2Q6QA

Crystal structure of spc42p, a critical component of spindle pole body in budding yeast
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
62
structure length
62
Chain Sequence
QQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKLEDQNLNLQIKISDLEKKLSDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Spindle pole body component SPC42
publication title Analysis of coiled-coil interactions between core proteins of the spindle pole body.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 27
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 2q6qA00
3E1RA 3F5HA 4BRYA 3WUVA 2Q6QA 4BRYB 2WVRA 2ZXXA 3WUUA 3WUTA 1UIIA
chains in the Genus database with same CATH superfamily
3OA7A 3CC2P 3U59A 4IFFA 1IO4A 1KQLA 2XKMA 3L4FA 5APYA 4M3LA 3JSVC 3EFGA 1CW5A 2A06G 2OYIA 2M5AA 3HE5B 5APQA 3GHGB 1NTKD 3OAKA 1NTZD 3HRNA 1RE3A 1S72P 3B5ND 3AE7C 1ZP0C 3H1IE 1K73Q 3V2QA 1AA0A 2HODB 1LTGC 4GOFA 3Q1MA 3JCUE 4IL6X 1G2CB 1JY2P 3PJSK 3L73G 1DH3A 3AE5C 2O01N 3RL0C 5B5EH 1SQPD 2A06E 2W27A 3HUSC 1LWUA 1EDKA 2PAJA 1URQD 3CMEP 1ZW0A 3PP5A 1GZLA 3QH9A 5AW6B 1NGMB 1BE3J 1LTAC 3A0HE 2OQQA 2O1JA 1X8YA 1M90Q 1SQQE 2E74B 3L37A 5AVXB 1P84H 2P2UA 5GTIH 4I7ZB 1K8AQ 1CI6B 1AQTA 1WT6A 3H1HJ 3FWLA 2KK7A 1NH4A 4R4MA 2V7QH 1NJIQ 3HD7C 4H13C 2H43A 1P84I 2K9YA 1SQXG 4XE5B 1EZVD 1S2EA 1VQKP 2H7HA 1YTZI 2E76C 2E42A 1U7MA 1BCCG 2GUSA 3E1RA 3L71J 2YO2A 3L70G 1EDLA 3MD0A 3G4SP 4HJGH 2OYOA 5AW0B 5AW4B 1EDJA 1L0LK 4PD4I 2AXCA 2P7JA 1LP1A 4LC1A 3USSA 2WVRA 2E75B 1YJNP 1SQXE 1FC2C 4KJMA 3TSIA 1FZEA 1PGOA 2KIKA 4NPDA 5CCHC 1DX7A 1RHZB 2QJPC 4BRYA 4AUWA 1H0TA 1KILE 4L76A 1K05A 2V4HA 2K88A 5KAIH 3V4WA 3M9BA 4L73A 1S5LE 1VQ9P 1KMIZ 2N9YB 3KPEA 4OWFA 2LKMA 1OX3A 1LTJB 2K37A 2IBZG 4HH2A 1PGQA 2E74D 2NPSB 1T6AA 1CSBA 2KLVA 2YXRB 3ZDMA 1J1DB 1NYHA 4LGDE 4YTPC 3A5TA 3AE9C 1U7JA 1KB9I 3G9RA 4BRYB 1H0TB 2UWJE 5KKZB 2QG4A 1N73C 1MKMA 1YHQP 3TK1A 1KYOE 2D2CC 4IOIH 2XV5A 4PD4E 2JKVA 4YXDC 4ZKPA 3UIAA 3B8EB 4U7JA 1L4AC 3GF3A 3CL3D 5CBOA 2YXQB 1ZMEC 1OVRA 3H1ID 1G1JA 4BXLA 2E75D 3E1IA 3CI9A 4PV1C 5TISH 3IFMA 1KILB 2OYIC 4OVNF 3SFEC 5KJ7A 2IZ1A 4WY4A 5CJ0A 2Y9ZA 1JY3P 2MKVA 2KZIA 1RE3C 2K9JB 2AXTE 1SQXJ 3QWOC 3LW5H 2P58A 4UB8E 4DT0A 1MFTA 1NAFA 2YKQA 1VQ8P 1SQQD 2KB7P 3BASA 4DCKA 3LIDA 1QVGO 2WSEJ 1XTCC 2NPSD 1BCCJ 1LWUC 4JPZB 2WPQA 2GM4A 1RE4A 2I1JA 1RF1A 2N1TA 1NVOA 1KB9E 4D6TE 1BGYG 3BVHA 2M0BA 1GDTA 1M56D 1FS0E 3G71P 2E75C 1WRGA 2O3JA 2YKOA 1YQ4C 2KS1A 3SWKA 2YMYA 3CCJP 2HPCA 2E43A 1HJ0A 4LLHA 1EQ7A 1PZQA 2IX7C 1FZFA 4JF7A 1AVYA 3L74G 2A45H 2Z5IA 4H44C 4Y28J 1SQXD 3GMAA 3CCLP 2BCCG 1FOSF 4ZNCA 1IK7A 2Z5HA 4ZKUA 1SFCA 1KZUB 1EZVI 3WUTA 1KILD 2FY8A 3H1KE 1L0ND 3TGUG 3D6ZA 1M1KQ 5K5GB 1E5WA 1J1DC 2ZT9B 2R5BA 5AVYB 1S3JA 1NTME 5B66E 2IZ0A 3AEAC 4MN4C 1M8OB 3L74E 2HR3A 1SQBE 2W8ZA 1IFPA 1ZRTE 2W6AA 1R5SA 5CHXA 1PP9E 5H2FE 1HH0A 3VYIA 2YIUB 3SFDC 4GOEA 3CCRP 2Q3EA 1NOHA 1PPJE 4WB4A 1H88A 2AEFA 1TU3F 2H89C 3WMM0 4L75A 1JUNA 1KYOD 1VL2A 3CWBG 3F89A 1KILC 3HUSB 3L72G 4PD4D 3CCSP 1GL2A 1LT1A 3RK3D 4D6TJ 1LT9A 2Y0DA 2Q1KA 1VDFA 2JDIH 1OW7A 4ZMDA 3CC7P 2C0XA 3FGAD 1NKZB 2PGDA 1EDIA 4AQRD 5CMZA 1QGKB 3WU2E 1ZR4A 3CXHE 1AV1A 1A02J 2NZ2A 3AE4C 1PFIA 2FYUG 3HD7B 1L0LG 4H13B 3RGUA 1BGYJ 2ZT9D 3PHLA 1FJPA 2OTLP 3JCUH 1LTIC 4A7PA 4PJ0E 2E76B 2JR8A 1GL2B 5KJ7C 4WY4C 2FFDA 1MZ9A 3AECC 1KD1Q 3EQ2A 2CPBA 5KLVE 1L2PA 1OIPA 2XDJA 1KB9D 1X0TA 3A0HH 3H1HE 4D6TD 3L74J 3CPWO 2WQYC 2BCCJ 4I2LC 4L74A 2KNCA 2C9LY 2QJPB 2QVAA 3NXSA 4R4LA 4RJTA 3RBXA 3TGUJ 1N7SA 2IYPA 3BATA 3M0DC 4ASWA 1RE4C 2OGUA 1RF1C 1KQSO 1M1JA 2N1TC 1JMBA 1FU1A 3L71E 3VP9A 4B86A 3BRVB 1KTMA 2N9BA 2BASA 4YXWH 3CCUP 1EXIA 4K35A 2P1JA 1NO4A 3H25A 3TNUB 1NTZK 2B89A 3H32A 3H1KD 5AW5B 5KLIC 2YIUC 2IPPA 1J1EC 1K04A 1NTMD 2E5TA 3HD7D 4H13D 1SQVG 4TLFA 2JJLA 5AW8B 3HTKA 1GK4A 1SQPK 5APSA 3H1LG 1SQBD 1N73B 2D2CB 1ZRTD 2OTJP 3CWBJ 4JBZA 3TYYA 2E76D 3L72J 1PP9D 1S5LH 1FZCA 1GL2D 1AFOA 1QL2A 4NPFX 1IFIA 4IFDK 2LXCB 5EFWB 2QEXP 2HFED 2IFMA 2L5GB 1OVVA 1L4AB 1PPJD 1USDA 3L36A 3F5HA 2FYZA 1VQ7P 2M8RA 4PV1B 5E79E 2AEMA 3LIEA 3MP7B 2OYIB 2M5AB 5CCHD 3SWYA 3CX5E 3L73E 1GTWA 2WPVB 5KLVJ 1JCCA 3FXDA 2Q5UA 1YI2P 3VMAA 1L0LJ 1LGHB 2IDBA 4EIJA 1BSHA 2JO1A 1KYOH 2QM7A 2KI7B 1NU1K 4PD4H 2Q6QA 1LWUB 2BEZF 1QLED 1FE6A 1GL2C 5KTBA 2MJZA 3CXHD 1KYOI 1Y47A 3P8MC 2FYUK 1Q90D 1LJ2A 5M1BA 5AVUB 1FAVA 1Z56A 1AVOA 5CCGA 3KZIE 1BE3D 1OMIA 1Q82Q 2D2CD 2C9NY 4JQ0D 2AXTH 4DZOA 5KLVD 1BCCE 1X9VA 1W2EA 3L70E 1HGVA 1L4AD 2Y0CA 3H1HD 1G1IA 3CLQA 4H44B 4UB8H 3CCEP 1ZR2A 2WITA 2VRSA 2NRGA 4DOJA 4Z1MH 2WTYA 2WSCJ 1SP4A 4PV1D 2B87A 3GLMA 1DEBA 4UB6E 1S1CX 3H1JG 2FFDC 3EWKA 1KC8Q 1T3JA 3O6QA 5AVSB 2O01H 1HJBA 1JTHA 2WT7A 1KB9H 2RN0A 1VQMP 1LP1B 4JYCA 3L71D 3IAOA 1OW6A 3CCQP 5AVWB 1DIPA 3H1LJ 5CJ4A 4IFMA 2I8DA 1YITP 3L73J 2IBZE 3KXDA 1N7SC 3KDPB 5C39A 2WWWA 2QM8A 4N6JA 1J2JB 3L75G 3NMDA 1SQVK 2B87B 1FZBA 3V2PA 4HKZH 3PRJA 5AW3B 2R3CA 2KUBA 2O1KA 3RK2C 2JWAA 2A06D 5B66H 2Q3IA 1RY3A 3VMZA 3D6YA 1SQQK 2FXMA 4H44D 5KAFE 3VMXA 2FXPA 1PIXA 1JO5A 5APWA 2PFXA 5H2FH 4U3FG 3S4RA 1IZNB 1FZCC 2G3AA 3CX5D 3L73D 4OH8B 4I1LA 3SSUA 3L70J 1FOSE 2XZRA 5APTA 3M06A 3BCCG 3K5BA 4CPGA 2W6BA 4EI2A 5DJTB 5APVA 1YQ3C 3D70A 1FDMA 1IFJA 4GIFA 2I1KA 4WY4B 3TDKA 3HE4A 3B4SA 1L0NG 5AW2B 3U1CA 3AE1C 1N2DC 2ZVNB 1UIXA 1VPCA 4IL6E 1S9KE 1RQUA 3WUUA 1BGYE 1UIIA 1JOCA 1EC5A 4GDOA 3WU2H 3L35A 3N4XA 3CXHH 1NTZG 2C0WA 3TF5A 1HGZA 2K1AA 2J5UA 1PV3A 2W6JH 1RF1B 2N1TB 1BCCD 3L70D 3AEBC 3WUVA 3CXHI 1M7LA 4PJ0H 4WBAA 1SQPG 5CCGC 2KS1B 2BCCE 2WMMA 2KLUA 2ZYDA 5KLIB 2HPCB 1H89A 4C7NA 1R8EA 4XA4A 3T97A 2XNDH 2PP6A 1J1EB 4C7RA 3TGUE 1JY3N 3D71A 2CK3H 3MIWA 3L75J 2R5DA 1OW8A 1SFCB 3PTZA 4EDFA 3FWNA 5AVQB 1YIJP 1N7LA 2IBZD 5KJ7D 1KFMA 1M57D 4WY4D 5GTHH 1MFZA 2W90A 1EZVG 2ZVOB 3VOPA 2HG5D 3B5NA 2A45G 4RO0A 2KZJA 3I56P 3H6PA 1USEA 1NU1G 3M91A 5BVZA 1HWTC 1HTLC 2LR2A 1ZXGA 4HB1A 1ZLLA 3CWBE 1URQA 1IFDA 3L72E 2N1TD 2G8YA 3BCCJ 4DJGA 3P7KA 1PGPA 3R2PA 2M3EA 3E7KA 3OW2O 2ZYAA 1OWAA 2R32A 1OXZA 4NPEA 1NU1E 1AJYA 1GU5A 1LT9B 1JM0A 2Y0EA 2ZJSE 3A7OA 4AYCA 1MUUA 3C8VA 1FJKA 5E79H 3CCMP 1HBWA 2FYUE 1L0LE 1JY3O 1FZGA 1NKNA 1SFCD 3CX5H 3GG2A 1NTZJ 2XNXA 4RKUJ 1URQB 2RMZA 2E5YA 3HE5A 3GHGA 3M0AA 1L0NK 5AVRB 5AW9B 1YJ9P 1GD2E 2RKLA 4Y99C 3CX5I 1VQLP 4H0LB 2KYVA 3LW5J 1S9KD 1SQPJ 2FYNB 1BGYD 4GODA 1IFNA 1KORA 2WPRA 2FFDB 1BDCA 4GT1A 1NTKK 3MUDA 1QEXA 4W80A 1NTMK 1XTGB 3I5CA 2CPSA 2P67A 3H1IG 3V2RA 1SQBK 1BDDA 1YTZT 1GMJA 3KZIH 4XFJA 2KNCB 3L74D 1SFCC 1E79H 2WSFJ 1RH5B 2BCCD 3P8CE 1N7SB 3AEGC 2WSEH 1M1JB 2DW3A 2LXBA 2QE7H 1CI6A 4OGQC 1FZAA 3AE8C 1K9MQ 1IK9A 2KP8A 1Y9BA 3TGUD 2QSIA 2Q7CA 1OVUA 1SQQG 3KHUA 1SQVE 4UB6H 2KSJA 1W2BO 1NU1J 2R3SA 3H1LE 3H32B 1FDIA 4JYBA 3S9OA 3Q5PA 5APXA 1KQGB 3B71A 3RK2B 2FKWB 1VQNP 2JP3A 1LNQA 3A0BE 2FXOA 3Q3DA 2JWDA 4W7ZA 2FYUJ 1JCDA 3MTUE 1HVVA 4H0LD 1YYCA 3HTKB 3M9QA 1WMKA 2M3BA 2OTKE 3CC4P 2GUVA 1FZCB 1SVFA 1QVFO 3V5BA 2IFNA 1LTSC 3AE6C 1SLQA 1S4XA 3CWBD 3FX0A 3VMYA 2QA4P 3L72D 2WZ7A 1NAYA 2IBZI 3B5NC 1LT9C 1N8RQ 3C1LA 3U1AA 5AVZB 3R4YA 3PLNA 1LTJA 3IF4A 5KLVK 1NU1D 2NPSA 1YBKA 1N7SD 2YO3A 1X22A 1URQC 1VQ6P 2AEJA 1LTBC 4N78E 2QJYC 3AEDC 5KAFH 2XU6A 4H0LC 1OZHA 2FYUD 1L0LD 2J58A 1GW3A 1ZV8A 4K3AA 2FYNC 1JMMA 1KQFB 1HUCA 5BU5A 1JY2N 3FXEA 5B5EE 3RK2D 3H1IJ 4W7YA 4WWIA 3RBZA 2R44A 4EOTA 2K3RA 2QIWA 2OYHA 1SQVJ 1W5CE 3A3YB 3I55P 3P32A 2KXPB 2YMKA 1KILA 1P84E 5GTIE 4C46A 3GHGC 1JB0J 3H1JE 2QJKB 3RL0g 3VN0A 1M1JC 1AQ5A 4IL6H 1IJDB 2K9JA 1SQQJ 2W83C 5TJHA 1MV8A 2KOGA 4RESB 1CZQA 1GK6A 2H88C 1R5LA 3G6EP 3O8ZA 4KT0J 3MUDC 3P8CD 3O6QB 2YNYA 3RK3E 1JTHB 2WT7B 3GW6A 3AEEC 2OYHB 1KV4A 1NHLA 3KQGA 2PRRA 3L75E 3W68A 4HYTB 3IN6A 1SQVD 3JC22 1D7MA 2E74C 2WPSA 5APUA 3V2NA 3H1LD 4I7ZC 1NWQA 2B9BA 1LTTC 4D6TG 1Q7YQ 1OFCX 3OJAB 5KAIE 1JY2O 1ZOYC 4O9BA 1VQOP 3S1KA 1RF0A 2ZXXA 3V6IA 5CCGD 2ZFCA 2GA1A 3M0DA 4U3FE 2QRXA 2H8PD 3AEFC 5AW7B 1Y8AA 1SQXK 4BWNA 3VP8A 5DJUB 3CMAP 2HYNA 2SPZA 3BCCE 1RQVA 3H1KG 2WSFH 1YJWP 3A2AA 1BSNA 1IFMA 3RK3B 1NTKG 3H1JJ 1VF5B 4YPCA 1NTMG 2IYOA 2WSSH 1T3UA 4Y99B 2V7QJ 1U57A 1L0NE 1Q2NA 4N78D 1SQBG 3CCVP 1QX8A 1DD3A 1LTJC 1VQ5P 1PP9G 3NFQA 3Q5RA 3IR9A 3HE4B 2NPSC 2A45I 4I6MC 2YKPA 5TISE 1HF9A 1NTKE 3HUSA 1T2KD 1PPJG 3MGNA 1NTZE 2QJKC 3M9HA 4EYYQ 3KYQA 1KN7A 3G3ZA 1A02F 2B88A 5KKZC 2JEEA 2KSEA 1SQPE 5AVVB 3MHVA 5BU8B 1P84D 3ABVC 1VQPP 4OGQB 3H1JD 2RH0A 1GU4A 3HD7A 2OYHC 1S5LX 2ITAA 2POHA 3BRTB 2FBWC 4GKGA 4WVZA 3RL0B 1Q86Q 1GW4A 4U3FJ 1EXJA 2ZYGA 3EFFK 2O01J 4C7NB 3T97B 1DD4A 1FDOA 1VF5D 2BEQD 1T2KC 3CD6P 4QMAA 3VTPC 1EZVE 1IC2A 2J59M 1BE3G 3L75D 1H8AA 2WSCH 3Q5SA 5CCHA 1ZN5A 3V4QA 5KLVG 1Q81Q 1QL1A 3GF7A 4KHXA 1KFNA 3H1HG 1L0NJ 3B5NB 3II6A 5CBNA 2Q9IA 3Q2YA 3W67A 1PL5A 1X79B 1FBMA 4N3YB 3N7NA 3NTNA 1BE3E 3H1KJ 1DEEG 5L8RJ 4TT3H 1NTKJ 2ZAEB 3TNUA 2P10A 3A0BH 2Y9YA 3RK3C 1NTMJ 4U3FD 3L71G 1SS1A 3MZWB 3ITKA 1VF5C 1JNMA 4ASVA 4OGQD 3AE3C 1SQBJ 2QJYB 3C9IA 2ZXEB 1RF0C 5AVTB 3SWFA 3AE2C 1N86A 2HLOA 1PP9J 3BCCD 2OARA 1N73A 1T8ZA 2HODA 3PH0A 3RL0D 1G2CA 1JEKA 5GTHE 1VQ4P 2L91A 2ZT9C 1PGJA 2Z4EA 5AW1B 1L4AA
chains in the Genus database with same CATH topology
3E1RA 3F5HA 4BRYA 3WUVA 2Q6QA 4BRYB 2WVRA 2ZXXA 3WUUA 3WUTA 1UIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E1R A;  3F5H A;  4BRY A;  3WUV A;  2Q6Q A;  4BRY B;  2WVR A;  2ZXX A;  3WUU A;  3WUT A;  1UII A; 
#chains in the Genus database with same CATH topology
 3OA7 A;  3CC2 P;  3U59 A;  4IFF A;  1IO4 A;  1KQL A;  2XKM A;  3L4F A;  5APY A;  4M3L A;  3JSV C;  3EFG A;  1CW5 A;  2A06 G;  2OYI A;  2M5A A;  3HE5 B;  5APQ A;  3GHG B;  1NTK D;  3OAK A;  1NTZ D;  3HRN A;  1RE3 A;  1S72 P;  3B5N D;  3AE7 C;  1ZP0 C;  3H1I E;  1K73 Q;  3V2Q A;  1AA0 A;  2HOD B;  1LTG C;  4GOF A;  3Q1M A;  3JCU E;  4IL6 X;  1G2C B;  1JY2 P;  3PJS K;  3L73 G;  1DH3 A;  3AE5 C;  2O01 N;  3RL0 C;  5B5E H;  1SQP D;  2A06 E;  2W27 A;  3HUS C;  1LWU A;  1EDK A;  2PAJ A;  1URQ D;  3CME P;  1ZW0 A;  3PP5 A;  1GZL A;  3QH9 A;  5AW6 B;  1NGM B;  1BE3 J;  1LTA C;  3A0H E;  2OQQ A;  2O1J A;  1X8Y A;  1M90 Q;  1SQQ E;  2E74 B;  3L37 A;  5AVX B;  1P84 H;  2P2U A;  5GTI H;  4I7Z B;  1K8A Q;  1CI6 B;  1AQT A;  1WT6 A;  3H1H J;  3FWL A;  2KK7 A;  1NH4 A;  4R4M A;  2V7Q H;  1NJI Q;  3HD7 C;  4H13 C;  2H43 A;  1P84 I;  2K9Y A;  1SQX G;  4XE5 B;  1EZV D;  1S2E A;  1VQK P;  2H7H A;  1YTZ I;  2E76 C;  2E42 A;  1U7M A;  1BCC G;  2GUS A;  3E1R A;  3L71 J;  2YO2 A;  3L70 G;  1EDL A;  3MD0 A;  3G4S P;  4HJG H;  2OYO A;  5AW0 B;  5AW4 B;  1EDJ A;  1L0L K;  4PD4 I;  2AXC A;  2P7J A;  1LP1 A;  4LC1 A;  3USS A;  2WVR A;  2E75 B;  1YJN P;  1SQX E;  1FC2 C;  4KJM A;  3TSI A;  1FZE A;  1PGO A;  2KIK A;  4NPD A;  5CCH C;  1DX7 A;  1RHZ B;  2QJP C;  4BRY A;  4AUW A;  1H0T A;  1KIL E;  4L76 A;  1K05 A;  2V4H A;  2K88 A;  5KAI H;  3V4W A;  3M9B A;  4L73 A;  1S5L E;  1VQ9 P;  1KMI Z;  2N9Y B;  3KPE A;  4OWF A;  2LKM A;  1OX3 A;  1LTJ B;  2K37 A;  2IBZ G;  4HH2 A;  1PGQ A;  2E74 D;  2NPS B;  1T6A A;  1CSB A;  2KLV A;  2YXR B;  3ZDM A;  1J1D B;  1NYH A;  4LGD E;  4YTP C;  3A5T A;  3AE9 C;  1U7J A;  1KB9 I;  3G9R A;  4BRY B;  1H0T B;  2UWJ E;  5KKZ B;  2QG4 A;  1N73 C;  1MKM A;  1YHQ P;  3TK1 A;  1KYO E;  2D2C C;  4IOI H;  2XV5 A;  4PD4 E;  2JKV A;  4YXD C;  4ZKP A;  3UIA A;  3B8E B;  4U7J A;  1L4A C;  3GF3 A;  3CL3 D;  5CBO A;  2YXQ B;  1ZME C;  1OVR A;  3H1I D;  1G1J A;  4BXL A;  2E75 D;  3E1I A;  3CI9 A;  4PV1 C;  5TIS H;  3IFM A;  1KIL B;  2OYI C;  4OVN F;  3SFE C;  5KJ7 A;  2IZ1 A;  4WY4 A;  5CJ0 A;  2Y9Z A;  1JY3 P;  2MKV A;  2KZI A;  1RE3 C;  2K9J B;  2AXT E;  1SQX J;  3QWO C;  3LW5 H;  2P58 A;  4UB8 E;  4DT0 A;  1MFT A;  1NAF A;  2YKQ A;  1VQ8 P;  1SQQ D;  2KB7 P;  3BAS A;  4DCK A;  3LID A;  1QVG O;  2WSE J;  1XTC C;  2NPS D;  1BCC J;  1LWU C;  4JPZ B;  2WPQ A;  2GM4 A;  1RE4 A;  2I1J A;  1RF1 A;  2N1T A;  1NVO A;  1KB9 E;  4D6T E;  1BGY G;  3BVH A;  2M0B A;  1GDT A;  1M56 D;  1FS0 E;  3G71 P;  2E75 C;  1WRG A;  2O3J A;  2YKO A;  1YQ4 C;  2KS1 A;  3SWK A;  2YMY A;  3CCJ P;  2HPC A;  2E43 A;  1HJ0 A;  4LLH A;  1EQ7 A;  1PZQ A;  2IX7 C;  1FZF A;  4JF7 A;  1AVY A;  3L74 G;  2A45 H;  2Z5I A;  4H44 C;  4Y28 J;  1SQX D;  3GMA A;  3CCL P;  2BCC G;  1FOS F;  4ZNC A;  1IK7 A;  2Z5H A;  4ZKU A;  1SFC A;  1KZU B;  1EZV I;  3WUT A;  1KIL D;  2FY8 A;  3H1K E;  1L0N D;  3TGU G;  3D6Z A;  1M1K Q;  5K5G B;  1E5W A;  1J1D C;  2ZT9 B;  2R5B A;  5AVY B;  1S3J A;  1NTM E;  5B66 E;  2IZ0 A;  3AEA C;  4MN4 C;  1M8O B;  3L74 E;  2HR3 A;  1SQB E;  2W8Z A;  1IFP A;  1ZRT E;  2W6A A;  1R5S A;  5CHX A;  1PP9 E;  5H2F E;  1HH0 A;  3VYI A;  2YIU B;  3SFD C;  4GOE A;  3CCR P;  2Q3E A;  1NOH A;  1PPJ E;  4WB4 A;  1H88 A;  2AEF A;  1TU3 F;  2H89 C;  3WMM 0;  4L75 A;  1JUN A;  1KYO D;  1VL2 A;  3CWB G;  3F89 A;  1KIL C;  3HUS B;  3L72 G;  4PD4 D;  3CCS P;  1GL2 A;  1LT1 A;  3RK3 D;  4D6T J;  1LT9 A;  2Y0D A;  2Q1K A;  1VDF A;  2JDI H;  1OW7 A;  4ZMD A;  3CC7 P;  2C0X A;  3FGA D;  1NKZ B;  2PGD A;  1EDI A;  4AQR D;  5CMZ A;  1QGK B;  3WU2 E;  1ZR4 A;  3CXH E;  1AV1 A;  1A02 J;  2NZ2 A;  3AE4 C;  1PFI A;  2FYU G;  3HD7 B;  1L0L G;  4H13 B;  3RGU A;  1BGY J;  2ZT9 D;  3PHL A;  1FJP A;  2OTL P;  3JCU H;  1LTI C;  4A7P A;  4PJ0 E;  2E76 B;  2JR8 A;  1GL2 B;  5KJ7 C;  4WY4 C;  2FFD A;  1MZ9 A;  3AEC C;  1KD1 Q;  3EQ2 A;  2CPB A;  5KLV E;  1L2P A;  1OIP A;  2XDJ A;  1KB9 D;  1X0T A;  3A0H H;  3H1H E;  4D6T D;  3L74 J;  3CPW O;  2WQY C;  2BCC J;  4I2L C;  4L74 A;  2KNC A;  2C9L Y;  2QJP B;  2QVA A;  3NXS A;  4R4L A;  4RJT A;  3RBX A;  3TGU J;  1N7S A;  2IYP A;  3BAT A;  3M0D C;  4ASW A;  1RE4 C;  2OGU A;  1RF1 C;  1KQS O;  1M1J A;  2N1T C;  1JMB A;  1FU1 A;  3L71 E;  3VP9 A;  4B86 A;  3BRV B;  1KTM A;  2N9B A;  2BAS A;  4YXW H;  3CCU P;  1EXI A;  4K35 A;  2P1J A;  1NO4 A;  3H25 A;  3TNU B;  1NTZ K;  2B89 A;  3H32 A;  3H1K D;  5AW5 B;  5KLI C;  2YIU C;  2IPP A;  1J1E C;  1K04 A;  1NTM D;  2E5T A;  3HD7 D;  4H13 D;  1SQV G;  4TLF A;  2JJL A;  5AW8 B;  3HTK A;  1GK4 A;  1SQP K;  5APS A;  3H1L G;  1SQB D;  1N73 B;  2D2C B;  1ZRT D;  2OTJ P;  3CWB J;  4JBZ A;  3TYY A;  2E76 D;  3L72 J;  1PP9 D;  1S5L H;  1FZC A;  1GL2 D;  1AFO A;  1QL2 A;  4NPF X;  1IFI A;  4IFD K;  2LXC B;  5EFW B;  2QEX P;  2HFE D;  2IFM A;  2L5G B;  1OVV A;  1L4A B;  1PPJ D;  1USD A;  3L36 A;  3F5H A;  2FYZ A;  1VQ7 P;  2M8R A;  4PV1 B;  5E79 E;  2AEM A;  3LIE A;  3MP7 B;  2OYI B;  2M5A B;  5CCH D;  3SWY A;  3CX5 E;  3L73 E;  1GTW A;  2WPV B;  5KLV J;  1JCC A;  3FXD A;  2Q5U A;  1YI2 P;  3VMA A;  1L0L J;  1LGH B;  2IDB A;  4EIJ A;  1BSH A;  2JO1 A;  1KYO H;  2QM7 A;  2KI7 B;  1NU1 K;  4PD4 H;  2Q6Q A;  1LWU B;  2BEZ F;  1QLE D;  1FE6 A;  1GL2 C;  5KTB A;  2MJZ A;  3CXH D;  1KYO I;  1Y47 A;  3P8M C;  2FYU K;  1Q90 D;  1LJ2 A;  5M1B A;  5AVU B;  1FAV A;  1Z56 A;  1AVO A;  5CCG A;  3KZI E;  1BE3 D;  1OMI A;  1Q82 Q;  2D2C D;  2C9N Y;  4JQ0 D;  2AXT H;  4DZO A;  5KLV D;  1BCC E;  1X9V A;  1W2E A;  3L70 E;  1HGV A;  1L4A D;  2Y0C A;  3H1H D;  1G1I A;  3CLQ A;  4H44 B;  4UB8 H;  3CCE P;  1ZR2 A;  2WIT A;  2VRS A;  2NRG A;  4DOJ A;  4Z1M H;  2WTY A;  2WSC J;  1SP4 A;  4PV1 D;  2B87 A;  3GLM A;  1DEB A;  4UB6 E;  1S1C X;  3H1J G;  2FFD C;  3EWK A;  1KC8 Q;  1T3J A;  3O6Q A;  5AVS B;  2O01 H;  1HJB A;  1JTH A;  2WT7 A;  1KB9 H;  2RN0 A;  1VQM P;  1LP1 B;  4JYC A;  3L71 D;  3IAO A;  1OW6 A;  3CCQ P;  5AVW B;  1DIP A;  3H1L J;  5CJ4 A;  4IFM A;  2I8D A;  1YIT P;  3L73 J;  2IBZ E;  3KXD A;  1N7S C;  3KDP B;  5C39 A;  2WWW A;  2QM8 A;  4N6J A;  1J2J B;  3L75 G;  3NMD A;  1SQV K;  2B87 B;  1FZB A;  3V2P A;  4HKZ H;  3PRJ A;  5AW3 B;  2R3C A;  2KUB A;  2O1K A;  3RK2 C;  2JWA A;  2A06 D;  5B66 H;  2Q3I A;  1RY3 A;  3VMZ A;  3D6Y A;  1SQQ K;  2FXM A;  4H44 D;  5KAF E;  3VMX A;  2FXP A;  1PIX A;  1JO5 A;  5APW A;  2PFX A;  5H2F H;  4U3F G;  3S4R A;  1IZN B;  1FZC C;  2G3A A;  3CX5 D;  3L73 D;  4OH8 B;  4I1L A;  3SSU A;  3L70 J;  1FOS E;  2XZR A;  5APT A;  3M06 A;  3BCC G;  3K5B A;  4CPG A;  2W6B A;  4EI2 A;  5DJT B;  5APV A;  1YQ3 C;  3D70 A;  1FDM A;  1IFJ A;  4GIF A;  2I1K A;  4WY4 B;  3TDK A;  3HE4 A;  3B4S A;  1L0N G;  5AW2 B;  3U1C A;  3AE1 C;  1N2D C;  2ZVN B;  1UIX A;  1VPC A;  4IL6 E;  1S9K E;  1RQU A;  3WUU A;  1BGY E;  1UII A;  1JOC A;  1EC5 A;  4GDO A;  3WU2 H;  3L35 A;  3N4X A;  3CXH H;  1NTZ G;  2C0W A;  3TF5 A;  1HGZ A;  2K1A A;  2J5U A;  1PV3 A;  2W6J H;  1RF1 B;  2N1T B;  1BCC D;  3L70 D;  3AEB C;  3WUV A;  3CXH I;  1M7L A;  4PJ0 H;  4WBA A;  1SQP G;  5CCG C;  2KS1 B;  2BCC E;  2WMM A;  2KLU A;  2ZYD A;  5KLI B;  2HPC B;  1H89 A;  4C7N A;  1R8E A;  4XA4 A;  3T97 A;  2XND H;  2PP6 A;  1J1E B;  4C7R A;  3TGU E;  1JY3 N;  3D71 A;  2CK3 H;  3MIW A;  3L75 J;  2R5D A;  1OW8 A;  1SFC B;  3PTZ A;  4EDF A;  3FWN A;  5AVQ B;  1YIJ P;  1N7L A;  2IBZ D;  5KJ7 D;  1KFM A;  1M57 D;  4WY4 D;  5GTH H;  1MFZ A;  2W90 A;  1EZV G;  2ZVO B;  3VOP A;  2HG5 D;  3B5N A;  2A45 G;  4RO0 A;  2KZJ A;  3I56 P;  3H6P A;  1USE A;  1NU1 G;  3M91 A;  5BVZ A;  1HWT C;  1HTL C;  2LR2 A;  1ZXG A;  4HB1 A;  1ZLL A;  3CWB E;  1URQ A;  1IFD A;  3L72 E;  2N1T D;  2G8Y A;  3BCC J;  4DJG A;  3P7K A;  1PGP A;  3R2P A;  2M3E A;  3E7K A;  3OW2 O;  2ZYA A;  1OWA A;  2R32 A;  1OXZ A;  4NPE A;  1NU1 E;  1AJY A;  1GU5 A;  1LT9 B;  1JM0 A;  2Y0E A;  2ZJS E;  3A7O A;  4AYC A;  1MUU A;  3C8V A;  1FJK A;  5E79 H;  3CCM P;  1HBW A;  2FYU E;  1L0L E;  1JY3 O;  1FZG A;  1NKN A;  1SFC D;  3CX5 H;  3GG2 A;  1NTZ J;  2XNX A;  4RKU J;  1URQ B;  2RMZ A;  2E5Y A;  3HE5 A;  3GHG A;  3M0A A;  1L0N K;  5AVR B;  5AW9 B;  1YJ9 P;  1GD2 E;  2RKL A;  4Y99 C;  3CX5 I;  1VQL P;  4H0L B;  2KYV A;  3LW5 J;  1S9K D;  1SQP J;  2FYN B;  1BGY D;  4GOD A;  1IFN A;  1KOR A;  2WPR A;  2FFD B;  1BDC A;  4GT1 A;  1NTK K;  3MUD A;  1QEX A;  4W80 A;  1NTM K;  1XTG B;  3I5C A;  2CPS A;  2P67 A;  3H1I G;  3V2R A;  1SQB K;  1BDD A;  1YTZ T;  1GMJ A;  3KZI H;  4XFJ A;  2KNC B;  3L74 D;  1SFC C;  1E79 H;  2WSF J;  1RH5 B;  2BCC D;  3P8C E;  1N7S B;  3AEG C;  2WSE H;  1M1J B;  2DW3 A;  2LXB A;  2QE7 H;  1CI6 A;  4OGQ C;  1FZA A;  3AE8 C;  1K9M Q;  1IK9 A;  2KP8 A;  1Y9B A;  3TGU D;  2QSI A;  2Q7C A;  1OVU A;  1SQQ G;  3KHU A;  1SQV E;  4UB6 H;  2KSJ A;  1W2B O;  1NU1 J;  2R3S A;  3H1L E;  3H32 B;  1FDI A;  4JYB A;  3S9O A;  3Q5P A;  5APX A;  1KQG B;  3B71 A;  3RK2 B;  2FKW B;  1VQN P;  2JP3 A;  1LNQ A;  3A0B E;  2FXO A;  3Q3D A;  2JWD A;  4W7Z A;  2FYU J;  1JCD A;  3MTU E;  1HVV A;  4H0L D;  1YYC A;  3HTK B;  3M9Q A;  1WMK A;  2M3B A;  2OTK E;  3CC4 P;  2GUV A;  1FZC B;  1SVF A;  1QVF O;  3V5B A;  2IFN A;  1LTS C;  3AE6 C;  1SLQ A;  1S4X A;  3CWB D;  3FX0 A;  3VMY A;  2QA4 P;  3L72 D;  2WZ7 A;  1NAY A;  2IBZ I;  3B5N C;  1LT9 C;  1N8R Q;  3C1L A;  3U1A A;  5AVZ B;  3R4Y A;  3PLN A;  1LTJ A;  3IF4 A;  5KLV K;  1NU1 D;  2NPS A;  1YBK A;  1N7S D;  2YO3 A;  1X22 A;  1URQ C;  1VQ6 P;  2AEJ A;  1LTB C;  4N78 E;  2QJY C;  3AED C;  5KAF H;  2XU6 A;  4H0L C;  1OZH A;  2FYU D;  1L0L D;  2J58 A;  1GW3 A;  1ZV8 A;  4K3A A;  2FYN C;  1JMM A;  1KQF B;  1HUC A;  5BU5 A;  1JY2 N;  3FXE A;  5B5E E;  3RK2 D;  3H1I J;  4W7Y A;  4WWI A;  3RBZ A;  2R44 A;  4EOT A;  2K3R A;  2QIW A;  2OYH A;  1SQV J;  1W5C E;  3A3Y B;  3I55 P;  3P32 A;  2KXP B;  2YMK A;  1KIL A;  1P84 E;  5GTI E;  4C46 A;  3GHG C;  1JB0 J;  3H1J E;  2QJK B;  3RL0 g;  3VN0 A;  1M1J C;  1AQ5 A;  4IL6 H;  1IJD B;  2K9J A;  1SQQ J;  2W83 C;  5TJH A;  1MV8 A;  2KOG A;  4RES B;  1CZQ A;  1GK6 A;  2H88 C;  1R5L A;  3G6E P;  3O8Z A;  4KT0 J;  3MUD C;  3P8C D;  3O6Q B;  2YNY A;  3RK3 E;  1JTH B;  2WT7 B;  3GW6 A;  3AEE C;  2OYH B;  1KV4 A;  1NHL A;  3KQG A;  2PRR A;  3L75 E;  3W68 A;  4HYT B;  3IN6 A;  1SQV D;  3JC2 2;  1D7M A;  2E74 C;  2WPS A;  5APU A;  3V2N A;  3H1L D;  4I7Z C;  1NWQ A;  2B9B A;  1LTT C;  4D6T G;  1Q7Y Q;  1OFC X;  3OJA B;  5KAI E;  1JY2 O;  1ZOY C;  4O9B A;  1VQO P;  3S1K A;  1RF0 A;  2ZXX A;  3V6I A;  5CCG D;  2ZFC A;  2GA1 A;  3M0D A;  4U3F E;  2QRX A;  2H8P D;  3AEF C;  5AW7 B;  1Y8A A;  1SQX K;  4BWN A;  3VP8 A;  5DJU B;  3CMA P;  2HYN A;  2SPZ A;  3BCC E;  1RQV A;  3H1K G;  2WSF H;  1YJW P;  3A2A A;  1BSN A;  1IFM A;  3RK3 B;  1NTK G;  3H1J J;  1VF5 B;  4YPC A;  1NTM G;  2IYO A;  2WSS H;  1T3U A;  4Y99 B;  2V7Q J;  1U57 A;  1L0N E;  1Q2N A;  4N78 D;  1SQB G;  3CCV P;  1QX8 A;  1DD3 A;  1LTJ C;  1VQ5 P;  1PP9 G;  3NFQ A;  3Q5R A;  3IR9 A;  3HE4 B;  2NPS C;  2A45 I;  4I6M C;  2YKP A;  5TIS E;  1HF9 A;  1NTK E;  3HUS A;  1T2K D;  1PPJ G;  3MGN A;  1NTZ E;  2QJK C;  3M9H A;  4EYY Q;  3KYQ A;  1KN7 A;  3G3Z A;  1A02 F;  2B88 A;  5KKZ C;  2JEE A;  2KSE A;  1SQP E;  5AVV B;  3MHV A;  5BU8 B;  1P84 D;  3ABV C;  1VQP P;  4OGQ B;  3H1J D;  2RH0 A;  1GU4 A;  3HD7 A;  2OYH C;  1S5L X;  2ITA A;  2POH A;  3BRT B;  2FBW C;  4GKG A;  4WVZ A;  3RL0 B;  1Q86 Q;  1GW4 A;  4U3F J;  1EXJ A;  2ZYG A;  3EFF K;  2O01 J;  4C7N B;  3T97 B;  1DD4 A;  1FDO A;  1VF5 D;  2BEQ D;  1T2K C;  3CD6 P;  4QMA A;  3VTP C;  1EZV E;  1IC2 A;  2J59 M;  1BE3 G;  3L75 D;  1H8A A;  2WSC H;  3Q5S A;  5CCH A;  1ZN5 A;  3V4Q A;  5KLV G;  1Q81 Q;  1QL1 A;  3GF7 A;  4KHX A;  1KFN A;  3H1H G;  1L0N J;  3B5N B;  3II6 A;  5CBN A;  2Q9I A;  3Q2Y A;  3W67 A;  1PL5 A;  1X79 B;  1FBM A;  4N3Y B;  3N7N A;  3NTN A;  1BE3 E;  3H1K J;  1DEE G;  5L8R J;  4TT3 H;  1NTK J;  2ZAE B;  3TNU A;  2P10 A;  3A0B H;  2Y9Y A;  3RK3 C;  1NTM J;  4U3F D;  3L71 G;  1SS1 A;  3MZW B;  3ITK A;  1VF5 C;  1JNM A;  4ASV A;  4OGQ D;  3AE3 C;  1SQB J;  2QJY B;  3C9I A;  2ZXE B;  1RF0 C;  5AVT B;  3SWF A;  3AE2 C;  1N86 A;  2HLO A;  1PP9 J;  3BCC D;  2OAR A;  1N73 A;  1T8Z A;  2HOD A;  3PH0 A;  3RL0 D;  1G2C A;  1JEK A;  5GTH E;  1VQ4 P;  2L91 A;  2ZT9 C;  1PGJ A;  2Z4E A;  5AW1 B;  1L4A A; 
#chains in the Genus database with same CATH homology
 3E1R A;  3F5H A;  4BRY A;  3WUV A;  2Q6Q A;  4BRY B;  2WVR A;  2ZXX A;  3WUU A;  3WUT A;  1UII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...