2Q6QA

Crystal structure of spc42p, a critical component of spindle pole body in budding yeast
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
62
structure length
62
Chain Sequence
QQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKLEDQNLNLQIKISDLEKKLSDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spindle pole body component SPC42
publication title Analysis of coiled-coil interactions between core proteins of the spindle pole body.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 27
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 2q6qA00
3WUUA 2ZXXA 3E1RA 3F5HA 3WUVA 4BRYB 3WUTA 4BRYA 2Q6QA 1UIIA 2WVRA
chains in the Genus database with same CATH superfamily
2O01J 2Q9IA 3RK3B 4KJMA 2KS1B 3B8EB 4OH8B 3H1IJ 3CCEP 5KKZC 1SQQD 4CPGA 4XE5B 4U7JA 5AW5B 1VQ6P 1GD2E 2AXTE 4PD4I 5APQA 2O1KA 1NTZK 1SFCA 1OZHA 5CJ0A 5KAFH 3GHGB 1NAYA 4N78D 2VRSA 1M1KQ 1KQLA 2W6JH 1H88A 2KNCB 1AVOA 4JF7A 1CZQA 4W80A 5M1BA 1NHLA 3B5NB 4HYTB 4HB1A 4JYCA 1DEBA 4ZMDA 2B87A 2FYNB 3H1KD 2WTYA 2E76B 3PJSK 1HGVA 2H8PD 1VQMP 3BATA 1FZGA 1URQD 1Y8AA 1H0TB 2A06D 1PP9J 3MUDA 3WUVA 3D70A 2QM7A 3C1LA 1LT9C 3W67A 3S1KA 3U59A 1BSNA 3AE8C 2R3SA 3P8CE 4JPZB 5CCGC 1G2CB 4BWNA 2FYUK 2HLOA 1JB0J 2Q3EA 2KSEA 2FFDB 3HTKB 5APTA 1RQVA 3GW6A 1QGKB 2JEEA 1TU3F 1NTMG 1SQPG 1GDTA 3VN0A 3GLMA 1KYOD 1MV8A 1M1JC 1LTSC 1J1EC 1EDIA 3CPWO 3RK2B 2OYHB 3L75D 1NTZE 3KYQA 2Q7CA 3Q1MA 2M8RA 1BDCA 5KLIB 1JMBA 1T2KC 1BE3D 1PPJD 1L4AD 2K1AA 3L74G 1T8ZA 1CI6B 1KQFB 5KAIH 4GOFA 1LTGC 1X8YA 4PD4D 1S1CX 3HD7A 1M7LA 3V5BA 1OIPA 1LTJB 1RHZB 3RK3D 1SQQG 4IFFA 1OWAA 4IL6X 4I1LA 1SQBD 2M5AB 1M56D 1KILA 5APYA 1ZRTD 1JM0A 3SWKA 2Q6QA 3B4SA 2GA1A 3L35A 1Y47A 2XV5A 3CX5I 4GKGA 2K37A 2FYZA 4AQRD 2IFNA 1VF5B 1NTMJ 2FYUE 3IAOA 1SQPJ 2LXBA 3KZIH 1G1IA 3OJAB 1M57D 1SQXD 1JY3N 3H1IE 3B5ND 1A02J 3H1KG 2YKQA 5AW4B 4H13B 4DZOA 1YITP 4XFJA 1FAVA 2A06G 3VMYA 2L91A 2E76D 2Z5IA 3MUDC 3ITKA 5AVQB 1ZMEC 2B87B 3GF3A 1E79H 3L74J 5AW8B 1VQ8P 3BVHA 1GMJA 1KYOH 3N7NA 1DD4A 1FJKA 3AE3C 2IZ1A 5AVWB 1FC2C 4DOJA 3BRTB 2AXCA 5CJ4A 1S3JA 3AE6C 1SQQJ 1DH3A 2ZYAA 3I55P 2YKPA 1YJNP 3TK1A 3ZDMA 3H25A 1WMKA 3MIWA 1BSHA 1PP9E 1URQA 2QRXA 3L75G 1NO4A 4UB8H 5TISH 1OFCX 3RK2D 1NTMK 2KSJA 1BE3G 1PPJG 2KI7B 5B5EE 2IDBA 2QJYB 1QL2A 1HGZA 3H1KJ 1QL1A 3RL0g 1N7LA 1N8RQ 2YMKA 2XNXA 3A2AA 3CX5D 3E7KA 2P2UA 1SQBG 1WT6A 1JMMA 3H1LD 1WRGA 3TYYA 3AE5C 2R5BA 3PH0A 2WSCJ 3QWOC 2G8YA 3A0BE 4OGQC 2RH0A 2ZYGA 1JY2O 1KILB 2YXQB 1VF5D 1X9VA 5AVUB 1L4AA 1SQXG 1OVRA 3CI9A 4M3LA 3OA7A 4PJ0H 4NPDA 1UIXA 1L0NG 3T97A 2B88A 1MUUA 1S4XA 1AV1A 3L75J 3N4XA 1NJIQ 2KS1A 4IL6E 5KJ7D 1VQLP 4H13D 2R44A 2GM4A 4I6MC 2Q3IA 1FDOA 1K05A 1FOSF 1RE4A 2YMYA 1S5LX 1BE3J 2R5DA 2ZYDA 3WU2H 1S72P 4WY4D 3TDKA 3TF5A 1NTME 2KYVA 2IYOA 3GHGA 3H1JD 3KXDA 1EZVI 1SQPE 2WITA 1VQPP 4UB6E 1KILE 4W7ZA 1SQBJ 2QEXP 3B5NA 3BCCD 2P1JA 3E1RA 1H8AA 4A7PA 1QX8A 3AEFC 1URQC 2MKVA 1IFIA 4HKZH 3L74E 1VDFA 2ZT9B 2LR2A 3FWLA 1SQXJ 1LNQA 1RQUA 1HTLC 2DW3A 3CXHH 2JO1A 1VQNP 1XTCC 2LXCB 2JWDA 1SQQE 2OGUA 3HTKA 2Y0DA 3U1AA 4GODA 5KAIE 1JY3P 2C0WA 1FZEA 1PGJA 4N78E 4RKUJ 1N73A 3LIEA 2XZRA 3H6PA 3H1LG 3G9RA 3QH9A 3JSVC 2K88A 3S4RA 2QJKB 3CCUP 5TJHA 2P7JA 1W2EA 1KN7A 2O3JA 1JTHB 2I8DA 1N86A 1JO5A 3H1KE 1SQBK 1NKZB 2A06E 2OYIC 2HG5D 1YTZI 1PIXA 1CI6A 3AEBC 2KXPB 2D2CC 3AEAC 1LTJA 3VOPA 1ZP0C 1MFTA 1EZVD 4K35A 4HJGH 3Q5SA 3M91A 3V6IA 2FBWC 2J5UA 2M5AA 3L71D 3HE5B 1CW5A 1SQXK 3IN6A 5GTHH 2E74B 3H1JG 3CCQP 1IK7A 1L0NK 3GHGC 2N9YB 5CCHC 4TLFA 1KYOE 5APVA 3G71P 4O9BA 2JWAA 5C39A 1JCCA 1UIIA 3V2NA 1VL2A 1BCCD 1Y9BA 1KD1Q 3BCCG 4JQ0D 3H1LJ 1HJ0A 3L75E 1HJBA 1HH0A 2Y0CA 2K9YA 3IF4A 3B5NC 1HWTC 2KIKA 5KJ7A 2CPBA 2YO2A 3P32A 4L74A 2WPVB 1BE3E 1PPJE 1S5LE 4YXDC 1LWUA 2E76C 2M0BA 2BEQD 4PD4E 3FXDA 2WSFJ 4WY4A 5TISE 2ZT9D 2WPSA 3EFGA 3RK3E 2B9BA 2WMMA 5B66E 3HUSB 1YQ3C 3L70D 1K73Q 1IK9A 1SQBE 1KFNA 1OW6A 2ZXEB 3M9QA 1ZRTE 1FDMA 2FFDC 2SPZA 2JR8A 1KQGB 1KB9H 2P10A 1DD3A 5AVRB 2Y9ZA 1SLQA 1R8EA 3H1JJ 3VP9A 3UIAA 2WZ7A 1ZLLA 3RBZA 3D6YA 1KQSO 3JC22 1N73B 1IC2A 3M9BA 1YYCA 1Q2NA 1SQXE 4L75A 3PHLA 5K5GB 2WSEH 3RK2C 2OYHC 2J59M 1QEXA 2OARA 1L0NE 1PGPA 2PGDA 3BCCJ 4IFDK 3RL0B 5KLIC 1KMIZ 4H0LB 5E79H 1NH4A 1T6AA 1RF1A 4H44D 1KV4A 5KLVD 1KC8Q 1LTJC 4RESB 1GL2B 3BASA 4EI2A 5CHXA 3L71G 1VQ4P 1NGMB 1LGHB 1FJPA 2HFED 2E74D 3A0HH 1R5SA 2W90A 2A45H 1EQ7A 4AYCA 4Y99B 1N7SD 5CBNA 2W27A 1VF5C 2W8ZA 1BCCG 2FXMA 2KK7A 1YHQP 2YO3A 1NU1D 1SFCC 2QG4A 2R3CA 3CXHI 2YXRB 4PV1B 2PRRA 1S9KD 5KJ7C 4H13C 1JCDA 1IFNA 1U7MA 2KZIA 3NTNA 3AE1C 4B86A 2WVRA 2C9LY 3JCUH 5AVSB 3EFFK 2YIUB 3CX5E 1MFZA 3L70G 1L0LD 4L73A 1D7MA 1LJ2A 1LWUB 2WSEJ 5L8RJ 3CC4P 3SFEC 2H89C 4WY4B 1NAFA 3H1LE 3L37A 1W2BO 3MD0A 3L71J 3KPEA 1X79B 4LGDE 2QE7H 4YXWH 2KLUA 4BRYB 2KUBA 3II6A 1NTKD 2XNDH 4JYBA 2MJZA 2HODB 4ZNCA 4BXLA 1HF9A 4RO0A 1BCCJ 2AXTH 1G1JA 1ZR4A 2N1TB 1OXZA 3RL0D 5CCGD 2QJYC 1RF0A 4WVZA 1H89A 4H0LD 5KLVG 1SQVD 3H32B 3C9IA 1IFPA 1SVFA 3KDPB 1SQPK 2RMZA 3G6EP 2IFMA 2BEZF 3H1JE 3CCVP 1J1DB 2CPSA 1GL2D 1RF1B 4ZKUA 3L70J 3SSUA 4KT0J 3HD7C 1FZAA 2RN0A 2W83C 1EXJA 2Y9YA 3BCCE 1JTHA 1L2PA 3CXHD 1KILC 3CC7P 1NU1G 4D6TD 3L72D 3CD6P 4EYYQ 3H1HD 1JY3O 4OWFA 2JJLA 2IBZI 2HYNA 1KTMA 2WPQA 3A7OA 5KAFE 1T2KD 2KLVA 3AECC 1NOHA 1S2EA 2WT7A 1RE3A 1SQQK 4PV1D 3IFMA 3Q3DA 3OAKA 4RJTA 2UWJE 2WWWA 3FX0A 3HE5A 2AEJA 3PTZA 1KORA 1KB9I 1L0LG 2BCCD 2QJPB 1P84I 1GU5A 5KLVJ 1RY3A 3NXSA 1N7SA 2B89A 3A3YB 1XTGB 3CC2P 3L73D 3FGAD 2NPSA 1PV3A 1IFDA 5APSA 1OVVA 3V2QA 4WWIA 1AQ5A 1K8AQ 3MTUE 3Q5RA 2IZ0A 1NTKG 3GF7A 4EDFA 2POHA 2LKMA 5BVZA 2G3AA 1NU1J 3KQGA 5AW0B 3GG2A 2ZT9C 5AVYB 4QMAA 2E5TA 2JDIH 2OTLP 5AW6B 1EZVE 1EC5A 2N1TD 3PLNA 1X0TA 3HUSA 1SQVG 1IO4A 4GDOA 3L71E 2JKVA 3CWBD 5E79E 2O01N 2A45I 4OVNF 1LP1A 2O01H 2ZVNB 1FZCB 2E75B 1NWQA 1GK6A 4U3FD 3U1CA 1L0LJ 1FBMA 3AE9C 3O8ZA 2BASA 1ZV8A 1GW4A 1BCCE 3HE4A 4MN4C 2QJKC 3TGUD 2XU6A 1FE6A 2IBZD 1W5CE 5KLVK 1YJWP 3P8MC 4D6TG 3AEGC 3AE7C 3L72G 1BDDA 1Q90D 3H1HG 2E5YA 5CCGA 2OTJP 5H2FH 1FU1A 1NTKJ 3W68A 1YBKA 3EQ2A 4Z1MH 2KB7P 3I56P 1KB9D 1NKNA 3P7KA 1GW3A 1JOCA 1P84D 2PFXA 2KZJA 3L70E 1L4AC 3KZIE 1GL2A 5BU8B 4H44B 5APUA 5DJUB 1IZNB 1NU1K 2BCCG 2WT7B 3VMXA 1K9MQ 2QA4P 3GMAA 3RK3C 1SQVJ 3NMDA 2E74C 1KZUB 3L73G 4I7ZB 2J58A 4EIJA 1RE4C 3F5HA 4R4LA 1NVOA 3LW5H 4OGQD 3C8VA 1GTWA 2QM8A 5B5EH 2AEFA 1HUCA 1SP4A 1OW8A 3M0DA 1N7SB 3ABVC 4GOEA 3TSIA 3G3ZA 1FDIA 1L0LK 3V2PA 1USDA 2NPSB 2ZAEB 1M90Q 4NPEA 4XA4A 4D6TJ 3L72J 3M9HA 3H1HJ 4I2LC 1JEKA 5KLVE 2OQQA 3RBXA 4C7RA 3CCLP 2HR3A 2XDJA 4C7NB 2FYNC 5AW9B 2ZFCA 3A0BH 1NTKK 3VP8A 5KKZB 3HUSC 3CWBG 4WB4A 4UB8E 4ASVA 2R32A 3WMM0 2N9BA 3SFDC 5DJTB 4U3FG 2BCCJ 2Q5UA 1JNMA 2ZXXA 3L36A 3FXEA 1K04A 1AVYA 1LTAC 2E75D 1FOSE 3MP7B 2L5GB 4BRYA 4IL6H 3TGUG 5AW3B 1BGYD 1PGQA 2IBZG 1NU1E 3L73J 1GK4A 1LP1B 1SQVK 2C9NY 1N73C 2HODA 2AEMA 3VMAA 1P84H 2OTKE 5AW1B 1EXIA 2C0XA 1PL5A 1YI2P 2FKWB 1S9KE 2N1TA 3HE4B 2ZVOB 3RL0C 1AFOA 3HRNA 4H0LC 5AVVB 1QVGO 1OMIA 2P58A 1VPCA 3CLQA 4UB6H 3LW5J 1LT9B 3M06A 3H32A 2I1KA 2KOGA 1J2JB 4C46A 1L0LE 1GL2C 1GU4A 1HVVA 1PFIA 4PJ0E 3G4SP 1EZVG 2JP3A 3CWBJ 1DX7A 1Q82Q 4R4MA 4NPFX 3R4YA 4Y99C 1NTKE 1M1JB 1J1EB 4U3FJ 3WUUA 1FS0E 3WU2E 3B71A 3VMZA 3CL3D 3M0DC 3M0AA 3TGUJ 3AEEC 4PV1C 2I1JA 2Y0EA 2D2CD 2NPSD 4L76A 4GT1A 4DT0A 4GIFA 1SQVE 2WQYC 2A45G 3SWFA 2Z4EA 2FY8A 2HPCA 2PAJA 2YIUC 3P8CD 5APWA 1A02F 1LWUC 1SS1A 5CCHD 2P67A 4WY4C 2GUVA 1VQOP 1ZXGA 2WPRA 4N6JA 3K5BA 1SFCB 2K9JA 1RH5B 3V4QA 2GUSA 3CXHE 4TT3H 3AE2C 2QSIA 4AUWA 1BGYG 1VQ7P 4D6TE 1NYHA 3L72E 1L0ND 1JY2N 3H1HE 4YTPC 5GTIH 1Q86Q 3BRVB 4IOIH 1ZOYC 2WSCH 1NTZD 2H88C 1E5WA 1YTZT 1YQ4C 3OW2O 3SWYA 1IFMA 2N1TC 5CMZA 4DCKA 2H43A 3I5CA 1Q81Q 3WUTA 2IPPA 5H2FE 3AEDC 1U57A 3F89A 1GZLA 1PZQA 2BCCE 1MZ9A 3VYIA 3MGNA 4EOTA 1FZCA 2QVAA 3L73E 5EFWB 1J1DC 1RF1C 2NZ2A 1EDKA 1YIJP 2IYPA 3AE4C 5AW7B 1S5LH 2YKOA 1FZFA 2W6BA 4PD4H 1OVUA 1VQ5P 1M8OB 2M3EA 1HBWA 5AW2B 2FYUD 4YPCA 5B66H 3E1IA 5GTHE 1BGYJ 3TNUA 1AQTA 4K3AA 2Q1KA 1LT1A 1EDJA 3MHVA 3H1ID 1ZW0A 2FXPA 4KHXA 3CWBE 1USEA 2CK3H 3HD7B 4JBZA 3FWNA 2QJPC 3Q5PA 3USSA 3CCSP 5CBOA 4U3FE 1DIPA 2H7HA 5AVXB 3S9OA 4DJGA 2HPCB 2K3RA 3TGUE 3CCRP 2IBZE 2FXOA 1SFCD 2OYIA 2RKLA 4OGQB 3O6QA 3LIDA 2E42A 3VTPC 4N3YB 2QIWA 2K9JB 1PP9D 2Z5HA 1NTZG 1EDLA 4IFMA 1KB9E 3L4FA 1N2DC 1P84E 4ASWA 3Q2YA 1X22A 5BU5A 2YNYA 5AVZB 4C7NA 2OYOA 1U7JA 1ZR2A 5CCHA 3IR9A 4ZKPA 2V4HA 2KNCA 3RGUA 1CSBA 1OX3A 2O1JA 1AA0A 4HH2A 1YJ9P 1FZCC 1QVFO 2E75C 3V4WA 1RF0C 1Z56A 3A5TA 3NFQA 2V7QH 4Y28J 1OW7A 1H0TA 1KFMA 3D6ZA 2FYUG 3CX5H 3CMAP 2M3BA 1G2CA 1URQB 3KHUA 1L0NJ 3A0HE 3MZWB 3PP5A 3H1IG 3D71A 1LT9A 2FFDA 1NTZJ 4LLHA 1QLED 3CCMP 3TNUB 1LTIC 2E43A 2KP8A 4H44C 5APXA 1JY2P 1VQ9P 5KTBA 2XKMA 1MKMA 2IX7C 5AVTB 1Q7YQ 2WSFH 1RE3C 1AJYA 3HD7D 4W7YA 1IJDB 1LTBC 1T3JA 2W6AA 1NTMD 4I7ZC 2OYHA 1PGOA 1SQPD 1R5LA 1T3UA 2NRGA 2ITAA 1VQKP 1BGYE 3JCUE 3R2PA 1M1JA 2WSSH 1KILD 3CMEP 1N7SC 1FZBA 3EWKA 1IFJA 3CCJP 1KYOI 1PP9G 2NPSC 2ZJSE 3PRJA 1DEEG 1ZN5A 1L4AB 4LC1A 1LTTC 3V2RA 2OYIB 2FYUJ 3O6QB 2V7QJ 4WBAA 5GTIE 1JUNA 3T97B 3L74D 2PP6A 2D2CB
chains in the Genus database with same CATH topology
3WUUA 2ZXXA 3E1RA 3F5HA 3WUVA 4BRYB 3WUTA 4BRYA 2Q6QA 1UIIA 2WVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WUU A;  2ZXX A;  3E1R A;  3F5H A;  3WUV A;  4BRY B;  3WUT A;  4BRY A;  2Q6Q A;  1UII A;  2WVR A; 
#chains in the Genus database with same CATH topology
 2O01 J;  2Q9I A;  3RK3 B;  4KJM A;  2KS1 B;  3B8E B;  4OH8 B;  3H1I J;  3CCE P;  5KKZ C;  1SQQ D;  4CPG A;  4XE5 B;  4U7J A;  5AW5 B;  1VQ6 P;  1GD2 E;  2AXT E;  4PD4 I;  5APQ A;  2O1K A;  1NTZ K;  1SFC A;  1OZH A;  5CJ0 A;  5KAF H;  3GHG B;  1NAY A;  4N78 D;  2VRS A;  1M1K Q;  1KQL A;  2W6J H;  1H88 A;  2KNC B;  1AVO A;  4JF7 A;  1CZQ A;  4W80 A;  5M1B A;  1NHL A;  3B5N B;  4HYT B;  4HB1 A;  4JYC A;  1DEB A;  4ZMD A;  2B87 A;  2FYN B;  3H1K D;  2WTY A;  2E76 B;  3PJS K;  1HGV A;  2H8P D;  1VQM P;  3BAT A;  1FZG A;  1URQ D;  1Y8A A;  1H0T B;  2A06 D;  1PP9 J;  3MUD A;  3WUV A;  3D70 A;  2QM7 A;  3C1L A;  1LT9 C;  3W67 A;  3S1K A;  3U59 A;  1BSN A;  3AE8 C;  2R3S A;  3P8C E;  4JPZ B;  5CCG C;  1G2C B;  4BWN A;  2FYU K;  2HLO A;  1JB0 J;  2Q3E A;  2KSE A;  2FFD B;  3HTK B;  5APT A;  1RQV A;  3GW6 A;  1QGK B;  2JEE A;  1TU3 F;  1NTM G;  1SQP G;  1GDT A;  3VN0 A;  3GLM A;  1KYO D;  1MV8 A;  1M1J C;  1LTS C;  1J1E C;  1EDI A;  3CPW O;  3RK2 B;  2OYH B;  3L75 D;  1NTZ E;  3KYQ A;  2Q7C A;  3Q1M A;  2M8R A;  1BDC A;  5KLI B;  1JMB A;  1T2K C;  1BE3 D;  1PPJ D;  1L4A D;  2K1A A;  3L74 G;  1T8Z A;  1CI6 B;  1KQF B;  5KAI H;  4GOF A;  1LTG C;  1X8Y A;  4PD4 D;  1S1C X;  3HD7 A;  1M7L A;  3V5B A;  1OIP A;  1LTJ B;  1RHZ B;  3RK3 D;  1SQQ G;  4IFF A;  1OWA A;  4IL6 X;  4I1L A;  1SQB D;  2M5A B;  1M56 D;  1KIL A;  5APY A;  1ZRT D;  1JM0 A;  3SWK A;  2Q6Q A;  3B4S A;  2GA1 A;  3L35 A;  1Y47 A;  2XV5 A;  3CX5 I;  4GKG A;  2K37 A;  2FYZ A;  4AQR D;  2IFN A;  1VF5 B;  1NTM J;  2FYU E;  3IAO A;  1SQP J;  2LXB A;  3KZI H;  1G1I A;  3OJA B;  1M57 D;  1SQX D;  1JY3 N;  3H1I E;  3B5N D;  1A02 J;  3H1K G;  2YKQ A;  5AW4 B;  4H13 B;  4DZO A;  1YIT P;  4XFJ A;  1FAV A;  2A06 G;  3VMY A;  2L91 A;  2E76 D;  2Z5I A;  3MUD C;  3ITK A;  5AVQ B;  1ZME C;  2B87 B;  3GF3 A;  1E79 H;  3L74 J;  5AW8 B;  1VQ8 P;  3BVH A;  1GMJ A;  1KYO H;  3N7N A;  1DD4 A;  1FJK A;  3AE3 C;  2IZ1 A;  5AVW B;  1FC2 C;  4DOJ A;  3BRT B;  2AXC A;  5CJ4 A;  1S3J A;  3AE6 C;  1SQQ J;  1DH3 A;  2ZYA A;  3I55 P;  2YKP A;  1YJN P;  3TK1 A;  3ZDM A;  3H25 A;  1WMK A;  3MIW A;  1BSH A;  1PP9 E;  1URQ A;  2QRX A;  3L75 G;  1NO4 A;  4UB8 H;  5TIS H;  1OFC X;  3RK2 D;  1NTM K;  2KSJ A;  1BE3 G;  1PPJ G;  2KI7 B;  5B5E E;  2IDB A;  2QJY B;  1QL2 A;  1HGZ A;  3H1K J;  1QL1 A;  3RL0 g;  1N7L A;  1N8R Q;  2YMK A;  2XNX A;  3A2A A;  3CX5 D;  3E7K A;  2P2U A;  1SQB G;  1WT6 A;  1JMM A;  3H1L D;  1WRG A;  3TYY A;  3AE5 C;  2R5B A;  3PH0 A;  2WSC J;  3QWO C;  2G8Y A;  3A0B E;  4OGQ C;  2RH0 A;  2ZYG A;  1JY2 O;  1KIL B;  2YXQ B;  1VF5 D;  1X9V A;  5AVU B;  1L4A A;  1SQX G;  1OVR A;  3CI9 A;  4M3L A;  3OA7 A;  4PJ0 H;  4NPD A;  1UIX A;  1L0N G;  3T97 A;  2B88 A;  1MUU A;  1S4X A;  1AV1 A;  3L75 J;  3N4X A;  1NJI Q;  2KS1 A;  4IL6 E;  5KJ7 D;  1VQL P;  4H13 D;  2R44 A;  2GM4 A;  4I6M C;  2Q3I A;  1FDO A;  1K05 A;  1FOS F;  1RE4 A;  2YMY A;  1S5L X;  1BE3 J;  2R5D A;  2ZYD A;  3WU2 H;  1S72 P;  4WY4 D;  3TDK A;  3TF5 A;  1NTM E;  2KYV A;  2IYO A;  3GHG A;  3H1J D;  3KXD A;  1EZV I;  1SQP E;  2WIT A;  1VQP P;  4UB6 E;  1KIL E;  4W7Z A;  1SQB J;  2QEX P;  3B5N A;  3BCC D;  2P1J A;  3E1R A;  1H8A A;  4A7P A;  1QX8 A;  3AEF C;  1URQ C;  2MKV A;  1IFI A;  4HKZ H;  3L74 E;  1VDF A;  2ZT9 B;  2LR2 A;  3FWL A;  1SQX J;  1LNQ A;  1RQU A;  1HTL C;  2DW3 A;  3CXH H;  2JO1 A;  1VQN P;  1XTC C;  2LXC B;  2JWD A;  1SQQ E;  2OGU A;  3HTK A;  2Y0D A;  3U1A A;  4GOD A;  5KAI E;  1JY3 P;  2C0W A;  1FZE A;  1PGJ A;  4N78 E;  4RKU J;  1N73 A;  3LIE A;  2XZR A;  3H6P A;  3H1L G;  3G9R A;  3QH9 A;  3JSV C;  2K88 A;  3S4R A;  2QJK B;  3CCU P;  5TJH A;  2P7J A;  1W2E A;  1KN7 A;  2O3J A;  1JTH B;  2I8D A;  1N86 A;  1JO5 A;  3H1K E;  1SQB K;  1NKZ B;  2A06 E;  2OYI C;  2HG5 D;  1YTZ I;  1PIX A;  1CI6 A;  3AEB C;  2KXP B;  2D2C C;  3AEA C;  1LTJ A;  3VOP A;  1ZP0 C;  1MFT A;  1EZV D;  4K35 A;  4HJG H;  3Q5S A;  3M91 A;  3V6I A;  2FBW C;  2J5U A;  2M5A A;  3L71 D;  3HE5 B;  1CW5 A;  1SQX K;  3IN6 A;  5GTH H;  2E74 B;  3H1J G;  3CCQ P;  1IK7 A;  1L0N K;  3GHG C;  2N9Y B;  5CCH C;  4TLF A;  1KYO E;  5APV A;  3G71 P;  4O9B A;  2JWA A;  5C39 A;  1JCC A;  1UII A;  3V2N A;  1VL2 A;  1BCC D;  1Y9B A;  1KD1 Q;  3BCC G;  4JQ0 D;  3H1L J;  1HJ0 A;  3L75 E;  1HJB A;  1HH0 A;  2Y0C A;  2K9Y A;  3IF4 A;  3B5N C;  1HWT C;  2KIK A;  5KJ7 A;  2CPB A;  2YO2 A;  3P32 A;  4L74 A;  2WPV B;  1BE3 E;  1PPJ E;  1S5L E;  4YXD C;  1LWU A;  2E76 C;  2M0B A;  2BEQ D;  4PD4 E;  3FXD A;  2WSF J;  4WY4 A;  5TIS E;  2ZT9 D;  2WPS A;  3EFG A;  3RK3 E;  2B9B A;  2WMM A;  5B66 E;  3HUS B;  1YQ3 C;  3L70 D;  1K73 Q;  1IK9 A;  1SQB E;  1KFN A;  1OW6 A;  2ZXE B;  3M9Q A;  1ZRT E;  1FDM A;  2FFD C;  2SPZ A;  2JR8 A;  1KQG B;  1KB9 H;  2P10 A;  1DD3 A;  5AVR B;  2Y9Z A;  1SLQ A;  1R8E A;  3H1J J;  3VP9 A;  3UIA A;  2WZ7 A;  1ZLL A;  3RBZ A;  3D6Y A;  1KQS O;  3JC2 2;  1N73 B;  1IC2 A;  3M9B A;  1YYC A;  1Q2N A;  1SQX E;  4L75 A;  3PHL A;  5K5G B;  2WSE H;  3RK2 C;  2OYH C;  2J59 M;  1QEX A;  2OAR A;  1L0N E;  1PGP A;  2PGD A;  3BCC J;  4IFD K;  3RL0 B;  5KLI C;  1KMI Z;  4H0L B;  5E79 H;  1NH4 A;  1T6A A;  1RF1 A;  4H44 D;  1KV4 A;  5KLV D;  1KC8 Q;  1LTJ C;  4RES B;  1GL2 B;  3BAS A;  4EI2 A;  5CHX A;  3L71 G;  1VQ4 P;  1NGM B;  1LGH B;  1FJP A;  2HFE D;  2E74 D;  3A0H H;  1R5S A;  2W90 A;  2A45 H;  1EQ7 A;  4AYC A;  4Y99 B;  1N7S D;  5CBN A;  2W27 A;  1VF5 C;  2W8Z A;  1BCC G;  2FXM A;  2KK7 A;  1YHQ P;  2YO3 A;  1NU1 D;  1SFC C;  2QG4 A;  2R3C A;  3CXH I;  2YXR B;  4PV1 B;  2PRR A;  1S9K D;  5KJ7 C;  4H13 C;  1JCD A;  1IFN A;  1U7M A;  2KZI A;  3NTN A;  3AE1 C;  4B86 A;  2WVR A;  2C9L Y;  3JCU H;  5AVS B;  3EFF K;  2YIU B;  3CX5 E;  1MFZ A;  3L70 G;  1L0L D;  4L73 A;  1D7M A;  1LJ2 A;  1LWU B;  2WSE J;  5L8R J;  3CC4 P;  3SFE C;  2H89 C;  4WY4 B;  1NAF A;  3H1L E;  3L37 A;  1W2B O;  3MD0 A;  3L71 J;  3KPE A;  1X79 B;  4LGD E;  2QE7 H;  4YXW H;  2KLU A;  4BRY B;  2KUB A;  3II6 A;  1NTK D;  2XND H;  4JYB A;  2MJZ A;  2HOD B;  4ZNC A;  4BXL A;  1HF9 A;  4RO0 A;  1BCC J;  2AXT H;  1G1J A;  1ZR4 A;  2N1T B;  1OXZ A;  3RL0 D;  5CCG D;  2QJY C;  1RF0 A;  4WVZ A;  1H89 A;  4H0L D;  5KLV G;  1SQV D;  3H32 B;  3C9I A;  1IFP A;  1SVF A;  3KDP B;  1SQP K;  2RMZ A;  3G6E P;  2IFM A;  2BEZ F;  3H1J E;  3CCV P;  1J1D B;  2CPS A;  1GL2 D;  1RF1 B;  4ZKU A;  3L70 J;  3SSU A;  4KT0 J;  3HD7 C;  1FZA A;  2RN0 A;  2W83 C;  1EXJ A;  2Y9Y A;  3BCC E;  1JTH A;  1L2P A;  3CXH D;  1KIL C;  3CC7 P;  1NU1 G;  4D6T D;  3L72 D;  3CD6 P;  4EYY Q;  3H1H D;  1JY3 O;  4OWF A;  2JJL A;  2IBZ I;  2HYN A;  1KTM A;  2WPQ A;  3A7O A;  5KAF E;  1T2K D;  2KLV A;  3AEC C;  1NOH A;  1S2E A;  2WT7 A;  1RE3 A;  1SQQ K;  4PV1 D;  3IFM A;  3Q3D A;  3OAK A;  4RJT A;  2UWJ E;  2WWW A;  3FX0 A;  3HE5 A;  2AEJ A;  3PTZ A;  1KOR A;  1KB9 I;  1L0L G;  2BCC D;  2QJP B;  1P84 I;  1GU5 A;  5KLV J;  1RY3 A;  3NXS A;  1N7S A;  2B89 A;  3A3Y B;  1XTG B;  3CC2 P;  3L73 D;  3FGA D;  2NPS A;  1PV3 A;  1IFD A;  5APS A;  1OVV A;  3V2Q A;  4WWI A;  1AQ5 A;  1K8A Q;  3MTU E;  3Q5R A;  2IZ0 A;  1NTK G;  3GF7 A;  4EDF A;  2POH A;  2LKM A;  5BVZ A;  2G3A A;  1NU1 J;  3KQG A;  5AW0 B;  3GG2 A;  2ZT9 C;  5AVY B;  4QMA A;  2E5T A;  2JDI H;  2OTL P;  5AW6 B;  1EZV E;  1EC5 A;  2N1T D;  3PLN A;  1X0T A;  3HUS A;  1SQV G;  1IO4 A;  4GDO A;  3L71 E;  2JKV A;  3CWB D;  5E79 E;  2O01 N;  2A45 I;  4OVN F;  1LP1 A;  2O01 H;  2ZVN B;  1FZC B;  2E75 B;  1NWQ A;  1GK6 A;  4U3F D;  3U1C A;  1L0L J;  1FBM A;  3AE9 C;  3O8Z A;  2BAS A;  1ZV8 A;  1GW4 A;  1BCC E;  3HE4 A;  4MN4 C;  2QJK C;  3TGU D;  2XU6 A;  1FE6 A;  2IBZ D;  1W5C E;  5KLV K;  1YJW P;  3P8M C;  4D6T G;  3AEG C;  3AE7 C;  3L72 G;  1BDD A;  1Q90 D;  3H1H G;  2E5Y A;  5CCG A;  2OTJ P;  5H2F H;  1FU1 A;  1NTK J;  3W68 A;  1YBK A;  3EQ2 A;  4Z1M H;  2KB7 P;  3I56 P;  1KB9 D;  1NKN A;  3P7K A;  1GW3 A;  1JOC A;  1P84 D;  2PFX A;  2KZJ A;  3L70 E;  1L4A C;  3KZI E;  1GL2 A;  5BU8 B;  4H44 B;  5APU A;  5DJU B;  1IZN B;  1NU1 K;  2BCC G;  2WT7 B;  3VMX A;  1K9M Q;  2QA4 P;  3GMA A;  3RK3 C;  1SQV J;  3NMD A;  2E74 C;  1KZU B;  3L73 G;  4I7Z B;  2J58 A;  4EIJ A;  1RE4 C;  3F5H A;  4R4L A;  1NVO A;  3LW5 H;  4OGQ D;  3C8V A;  1GTW A;  2QM8 A;  5B5E H;  2AEF A;  1HUC A;  1SP4 A;  1OW8 A;  3M0D A;  1N7S B;  3ABV C;  4GOE A;  3TSI A;  3G3Z A;  1FDI A;  1L0L K;  3V2P A;  1USD A;  2NPS B;  2ZAE B;  1M90 Q;  4NPE A;  4XA4 A;  4D6T J;  3L72 J;  3M9H A;  3H1H J;  4I2L C;  1JEK A;  5KLV E;  2OQQ A;  3RBX A;  4C7R A;  3CCL P;  2HR3 A;  2XDJ A;  4C7N B;  2FYN C;  5AW9 B;  2ZFC A;  3A0B H;  1NTK K;  3VP8 A;  5KKZ B;  3HUS C;  3CWB G;  4WB4 A;  4UB8 E;  4ASV A;  2R32 A;  3WMM 0;  2N9B A;  3SFD C;  5DJT B;  4U3F G;  2BCC J;  2Q5U A;  1JNM A;  2ZXX A;  3L36 A;  3FXE A;  1K04 A;  1AVY A;  1LTA C;  2E75 D;  1FOS E;  3MP7 B;  2L5G B;  4BRY A;  4IL6 H;  3TGU G;  5AW3 B;  1BGY D;  1PGQ A;  2IBZ G;  1NU1 E;  3L73 J;  1GK4 A;  1LP1 B;  1SQV K;  2C9N Y;  1N73 C;  2HOD A;  2AEM A;  3VMA A;  1P84 H;  2OTK E;  5AW1 B;  1EXI A;  2C0X A;  1PL5 A;  1YI2 P;  2FKW B;  1S9K E;  2N1T A;  3HE4 B;  2ZVO B;  3RL0 C;  1AFO A;  3HRN A;  4H0L C;  5AVV B;  1QVG O;  1OMI A;  2P58 A;  1VPC A;  3CLQ A;  4UB6 H;  3LW5 J;  1LT9 B;  3M06 A;  3H32 A;  2I1K A;  2KOG A;  1J2J B;  4C46 A;  1L0L E;  1GL2 C;  1GU4 A;  1HVV A;  1PFI A;  4PJ0 E;  3G4S P;  1EZV G;  2JP3 A;  3CWB J;  1DX7 A;  1Q82 Q;  4R4M A;  4NPF X;  3R4Y A;  4Y99 C;  1NTK E;  1M1J B;  1J1E B;  4U3F J;  3WUU A;  1FS0 E;  3WU2 E;  3B71 A;  3VMZ A;  3CL3 D;  3M0D C;  3M0A A;  3TGU J;  3AEE C;  4PV1 C;  2I1J A;  2Y0E A;  2D2C D;  2NPS D;  4L76 A;  4GT1 A;  4DT0 A;  4GIF A;  1SQV E;  2WQY C;  2A45 G;  3SWF A;  2Z4E A;  2FY8 A;  2HPC A;  2PAJ A;  2YIU C;  3P8C D;  5APW A;  1A02 F;  1LWU C;  1SS1 A;  5CCH D;  2P67 A;  4WY4 C;  2GUV A;  1VQO P;  1ZXG A;  2WPR A;  4N6J A;  3K5B A;  1SFC B;  2K9J A;  1RH5 B;  3V4Q A;  2GUS A;  3CXH E;  4TT3 H;  3AE2 C;  2QSI A;  4AUW A;  1BGY G;  1VQ7 P;  4D6T E;  1NYH A;  3L72 E;  1L0N D;  1JY2 N;  3H1H E;  4YTP C;  5GTI H;  1Q86 Q;  3BRV B;  4IOI H;  1ZOY C;  2WSC H;  1NTZ D;  2H88 C;  1E5W A;  1YTZ T;  1YQ4 C;  3OW2 O;  3SWY A;  1IFM A;  2N1T C;  5CMZ A;  4DCK A;  2H43 A;  3I5C A;  1Q81 Q;  3WUT A;  2IPP A;  5H2F E;  3AED C;  1U57 A;  3F89 A;  1GZL A;  1PZQ A;  2BCC E;  1MZ9 A;  3VYI A;  3MGN A;  4EOT A;  1FZC A;  2QVA A;  3L73 E;  5EFW B;  1J1D C;  1RF1 C;  2NZ2 A;  1EDK A;  1YIJ P;  2IYP A;  3AE4 C;  5AW7 B;  1S5L H;  2YKO A;  1FZF A;  2W6B A;  4PD4 H;  1OVU A;  1VQ5 P;  1M8O B;  2M3E A;  1HBW A;  5AW2 B;  2FYU D;  4YPC A;  5B66 H;  3E1I A;  5GTH E;  1BGY J;  3TNU A;  1AQT A;  4K3A A;  2Q1K A;  1LT1 A;  1EDJ A;  3MHV A;  3H1I D;  1ZW0 A;  2FXP A;  4KHX A;  3CWB E;  1USE A;  2CK3 H;  3HD7 B;  4JBZ A;  3FWN A;  2QJP C;  3Q5P A;  3USS A;  3CCS P;  5CBO A;  4U3F E;  1DIP A;  2H7H A;  5AVX B;  3S9O A;  4DJG A;  2HPC B;  2K3R A;  3TGU E;  3CCR P;  2IBZ E;  2FXO A;  1SFC D;  2OYI A;  2RKL A;  4OGQ B;  3O6Q A;  3LID A;  2E42 A;  3VTP C;  4N3Y B;  2QIW A;  2K9J B;  1PP9 D;  2Z5H A;  1NTZ G;  1EDL A;  4IFM A;  1KB9 E;  3L4F A;  1N2D C;  1P84 E;  4ASW A;  3Q2Y A;  1X22 A;  5BU5 A;  2YNY A;  5AVZ B;  4C7N A;  2OYO A;  1U7J A;  1ZR2 A;  5CCH A;  3IR9 A;  4ZKP A;  2V4H A;  2KNC A;  3RGU A;  1CSB A;  1OX3 A;  2O1J A;  1AA0 A;  4HH2 A;  1YJ9 P;  1FZC C;  1QVF O;  2E75 C;  3V4W A;  1RF0 C;  1Z56 A;  3A5T A;  3NFQ A;  2V7Q H;  4Y28 J;  1OW7 A;  1H0T A;  1KFM A;  3D6Z A;  2FYU G;  3CX5 H;  3CMA P;  2M3B A;  1G2C A;  1URQ B;  3KHU A;  1L0N J;  3A0H E;  3MZW B;  3PP5 A;  3H1I G;  3D71 A;  1LT9 A;  2FFD A;  1NTZ J;  4LLH A;  1QLE D;  3CCM P;  3TNU B;  1LTI C;  2E43 A;  2KP8 A;  4H44 C;  5APX A;  1JY2 P;  1VQ9 P;  5KTB A;  2XKM A;  1MKM A;  2IX7 C;  5AVT B;  1Q7Y Q;  2WSF H;  1RE3 C;  1AJY A;  3HD7 D;  4W7Y A;  1IJD B;  1LTB C;  1T3J A;  2W6A A;  1NTM D;  4I7Z C;  2OYH A;  1PGO A;  1SQP D;  1R5L A;  1T3U A;  2NRG A;  2ITA A;  1VQK P;  1BGY E;  3JCU E;  3R2P A;  1M1J A;  2WSS H;  1KIL D;  3CME P;  1N7S C;  1FZB A;  3EWK A;  1IFJ A;  3CCJ P;  1KYO I;  1PP9 G;  2NPS C;  2ZJS E;  3PRJ A;  1DEE G;  1ZN5 A;  1L4A B;  4LC1 A;  1LTT C;  3V2R A;  2OYI B;  2FYU J;  3O6Q B;  2V7Q J;  4WBA A;  5GTI E;  1JUN A;  3T97 B;  3L74 D;  2PP6 A;  2D2C B; 
#chains in the Genus database with same CATH homology
 3WUU A;  2ZXX A;  3E1R A;  3F5H A;  3WUV A;  4BRY B;  3WUT A;  4BRY A;  2Q6Q A;  1UII A;  2WVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...