2IPPA 2E75C 1QVGO 2O1KA 3D6YA 3EQ2A 3OJAB 1PZQA 1SQXE 3H1JD 2WMMA 1Y8AA 3H1HD 1NTMD 1SQBD 1Z56A 2FYUE 1IFMA 1U7JA 2ZT9C 1IFPA 1XTGB 3TF5A 4JPZB 3B5NC 2HFED 2IX7C 3Q1MA 3KZIE 4PD4H 3GMAA 4YTPC 2V7QH 1JY3N 1BGYJ 5KKZB 2HODB 2N1TA 2LR2A 2H43A 3CX5D 2Q1KA 3SSUA 1LGHB 2OGUA 3S9OA 4BXLA 3NTNA 4JQ0D 4L76A 4K3AA 2OQQA 2CPSA 2A06E 2L91A 2GM4A 4DJGA 2E43A 1L4AC 5KAFH 5APYA 2ZAEB 1T8ZA 1HJBA 3TYYA 3M0DC 3P8MC 4AQRD 1PGJA 2KI7B 3M9HA 1RQVA 4GT1A 4UB6E 3CLQA 1DIPA 3V2PA 3Q5SA 1LT9C 4H13D 1NU1E 3CCMP 1OWAA 1S3JA 4I7ZB 3L73G 4U3FG 2AXTE 1LWUB 3OAKA 1YJNP 1ZRTE 4RKUJ 1FZEA 4Y99C 1NHLA 1IO4A 1UIIA 3NFQA 3H1LJ 3CXHI 4KHXA 1SFCD 1M1JA 3FX0A 2MJZA 5AVQB 3UIAA 4HKZH 3CI9A 5APUA 1SQVK 2ZJSE 3M9QA 3HD7C 5TISE 3RL0C 1Q90D 3L71E 4A7PA 1KB9D 2WSCH 3H1LE 4HH2A 1ZOYC 3L73D 4U3FD 2KNCA 2J59M 3FWNA 3MZWB 3CD6P 2GUVA 1BSNA 3AECC 4EI2A 2YMKA 3CPWO 4I6MC 3RK3D 1YBKA 3T97B 1NTMK 1SQBK 3II6A 3TGUJ 4C7NB 1R8EA 2KP8A 2XNXA 4PD4I 3D70A 2BCCJ 1RF0C 1NTKG 3P8CE 3VMXA 2E74C 2E76D 2RH0A 1RF1C 1JTHA 2M5AA 1YQ3C 5APSA 1SQPG 1L0ND 2NPSA 3RBXA 1T2KC 1GL2A 1ZP0C 1H88A 2ZYAA 3CMEP 1OW7A 1H0TB 1KQLA 5H2FH 3H1HE 1NTME 1SQBE 3TSIA 1NTKD 1URQD 2C0WA 1FZCC
chains in the Genus database with same CATH topology
2P58A 2KS1B 1U7MA 4HKZH 1X0TA 5CBNA 1LP1B 2B88A 1BDDA 2B89A 2KZIA 3S1KA 4MN4C 2K3RA 2LR2A 1JM0A 2Q1KA 3QWOC 1MFTA 5EFWB 1FC2C 4GOFA 1EDIA 4BXLA 3MZWB 2M0BA 1LT1A 2HR3A 3PH0A 1ZXGA 4IOIH 4K3AA 4ZMDA 2UWJE 1H0TA 4HJGH 2JWDA 1OVVA 2B87A 5DJUB 3ZDMA 4CPGA 4WWIA 5CBOA 5K5GB 4NPEA 1DEEG 2KUBA 2ZAEB 2KIKA 4GOEA 1EC5A 2SPZA 4EYYQ 5DJTB 4ASWA 1SS1A 3FXEA 4ASVA 2LXBA 1LP1A 1OVUA 2B87B 2M5AA 4NPDA 2R44A 2RKLA 2QRXA 2KI7B 1BDCA 3MHVA 2OTKE 4NPFX 3FXDA 1EDKA 2KZJA 1EDLA 3RGUA 1S3JA 4JBZA 4GODA 2WMMA 1JMBA 1EDJA 4KJMA 2I8DA 1H0TB 1ZW0A 2M5AB 1U7JA 1Y47A 1OVRA 5C39A 1NVOA 1Q2NA 4ZNCA 2QVAA 4HB1A 4K35A 2LXCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P58 A;  2KS1 B;  1U7M A;  4HKZ H;  1X0T A;  5CBN A;  1LP1 B;  2B88 A;  1BDD A;  2B89 A;  2KZI A;  3S1K A;  4MN4 C;  2K3R A;  2LR2 A;  1JM0 A;  2Q1K A;  3QWO C;  1MFT A;  5EFW B;  1FC2 C;  4GOF A;  1EDI A;  4BXL A;  3MZW B;  2M0B A;  1LT1 A;  2HR3 A;  3PH0 A;  1ZXG A;  4IOI H;  4K3A A;  4ZMD A;  2UWJ E;  1H0T A;  4HJG H;  2JWD A;  1OVV A;  2B87 A;  5DJU B;  3ZDM A;  4CPG A;  4WWI A;  5CBO A;  5K5G B;  4NPE A;  1DEE G;  2KUB A;  2ZAE B;  2KIK A;  4GOE A;  1EC5 A;  2SPZ A;  4EYY Q;  5DJT B;  4ASW A;  1SS1 A;  3FXE A;  4ASV A;  2LXB A;  1LP1 A;  1OVU A;  2B87 B;  2M5A A;  4NPD A;  2R44 A;  2RKL A;  2QRX A;  2KI7 B;  1BDC A;  3MHV A;  2OTK E;  4NPF X;  3FXD A;  1EDK A;  2KZJ A;  1EDL A;  3RGU A;  1S3J A;  4JBZ A;  4GOD A;  2WMM A;  1JMB A;  1EDJ A;  4KJM A;  2I8D A;  1H0T B;  1ZW0 A;  2M5A B;  1U7J A;  1Y47 A;  1OVR A;  5C39 A;  1NVO A;  1Q2N A;  4ZNC A;  2QVA A;  4HB1 A;  4K35 A;  2LXC B; 
#chains in the Genus database with same CATH topology
 3TNU B;  1OX3 A;  1U7M A;  1BDD A;  1Y9B A;  1SQP D;  2R3C A;  3HUS A;  1J1D B;  2K88 A;  4DCK A;  2JP3 A;  3CX5 E;  4WY4 A;  1QVF O;  3L72 G;  2QG4 A;  1NTZ G;  3IF4 A;  3PH0 A;  3MGN A;  3C1L A;  3RL0 g;  2FXO A;  1FU1 A;  3NXS A;  4M3L A;  1NKZ B;  4XA4 A;  2ZT9 B;  4DOJ A;  3VMY A;  1OVV A;  2PGD A;  2Z5H A;  4NPE A;  5AW3 B;  3AE7 C;  3WU2 H;  3B5N B;  1A02 F;  2ZYD A;  1VQ4 P;  2QJP C;  2W6A A;  2O01 H;  3RK2 B;  2IFM A;  1AVO A;  2OTK E;  4OH8 B;  2IDB A;  1VQN P;  1HUC A;  1DD4 A;  3L72 D;  1VQ5 P;  1NTZ D;  3H1I J;  3E7K A;  3CCJ P;  1JY2 P;  3FWL A;  5AVW B;  2KS1 A;  1SQQ K;  1K05 A;  1YI2 P;  3KDP B;  1OW6 A;  1KIL C;  3GLM A;  5BU8 B;  2L5G B;  1M90 Q;  1N7S D;  3PRJ A;  3EFG A;  3BVH A;  2WSF H;  5BVZ A;  3Q5P A;  2HLO A;  4ZKU A;  1M1J B;  2NPS D;  1KOR A;  1SLQ A;  4L73 A;  4AUW A;  1W5C E;  3AED C;  1GL2 D;  1KN7 A;  5CCH C;  2WPV B;  3CCR P;  1MKM A;  3WUV A;  4LGD E;  2N9Y B;  4Y99 B;  1WMK A;  5CHX A;  1JEK A;  2OAR A;  3ZDM A;  1KMI Z;  5CJ0 A;  4GOE A;  3GF7 A;  1JOC A;  3L75 G;  3GW6 A;  3VP8 A;  1HTL C;  1G2C A;  2QJK C;  1NTK K;  1LNQ A;  1CI6 A;  1PP9 J;  1PL5 A;  1UIX A;  2FYN C;  3HD7 B;  3GHG C;  3RL0 B;  1RE3 A;  3CXH D;  1FBM A;  2QA4 P;  3MUD A;  4JBZ A;  4B86 A;  1L0N E;  1JTH B;  2M5A B;  2FFD C;  1R5S A;  3PTZ A;  1PPJ G;  4PJ0 E;  5KLV G;  1IK9 A;  1NVO A;  3OW2 O;  1NAF A;  3V4W A;  3WMM 0;  1IFI A;  2R5B A;  2W90 A;  3O6Q A;  5KAI H;  3L75 D;  5E79 E;  5AVX B;  2LKM A;  3OA7 A;  1NTK E;  1LP1 B;  1G1I A;  3CWB G;  2P1J A;  4GIF A;  3PLN A;  4MN4 C;  2E74 B;  3WUT A;  3U1A A;  1RF1 B;  1SQP E;  2OYH A;  1BE3 J;  2Q3I A;  3A5T A;  1HBW A;  1EDI A;  4H44 D;  1Q86 Q;  1S72 P;  1PPJ D;  5KLV D;  5AW4 B;  3VMZ A;  2IBZ I;  1SFC C;  4OGQ D;  4UB8 E;  1IFD A;  1BE3 E;  1GK4 A;  3U59 A;  1L0L G;  2B87 A;  3U1C A;  2Q7C A;  4WY4 B;  2KUB A;  2PAJ A;  3CWB D;  5CJ4 A;  1AV1 A;  1FZC B;  5AVY B;  3QH9 A;  2QE7 H;  3TGU G;  2JKV A;  3H32 B;  1JY2 O;  3P7K A;  1YJW P;  3LID A;  1BCC J;  4N3Y B;  2WPQ A;  3L72 E;  1KD1 Q;  1SQX J;  3CC7 P;  1NTZ E;  1AJY A;  1ZW0 A;  5B5E E;  1IFN A;  1OFC X;  3B8E B;  1L0L D;  1J1D C;  2FYU J;  3A0H E;  1BCC E;  3A3Y B;  1LTI C;  5KLI C;  2JEE A;  1Q7Y Q;  1P84 H;  2N1T C;  4I2L C;  2K1A A;  2KS1 B;  3WUU A;  3TGU D;  5CBN A;  4IL6 X;  1FJK A;  2QJP B;  3N7N A;  4UB6 H;  1AFO A;  2K3R A;  1VQK P;  3KPE A;  2WTY A;  1NO4 A;  2WT7 A;  5KTB A;  4GOF A;  2KLU A;  1K9M Q;  2RN0 A;  2YKP A;  3RK2 C;  2HPC A;  2BAS A;  1VQL P;  5B66 H;  1GU5 A;  3L70 E;  4HJG H;  4Y28 J;  3BAT A;  5AVR B;  1JNM A;  1PGO A;  3USS A;  2FBW C;  3PHL A;  1CSB A;  1LTJ A;  1JY2 N;  3A0B H;  5TIS H;  1HJ0 A;  3E1I A;  1KIL B;  4ASW A;  1AA0 A;  1FE6 A;  3FXE A;  1LTS C;  4BRY A;  4H0L C;  2WQY C;  4D6T G;  2OTL P;  3L74 E;  4NPF X;  4EDF A;  1CZQ A;  3JCU E;  1NOH A;  1URQ A;  1HGZ A;  2XKM A;  1NU1 J;  3CMA P;  1EDJ A;  1PGQ A;  3HTK A;  1M1J C;  3MD0 A;  3P32 A;  5KLV K;  2C9L Y;  1GTW A;  2HG5 D;  3NMD A;  3L75 E;  3C9I A;  3BRT B;  2P67 A;  4PV1 D;  1SQQ G;  2YKQ A;  2QJK B;  4D6T D;  2P2U A;  2KOG A;  4XFJ A;  5KJ7 D;  2AEJ A;  3L71 J;  3KHU A;  4EOT A;  2FYN B;  3GHG B;  1KQF B;  3L36 A;  1U57 A;  2JJL A;  2GUS A;  1OXZ A;  3CL3 D;  4ZMD A;  1JCC A;  3K5B A;  2FFD B;  2Y9Y A;  1PPJ E;  5KLV E;  1VQ8 P;  1S5L X;  1TU3 F;  1LTT C;  4WB4 A;  5CBO A;  1HH0 A;  5APX A;  3N4X A;  4IL6 E;  1P84 I;  3H6P A;  1L0L K;  5CCG D;  2KSE A;  3TDK A;  1SQQ D;  5AW5 B;  3RBZ A;  3L35 A;  1SQV J;  1M57 D;  4GKG A;  3CWB E;  2LXB A;  3H1K J;  2NPS C;  3VYI A;  2B87 B;  5GTH H;  1VF5 C;  1FZA A;  2IBZ G;  1VDF A;  2VRS A;  1GL2 C;  1KZU B;  4C7R A;  1YYC A;  1MZ9 A;  2PP6 A;  5KAF E;  1SQV E;  4RJT A;  3H1K E;  1N7S A;  1KYO E;  1OVR A;  3H1J J;  3H1H J;  1NTM J;  1KV4 A;  1SQB J;  3IR9 A;  2YO3 A;  1SFC B;  1L0L E;  2XV5 A;  2E75 D;  1ZLL A;  3AEE C;  3HUS C;  3V6I A;  3SFE C;  2IBZ D;  2B89 A;  2AXC A;  3H1J E;  4BWN A;  3I55 P;  1DEB A;  2BEZ F;  4WY4 C;  2ZT9 D;  3V2R A;  3D6Z A;  1FC2 C;  3G9R A;  4OVN F;  3JSV C;  5AW0 B;  1Q81 Q;  3LW5 H;  3B5N D;  5BU5 A;  2R3S A;  2W27 A;  2HR3 A;  1LJ2 A;  4JF7 A;  1RY3 A;  1K8A Q;  4HYT B;  1A02 J;  1X9V A;  2ZXX A;  1GZL A;  3CCV P;  3G4S P;  5KLI B;  1S2E A;  2N1T B;  4YPC A;  1LTA C;  3AE2 C;  1QL2 A;  2C0X A;  5AVT B;  1L4A D;  2W6J H;  4C46 A;  3BCC G;  1S5L E;  5C39 A;  2FXM A;  3LW5 J;  2JWA A;  2KLV A;  1URQ B;  5AVV B;  2QVA A;  2JDI H;  3VMA A;  2NZ2 A;  4K35 A;  2V4H A;  5GTI E;  2YXQ B;  1J2J B;  3CCQ P;  2OYI A;  1Q82 Q;  1X22 A;  3CCL P;  4H0L B;  1T6A A;  4D6T E;  1EZV I;  1N2D C;  3GG2 A;  1RH5 B;  1T3U A;  3BCC D;  2KYV A;  1IJD B;  2M0B A;  1IK7 A;  2MKV A;  3L73 J;  4IOI H;  4O9B A;  1WT6 A;  1GU4 A;  1VQ9 P;  2Q6Q A;  1FZF A;  5E79 H;  2JWD A;  1HGV A;  1JB0 J;  1USD A;  3EFF K;  2C9N Y;  4Z1M H;  5DJU B;  1NJI Q;  3HD7 D;  3V5B A;  3RL0 D;  5K5G B;  1BGY G;  1EC5 A;  1KB9 E;  3L73 E;  4U3F E;  5DJT B;  1GDT A;  5AW7 B;  1SQQ E;  1N73 A;  4ASV A;  2A06 G;  1RE3 C;  2HOD A;  3MUD C;  2P7J A;  3RK3 E;  2KNC B;  1QGK B;  3FXD A;  3HE5 A;  2K37 A;  2Q9I A;  4UB8 H;  1L0N J;  1JMM A;  2FY8 A;  5AVZ B;  1Y47 A;  2WPR A;  2E74 D;  1BGY D;  1NU1 G;  3MP7 B;  1K04 A;  3BRV B;  3CC4 P;  1CW5 A;  1ZME C;  1N7S B;  2A06 D;  1NTK J;  3B71 A;  2OYH C;  4N6J A;  5AVS B;  3S1K A;  3CCE P;  3IFM A;  1W2E A;  2NPS B;  2IYO A;  1RE4 A;  1VF5 B;  1QLE D;  1SQP J;  1GL2 B;  3CC2 P;  1P84 D;  5B5E H;  2JO1 A;  3V2N A;  3A0H H;  2QEX P;  1LWU A;  5APQ A;  3L71 G;  1MV8 A;  2JR8 A;  4H13 C;  3H1L G;  1FDI A;  4W7Y A;  4PV1 C;  2FYZ A;  2W8Z A;  4PD4 D;  1ZRT D;  3M91 A;  1W2B O;  2SPZ A;  5APW A;  3CCS P;  2DW3 A;  3R2P A;  2WZ7 A;  3HUS B;  3PP5 A;  4KT0 J;  3KZI H;  1H8A A;  2D2C D;  2E5T A;  3S4R A;  3O8Z A;  1EDK A;  1S1C X;  3E1R A;  1NKN A;  3Q2Y A;  4GOD A;  2CPB A;  2Y0E A;  2WVR A;  3L72 J;  1N7L A;  4LLH A;  3H1L D;  1HVV A;  1NTZ J;  5KJ7 A;  1EXJ A;  2BCC G;  3T97 A;  2WPS A;  3L37 A;  3I56 P;  3SWK A;  4C7N A;  2R5D A;  5APT A;  4GDO A;  3RK3 C;  3G3Z A;  4JYB A;  4ZKP A;  4EIJ A;  1GW3 A;  5L8R J;  2FKW B;  2RMZ A;  2XND H;  1MFT A;  1MFZ A;  1ZR2 A;  2E76 C;  5CCG A;  3D71 A;  3HRN A;  2OYI B;  3R4Y A;  2G3A A;  1FOS E;  1KIL D;  2HYN A;  1H0T A;  2BCC D;  3SFD C;  1LTJ C;  3L70 J;  1PIX A;  2FXP A;  2XZR A;  2AXT H;  1FOS F;  3FGA D;  1EZV G;  5AW8 B;  4RES B;  1N8R Q;  5AW1 B;  4IFM A;  2QJY B;  3TNU A;  2H8P D;  4W80 A;  5CCH D;  1URQ C;  2QRX A;  1BDC A;  1NWQ A;  3KQG A;  3KXD A;  3G6E P;  1M8O B;  3L74 J;  2Y9Z A;  2O3J A;  5AW9 B;  1SP4 A;  3GF3 A;  1N73 B;  1NYH A;  4KJM A;  2XDJ A;  1KC8 Q;  1WRG A;  3HE5 B;  4IL6 H;  2ZFC A;  1OIP A;  1EZV D;  4HB1 A;  1ZV8 A;  4XE5 B;  1GK6 A;  3VP9 A;  2KXP B;  1G2C B;  1BGY E;  1NU1 K;  3B5N A;  1CI6 B;  2K9Y A;  4OWF A;  3CXH E;  3L75 J;  2KZI A;  3AEG C;  1JM0 A;  3H1I G;  1R5L A;  3CCU P;  1N86 A;  3AE1 C;  1KYO H;  2J5U A;  3BAS A;  1P84 E;  1L2P A;  3W68 A;  3C8V A;  2V7Q J;  2UWJ E;  2E42 A;  1YJ9 P;  2M8R A;  2J58 A;  1OZH A;  3O6Q B;  4RO0 A;  2XU6 A;  5KLV J;  3HE4 A;  2A45 H;  3M0A A;  2KIK A;  2NRG A;  2W83 C;  1L4A A;  2QSI A;  3M06 A;  4EYY Q;  1VQP P;  4PD4 E;  2PFX A;  3AEA C;  5M1B A;  3W67 A;  3G71 P;  1VQ6 P;  3H1I D;  2OYH B;  5B66 E;  3CWB J;  3M0D A;  1AVY A;  1ZN5 A;  1VQM P;  3EWK A;  1IFJ A;  2KZJ A;  1EDL A;  1N7S C;  5AW6 B;  1MUU A;  2OTJ P;  3A0B E;  2I8D A;  1LT9 A;  2B9B A;  2QM7 A;  4QMA A;  2Y0D A;  3V4Q A;  3CX5 H;  1DD3 A;  1E79 H;  4H13 B;  1L0L J;  1L0N G;  4PV1 B;  1D7M A;  2K9J A;  3VN0 A;  1PP9 G;  1H89 A;  1NAY A;  2B88 A;  4DT0 A;  2Y0C A;  1YQ4 C;  3QWO C;  1FDO A;  3HD7 A;  3IAO A;  3LIE A;  1S5L H;  2CK3 H;  2PRR A;  4I1L A;  1LT1 A;  1NGM B;  1ZXG A;  1BSH A;  1JCD A;  1QX8 A;  2N1T D;  2ZXE B;  3TGU E;  4AYC A;  3PJS K;  1KIL E;  3AE4 C;  2BCC E;  2O01 N;  5GTI H;  1IZN B;  2AEM A;  1PP9 D;  2WSC J;  3AE5 C;  4R4M A;  3RK3 B;  2ZYG A;  3M9B A;  1RF0 A;  2YIU B;  2ZVN B;  1LP1 A;  1FZB A;  2WT7 B;  2R44 A;  1BE3 G;  3RK2 D;  3MHV A;  1E5W A;  1HWT C;  1RF1 A;  5APV A;  1J1E C;  3B4S A;  2QIW A;  3SWY A;  3RGU A;  2HPC B;  4TT3 H;  1KYO I;  1JMB A;  2E76 B;  3F89 A;  4IFD K;  4N78 D;  1G1J A;  4H44 C;  3TK1 A;  2E75 B;  1LTJ B;  1KB9 H;  4ZNC A;  2A45 I;  5GTH E;  4IFF A;  2E5Y A;  1LTG C;  1X79 B;  4H0L D;  1JUN A;  5CMZ A;  1EZV E;  1KFN A;  2OYI C;  1DH3 A;  4OGQ C;  4BRY B;  2D2C C;  1BE3 D;  2KSJ A;  1S9K D;  1KQS O;  2GA1 A;  1VQ7 P;  1SVF A;  1FZC A;  3Q3D A;  1GMJ A;  1BCC G;  3H32 A;  5EFW B;  2KB7 P;  5TJH A;  4D6T J;  1SQX G;  2Z4E A;  3AE8 C;  2QJY C;  3HTK B;  4LC1 A;  1EXI A;  1ZR4 A;  2FYU G;  1YTZ T;  1JY3 P;  3A7O A;  2IZ1 A;  3MTU E;  3AE9 C;  3CX5 I;  4YXW H;  1KQG B;  5H2F E;  1YHQ P;  2P10 A;  4L75 A;  4CPG A;  2H89 C;  1T3J A;  1N73 C;  1USE A;  2R32 A;  5KKZ C;  4PJ0 H;  1FZG A;  3L70 G;  1IC2 A;  4U3F J;  1BCC D;  1FAV A;  1OVU A;  3HE4 B;  1SQQ J;  1SQX D;  3H1I E;  3A2A A;  3SWF A;  1VL2 A;  1L4A B;  3L4F A;  4TLF A;  2FYU D;  1GW4 A;  2YO2 A;  3ABV C;  2Q3E A;  1RQU A;  2WSS H;  1S4X A;  2M3E A;  1DX7 A;  3AE3 C;  5AVU B;  1RHZ B;  1GD2 E;  3L74 G;  2O01 J;  1M7L A;  1VF5 D;  1KTM A;  1LT9 B;  3L70 D;  2O1J A;  2LXC B;  2WSE H;  3AEF C;  3WU2 E;  1L0N K;  1RE4 C;  2Z5I A;  1KIL A;  1M1K Q;  1PFI A;  3VOP A;  1FDM A;  2K9J B;  4I7Z C;  2G8Y A;  3AE6 C;  1LWU C;  2H7H A;  4U7J A;  1X8Y A;  3MIW A;  1T2K D;  3V2Q A;  3L74 D;  2QM8 A;  4WVZ A;  1AQT A;  5CCH A;  1XTC C;  1KB9 I;  2IBZ E;  2IFN A;  4DZO A;  2I1J A;  4WWI A;  1KFM A;  1SQP K;  2N9B A;  1K73 Q;  1DEE G;  2WSF J;  4WY4 D;  2AEF A;  2YKO A;  3Q5R A;  1PP9 E;  1HF9 A;  1PV3 A;  1EQ7 A;  2YXR B;  3F5H A;  4NPD A;  2RKL A;  2WSE J;  1JO5 A;  1NU1 D;  2OYO A;  1OMI A;  4WBA A;  2M3B A;  3VTP C;  3GHG A;  1FJP A;  1PGP A;  2YNY A;  3KYQ A;  1QEX A;  5KJ7 C;  2BEQ D;  2ZVO B;  4R4L A;  2WWW A;  1QL1 A;  1Q2N A;  2FFD A;  1YTZ I;  4N78 E;  2Q5U A;  1YIT P;  3ITK A;  1OW8 A;  1SQV G;  2P58 A;  2ITA A;  2POH A;  3H1K G;  1X0T A;  3L71 D;  1NTZ K;  4JYC A;  1FS0 E;  1S9K E;  4L74 A;  5CCG C;  2YMY A;  4W7Z A;  1JY3 O;  1YIJ P;  1M56 D;  1AQ5 A;  2A45 G;  2W6B A;  1NH4 A;  1J1E B;  2IYP A;  3H25 A;  3AEB C;  1VPC A;  3JC2 2;  1SQX K;  2YIU C;  5AW2 B;  3H1J G;  3H1H G;  1NTM G;  1SQB G;  3JCU H;  3BCC J;  2WIT A;  2FYU K;  1VQO P;  2H88 C;  1LTB C;  4H44 B;  1SQV D;  4YXD C;  3P8C D;  1SFC A;  3CXH H;  3H1K D;  3IN6 A;  1KYO D;  5KAI E;  2I1K A;  2IZ0 A;  2KK7 A;  3I5C A;  1SS1 A;  4OGQ B;  3BCC E;  2D2C B;  2IPP A;  2E75 C;  1QVG O;  2O1K A;  3D6Y A;  3EQ2 A;  3OJA B;  1PZQ A;  1SQX E;  3H1J D;  2WMM A;  1Y8A A;  3H1H D;  1NTM D;  1SQB D;  1Z56 A;  2FYU E;  1IFM A;  1U7J A;  2ZT9 C;  1IFP A;  1XTG B;  3TF5 A;  4JPZ B;  3B5N C;  2HFE D;  2IX7 C;  3Q1M A;  3KZI E;  4PD4 H;  3GMA A;  4YTP C;  2V7Q H;  1JY3 N;  1BGY J;  5KKZ B;  2HOD B;  2N1T A;  2LR2 A;  2H43 A;  3CX5 D;  2Q1K A;  3SSU A;  1LGH B;  2OGU A;  3S9O A;  4BXL A;  3NTN A;  4JQ0 D;  4L76 A;  4K3A A;  2OQQ A;  2CPS A;  2A06 E;  2L91 A;  2GM4 A;  4DJG A;  2E43 A;  1L4A C;  5KAF H;  5APY A;  2ZAE B;  1T8Z A;  1HJB A;  3TYY A;  3M0D C;  3P8M C;  4AQR D;  1PGJ A;  2KI7 B;  3M9H A;  1RQV A;  4GT1 A;  4UB6 E;  3CLQ A;  1DIP A;  3V2P A;  3Q5S A;  1LT9 C;  4H13 D;  1NU1 E;  3CCM P;  1OWA A;  1S3J A;  4I7Z B;  3L73 G;  4U3F G;  2AXT E;  1LWU B;  3OAK A;  1YJN P;  1ZRT E;  4RKU J;  1FZE A;  4Y99 C;  1NHL A;  1IO4 A;  1UII A;  3NFQ A;  3H1L J;  3CXH I;  4KHX A;  1SFC D;  1M1J A;  3FX0 A;  2MJZ A;  5AVQ B;  3UIA A;  4HKZ H;  3CI9 A;  5APU A;  1SQV K;  2ZJS E;  3M9Q A;  3HD7 C;  5TIS E;  3RL0 C;  1Q90 D;  3L71 E;  4A7P A;  1KB9 D;  2WSC H;  3H1L E;  4HH2 A;  1ZOY C;  3L73 D;  4U3F D;  2KNC A;  2J59 M;  3FWN A;  3MZW B;  3CD6 P;  2GUV A;  1BSN A;  3AEC C;  4EI2 A;  2YMK A;  3CPW O;  4I6M C;  3RK3 D;  1YBK A;  3T97 B;  1NTM K;  1SQB K;  3II6 A;  3TGU J;  4C7N B;  1R8E A;  2KP8 A;  2XNX A;  4PD4 I;  3D70 A;  2BCC J;  1RF0 C;  1NTK G;  3P8C E;  3VMX A;  2E74 C;  2E76 D;  2RH0 A;  1RF1 C;  1JTH A;  2M5A A;  1YQ3 C;  5APS A;  1SQP G;  1L0N D;  2NPS A;  3RBX A;  1T2K C;  1GL2 A;  1ZP0 C;  1H88 A;  2ZYA A;  3CME P;  1OW7 A;  1H0T B;  1KQL A;  5H2F H;  3H1H E;  1NTM E;  1SQB E;  3TSI A;  1NTK D;  1URQ D;  2C0W A;  1FZC C; 
#chains in the Genus database with same CATH homology
 2P58 A;  2KS1 B;  1U7M A;  4HKZ H;  1X0T A;  5CBN A;  1LP1 B;  2B88 A;  1BDD A;  2B89 A;  2KZI A;  3S1K A;  4MN4 C;  2K3R A;  2LR2 A;  1JM0 A;  2Q1K A;  3QWO C;  1MFT A;  5EFW B;  1FC2 C;  4GOF A;  1EDI A;  4BXL A;  3MZW B;  2M0B A;  1LT1 A;  2HR3 A;  3PH0 A;  1ZXG A;  4IOI H;  4K3A A;  4ZMD A;  2UWJ E;  1H0T A;  4HJG H;  2JWD A;  1OVV A;  2B87 A;  5DJU B;  3ZDM A;  4CPG A;  4WWI A;  5CBO A;  5K5G B;  4NPE A;  1DEE G;  2KUB A;  2ZAE B;  2KIK A;  4GOE A;  1EC5 A;  2SPZ A;  4EYY Q;  5DJT B;  4ASW A;  1SS1 A;  3FXE A;  4ASV A;  2LXB A;  1LP1 A;  1OVU A;  2B87 B;  2M5A A;  4NPD A;  2R44 A;  2RKL A;  2QRX A;  2KI7 B;  1BDC A;  3MHV A;  2OTK E;  4NPF X;  3FXD A;  1EDK A;  2KZJ A;  1EDL A;  3RGU A;  1S3J A;  4JBZ A;  4GOD A;  2WMM A;  1JMB A;  1EDJ A;  4KJM A;  2I8D A;  1H0T B;  1ZW0 A;  2M5A B;  1U7J A;  1Y47 A;  1OVR A;  5C39 A;  1NVO A;  1Q2N A;  4ZNC A;  2QVA A;  4HB1 A;  4K35 A;  2LXC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...