2Q6QA

Crystal structure of spc42p, a critical component of spindle pole body in budding yeast
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
62
structure length
62
Chain Sequence
QQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKLEDQNLNLQIKISDLEKKLSDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spindle pole body component SPC42
publication title Analysis of coiled-coil interactions between core proteins of the spindle pole body.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 27
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 2q6qA00
1UIIA 3WUVA 3E1RA 2WVRA 2Q6QA 3F5HA 4BRYB 3WUUA 4BRYA 3WUTA 2ZXXA
chains in the Genus database with same CATH superfamily
1FC2C 3RK3C 1RF0C 1SP4A 3SWFA 1SQVE 2PRRA 2WSEH 5APWA 2E5TA 3AEAC 4H13D 3AE1C 2JWAA 1SLQA 2KXPB 2O3JA 4JPZB 2K1AA 1KV4A 4Z1MH 4ZMDA 2Z5IA 3V6IA 1N7SA 1TU3F 3VMYA 2E42A 4NPEA 2WSEJ 1VQKP 2ZYAA 3FX0A 1PP9D 4PV1D 2QM8A 2KNCA 3AE5C 3V4WA 4RJTA 1YYCA 1SQVK 1SS1A 4WY4D 3CX5I 1VF5D 5M1BA 2M3EA 3PLNA 3S9OA 3WU2E 2E74C 1L0ND 1N86A 3CC2P 3H1HG 3V2RA 1BCCD 5TISH 3TK1A 1P84D 4WVZA 1BDCA 1PFIA 4YXWH 3V5BA 1NO4A 1KILC 4U3FD 1PGQA 2E76C 4IFFA 1KYOI 2WMMA 3ZDMA 4C7NA 2FFDB 1VQ6P 4TT3H 3RK2C 5AVWB 2OTKE 3GF7A 4C46A 1JMBA 2N1TA 1EDIA 5AVQB 1RF0A 1GDTA 1IFNA 2QA4P 2B9BA 1H8AA 2YO3A 3L74G 4EOTA 4B86A 3H1HE 2ZFCA 1J1DB 2HPCB 2IYOA 3TYYA 1S4XA 5KLIC 3CMAP 2O01H 2YNYA 2L5GB 1JY3O 3Q5PA 1FZFA 1G1IA 4IOIH 2WPSA 4MN4C 1ZLLA 1URQD 1CW5A 3TGUD 1NTMD 4H0LC 3P8CD 2E43A 3HE4A 2GM4A 3F89A 2I1KA 4HH2A 2O01J 1RY3A 2YKPA 4I7ZC 1Q7YQ 2M0BA 5AW8B 3L74E 2N9BA 1Y8AA 3VMZA 3P8MC 1T3UA 1H89A 3C8VA 4AUWA 1AVYA 1SQBJ 3IFMA 5TJHA 3CWBG 1CI6A 3CCRP 3B5ND 1KILA 3CC4P 2FYNB 3CI9A 2FBWC 2IFNA 3JCUE 1AQ5A 4D6TJ 1AVOA 1DD3A 5AW2B 3LIEA 3KYQA 1SFCD 5AVYB 2Y0EA 5BU5A 3Q1MA 3H1LG 2CPBA 2FYUD 2OTJP 3RBXA 2G3AA 3HTKB 3AE2C 3L4FA 1FZBA 1SQQK 2KI7B 2WT7A 5GTHE 2KZIA 3H1JD 1NTZG 3A0BH 3CWBE 1FS0E 3H1KJ 3B71A 1NU1D 3HE5A 5CCHC 2AEJA 2Y0CA 2CPSA 2D2CB 3SSUA 1WRGA 1P84I 1BE3D 3B8EB 4HJGH 3T97A 1SQXD 3WUVA 1YI2P 3H1LE 1OIPA 4WY4B 3NMDA 1SQQJ 3A2AA 4YTPC 4IL6X 1L0NJ 2HODA 1U7MA 1VQ8P 1BCCJ 3OJAB 3H1IJ 3CCQP 3KDPB 3PP5A 2FFDC 1NTZE 3L71G 3RK3E 4U3FJ 1KQGB 1VQ9P 5CBOA 2WSFH 3U1AA 3AEFC 2G8YA 2WPVB 3L75D 1FDMA 5APUA 4XA4A 3OA7A 1J1DC 1D7MA 4LLHA 1EZVG 1SQPD 1GL2A 1NWQA 4IL6H 2NPSB 2WSFJ 3AEDC 3BRVB 3M0DA 3AEEC 1A02J 3MD0A 1NTZK 1G2CB 3M06A 4GOEA 5E79H 2XNXA 5KTBA 3L71E 2JJLA 4H44D 5AVZB 3HUSA 1LGHB 1MFTA 1BSHA 1RF1B 4OH8B 3TGUJ 1NAYA 3KZIH 2HLOA 1NTMJ 5KAFE 1MKMA 5APYA 2H43A 4JF7A 2WSSH 1EZVE 3EQ2A 1OFCX 1ZR4A 1KILE 5GTIE 3JSVC 3MUDA 2W8ZA 1USDA 2H8PD 3O6QA 2W6AA 2FYNC 3Q5RA 1ZN5A 1BGYD 2P10A 2R3SA 2FFDA 2ZYDA 3P32A 5APTA 3HD7B 1YBKA 1S9KD 3B5NB 1HVVA 1IZNB 3L70G 2DW3A 3EFGA 2HYNA 5KLVG 1ZV8A 2WSCH 1SFCB 2HR3A 1PGPA 2Q1KA 2J5UA 1J1EB 5B5EH 2FYUJ 1KB9E 1AQTA 1U7JA 3A0HE 2XV5A 1SQVD 3MP7B 2D2CC 1N73B 2LKMA 3I5CA 2WSCJ 1BDDA 4HKZH 2IYPA 1W5CE 2AXTH 2C9NY 2K3RA 1U57A 2KUBA 3RBZA 1QX8A 3L70E 4WY4C 1L0LG 1JTHA 4L76A 4PD4E 4DT0A 5AW9B 1RE4A 1BE3J 5KLVE 1YTZI 4OGQD 1SQXJ 2P58A 2L91A 3GMAA 2YXQB 2OYIA 1PGJA 2R44A 1LP1B 1EDLA 1S5LE 1AJYA 1KFMA 1SQPK 3SWYA 1OVUA 3CXHI 3M9QA 1JY2O 1GD2E 5KJ7C 2MKVA 1YITP 3BCCJ 2WPQA 4KHXA 1L0LE 1MV8A 5KLVK 3TSIA 2JKVA 1OVVA 2NPSC 2JEEA 1JY2N 3HTKA 2V7QH 4QMAA 2H7HA 2BEQD 1SQPJ 2W83C 4L75A 3GHGB 4I1LA 1J2JB 4CPGA 2HFED 3I56P 4W7YA 2Y9ZA 2K9JB 2B87A 2R32A 1RF1C 4D6TD 3L35A 1DH3A 1ZMEC 2XDJA 3H1HD 2YMKA 2V7QJ 3A5TA 3AE9C 1L0LK 3AECC 1PIXA 1HH0A 1M56D 2ITAA 3CX5E 1GW4A 5DJUB 1PL5A 3RGUA 3H1KD 4NPDA 3ITKA 2QE7H 1LT9C 3NFQA 1KN7A 3HD7C 1KQFB 3G3ZA 1IFPA 1NKNA 1IFDA 3PHLA 1BGYJ 2QSIA 2J59M 3CCLP 3L73G 1SFCC 1KYOE 1SQQD 5KJ7A 3R2PA 4GOFA 1L4AA 1SQBG 4ASVA 3WMM0 1J1EC 1LTJA 1K73Q 1Y9BA 1QL1A 3V2NA 3H1ID 2NPSA 2QRXA 1N73C 1XTGB 1QEXA 3CD6P 2FXOA 3D6YA 2KB7P 4A7PA 1N7SD 2KS1A 3VMXA 1LTBC 1SQVJ 2Q7CA 5AVRB 1YQ4C 3D71A 5APVA 3CCVP 1IC2A 1X8YA 1NTKG 4UB6E 3QH9A 2C9LY 3L73E 5CCGC 1ZRTE 2MJZA 3WUTA 1SQBE 2ZJSE 2A06G 1YHQP 3H32A 3SFEC 2E75D 1PP9G 1YTZT 3WU2H 4K35A 4GDOA 1HGVA 5AW5B 5KAIE 4K3AA 1K05A 4BXLA 3H1LD 2WVRA 2QG4A 3FXEA 5CBNA 1LT9A 2PGDA 3MHVA 1NTKE 1T8ZA 1K9MQ 1JY3N 1LTTC 1IFJA 1BCCG 2CK3H 4BRYA 1FZGA 3MTUE 1NTZD 2N1TD 2A06E 1CSBA 1VQNP 3RK3D 1JO5A 2HG5D 3GHGC 1PP9E 1FJKA 4GT1A 4LC1A 3KQGA 1R5SA 2IDBA 1ZP0C 4ZKPA 1JNMA 1LJ2A 1M90Q 1FE6A 4IFMA 1NTKK 4XE5B 4AYCA 3H1HJ 1HTLC 2GUSA 3S1KA 1BCCE 2Z5HA 3M9BA 5CCGA 3EWKA 1P84E 4H13B 2BCCD 1VQ4P 1NJIQ 3G6EP 4TLFA 5AVTB 1LP1A 3N4XA 1NYHA 5B66E 3TGUG 2E74D 3FWNA 3H25A 1N2DC 5AW4B 1LWUB 3VOPA 3MZWB 2K37A 4PV1B 2NZ2A 1HBWA 1KILD 1KZUB 3V4QA 2E76D 3B4SA 5AW7B 3TNUB 1VQ5P 3L74J 1H0TB 2QJYB 5H2FE 1KORA 2Q3EA 1HF9A 3JCUH 1HJ0A 1VF5B 1KMIZ 3CCEP 1RH5B 2OGUA 1E5WA 3RK2D 1X0TA 3AE4C 1MUUA 2KP8A 1GU5A 3AE8C 1JOCA 5AVUB 4PJ0E 1BSNA 4GKGA 3TGUE 2M5AB 2RKLA 2ZVNB 5K5GB 3P8CE 2QM7A 1VQLP 3BCCD 5GTHH 3GW6A 4YPCA 1NKZB 1N7SB 2SPZA 4M3LA 1KB9D 2GA1A 5AW3B 3L72G 2KNCB 2Q5UA 2M3BA 1QVGO 4H0LD 3QWOC 1JEKA 1OW7A 3H1JG 3IAOA 2PAJA 5CJ0A 1NU1G 1UIXA 2E75B 3M91A 1OZHA 5KLVD 1BE3G 3BVHA 3S4RA 4WBAA 2YO2A 2JDIH 1FOSE 1SQXG 1URQB 4UB8E 3GF3A 5CCHA 3H1LJ 4ZKUA 2LR2A 3HRNA 3NXSA 1QVFO 3A3YB 4C7NB 3L72E 3PJSK 4W7ZA 1DEEG 4DCKA 1GU4A 2OTLP 1PZQA 2QJPB 3RL0D 1M1JB 1NTZJ 3H1JE 2N1TB 2OQQA 2JWDA 4L74A 4EYYQ 1T3JA 3KXDA 1NU1E 2W6BA 1GL2D 4DOJA 5APQA 1AV1A 1L0LD 1VPCA 1KQSO 1OVRA 2ZXXA 1YIJP 3AE7C 1FDOA 1BE3E 3L75G 3MGNA 2OYOA 3W68A 1SQXE 2IBZD 3R4YA 1HWTC 1Z56A 2JP3A 4H13C 1IK9A 3TF5A 1FBMA 4WWIA 1Q90D 2ZVOB 1SVFA 5KAFH 1ZR2A 3G71P 5AVVB 3D6ZA 2RH0A 3HE4B 2HPCA 1EXJA 1N8RQ 2B89A 3L71J 2FYZA 1MFZA 1LWUC 5AW6B 2BCCJ 3M0AA 3CC7P 1JY2P 4PV1C 1KC8Q 4EI2A 5GTIH 1NAFA 4N3YB 2BASA 2I8DA 3L75E 1X22A 2XNDH 2QJYC 2YKQA 1R5LA 3W67A 2P7JA 1VF5C 1Q86Q 1CI6B 4AQRD 3CXHE 4IFDK 2ZXEB 1PPJG 2H88C 2QVAA 1VQMP 4N78E 3V2PA 3E1RA 2Y0DA 1M57D 1QLED 1BGYG 1UIIA 1FZAA 1KYOD 1N7SC 2JO1A 2IZ0A 2WZ7A 1KB9H 3CLQA 1X9VA 1LTGC 3PRJA 5KKZB 2WT7B 1S5LX 1DIPA 1YJNP 1XTCC 2YKOA 4KJMA 1NH4A 2FY8A 1VQ7P 4R4LA 3HE5B 1RQVA 1PPJE 5APSA 2P67A 2ZAEB 1GMJA 3KHUA 2AEFA 4PD4H 3A7OA 5AW1B 4RO0A 2E75C 3SFDC 2FXPA 3T97B 3FGAD 3G9RA 1VL2A 1S72P 3L73D 1ZRTD 4XFJA 1LWUA 1URQC 2WTYA 3L70J 3EFFK 1S5LH 1GK4A 1EC5A 2HODB 1Q2NA 3FXDA 4I2LC 4H44B 2A45I 1IJDB 5KLVJ 1GW3A 1DEBA 1AA0A 5AVSB 2PP6A 2A45H 2QJPC 4WY4A 1M1JC 2N1TC 2O1JA 1JCCA 3CCSP 3U1CA 2P1JA 2IBZI 1T2KD 1IFMA 5TISE 2KSJA 4GODA 4N6JA 3RL0B 1NTKD 2XKMA 2M5AA 1ZOYC 3B5NC 3N7NA 1GL2B 1DX7A 1L0LJ 2A06D 5L8RJ 3L74D 1LT1A 1JCDA 3SWKA 2D2CD 2P2UA 3VMAA 2KLUA 1WMKA 2FXMA 1YJ9P 1PV3A 3HUSB 2YIUB 2C0WA 4W80A 1JY3P 2N9YB 1JM0A 4L73A 4D6TG 1G2CA 1RQUA 3CX5H 2FKWB 3E7KA 1RF1A 1URQA 5CJ4A 4HYTB 3O6QB 1M7LA 2VRSA 2V4HA 1FZCB 3FWLA 4OWFA 3CWBD 1NOHA 3H1KG 1Y47A 2H89C 5KJ7D 1KYOH 1L4AD 3GLMA 5BU8B 1M1JA 4OGQB 1USEA 2ZT9D 2KIKA 4U7JA 1FDIA 3U59A 3UIAA 3GG2A 2R3CA 3D70A 4D6TE 1GTWA 4JQ0D 2NPSD 5KKZC 4NPFX 3V2QA 1DD4A 3WUUA 1JUNA 1SQQG 3HD7A 3B5NA 1FZEA 2RMZA 2XZRA 1HUCA 1K8AQ 1L0NG 4JBZA 1SQBK 1NVOA 3H1IG 2AEMA 2LXBA 1SFCA 4KT0J 3H1KE 4UB6H 4U3FG 1VDFA 1JTHB 1S1CX 1Q82Q 4Y28J 4HB1A 1N73A 5C39A 3AEBC 4RKUJ 5AVXB 4H44C 2OYHB 3A0BE 1GK6A 3NTNA 5KAIH 2KLVA 3L73J 1M1KQ 1YJWP 5CHXA 2OYIB 1SQQE 4ZNCA 2YXRB 2QJKB 2Y9YA 3VP8A 1L0NE 2IFMA 1OXZA 3HD7D 1JMMA 3BRTB 1VQOP 3H1IE 2UWJE 3CCUP 1H88A 3L71D 3PTZA 1E79H 2NRGA 3RL0C 3MIWA 4U3FE 2K9YA 2KSEA 1L2PA 1EQ7A 2XU6A 2QIWA 2B88A 1M8OB 1GL2C 1NGMB 1NTMG 1MZ9A 1YQ3C 3KPEA 3RL0g 1HJBA 3M0DC 1NTKJ 3L72D 4YXDC 2ZYGA 3VYIA 1EZVD 4Y99B 1L0NK 2OARA 3HUSC 2B87B 1FU1A 2YIUC 3II6A 4BWNA 3CCMP 1PP9J 1EXIA 1R8EA 1EDKA 5DJTB 5CCGD 2R5BA 4IL6E 1P84H 4LGDE 3GHGA 1CZQA 3Q3DA 3IR9A 2RN0A 1NTME 2K9JA 3MUDC 5E79E 3K5BA 1K04A 2AXCA 2BEZF 5B66H 4DZOA 4C7RA 3C1LA 1FZCC 1KD1Q 1W2EA 2FYUG 1OW6A 3KZIE 3IF4A 1FAVA 4GIFA 1N7LA 2O1KA 2BCCG 4OGQC 1NHLA 5H2FH 2JR8A 3CWBJ 2GUVA 3VP9A 3CCJP 4DJGA 3Q5SA 1IO4A 1L4AB 3L70D 1A02F 1NTMK 4PD4D 2ZT9B 1ZXGA 4EIJA 1LTJB 3O8ZA 3CXHD 2IX7C 2KOGA 1OX3A 4PJ0H 1AFOA 4N78D 3AE3C 1QL2A 1GZLA 2POHA 3IN6A 1FJPA 2I1JA 3M9HA 2KZJA 2FYUE 2W6JH 2KS1B 2KYVA 3CL3D 2J58A 3VTPC 3LW5H 2BCCE 3LIDA 1RE4C 1Q81Q 2K88A 3JC22 4WB4A 3RK3B 2OYHC 5B5EE 1LTIC 3BCCG 2Q3IA 2OYIC 3H32B 2KK7A 3LW5J 1PPJD 1G1JA 2QJKC 1LNQA 3BASA 3USSA 1KFNA 2FYUK 2AXTE 3AEGC 2LXCB 1WT6A 1SQPG 5CCHD 1FZCA 1IK7A 4UB8H 1RHZB 1S2EA 3PH0A 1LT9B 2WQYC 1FOSF 1VQPP 1EZVI 2WPRA 1ZW0A 1T2KC 1NU1K 1LTSC 1HGZA 2IZ1A 3C9IA 1RE3C 4BRYB 1X79B 3H6PA 3BCCE 3BATA 5EFWB 1S3JA 4Y99C 4R4MA 2E74B 1JB0J 1SQXK 3L36A 3CX5D 1W2BO 3L72J 1LTAC 3OAKA 2W27A 4EDFA 2M8RA 1SQPE 1KILB 5CMZA 3H1JJ 2E76B 3VN0A 3P7KA 3ABVC 2A45G 1NU1J 3CMEP 3AE6C 3RK2B 1KB9I 3F5HA 3I55P 1OWAA 4OVNF 2OYHA 3A0HH 1OMIA 1OW8A 2IBZG 1IFIA 1T6AA 1EDJA 3TDKA 2WWWA 3E1IA 2C0XA 5BVZA 2R5DA 2Q6QA 4ASWA 5KLIB 4PD4I 3Q2YA 4I6MC 2QEXP 2Z4EA 2Q9IA 5AW0B 1SQVG 3CXHH 2E5YA 1L4AC 2YMYA 2ZT9C 3L37A 1LTJC 4H0LB 1BGYE 1KQLA 4JYCA 5APXA 2WITA 3G4SP 3OW2O 3L75J 1PGOA 3CPWO 1S9KE 4O9BA 1SQBD 2PFXA 1RE3A 4I7ZB 2IBZE 1QGKB 2O01N 4JYBA 2IPPA 1KTMA 3TNUA 1H0TA 2W90A 4RESB
chains in the Genus database with same CATH topology
1UIIA 3WUVA 3E1RA 2WVRA 2Q6QA 3F5HA 4BRYB 3WUUA 4BRYA 3WUTA 2ZXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UII A;  3WUV A;  3E1R A;  2WVR A;  2Q6Q A;  3F5H A;  4BRY B;  3WUU A;  4BRY A;  3WUT A;  2ZXX A; 
#chains in the Genus database with same CATH topology
 1FC2 C;  3RK3 C;  1RF0 C;  1SP4 A;  3SWF A;  1SQV E;  2PRR A;  2WSE H;  5APW A;  2E5T A;  3AEA C;  4H13 D;  3AE1 C;  2JWA A;  1SLQ A;  2KXP B;  2O3J A;  4JPZ B;  2K1A A;  1KV4 A;  4Z1M H;  4ZMD A;  2Z5I A;  3V6I A;  1N7S A;  1TU3 F;  3VMY A;  2E42 A;  4NPE A;  2WSE J;  1VQK P;  2ZYA A;  3FX0 A;  1PP9 D;  4PV1 D;  2QM8 A;  2KNC A;  3AE5 C;  3V4W A;  4RJT A;  1YYC A;  1SQV K;  1SS1 A;  4WY4 D;  3CX5 I;  1VF5 D;  5M1B A;  2M3E A;  3PLN A;  3S9O A;  3WU2 E;  2E74 C;  1L0N D;  1N86 A;  3CC2 P;  3H1H G;  3V2R A;  1BCC D;  5TIS H;  3TK1 A;  1P84 D;  4WVZ A;  1BDC A;  1PFI A;  4YXW H;  3V5B A;  1NO4 A;  1KIL C;  4U3F D;  1PGQ A;  2E76 C;  4IFF A;  1KYO I;  2WMM A;  3ZDM A;  4C7N A;  2FFD B;  1VQ6 P;  4TT3 H;  3RK2 C;  5AVW B;  2OTK E;  3GF7 A;  4C46 A;  1JMB A;  2N1T A;  1EDI A;  5AVQ B;  1RF0 A;  1GDT A;  1IFN A;  2QA4 P;  2B9B A;  1H8A A;  2YO3 A;  3L74 G;  4EOT A;  4B86 A;  3H1H E;  2ZFC A;  1J1D B;  2HPC B;  2IYO A;  3TYY A;  1S4X A;  5KLI C;  3CMA P;  2O01 H;  2YNY A;  2L5G B;  1JY3 O;  3Q5P A;  1FZF A;  1G1I A;  4IOI H;  2WPS A;  4MN4 C;  1ZLL A;  1URQ D;  1CW5 A;  3TGU D;  1NTM D;  4H0L C;  3P8C D;  2E43 A;  3HE4 A;  2GM4 A;  3F89 A;  2I1K A;  4HH2 A;  2O01 J;  1RY3 A;  2YKP A;  4I7Z C;  1Q7Y Q;  2M0B A;  5AW8 B;  3L74 E;  2N9B A;  1Y8A A;  3VMZ A;  3P8M C;  1T3U A;  1H89 A;  3C8V A;  4AUW A;  1AVY A;  1SQB J;  3IFM A;  5TJH A;  3CWB G;  1CI6 A;  3CCR P;  3B5N D;  1KIL A;  3CC4 P;  2FYN B;  3CI9 A;  2FBW C;  2IFN A;  3JCU E;  1AQ5 A;  4D6T J;  1AVO A;  1DD3 A;  5AW2 B;  3LIE A;  3KYQ A;  1SFC D;  5AVY B;  2Y0E A;  5BU5 A;  3Q1M A;  3H1L G;  2CPB A;  2FYU D;  2OTJ P;  3RBX A;  2G3A A;  3HTK B;  3AE2 C;  3L4F A;  1FZB A;  1SQQ K;  2KI7 B;  2WT7 A;  5GTH E;  2KZI A;  3H1J D;  1NTZ G;  3A0B H;  3CWB E;  1FS0 E;  3H1K J;  3B71 A;  1NU1 D;  3HE5 A;  5CCH C;  2AEJ A;  2Y0C A;  2CPS A;  2D2C B;  3SSU A;  1WRG A;  1P84 I;  1BE3 D;  3B8E B;  4HJG H;  3T97 A;  1SQX D;  3WUV A;  1YI2 P;  3H1L E;  1OIP A;  4WY4 B;  3NMD A;  1SQQ J;  3A2A A;  4YTP C;  4IL6 X;  1L0N J;  2HOD A;  1U7M A;  1VQ8 P;  1BCC J;  3OJA B;  3H1I J;  3CCQ P;  3KDP B;  3PP5 A;  2FFD C;  1NTZ E;  3L71 G;  3RK3 E;  4U3F J;  1KQG B;  1VQ9 P;  5CBO A;  2WSF H;  3U1A A;  3AEF C;  2G8Y A;  2WPV B;  3L75 D;  1FDM A;  5APU A;  4XA4 A;  3OA7 A;  1J1D C;  1D7M A;  4LLH A;  1EZV G;  1SQP D;  1GL2 A;  1NWQ A;  4IL6 H;  2NPS B;  2WSF J;  3AED C;  3BRV B;  3M0D A;  3AEE C;  1A02 J;  3MD0 A;  1NTZ K;  1G2C B;  3M06 A;  4GOE A;  5E79 H;  2XNX A;  5KTB A;  3L71 E;  2JJL A;  4H44 D;  5AVZ B;  3HUS A;  1LGH B;  1MFT A;  1BSH A;  1RF1 B;  4OH8 B;  3TGU J;  1NAY A;  3KZI H;  2HLO A;  1NTM J;  5KAF E;  1MKM A;  5APY A;  2H43 A;  4JF7 A;  2WSS H;  1EZV E;  3EQ2 A;  1OFC X;  1ZR4 A;  1KIL E;  5GTI E;  3JSV C;  3MUD A;  2W8Z A;  1USD A;  2H8P D;  3O6Q A;  2W6A A;  2FYN C;  3Q5R A;  1ZN5 A;  1BGY D;  2P10 A;  2R3S A;  2FFD A;  2ZYD A;  3P32 A;  5APT A;  3HD7 B;  1YBK A;  1S9K D;  3B5N B;  1HVV A;  1IZN B;  3L70 G;  2DW3 A;  3EFG A;  2HYN A;  5KLV G;  1ZV8 A;  2WSC H;  1SFC B;  2HR3 A;  1PGP A;  2Q1K A;  2J5U A;  1J1E B;  5B5E H;  2FYU J;  1KB9 E;  1AQT A;  1U7J A;  3A0H E;  2XV5 A;  1SQV D;  3MP7 B;  2D2C C;  1N73 B;  2LKM A;  3I5C A;  2WSC J;  1BDD A;  4HKZ H;  2IYP A;  1W5C E;  2AXT H;  2C9N Y;  2K3R A;  1U57 A;  2KUB A;  3RBZ A;  1QX8 A;  3L70 E;  4WY4 C;  1L0L G;  1JTH A;  4L76 A;  4PD4 E;  4DT0 A;  5AW9 B;  1RE4 A;  1BE3 J;  5KLV E;  1YTZ I;  4OGQ D;  1SQX J;  2P58 A;  2L91 A;  3GMA A;  2YXQ B;  2OYI A;  1PGJ A;  2R44 A;  1LP1 B;  1EDL A;  1S5L E;  1AJY A;  1KFM A;  1SQP K;  3SWY A;  1OVU A;  3CXH I;  3M9Q A;  1JY2 O;  1GD2 E;  5KJ7 C;  2MKV A;  1YIT P;  3BCC J;  2WPQ A;  4KHX A;  1L0L E;  1MV8 A;  5KLV K;  3TSI A;  2JKV A;  1OVV A;  2NPS C;  2JEE A;  1JY2 N;  3HTK A;  2V7Q H;  4QMA A;  2H7H A;  2BEQ D;  1SQP J;  2W83 C;  4L75 A;  3GHG B;  4I1L A;  1J2J B;  4CPG A;  2HFE D;  3I56 P;  4W7Y A;  2Y9Z A;  2K9J B;  2B87 A;  2R32 A;  1RF1 C;  4D6T D;  3L35 A;  1DH3 A;  1ZME C;  2XDJ A;  3H1H D;  2YMK A;  2V7Q J;  3A5T A;  3AE9 C;  1L0L K;  3AEC C;  1PIX A;  1HH0 A;  1M56 D;  2ITA A;  3CX5 E;  1GW4 A;  5DJU B;  1PL5 A;  3RGU A;  3H1K D;  4NPD A;  3ITK A;  2QE7 H;  1LT9 C;  3NFQ A;  1KN7 A;  3HD7 C;  1KQF B;  3G3Z A;  1IFP A;  1NKN A;  1IFD A;  3PHL A;  1BGY J;  2QSI A;  2J59 M;  3CCL P;  3L73 G;  1SFC C;  1KYO E;  1SQQ D;  5KJ7 A;  3R2P A;  4GOF A;  1L4A A;  1SQB G;  4ASV A;  3WMM 0;  1J1E C;  1LTJ A;  1K73 Q;  1Y9B A;  1QL1 A;  3V2N A;  3H1I D;  2NPS A;  2QRX A;  1N73 C;  1XTG B;  1QEX A;  3CD6 P;  2FXO A;  3D6Y A;  2KB7 P;  4A7P A;  1N7S D;  2KS1 A;  3VMX A;  1LTB C;  1SQV J;  2Q7C A;  5AVR B;  1YQ4 C;  3D71 A;  5APV A;  3CCV P;  1IC2 A;  1X8Y A;  1NTK G;  4UB6 E;  3QH9 A;  2C9L Y;  3L73 E;  5CCG C;  1ZRT E;  2MJZ A;  3WUT A;  1SQB E;  2ZJS E;  2A06 G;  1YHQ P;  3H32 A;  3SFE C;  2E75 D;  1PP9 G;  1YTZ T;  3WU2 H;  4K35 A;  4GDO A;  1HGV A;  5AW5 B;  5KAI E;  4K3A A;  1K05 A;  4BXL A;  3H1L D;  2WVR A;  2QG4 A;  3FXE A;  5CBN A;  1LT9 A;  2PGD A;  3MHV A;  1NTK E;  1T8Z A;  1K9M Q;  1JY3 N;  1LTT C;  1IFJ A;  1BCC G;  2CK3 H;  4BRY A;  1FZG A;  3MTU E;  1NTZ D;  2N1T D;  2A06 E;  1CSB A;  1VQN P;  3RK3 D;  1JO5 A;  2HG5 D;  3GHG C;  1PP9 E;  1FJK A;  4GT1 A;  4LC1 A;  3KQG A;  1R5S A;  2IDB A;  1ZP0 C;  4ZKP A;  1JNM A;  1LJ2 A;  1M90 Q;  1FE6 A;  4IFM A;  1NTK K;  4XE5 B;  4AYC A;  3H1H J;  1HTL C;  2GUS A;  3S1K A;  1BCC E;  2Z5H A;  3M9B A;  5CCG A;  3EWK A;  1P84 E;  4H13 B;  2BCC D;  1VQ4 P;  1NJI Q;  3G6E P;  4TLF A;  5AVT B;  1LP1 A;  3N4X A;  1NYH A;  5B66 E;  3TGU G;  2E74 D;  3FWN A;  3H25 A;  1N2D C;  5AW4 B;  1LWU B;  3VOP A;  3MZW B;  2K37 A;  4PV1 B;  2NZ2 A;  1HBW A;  1KIL D;  1KZU B;  3V4Q A;  2E76 D;  3B4S A;  5AW7 B;  3TNU B;  1VQ5 P;  3L74 J;  1H0T B;  2QJY B;  5H2F E;  1KOR A;  2Q3E A;  1HF9 A;  3JCU H;  1HJ0 A;  1VF5 B;  1KMI Z;  3CCE P;  1RH5 B;  2OGU A;  1E5W A;  3RK2 D;  1X0T A;  3AE4 C;  1MUU A;  2KP8 A;  1GU5 A;  3AE8 C;  1JOC A;  5AVU B;  4PJ0 E;  1BSN A;  4GKG A;  3TGU E;  2M5A B;  2RKL A;  2ZVN B;  5K5G B;  3P8C E;  2QM7 A;  1VQL P;  3BCC D;  5GTH H;  3GW6 A;  4YPC A;  1NKZ B;  1N7S B;  2SPZ A;  4M3L A;  1KB9 D;  2GA1 A;  5AW3 B;  3L72 G;  2KNC B;  2Q5U A;  2M3B A;  1QVG O;  4H0L D;  3QWO C;  1JEK A;  1OW7 A;  3H1J G;  3IAO A;  2PAJ A;  5CJ0 A;  1NU1 G;  1UIX A;  2E75 B;  3M91 A;  1OZH A;  5KLV D;  1BE3 G;  3BVH A;  3S4R A;  4WBA A;  2YO2 A;  2JDI H;  1FOS E;  1SQX G;  1URQ B;  4UB8 E;  3GF3 A;  5CCH A;  3H1L J;  4ZKU A;  2LR2 A;  3HRN A;  3NXS A;  1QVF O;  3A3Y B;  4C7N B;  3L72 E;  3PJS K;  4W7Z A;  1DEE G;  4DCK A;  1GU4 A;  2OTL P;  1PZQ A;  2QJP B;  3RL0 D;  1M1J B;  1NTZ J;  3H1J E;  2N1T B;  2OQQ A;  2JWD A;  4L74 A;  4EYY Q;  1T3J A;  3KXD A;  1NU1 E;  2W6B A;  1GL2 D;  4DOJ A;  5APQ A;  1AV1 A;  1L0L D;  1VPC A;  1KQS O;  1OVR A;  2ZXX A;  1YIJ P;  3AE7 C;  1FDO A;  1BE3 E;  3L75 G;  3MGN A;  2OYO A;  3W68 A;  1SQX E;  2IBZ D;  3R4Y A;  1HWT C;  1Z56 A;  2JP3 A;  4H13 C;  1IK9 A;  3TF5 A;  1FBM A;  4WWI A;  1Q90 D;  2ZVO B;  1SVF A;  5KAF H;  1ZR2 A;  3G71 P;  5AVV B;  3D6Z A;  2RH0 A;  3HE4 B;  2HPC A;  1EXJ A;  1N8R Q;  2B89 A;  3L71 J;  2FYZ A;  1MFZ A;  1LWU C;  5AW6 B;  2BCC J;  3M0A A;  3CC7 P;  1JY2 P;  4PV1 C;  1KC8 Q;  4EI2 A;  5GTI H;  1NAF A;  4N3Y B;  2BAS A;  2I8D A;  3L75 E;  1X22 A;  2XND H;  2QJY C;  2YKQ A;  1R5L A;  3W67 A;  2P7J A;  1VF5 C;  1Q86 Q;  1CI6 B;  4AQR D;  3CXH E;  4IFD K;  2ZXE B;  1PPJ G;  2H88 C;  2QVA A;  1VQM P;  4N78 E;  3V2P A;  3E1R A;  2Y0D A;  1M57 D;  1QLE D;  1BGY G;  1UII A;  1FZA A;  1KYO D;  1N7S C;  2JO1 A;  2IZ0 A;  2WZ7 A;  1KB9 H;  3CLQ A;  1X9V A;  1LTG C;  3PRJ A;  5KKZ B;  2WT7 B;  1S5L X;  1DIP A;  1YJN P;  1XTC C;  2YKO A;  4KJM A;  1NH4 A;  2FY8 A;  1VQ7 P;  4R4L A;  3HE5 B;  1RQV A;  1PPJ E;  5APS A;  2P67 A;  2ZAE B;  1GMJ A;  3KHU A;  2AEF A;  4PD4 H;  3A7O A;  5AW1 B;  4RO0 A;  2E75 C;  3SFD C;  2FXP A;  3T97 B;  3FGA D;  3G9R A;  1VL2 A;  1S72 P;  3L73 D;  1ZRT D;  4XFJ A;  1LWU A;  1URQ C;  2WTY A;  3L70 J;  3EFF K;  1S5L H;  1GK4 A;  1EC5 A;  2HOD B;  1Q2N A;  3FXD A;  4I2L C;  4H44 B;  2A45 I;  1IJD B;  5KLV J;  1GW3 A;  1DEB A;  1AA0 A;  5AVS B;  2PP6 A;  2A45 H;  2QJP C;  4WY4 A;  1M1J C;  2N1T C;  2O1J A;  1JCC A;  3CCS P;  3U1C A;  2P1J A;  2IBZ I;  1T2K D;  1IFM A;  5TIS E;  2KSJ A;  4GOD A;  4N6J A;  3RL0 B;  1NTK D;  2XKM A;  2M5A A;  1ZOY C;  3B5N C;  3N7N A;  1GL2 B;  1DX7 A;  1L0L J;  2A06 D;  5L8R J;  3L74 D;  1LT1 A;  1JCD A;  3SWK A;  2D2C D;  2P2U A;  3VMA A;  2KLU A;  1WMK A;  2FXM A;  1YJ9 P;  1PV3 A;  3HUS B;  2YIU B;  2C0W A;  4W80 A;  1JY3 P;  2N9Y B;  1JM0 A;  4L73 A;  4D6T G;  1G2C A;  1RQU A;  3CX5 H;  2FKW B;  3E7K A;  1RF1 A;  1URQ A;  5CJ4 A;  4HYT B;  3O6Q B;  1M7L A;  2VRS A;  2V4H A;  1FZC B;  3FWL A;  4OWF A;  3CWB D;  1NOH A;  3H1K G;  1Y47 A;  2H89 C;  5KJ7 D;  1KYO H;  1L4A D;  3GLM A;  5BU8 B;  1M1J A;  4OGQ B;  1USE A;  2ZT9 D;  2KIK A;  4U7J A;  1FDI A;  3U59 A;  3UIA A;  3GG2 A;  2R3C A;  3D70 A;  4D6T E;  1GTW A;  4JQ0 D;  2NPS D;  5KKZ C;  4NPF X;  3V2Q A;  1DD4 A;  3WUU A;  1JUN A;  1SQQ G;  3HD7 A;  3B5N A;  1FZE A;  2RMZ A;  2XZR A;  1HUC A;  1K8A Q;  1L0N G;  4JBZ A;  1SQB K;  1NVO A;  3H1I G;  2AEM A;  2LXB A;  1SFC A;  4KT0 J;  3H1K E;  4UB6 H;  4U3F G;  1VDF A;  1JTH B;  1S1C X;  1Q82 Q;  4Y28 J;  4HB1 A;  1N73 A;  5C39 A;  3AEB C;  4RKU J;  5AVX B;  4H44 C;  2OYH B;  3A0B E;  1GK6 A;  3NTN A;  5KAI H;  2KLV A;  3L73 J;  1M1K Q;  1YJW P;  5CHX A;  2OYI B;  1SQQ E;  4ZNC A;  2YXR B;  2QJK B;  2Y9Y A;  3VP8 A;  1L0N E;  2IFM A;  1OXZ A;  3HD7 D;  1JMM A;  3BRT B;  1VQO P;  3H1I E;  2UWJ E;  3CCU P;  1H88 A;  3L71 D;  3PTZ A;  1E79 H;  2NRG A;  3RL0 C;  3MIW A;  4U3F E;  2K9Y A;  2KSE A;  1L2P A;  1EQ7 A;  2XU6 A;  2QIW A;  2B88 A;  1M8O B;  1GL2 C;  1NGM B;  1NTM G;  1MZ9 A;  1YQ3 C;  3KPE A;  3RL0 g;  1HJB A;  3M0D C;  1NTK J;  3L72 D;  4YXD C;  2ZYG A;  3VYI A;  1EZV D;  4Y99 B;  1L0N K;  2OAR A;  3HUS C;  2B87 B;  1FU1 A;  2YIU C;  3II6 A;  4BWN A;  3CCM P;  1PP9 J;  1EXI A;  1R8E A;  1EDK A;  5DJT B;  5CCG D;  2R5B A;  4IL6 E;  1P84 H;  4LGD E;  3GHG A;  1CZQ A;  3Q3D A;  3IR9 A;  2RN0 A;  1NTM E;  2K9J A;  3MUD C;  5E79 E;  3K5B A;  1K04 A;  2AXC A;  2BEZ F;  5B66 H;  4DZO A;  4C7R A;  3C1L A;  1FZC C;  1KD1 Q;  1W2E A;  2FYU G;  1OW6 A;  3KZI E;  3IF4 A;  1FAV A;  4GIF A;  1N7L A;  2O1K A;  2BCC G;  4OGQ C;  1NHL A;  5H2F H;  2JR8 A;  3CWB J;  2GUV A;  3VP9 A;  3CCJ P;  4DJG A;  3Q5S A;  1IO4 A;  1L4A B;  3L70 D;  1A02 F;  1NTM K;  4PD4 D;  2ZT9 B;  1ZXG A;  4EIJ A;  1LTJ B;  3O8Z A;  3CXH D;  2IX7 C;  2KOG A;  1OX3 A;  4PJ0 H;  1AFO A;  4N78 D;  3AE3 C;  1QL2 A;  1GZL A;  2POH A;  3IN6 A;  1FJP A;  2I1J A;  3M9H A;  2KZJ A;  2FYU E;  2W6J H;  2KS1 B;  2KYV A;  3CL3 D;  2J58 A;  3VTP C;  3LW5 H;  2BCC E;  3LID A;  1RE4 C;  1Q81 Q;  2K88 A;  3JC2 2;  4WB4 A;  3RK3 B;  2OYH C;  5B5E E;  1LTI C;  3BCC G;  2Q3I A;  2OYI C;  3H32 B;  2KK7 A;  3LW5 J;  1PPJ D;  1G1J A;  2QJK C;  1LNQ A;  3BAS A;  3USS A;  1KFN A;  2FYU K;  2AXT E;  3AEG C;  2LXC B;  1WT6 A;  1SQP G;  5CCH D;  1FZC A;  1IK7 A;  4UB8 H;  1RHZ B;  1S2E A;  3PH0 A;  1LT9 B;  2WQY C;  1FOS F;  1VQP P;  1EZV I;  2WPR A;  1ZW0 A;  1T2K C;  1NU1 K;  1LTS C;  1HGZ A;  2IZ1 A;  3C9I A;  1RE3 C;  4BRY B;  1X79 B;  3H6P A;  3BCC E;  3BAT A;  5EFW B;  1S3J A;  4Y99 C;  4R4M A;  2E74 B;  1JB0 J;  1SQX K;  3L36 A;  3CX5 D;  1W2B O;  3L72 J;  1LTA C;  3OAK A;  2W27 A;  4EDF A;  2M8R A;  1SQP E;  1KIL B;  5CMZ A;  3H1J J;  2E76 B;  3VN0 A;  3P7K A;  3ABV C;  2A45 G;  1NU1 J;  3CME P;  3AE6 C;  3RK2 B;  1KB9 I;  3F5H A;  3I55 P;  1OWA A;  4OVN F;  2OYH A;  3A0H H;  1OMI A;  1OW8 A;  2IBZ G;  1IFI A;  1T6A A;  1EDJ A;  3TDK A;  2WWW A;  3E1I A;  2C0X A;  5BVZ A;  2R5D A;  2Q6Q A;  4ASW A;  5KLI B;  4PD4 I;  3Q2Y A;  4I6M C;  2QEX P;  2Z4E A;  2Q9I A;  5AW0 B;  1SQV G;  3CXH H;  2E5Y A;  1L4A C;  2YMY A;  2ZT9 C;  3L37 A;  1LTJ C;  4H0L B;  1BGY E;  1KQL A;  4JYC A;  5APX A;  2WIT A;  3G4S P;  3OW2 O;  3L75 J;  1PGO A;  3CPW O;  1S9K E;  4O9B A;  1SQB D;  2PFX A;  1RE3 A;  4I7Z B;  2IBZ E;  1QGK B;  2O01 N;  4JYB A;  2IPP A;  1KTM A;  3TNU A;  1H0T A;  2W90 A;  4RES B; 
#chains in the Genus database with same CATH homology
 1UII A;  3WUV A;  3E1R A;  2WVR A;  2Q6Q A;  3F5H A;  4BRY B;  3WUU A;  4BRY A;  3WUT A;  2ZXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...